Harris, J R; Scheffler, D; Gebauer, W; Lehnert, R; Markl, J
2000-12-01
The multimeric/higher oligomeric states of the two isoforms of Haliotis tuberculata hemocyanin (HtH1 and HtH2) have been assessed by transmission electron microscopy (TEM) of negatively stained specimens, for comparison with previously published structural data from keyhole limpet hemocyanin (KLH1 and KLH2) [see Harris, J.R., Gebauer, W., Guderian, F.U., Markl, J., 1997a. Keyhole limpet hemocyanin (KLH), I: Reassociation from Immucothel followed by separation of KLH1 and KLH2. Micron, 28, 31-41; Harris, J.R., Gebauer, W., Söhngen, S.M., Nermut, M.V., Markl, J., 1997b. Keyhole limpet hemocyanin (KLH). II: Characteristic reassociation properties of purified KLH1 and KLH2. Micron, 28, 43-56; Harris, J.R., Gebauer, W., Adrian, M., Markl, J., 1998. Keyhole limpet hemocyanin (KLH): Slow in vitro reassociation of KLH1 and KLH2 from Immucothel. Micron, 29, 329-339]. In purified samples of both HtH isoforms, the hollow cylindrical ca 8MDa didecamer predominates together with a small number of decamers, but tri- and longer multidecamers are detectable only in the HtH2. The stability of the two HtH isoforms under varying ionic conditions have been monitored, thereby enabling conditions for the production of stable decamers to be established. The ability of these decamers to reform multimers in the presence of 10 and 100mM concentrations of calcium and magnesium ions in Tris-HCl buffer (pH 7.4), and also of individual HtH1 and HtH2 subunits (produced by pH 9.6 dissociation in glycine-NaOH buffer), to reassociate in the presence of calcium and magnesium ions, has been assessed. For the HtH1 decamers, the predominant multimeric product is the didecamer at 10 and 100mM calcium and magnesium concentrations, whereas for the HtH2 decamers, large numbers of multidecamers are produced, with the reaction proceeding more completely at the higher calcium and magnesium concentration. With the HtH1 subunit, reassociation in the presence of 10 and 100mM calcium and magnesium ions yielded
The Newsworthiness of International Terrorism.
Weimann, Gabriel; Brosius, Hans-Bernd
1991-01-01
Investigates the newsworthiness of international terrorism. Relates the concept of deviance as a predictor of newsworthiness to the specific attributes of terrorist events and their impact on media selection (coverage or no coverage) and prominence of coverage. (SR)
The newsworthiness of suicide.
Pirkis, Jane; Burgess, Philip; Blood, R Warwick; Francis, Catherine
2007-06-01
There is a paucity of studies examining which suicides are considered news-worthy. By combining data on media reports of individuals' suicides with routinely collected suicide data, it was found that 1% of Australian suicides were reported over a 1-year period. There was evidence of over-reporting of suicides by older people and females, and those involving dramatic methods. Reported suicides fell into three groups: suicides reported in a broader context; suicides by celebrities; and suicides involving unusual circumstances/methods. The data suggest a need for media professionals and suicide experts to work together to balance newsworthiness against the risk of copycat behavior.
Plano de marketing : empresa HTH
Carneiro, Marta Fernandes
2017-01-01
Este plano de marketing na empresa HTH, visa garantir a qualidade dos seus produtos; garantir a excelente relação com os seus clientes; lutar para conseguir ter uma boa oferta de preços, fator decisivo neste mercado; minimizar os tempos de entrega para se diferenciar da concorrência; e, melhorar a divulgação da empresa e dos seus produtos.
The clinical relevance and newsworthiness of NIHR HTA-funded research: a cohort study.
Wright, D; Young, A; Iserman, E; Maeso, R; Turner, S; Haynes, R B; Milne, R
2014-05-07
To assess the clinical relevance and newsworthiness of the UK National Institute for Health Research (NIHR) Health Technology Assessment (HTA) Programme funded reports. Retrospective cohort study. The cohort included 311 NIHR HTA Programme funded reports publishing in HTA in the period 1 January 2007-31 December 2012. The McMaster Online Rating of Evidence (MORE) system independently identified the clinical relevance and newsworthiness of NIHR HTA publications and non-NIHR HTA publications. The MORE system involves over 4000 physicians rating publications on a scale of relevance (the extent to which articles are relevant to practice) and a scale of newsworthiness (the extent to which articles contain news or something clinicians are unlikely to know). The proportion of reports published in HTA meeting MORE inclusion criteria and mean average relevance and newsworthiness ratings were calculated and compared with publications from the same studies publishing outside HTA and non-NIHR HTA funded publications. 286/311 (92.0%) of NIHR HTA reports were assessed by MORE, of which 192 (67.1%) passed MORE criteria. The average clinical relevance rating for NIHR HTA reports was 5.48, statistically higher than the 5.32 rating for non-NIHR HTA publications (mean difference=0.16, 95% CI 0.04 to 0.29, p=0.01). Average newsworthiness ratings were similar between NIHR HTA reports and non-NIHR HTA publications (4.75 and 4.70, respectively; mean difference=0.05, 95% CI -0.18 to 0.07, p=0.402). NIHR HTA-funded original research reports were statistically higher for newsworthiness than reviews (5.05 compared with 4.64) (mean difference=0.41, 95% CI 0.18 to 0.64, p=0.001). Funding research of clinical relevance is important in maximising the value of research investment. The NIHR HTA Programme is successful in funding projects that generate outputs of clinical relevance.
Respecting an Individual's Privacy Critical in Making Difficult Journalistic Judgments.
Adams, Julian
1984-01-01
Discusses the criteria of "newsworthy" regarding news reporting and the right to privacy. Examines the thin line between what is legal and what is ethical to print and some components of the law to consider when making such decisions. (HTH)
Crystal Structure of a Putative HTH-Type Transcriptional Regulator yxaF from Bacillus subtilis
International Nuclear Information System (INIS)
Seetharaman, J.; Kumaran, D.; Bonanno, J.; Burley, S.; Swaminathan, S.
2006-01-01
The New York Structural GenomiX Research Consortium (NYSGXRC) has selected the protein coded by yxaF gene from Bacillus subtilis as a target for structure determination. The yxaF protein has 191 residues with a molecular mass of 21 kDa and had no sequence homology to any structure in the Protein Data Bank (PDB) at the time of target selection. We aimed to elucidate the three-dimensional structure for the putative protein yxaF to better understand the relationship between protein sequence, structure, and function. This protein is annotated as a putative helix-turn-helix (HTH) type transcriptional regulator. Many transcriptional regulators like TetR and QacR use a structurally well-defined DNA-binding HTH motif to recognize the target DNA sequences. DNA-HTH motif interactions have been extensively studied. As the HTH motif is structurally conserved in many regulatory proteins, these DNA-protein complexes show some similarity in DNA recognition patterns. Many such regulatory proteins have a ligand-binding domain in addition to the DNA-binding domain. Structural studies on ligand-binding regulatory proteins provide a wealth of information on ligand-, and possibly drug-, binding mechanisms. Understanding the ligand-binding mechanism may help overcome problems with drug resistance, which represent increasing challenges in medicine. The protein encoded by yxaF, hereafter called T1414, shows fold similar to QacR repressor and TetR/CamR repressor and possesses putative DNA and ligand-binding domains. Here, we report the crystal structure of T1414 and compare it with structurally similar drug and DNA-binding proteins
Criteria for newsworthiness and photojournalism Critérios de noticiabilidade e o fotojornalismo
Directory of Open Access Journals (Sweden)
Ivan Luiz Giacomelli
2008-03-01
Full Text Available This article reports on a survey aimed at checking, on a preliminary basis, the influence of the criteria of newsworthiness in making photojournalism, as well as if photojournalism influences the choice and selection of facts that will be news in the newspapers the next morning. Included in this study is a brief report on the historical evolution of both the journalism as the photojournalism, added by concepts of newsworthiness in both areas. In closing, it empirically checks the influence of the criteria for newsworthiness of photojournalism in journalism. Este artigo é um levantamento destinado a verificar, de forma preliminar, a influência dos critérios de noticiabilidade no fazer fotojornalístico, bem como se o fotojornalismo influencia na escolha e seleção dos fatos serão notícia nos jornais do dia seguinte. Integra este estudo um breve relato histórico sobre a evolução tanto do jornalismo quanto do fotojornalismo, seguido de conceitos de noticiabilidade nas duas áreas. Por fim, verifica empiricamente a influência dos critérios de noticiabilidade do fotojornalismo no jornalismo.
Irradiation-assisted stress corrosion cracking in HTH Alloy X-750 and Alloy 625
International Nuclear Information System (INIS)
Bajaj, R.; Mills, W.J.; Lebo, M.R.; Hyatt, B.Z.; Burke, M.G.
1995-01-01
In-reactor testing of bolt-loaded compact tension specimens was performed in 360 C water to determine the irradiation-assisted stress corrosion cracking (IASCC) behavior of HTH Alloy X-750 and direct-aged Alloy 625. New data confirm previous results showing that high irradiation levels reduce SCC resistance in Alloy X-750. Heat-to-heat variability correlates with boron content, with low boron heats showing improved IASCC properties. Alloy 625 is resistant to IASCC, as no cracking was observed in any Alloy 625 specimens. Microstructural, microchemical and deformation studies were performed to characterize the mechanisms responsible for IASCC in Alloy X-750 and the lack of an effect in Alloy 625. The mechanisms under investigation are: boron transmutation effects, radiation-induced changes in microstructure and deformation characteristics, and radiation-induced segregation. Irradiation of Alloy X-750 caused significant strengthening and ductility loss that was associated with the formation of cavities and dislocation loops. High irradiation levels did not cause significant segregation of alloying or trace elements in Alloy X-750. Irradiation of Alloy 625 resulted in the formation of small dislocation loops and a fine body-centered-orthorhombic phase. The strengthening due to the loops and precipitates was apparently offset by a partial dissolution of γ double-prime precipitates, as Alloy 625 showed no irradiation-induced strengthening or ductility loss. In the nonirradiated condition, an IASCC susceptible HTH heat containing 28 ppm B showed grain boundary segregation of boron, whereas a nonsusceptible HTH heat containing 2 ppm B and Alloy 625 with 20 ppm B did not show significant boron segregation. Transmutation of boron to helium at grain boundaries, coupled with matrix strengthening, is believed to be responsible for IASCC in Alloy X-750, and the absence of these two effects results in the superior IASCC resistance displayed by Alloy 625
Irradiation assisted stress corrosion cracking of HTH Alloy X-750 and Alloy 625
International Nuclear Information System (INIS)
Mills, W.J.; Lebo, M.R.; Bajaj, R.; Kearns, J.J.; Hoffman, R.C.; Korinko, J.J.
1994-01-01
In-reactor testing of bolt-loaded precracked compact tension specimens was performed in 360 degree C water to determine effect of irradiation on the SCC behavior of HTH Alloy X-750 and direct aged Alloy 625. Out-of-flux and autoclave control specimens provided baseline data. Primary test variables were stress intensity factor, fluence, chemistry, processing history, prestrain. Results for the first series of experiments were presented at a previous conference. Data from two more recent experiments are compared with previous results; they confirm that high irradiation levels significantly reduce SCC resistance in HTH Alloy X-750. Heat-to-heat differences in IASCC were related to differences in boron content, with low boron heats showing improved SCC resistance. The in-reactor SCC performance of Alloy 625 was superior to that for Alloy X-750, as no cracking was observed in any Alloy 625 specimens even though they were tested at very high K 1 and fluence levels. A preliminary SCC usage model developed for Alloy X-750 indicates that in-reactor creep processes, which relax stresses but also increase crack tip strain rates, and radiolysis effects accelerate SCC. Hence, in-reactor SCC damage under high flux conditions may be more severe than that associated with postirradiation tests. In addition, preliminary mechanism studies were performed to determine the cause of IASCC In Alloy X-750
Directory of Open Access Journals (Sweden)
Elorza Izaskun
2014-12-01
Full Text Available The contrastive analysis of two sets of newspaper articles has been carried out in order to observe how the reports of the same events are constructed in two different languages and cultures as represented by El País and The Guardian newspapers. The first set of texts consists of two science popularization articles dealing with the same scientific finding (Bee Texts, whereas the second set consists of all the articles covering the opening day of a world summit held in Rome (Summit Texts which were published in the online versions of El País and The Guardian respectively. Newsworthiness (Bell, 1991, attribution and lexicogrammatical strategies have been studied in order to show how ideological construction has been developed in these two different kinds of report, one dealing with a non-controversial event (as represented in the Bee Texts and the other with a controversial event (as represented in the Summit Texts.
O'Connor, Eabhann M; Nason, Gregory J; O'Kelly, Fardod; Manecksha, Rustom P; Loeb, Stacy
2017-09-01
To assess whether a correlation exists between newsworthiness (Altmetric score) and scientific impact markers, such as citation analysis, impact factors, and levels of evidence. The top five most cited articles for the year 2014 and 2015 from the top 10 ranking urology journals (Scientific Impact Group) were identified. The top 50 articles each in 2014 and 2015 were identified from Altmetric support based on media activity (Media Impact Group). We determined the number of citations that these articles received in the scientific literature, and calculated correlations between citations with Altmetric scores. In the Scientific Impact Group, the mean number of citations per article was 37.6, and the most highly cited articles were oncology guidelines. The mean Altmetric score in these articles was 14.8. There was a weak positive correlation between citations and Altmetric score (r s = 0.35, 95% confidence interval 0.16-0.52, P scientifically rigorous, or that this audience places greater value on different subjects than the scientific community. © 2017 The Authors BJU International © 2017 BJU International Published by John Wiley & Sons Ltd.
Hinnant, Amanda; Oh, Hyun Jee; Caburnay, Charlene A.; Kreuter, Matthew W.
2011-01-01
News stories reporting race-specific health information commonly emphasize disparities between racial groups. But recent research suggests this focus on disparities has unintended effects on African American audiences, generating negative emotions and less interest in preventive behaviors (Nicholson RA, Kreuter MW, Lapka C et al. Unintended effects of emphasizing disparities in cancer communication to African-Americans. Cancer Epidemiol Biomarkers Prev 2008; 17: 2946–52). They found that black adults are more interested in cancer screening after reading about the progress African Americans have made in fighting cancer than after reading stories emphasizing disparities between blacks and whites. This study builds on past findings by (i) examining how health journalists judge the newsworthiness of stories that report race-specific health information by emphasizing disparities versus progress and (ii) determining whether these judgments can be changed by informing journalists of audience reactions to disparity versus progress framing. In a double-blind-randomized experiment, 175 health journalists read either a disparity- or progress-framed story on colon cancer, preceded by either an inoculation about audience effects of such framing or an unrelated (i.e. control) information stimuli. Journalists rated the disparity-frame story more favorably than the progress-frame story in every category of news values. However, the inoculation significantly increased positive reactions to the progress-frame story. Informing journalists of audience reactions to race-specific health information could influence how health news stories are framed. PMID:21911844
Hydrogeologic characterization of wells HTH-1, UE18r, UE6e, and HTH-3, Nevada Test Site
International Nuclear Information System (INIS)
Lyles, B.F.; McKay, W.A.; Chapman, J.B.; Tyler, S.W.
1991-06-01
Monitoring for the migration of contaminants in groundwater or for the proper design of nuclear test emplacement holes at the Nevada Test Site (NTS) requires proper placement and completion of monitoring wells. This is only possible if the hydrogeologic system is understood in a regional and local context, necessitating data from existing wells and boreholes. Though the NTS Groundwater Characterization Project will be drilling wells, their great expense limits the number of new wells. However, there are many existing boreholes and wells on the NTS which have not been completely evaluated hydrologically. Some of these are incorporated in the Long Term Hydrologic Monitoring Program (LTHMP) of the US Environmental Protection Agency (EPA), others are related to the testing programs. In all cases, additional site investigation in necessary to properly interpret the hydrogeologic data from these wells. Monitoring wells on the NTS are poorly characterized with regard to aquifers penetrated, vertical hydraulic gradients, and vertical variations in water quality. One of the goals of the well validation program was to gain a thorough understanding of the parameters needed to interpret the source and fate potential hazardous and radioactive substances that may be detected in these wells in the future. One of the most critical parameters for monitoring is the knowledge of what aquifer or geologic unit is being sampled when a water sample is collected. Pumped water samples are weighted most heavily to the water quality of the most productive (highest transmissivity) aquifer penetrated by the well
Health risks in perspective: Judging health risks of energy technologies
Energy Technology Data Exchange (ETDEWEB)
Rowe, M.D.
1992-09-18
Almost daily, Americans receive reports from the mass news media about some new and frightening risk to health and welfare. Most such reports emphasize the newsworthiness of the risks -- the possibility of a crisis, disagreements among experts, how things happened, who is responsible for fixing them, how much will it cost, conflict among parties involved, etc. As a rule, the magnitudes of the risks, or the difficulty of estimating those magnitudes, have limited newsworthiness, and so they are not mentioned. Because of this emphasis in the news media, most people outside the risk assessment community must judge the relative significance of the various risks to which we all are exposed with only that information deemed newsworthy by reporters. This information is biased and shows risks in isolation. There is no basis for understanding and comparing the relative importance of risks among themselves, or for comparing one risk, perhaps a new or newly-discovered one, in the field of all risks. The purpose of this report is to provide perspective on the various risks to which we are routinely exposed. It serves as a basis for understanding the meaning of quantitative risk estimates and for comparing new or newly-discovered risks with other, better-understood risks. Specific emphasis is placed on health risks of energy technologies.
Chauhan, Nishant Ranjan; Kapoor, Medha; Prabha Singh, Laxmi; Gupta, Rajinder Kumar; Chand Meena, Ramesh; Tulsawani, Rajkumar; Nanda, Sarita; Bala Singh, Shashi
2017-09-01
Heat Stress (HS) induces diverse pathophysiological changes, which include brain ischemia, oxidative stress and neuronal damage. The present study was undertaken with the objective to ascertain whether neuroinflammation in Hypothalamus (HTH) caused under HS affects monoamine levels and hence, its physiological role in thermoregulation. Rats were exposed to HS in a heat simulation environmental chamber (Ambient temperature, Ta=45±0.5°C and Relative Humidity, RH=30±10%) with real-time measurement of core temperature (Tc) and skin temperature (Ts). Animals were divided into two subgroups: Moderate HS (MHS) (Tc=40°C) and Severe HS (SHS)/Heat stroke (Tc=42°C). Rats with MHS showed an increase in Mean Arterial Pressure (MAP) and Heart Rate (HR) while fall in MAP and rise in HR was observed in rats with SHS. In addition, oxidative stress and an increase in pyknotic neurons were observed in HTH. High levels of Adrenocorticotropic-hormone (ACTH), Epinephrine (EPI), Norepinephrine (NE) and Dopamine (DA) in the systemic circulation and progressive increase in EPI and DA levels in HTH were recorded after the thermal insult. Moreover, a substantial increase in Glutamate (Glu) level was observed in HTH as well as in systemic circulation of heat stroke rats. We found a rise in NE whereas a fall in Serotonin (5-HT) level in HTH at MHS, without perturbing inflammatory mediators. However, rats with SHS exhibited significant elevations in NF-kB, IL-1β, COX2, GFAP and Iba1 protein expression in HTH. In conclusion, the data suggest that SHS induces neuroinflammation in HTH, which is associated with monoamines and Glu imbalances, leading to thermoregulatory disruption. Copyright © 2017 IBRO. Published by Elsevier Ltd. All rights reserved.
Smith, Frank W; Jockusch, Elizabeth L
2014-11-01
The establishment of segment identity is a key developmental process that allows for divergence along the anteroposterior body axis in arthropods. In Drosophila, the identity of a segment is determined by the complement of Hox genes it expresses. In many contexts, Hox transcription factors require the protein products of extradenticle (exd) and homothorax (hth) as cofactors to perform their identity specification functions. In holometabolous insects, segment identity may be specified twice, during embryogenesis and metamorphosis. To glean insight into the relationship between embryonic and metamorphic segmental identity specification, we have compared these processes in the flour beetle Tribolium castaneum, which develops ventral appendages during embryogenesis that later metamorphose into adult appendages with distinct morphologies. At metamorphosis, comparisons of RNAi phenotypes indicate that Hox genes function jointly with Tc-hth and Tc-exd to specify several region-specific aspects of the adult body wall. On the other hand, Hox genes specify appendage identities along the anteroposterior axis independently of Tc-hth/Tc-exd and Tc-hth/Tc-exd specify proximal vs. distal identity within appendages independently of Hox genes during this stage. During embryogenesis, Tc-hth and Tc-exd play a broad role in the segmentation process and are required for specification of body wall identities in the thorax; however, contrasting with results from other species, we did not obtain homeotic transformations of embryonic appendages in response to Tc-hth or Tc-exd RNAi. In general, the homeotic effects of interference with the function of Hox genes and Tc-hth/Tc-exd during metamorphosis did not match predictions based on embryonic roles of these genes. Comparing metamorphic patterning in T. castaneum to embryonic and post-embryonic development in hemimetabolous insects suggests that holometabolous metamorphosis combines patterning processes of both late embryogenesis and
Stenning, Keith; Michell, Lynn
1985-01-01
Reports the results of a study showing that one stylistic feature, the inclusion of connectives other than "and/then" is a good predictor of explanation in five- to ten-year-olds, but a straightforward lack of linguistic resources is not necessarily what limits older children's achievement of explanatory narrative. (HTH)
Directory of Open Access Journals (Sweden)
Lu Bai
2017-01-01
Full Text Available The study investigated the expression of Wnt/β-catenin pathway in diabetic rats and the intervention effect of Huayu Tongluo herbs (HTH. Ten rats were randomly selected as control group and the remaining rats were established as diabetic models. The diabetic rats were randomly divided into model group and HTH treatment group. The intervention was intragastric administration in all rats for 20 weeks. At the end of every 4 weeks, fasting blood glucose and 24 h urinary total protein quantitatively were measured. At the end of the 20th week, biochemical parameters and body weight were tested. The kidney tissues were observed under light microscope and transmission electron microscopy. We examined Wnt/beta-catenin signaling pathway key proteins and renal interstitial fibrosis related molecular markers expression. The results showed that HTH could reduce urinary protein excretion and relieve renal pathological damage. Wnt4, p-GSK3β (S9, and β-catenin expression were decreased in the signaling pathway, but GSK3β level was not changed by HTH in diabetic rats. Furthermore, the expressions of TGF-β1 and ILK were decreased, but the level of E-cadherin was increased in diabetic rats after treatment with HTH. This study demonstrated that HTH could inhibit the high expression of Wnt/β-catenin pathway in kidney of diabetic rats. The effect might be one of the main ways to reduce urinary protein excretion.
Kids Sell: Celebrity Kids’ Right to Privacy
Directory of Open Access Journals (Sweden)
Seong Choul Hong
2016-04-01
Full Text Available The lives of celebrities are often spotlighted in the media because of their newsworthiness; however, many celebrities argue that their right to privacy is often infringed upon. Concerns about celebrity privacy are not limited to the celebrities themselves and often expand to their children. As a result of their popularity, public interest has pushed paparazzi and journalists to pursue trivial and private details about the lives of both celebrities and their children. This paper investigates conflicting areas where the right to privacy and the right to know collide when dealing with the children of celebrities. In general, the courts have been unsympathetic to celebrity privacy claims, noting their newsworthiness and self-promoted characteristic. Unless the press violates news-gathering ethics or torts, the courts will often rule in favor of the media. However, the story becomes quite different when related to an infringement on the privacy of celebrities’ children. This paper argues that all children have a right to protect their privacy regardless of their parents’ social status. Children of celebrities should not be exempt to principles of privacy just because their parents are a celebrity. Furthermore, they should not be exposed by the media without the voluntary consent of their legal patrons. That is, the right of the media to publish and the newsworthiness of children of celebrities must be restrictedly acknowledged.
International Nuclear Information System (INIS)
Chapman, J.B.; Mihevc, T.M.; Lyles, B.F.
1994-08-01
The Central Nevada Test Area was the site of the Faultless underground nuclear test that could be a source of radionuclide contamination to aquifers in Hot Creek Valley, Nevada. Field studies in 1992 and 1993 have used hydrologic logging and water sampling to determine the adequacy of the current groundwater monitoring network and the status of water-level recovery to pre-shot levels in the nuclear chimney. The field studies have determined that there is a possibility for contaminant migration away from the Faultless event though the pre-event water level has not been attained, while new data raise questions about the ability of the current monitoring network to detect migration. Hydrologic logs from the postshot hole (drilled into the chimney created by the nuclear detonation) reveal inflow around 485 m below land surface. The physical and chemical characteristics of the inflow water indicate that its source is much deeper in the chimney, perhaps driven upward in a convection cell generated by heat near the nuclear cavity. Logging and sampling at monitoring wells HTH-1 and HTH-2 revealed that the completion of HTH-1 may be responsible for its elevated water level (as compared to pre-nuclear test levels) and may have also created a local mound in the water table in the alluvium that accounts for higher post-test water levels at HTH-2. This mound would serve to divert flow around the monitoring wells, so that only migration of contaminants through the underlying, higher pressure, volcanic units is currently monitored. A hydraulic high found in an abandoned hole located between the nuclear chimney and the monitoring wells further reduces the likelihood of HTH-1 or HTH-2 intercepting contaminant migration
Directory of Open Access Journals (Sweden)
Hou-Long Long
2018-05-01
Full Text Available Dietary anthocyanin compounds have multiple biological effects, including antioxidant, anti-inflammatory, and anti-atherosclerotic characteristics. The present study evaluated the anti-tumor capacity of mulberry anthocyanins (MA in thyroid cancer cells. Our data showed that MA suppressed SW1736 and HTh-7 cell proliferation in a time- and dose-dependent manner. Meanwhile, flow cytometry results indicated that MA significantly increased SW1736 and HTh-7 cell apoptosis. We additionally observed that SW1736 and HTh-7 cell autophagy was markedly enhanced after MA treatment. Importantly, anthocyanin-induced cell death was largely abolished by 3-methyladenine (3-MA or chloroquine diphosphate salt (CQ treatment, suggesting that MA-induced SW1736 and HTh-7 cell death was partially dependent on autophagy. In addition, activation of protein kinase B (Akt, mammalian target of rapamycin (mTOR, and ribosomal protein S6 (S6 were significantly suppressed by anthocyanin exposure. In summary, MA may serve as an adjunctive therapy for thyroid cancer patients through induction of apoptosis and autophagy-dependent cell death. Keywords: Mulberry anthocyanins, Thyroid cancer, Apoptosis, Autophagic death
Tyrosine hydroxylase regulatory domain as indicator of enzyme sensitivity to irradiation
International Nuclear Information System (INIS)
Mustafayeva, N.N.; Alieva, I.N.; Aliev, Ds.I.
2002-01-01
Full text: At the present time contra dictionary and variously kind opinions concern to effect of different level of irradiation on the structure and functional activity of the tyrosine hydroxylase (TH), the key a rate-limiting enzyme in the biosynthesis of catecholamines are discussed in this study. To date, the effect of the irradiation on the both catalytic and N-terminal regulatory domains of TH localized in the different parts of the brain has been established. Th is responsible for dopamine, noradrenaline and adrenaline catecholamines neuro mediators biosynthesis, so a number of pathological changes in an organism has been induced by the structural reorganization different parts of the TH domains under pathological effect of environment. The available conformational states of the human TH type 1 (hTH1) regulatory domain, the activity of which is regulated by the feedback inhibition of the catecholamine products including dopamine has been established by the method of molecular mechanics. It is shown that N-terminal sequence Met30-Ser40 of hTH1 located between the two a-helices (residues 16-29 and residues 41-59) has a number of low-energy conformational states. The most available structures consists of b-turn type II on the pentapeptide fragment of hTH1. This fragment distortion under pathological factors effect, i.e. irradiation may lead to global reorganization in enzyme structure as well as at the enzyme catalytic and regulatory functions
Directory of Open Access Journals (Sweden)
Sonia Carreño-Moreno
2016-02-01
Full Text Available The objective of this work, is provide conceptual elements that constitute an integrated vision of care conditions required by the human talent in health HTH that caters to people with chronic disease (CD and their families, and that are translated into a tool for gathering information of survey type that allow characterization. This research was conducted in three phases: 1 Review of the literature. 2 Structuring a proposed survey 3 Refinement of the final version of the survey. As results, based on the conceptual framework it was possible to reach a comprehensive vision that served as the basis for the development of a survey to identify the conditions of HTH to care for people with chronic illness and their families. This instrument, called GCPC-A-THS (in Spanish, contains 37 items distributed in 6 additional dimensions that include aspects of care such as: sociodemographic variables of HTH, caring ability, information and communication technologies (ICTs as a means of support to care, continuity, security and also includes some items related to the level of professional satisfaction. The work done made it possible to achieve a comprehensive view of the characteristics and conditions required by the HTH for care to people with chronic illness and their families.
Media attention and the market for 'green' consumer products
DEFF Research Database (Denmark)
Thøgersen, John
2006-01-01
, but also its mere success means that stories framing green businesses in a negative light become newsworthy while positive stories lose their newsworthiness. Therefore, and despite a large and loyal customer base, many green companies now find themselves in a much more hostile environment than a decade ago.......There are signs that a general counter-attack is now being orchestrated against the greens. This paper surveys the evidence regarding an issue-attention cycle in environmental concern in Western Europe and North America. It furthermore discusses the role of the news media in creating the cycle....... It is well documented that the mass media plays an important role in determining which issues receive high or low attention by the general public. However, not only does the media's assessment of what is newsworthy mean that green businesses will eventually lose the current of a rising issue attention cycle...
Liu, Sushuang; Liu, Yanmin; Jia, Yanhong; Wei, Jiaping; Wang, Shuang; Liu, Xiaolin; Zhou, Yali; Zhu, Yajing; Gu, Weihong; Ma, Hao
2017-06-01
Matrix metalloproteinases (MMPs) are a family of zinc- and calcium-dependent endopeptidases. Gm1-MMP was found to play an important role in soybean tissue remodeling during leaf expansion. In this study, Gm1-MMP was isolated and characterized. Its encoding protein had a relatively low phylogenetic relationship with the MMPs in other plant species. Subcellular localization indicated that Gm1-MMP was a plasma membrane protein. Gm1-MMP showed higher expression levels in mature leaves, old leaves, pods, and mature seeds, as well as was involved in the development of soybean seed. Additionally, it was involved in response to high temperature and humidity (HTH) stress in R7 leaves and seeds in soybean. The analysis of promoter of Gm1-MMP suggested that the fragment from -399 to -299 was essential for its promoter activity in response to HTH stress. The overexpression of Gm1-MMP in Arabidopsis affected the growth and development of leaves, enhanced leaf and developing seed tolerance to HTH stress and improved seed vitality. The levels of hydrogen peroxide (H 2 O 2 ) and ROS in transgenic Arabidopsis seeds were lower than those in wild type seeds under HTH stress. Gm1-MMP could interact with soybean metallothionein-II (GmMT-II), which was confirmed by analysis of yeast two-hybrid assay and BiFC assays. All the results indicated that Gm1-MMP plays an important role in the growth and development of leaves and seeds as well as in tolerance to HTH stress. It will be helpful for us understanding the functions of Gm1-MMP in plant growth and development, and in response to abiotic stresses. Copyright © 2017 Elsevier B.V. All rights reserved.
Inhibition of stress corrosion cracking of Alloy X-750 by prestrain
International Nuclear Information System (INIS)
Mills, W.J.; Lebo, M.R.; Kearns, J.J.
1997-03-01
Tests of precracked and as-notched compact tension specimens were conducted in 3600C hydrogenated water to determine the effect of prestrain on the stress corrosion cracking (SCC) resistance of Alloy X-750 in the HTH, AH and HOA heat treated conditions. Prestraining is defined as the intentional application of an initial load (or strain) that is higher than the final test load. Prestrain was varied from 10% to 40% (i.e., the initial to final load ratios ranged from 1.1 to 1.4). Other variables included notch root radius, stress level and irradiation. Specimens were bolt-loaded to maintain essentially constant displacement conditions during the course of the test. The frequent heat up and cooldown cycles that were necessary for periodic inspections provided an opportunity to evaluate the effect of test variables on rapid low temperature crack propagation to which this alloy is subject. For Condition HTH, application of 20% to 40% prestrain either eliminates or significantly retards SCC initiation in as-notched specimens and the onset of crack growth in precracked specimens. In addition, this procedure reduces the propensity for low temperature crack growth during cooldown. Similar results were observed for precracked HOA specimens. Application of 20% prestrain also retards SCC in as-notched and precracked AH specimens, but the effects are not as great as in Condition HTH. Prestraining at the 10% level was found to produce an inconsistent benefit. In-reactor SCC testing shows that prestrain greatly improves the in-flux and out-of-flux SCC resistance of Condition HTH material. No SCC was observed in precracked specimens prestrained 30%, whereas extensive cracking was observed in their nonprestrain counterparts
Role of Sida cordifolia L. leaves on biochemical and antioxidant profile during myocardial injury.
Kubavat, J B; Asdaq, S M B
2009-07-06
The Sida cordifolia L. (Family: Malvaceae) is a widely allocated herb by folk tribes of Gujarat state of India for the treatment of coronary manifestations. However, no published data relevant to use of the plant is available. The aim of the present study was to evaluate the antioxidant and biochemical profile of hydroalcoholic extract of Sida cordifolia L. (HESC) leaves against myocardial infarction (MI) in rats. Albino rats were administered HESC (100 and 500 mg/kg) and propranolol (10 mg/kg) once daily orally for 30 days. At the end of treatment period, MI was induced by administering isoproterenol (ISO) or by subjecting heart to ischemia reperfusion injury (IRI). Endogenous biomarkers (LDH and CK-MB) and antioxidants (SOD and catalase) were estimated in serum/perfusate and heart tissue homogenate (HTH). The LDH and CK-MB activities were elevated in HTH and depleted in serum/perfusate of HESC and propranolol groups when compared to ISO/IRI control. Further, it was found that both doses significantly increased endogenous antioxidants in HTH. Moreover, biochemical findings were supported by histopathological observations. The result confirm, at least in part, for the use of Sida cordifolia in folk medicine to treat MI.
ORF Alignment: NC_000964 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available HTH-type ... transcriptional regulator pksA ... Length = 182 ... Query: 8 ... EKRRKQIAEATWRVILERGME...GASARNIAKEAGLSLGALRHYFSTQDELLAFAMKLVQEK 67 ... EKRRKQIAEATWRVILERGMEGASARNIAKEAGLSLGALRHYFSTQDELLAFAM...KLVQEK Sbjct: 1 ... EKRRKQIAEATWRVILERGMEGASARNIAKEAGLSLGALRHYFSTQDELLAFAMKLVQEK 60
Linn, Bill
1981-01-01
Relates composition to the philosophy of Taoism as performing an activity instinctively and with ease. Illustrates the relationship with examples of students' reactions to particular writing situations. (HTH)
Directory of Open Access Journals (Sweden)
Teresa Milano
2016-01-01
Full Text Available The MocR bacterial transcriptional regulators are characterized by an N-terminal domain, 60 residues long on average, possessing the winged-helix-turn-helix (wHTH architecture responsible for DNA recognition and binding, linked to a large C-terminal domain (350 residues on average that is homologous to fold type-I pyridoxal 5′-phosphate (PLP dependent enzymes like aspartate aminotransferase (AAT. These regulators are involved in the expression of genes taking part in several metabolic pathways directly or indirectly connected to PLP chemistry, many of which are still uncharacterized. A bioinformatics analysis is here reported that studied the features of a distinct group of MocR regulators predicted to be functionally linked to a family of homologous genes coding for integral membrane proteins of unknown function. This group occurs mainly in the Actinobacteria and Gammaproteobacteria phyla. An analysis of the multiple sequence alignments of their wHTH and AAT domains suggested the presence of specificity-determining positions (SDPs. Mapping of SDPs onto a homology model of the AAT domain hinted at possible structural/functional roles in effector recognition. Likewise, SDPs in wHTH domain suggested the basis of specificity of Transcription Factor Binding Site recognition. The results reported represent a framework for rational design of experiments and for bioinformatics analysis of other MocR subgroups.
Shelf-Life of Chlorine Solutions Recommended in Ebola Virus Disease Response.
Iqbal, Qais; Lubeck-Schricker, Maya; Wells, Emma; Wolfe, Marlene K; Lantagne, Daniele
2016-01-01
In Ebola Virus Disease (EVD) outbreaks, it is widely recommended to wash living things (handwashing) with 0.05% (500 mg/L) chlorine solution and non-living things (surfaces, personal protective equipment, dead bodies) with 0.5% (5,000 mg/L) chlorine solution. Chlorine solutions used in EVD response are primarily made from powdered calcium hypochlorite (HTH), granular sodium dichloroisocyanurate (NaDCC), and liquid sodium hypochlorite (NaOCl), and have a pH range of 5-11. Chlorine solutions degrade following a reaction highly dependent on, and unusually sensitive to, pH, temperature, and concentration. We determined the shelf-life of 0.05% and 0.5% chlorine solutions used in EVD response, including HTH, NaDCC, stabilized NaOCl, generated NaOCl, and neutralized NaOCl solutions. Solutions were stored for 30 days at 25, 30, and 35°C, and tested daily for chlorine concentration and pH. Maximum shelf-life was defined as days until initial concentration fell to pH = 7) had a maximum shelf-life of a few hours, NaDCC solutions (pH = 6) 2 days, generated NaOCl solutions (pH = 9) 6 days, and HTH and stabilized NaOCl solutions (pH 9-11) >30 days. Models were developed for solutions with maximum shelf-lives between 1-30 days. Extrapolating to 40°C, the maximum predicted shelf-life for 0.05% and 0.5% NaDCC solutions were 0.38 and 0.82 hours, respectively; predicted shelf-life for 0.05% and 0.5% generated NaOCl solutions were >30 and 5.4 days, respectively. Each chlorine solution type offers advantages and disadvantages to responders, as: NaDCC is an easy-to-import high-concentration effervescent powder; HTH is similar, but forms a precipitate that may clog pipes; and, NaOCl solutions can be made locally, but are difficult to transport. We recommend responders chose the most appropriate source chlorine compound for their use, and ensure solutions are stored at appropriate temperatures and used or replaced before expiring.
HDR-Aggregate Read Service (ARS)
Department of Veterans Affairs — ARS is a SOAP web service exposed over HTTPS that provides an aggregated (report) view of HTH Survey, DMP and Census data stored in the HDR DB. ARS is deployed in...
Survey Helps Class to See, Understand Local Standards.
Pasternack, Steve
1986-01-01
Presents an exercise in which students interview various groups of citizens--church leaders, school officials, government and business leaders--in order to give students a broader understanding of the definitions of obscenity and community standards. (HTH)
Lancaster, Ron; Marion, Charlie
1996-01-01
Two lessons, 1 dealing with Social Security taxes and the other with the Dow Jones industrial average, are presented along with 10 questions and answers designed to demonstrate to students that mathematics is useful, current, and newsworthy. (AIM)
Francis Bacon and the Technology of Style.
Baker, Christopher
1983-01-01
Examines Francis Bacon's intentionally devised style for scientific writings and the theoretical basis of that style. Discusses his emphasis on a truly objective point of view, and his use of aphorisms to adapt to his audience. (HTH)
Cohen, Alan S.
1984-01-01
Describes a final exercise that gives composition students a better sense of how they have grown as writers during the semester. Students review, edit, and make conclusions on their "selected works," preparing a manuscript-like folder. (HTH)
Akande, Adebowale
1993-01-01
Describes assessment and successful treatment of a preadolescent with erratic toileting behavior and related social skills difficulties. Treatment included monitoring of bowel movements, using a star chart, and applying rewards as positive reinforcement of acceptable behavior. (HTH)
Audiences, Journalists, and Forms of Capital in the Online Journalistic Field
Directory of Open Access Journals (Sweden)
Edson C. Tandoc Jr.
2016-04-01
Full Text Available This study found divergence in how online journalists and student-audiences rated articles with varying popularity, as measured by audience metrics, and quality, as operationalized by winning a journalistic award. The findings revealed that while metrics and awards did not matter for young online news audiences, they were important for online journalists. But even among journalists, the importance of metrics and awards varied depending on whether the journalists were evaluating stories or their peers. For online journalists, popular stories were more newsworthy than those that were not. Awards did not influence their judgment of newsworthiness. But when evaluating the authors of the articles, online journalists rated authors of articles that won awards more favorably than authors of articles without awards. The popularity of stories did not matter in their evaluation of the authors.
Hammerstrom, Troy G; Horton, Lori B; Swick, Michelle C; Joachimiak, Andrzej; Osipiuk, Jerzy; Koehler, Theresa M
2015-02-01
The Bacillus anthracis virulence regulator AtxA controls transcription of the anthrax toxin genes and capsule biosynthetic operon. AtxA activity is elevated during growth in media containing glucose and CO(2)/bicarbonate, and there is a positive correlation between the CO(2)/bicarbonate signal, AtxA activity and homomultimerization. AtxA activity is also affected by phosphorylation at specific histidines. We show that AtxA crystallizes as a dimer. Distinct folds associated with predicted DNA-binding domains (HTH1 and HTH2) and phosphoenolpyruvate: carbohydrate phosphotransferase system-regulated domains (PRD1 and PRD2) are apparent. We tested AtxA variants containing single and double phosphomimetic (His→Asp) and phosphoablative (His→Ala) amino acid changes for activity in B. anthracis cultures and for protein-protein interactions in cell lysates. Reduced activity of AtxA H199A, lack of multimerization and activity of AtxAH379D variants, and predicted structural changes associated with phosphorylation support a model for control of AtxA function. We propose that (i) in the AtxA dimer, phosphorylation of H199 in PRD1 affects HTH2 positioning, influencing DNA-binding; and (ii) phosphorylation of H379 in PRD2 disrupts dimer formation. The AtxA structure is the first reported high-resolution full-length structure of a PRD-containing regulator, and can serve as a model for proteins of this family, especially those that link virulence to bacterial metabolism. © 2014 John Wiley & Sons Ltd.
Energy Technology Data Exchange (ETDEWEB)
Hammerstrom, Troy G.; Lori, Horton B.; Swick, Michelle C.; Joachimiak, Andrzej; Osipiuk, Jerzy; Koehler, Theresa M.
2014-12-30
The Bacillus anthracis virulence regulator AtxA controls transcription of the anthrax toxin genes and capsule biosynthetic operon. AtxA activity is elevated during growth in media containing glucose and CO2/bicarbonate, and there is a positive correlation between the CO2/bicarbonate signal, AtxA activity and homomultimerization. AtxA activity is also affected by phosphorylation at specific histidines. We show that AtxA crystallizes as a dimer. Distinct folds associated with predicted DNA-binding domains (HTH1 and HTH2) and phosphoenolpyruvate: carbohydrate phosphotransferase system-regulated domains (PRD1 and PRD2) are apparent. We tested AtxA variants containing single and double phosphomimetic (HisAsp) and phosphoablative (HisAla) amino acid changes for activity in B.anthracis cultures and for protein-protein interactions in cell lysates. Reduced activity of AtxA H199A, lack of multimerization and activity of AtxAH379D variants, and predicted structural changes associated with phosphorylation support a model for control of AtxA function. We propose that (i) in the AtxA dimer, phosphorylation of H199 in PRD1 affects HTH2 positioning, influencing DNA-binding; and (ii) phosphorylation of H379 in PRD2 disrupts dimer formation. The AtxA structure is the first reported high-resolution full-length structure of a PRD-containing regulator, and can serve as a model for proteins of this family, especially those that link virulence to bacterial metabolism.
Solution structure of CEH-37 homeodomain of the nematode Caenorhabditis elegans
International Nuclear Information System (INIS)
Moon, Sunjin; Lee, Yong Woo; Kim, Woo Taek; Lee, Weontae
2014-01-01
Highlights: •We have determined solution structures of CEH-37 homedomain. •CEH-37 HD has a compact α-helical structure with HTH DNA binding motif. •Solution structure of CEH-37 HD shares its molecular topology with that of the homeodomain proteins. •Residues in the N-terminal region and HTH motif are important in binding to Caenorhabditis elegans telomeric DNA. •CEH-37 could play an important role in telomere function via DNA binding. -- Abstract: The nematode Caenorhabditis elegans protein CEH-37 belongs to the paired OTD/OTX family of homeobox-containing homeodomain proteins. CEH-37 shares sequence similarity with homeodomain proteins, although it specifically binds to double-stranded C. elegans telomeric DNA, which is unusual to homeodomain proteins. Here, we report the solution structure of CEH-37 homeodomain and molecular interaction with double-stranded C. elegans telomeric DNA using nuclear magnetic resonance (NMR) spectroscopy. NMR structure shows that CEH-37 homeodomain is composed of a flexible N-terminal region and three α-helices with a helix-turn-helix (HTH) DNA binding motif. Data from size-exclusion chromatography and fluorescence spectroscopy reveal that CEH-37 homeodomain interacts strongly with double-stranded C. elegans telomeric DNA. NMR titration experiments identified residues responsible for specific binding to nematode double-stranded telomeric DNA. These results suggest that C. elegans homeodomain protein, CEH-37 could play an important role in telomere function via DNA binding
Solution structure of CEH-37 homeodomain of the nematode Caenorhabditis elegans
Energy Technology Data Exchange (ETDEWEB)
Moon, Sunjin [Structural Biochemistry and Molecular Biophysics Lab, Department of Biochemistry, College of Life Science and Biotechnology, Yonsei University, Seoul 120-749 (Korea, Republic of); Lee, Yong Woo; Kim, Woo Taek [Department of Systems Biology, College of Life Science and Biotechnology, Yonsei University, Seoul 120-749 (Korea, Republic of); Lee, Weontae, E-mail: wlee@spin.yonsei.ac.kr [Structural Biochemistry and Molecular Biophysics Lab, Department of Biochemistry, College of Life Science and Biotechnology, Yonsei University, Seoul 120-749 (Korea, Republic of)
2014-01-10
Highlights: •We have determined solution structures of CEH-37 homedomain. •CEH-37 HD has a compact α-helical structure with HTH DNA binding motif. •Solution structure of CEH-37 HD shares its molecular topology with that of the homeodomain proteins. •Residues in the N-terminal region and HTH motif are important in binding to Caenorhabditis elegans telomeric DNA. •CEH-37 could play an important role in telomere function via DNA binding. -- Abstract: The nematode Caenorhabditis elegans protein CEH-37 belongs to the paired OTD/OTX family of homeobox-containing homeodomain proteins. CEH-37 shares sequence similarity with homeodomain proteins, although it specifically binds to double-stranded C. elegans telomeric DNA, which is unusual to homeodomain proteins. Here, we report the solution structure of CEH-37 homeodomain and molecular interaction with double-stranded C. elegans telomeric DNA using nuclear magnetic resonance (NMR) spectroscopy. NMR structure shows that CEH-37 homeodomain is composed of a flexible N-terminal region and three α-helices with a helix-turn-helix (HTH) DNA binding motif. Data from size-exclusion chromatography and fluorescence spectroscopy reveal that CEH-37 homeodomain interacts strongly with double-stranded C. elegans telomeric DNA. NMR titration experiments identified residues responsible for specific binding to nematode double-stranded telomeric DNA. These results suggest that C. elegans homeodomain protein, CEH-37 could play an important role in telomere function via DNA binding.
The Computer and the Writer's Craft: Implications for Teachers.
Brockmann, R. John; McCauley, Rebecca J.
1984-01-01
Examines how computers as a medium for communication affect the craft of writing, and subsequently affect teaching approaches. Discusses the need for teaching online document design and problem-solving processes as they relate to the communication process. (HTH)
Hydrogen metal hydride storage with integrated catalytic recombiner for mobile application
Energy Technology Data Exchange (ETDEWEB)
Marinescu-Pasoi, L.; Behrens, U.; Langer, G.; Gramatte, W.; Rastogi, A.K.; Schmitt, R.E. (Battelle-Institut e.V., Frankfurt am Main (DE). Dept. of Energy Technology)
1991-01-01
A novel, thermodynamically efficient device is under development at Battelle in Frankfurt, by which the range of hydrogen-driven cars with a metal hydride tank might be roughly doubled. The device makes use of the properties of metal hydrides, combined with catalytic combustion. Its development is funded by the Hessian Ministry of Economic Affairs and Technology; it is to be completed by the end of 1990. High-temperature hydrides (HTH) have about three times the storage capacity of low temperature hydrides (LTH), but require relatively large amounts of heat at high temperatures to release the hydrogen. The exhaust heat from combustion-engine-driven vehicles is insufficient for this, and vehicles with electric (fuel cell) drive produce practically no exhaust heat at all. The Battelle-developed device is a combination of an HTH storage cell, an LTH storage cell and a catalyst. (author).
Thermodynamic study of the thorium-hydrogen system at 700 K
International Nuclear Information System (INIS)
Picard, C.; Kleppa, O.J.
1980-01-01
The partial enthalpies of solution of hydrogen in thorium-hydrogen alloys with H/Th ratios ranging from 0 to 2 have been measured calorimetrically at 700 K. From these data we calculate the standard enthalpy of formation of ThH 2 at this temperature to be -34.8 kcal mol -1 with an estimated uncertainty of +- 0.2 kcal mol -1 . This agrees well with values calculated by earlier investigators from plateau pressure equilbrium data. For several alloy compositions within the nearly stoichiometric phase ThH 2 the equilibrium pressures of hydrogen also were determined. Comparisons of the relative partial Gibbs energies of hydrogen obtained from these equilibrium pressures with corresponding enthalpies from calorimetry provide information on the partial entropy. The partial enthalpy and entropy both change dramatically with composition between H/Th = 1.99 and 2.003
De Nooy, W.; Kleinnijenhuis, J.
2013-01-01
In multiparty election campaigns, many political parties and candidates compete for media attention, voters, and a government majority. Negative campaigning, which is often newsworthy, is an attractive strategy in the competition for media attention. However, political support for another party
de Nooy, W.; Kleinnijenhuis, J.
2013-01-01
In multiparty election campaigns, many political parties and candidates compete for media attention, voters, and a government majority. Negative campaigning, which is often newsworthy, is an attractive strategy in the competition for media attention. However, political support for another party
J-Educators Must Deal with "A Nation at Risk."
Craig, J. Robert
1985-01-01
Suggests that mass communication educators need to interpret the literacy called for in "A Nation at Risk" to include media literacy: responsible awareness of media effects, media criticism and ethics, nontraditional media technologies, and media issues and problems. (HTH)
Children's Preferences for Film Form and Technique.
Cox, Carole
1982-01-01
Describes the methodology and results of a study of the preferences of fourth- and fifth-grade children for film form and technique. Indicates that children prefer narrative/live action films, followed by narrative/animation, nonnarrative/live action, and nonnarrative/animation. (HTH)
From Surrogacy to Contested Adoption: What Went Wrong?
Greenfield, Joanna; Jennings, Seamus
1995-01-01
Notes the complex and emotive nature of surrogate motherhood. Describes a surrogacy arrangement that was apparently based initially on a clear agreement and partnership, but developed into a disputed adoption application when the surrogate mother became dissatisfied with contact arrangements. (HTH)
Elementary School Math Instruction: Can Reading Specialists Assist?
Heinrichs, Audrey S.
1987-01-01
Discusses the contradictions found in recommendations for direction instruction or informal math language development, and some suggestions for practical resolution of disagreements, to enable school reading specialists to provide both background and practical help to classroom instructors teaching math. (HTH)
19 CFR 12.48 - Importation prohibited; exceptions to prohibition of importation; procedure.
2010-04-01
..., historical, or newsworthy purposes in articles, books, journals, newspapers, or albums (but not for advertising purposes, except illustrations of stamps and paper money in philatelic or numismatic advertising... numismatic articles, books, journals, newspapers, or albums) of black and white illustrations of canceled and...
"Daughter of Time": Outside Reading for a Research Writing Course.
Sosville, Jerri
1987-01-01
Presents an alternative to the usual selections taught in research paper writing courses. Suggests that Josephine Tey's novel is more relevant and enjoyable, as well as better suited for research projects, than, for example, "1984" or "The Sound and the Fury." (HTH)
Ainsworth, Mary D. S.; Marvin, Robert S.
1995-01-01
Developmental psychologist Ainsworth discusses early influences on her work in attachment theory; similarities and differences in attachment behaviors across cultures; construction of assessments and research designs; individual differences in attachment and maternal support; and the influence of early relationships on later ones. (HTH)
Intercountry Adoption: A Comparison between France and England.
Greenfield, Joanna
1995-01-01
Examined the intercountry adoption experiences of 100 French and 100 English families, comparing policy in each country. Found a lack of effective and sensitive management of the introductory meetings between prospective parents and adoptive children, and of adequate birth records information. (HTH)
Murphy, Christina
1985-01-01
Presents a dialogue between two adherents of the process centered paradigm of rhetoric: one a "classicist" who sees art as the knowledge necessary for producing preconceived results by conscious, directed actions, and the other a "romantic," who sees art as "magical" inspiration. (HTH)
Applications of the Wilkinson Model of Writing Maturity to College Writing.
Sternglass, Marilyn
1982-01-01
Examines the four-category model developed by Andrew Wilkinson at the University of Essex (England) to assess growth in writing maturity. The four measures of development are stylistic, affective, cognitive, and moral. Each has several subcategories. Includes college student essays to illustrate the model. (HTH)
What Do Feminist Critics Want? Or a Postcard from the Volcano.
Gilbert, Sandra
1980-01-01
Explores the task of revising Western culture, particularly in the study of literature, that feminist critics encounter. Discusses the male-oriented attitudes towards feminist studies in academia, as well as the attributes of and need for the study of literature from a feminist perspective. (HTH)
The Historical Construction of the Mediterranean
DEFF Research Database (Denmark)
Fenech, Dominic; Pace, Michelle
2017-01-01
Ideas about what the Mediterranean is, was or is imagined to be abound, and the debate over definition continues to intrigue scholars more than ever, especially as the region’s heightened newsworthiness in recent years has forced the protagonists of world affairs to turn their attention to it...
Schewe, Phillip F., Ed.
Information is provided on some of the interesting and newsworthy developments in physics and its related fields during 1983. Areas considered include: (1) acoustics; (2) astrophysics; (3) condensed matter physics; (4) crystallography; (5) physics education; (6) electron and atomic physics; (7) elementary particle physics; (8) fluid dynamics; (9)…
Chinese Journalism Education: Slow Progress since 1918.
Jingming, Zhang; Jiana, Peng
1986-01-01
Notes that journalism education prior to 1949 was modeled after American journalism schools, while since the 1950s, that orientation has been replaced by Soviet principles. Observes the projected shortage of journalism graduates and the need for increased capacity in journalism institutions and for increased international exchange. (HTH)
Hirsch's "Philosophy of Composition": An Evaluation of the Argument.
Doherty, Paul C.
1982-01-01
Examines the description of the reading for revision process put forth in E. D. Hirsch's "The Philosophy of Composition," contending the research studies Hirsch uses are inconsistent and, taken together, do not support the general description of the reading process that underlies the argument of the book. (HTH)
Effect of excess ozone on UV-stimulated tritium oxidation
International Nuclear Information System (INIS)
Hasegawa, Kiyoshi; Horii, Kazuhiro; Matsuyama, Masao; Watanabe, Kuniaki.
1995-01-01
The authors have reported that the oxidation of tritium is considerably accelerated by irradiating a mixture gas of HT(H 2 )-O 2 with UV-photons, and this UV-stimulated HT oxidation is mainly due to the formation of intermediates such as ozone and activated oxygen species. This suggests that the oxidation will be much more enhanced in the presence of excess ozone in the reaction system. To examine this possibility, effects of the excess ozone on the UV-stimulated HT oxidation was experimentally studied on the one hand, and reaction mechanisms were investigated by developing a computer simulation program applicable to the three-component system of HT(H 2 )-O 2 -O 3 . The formation rate of HTO was measured for gas mixtures consisting of O 2 (75.5 Torr), O 3 (0.5-2% of O 2 ), H 2 (0.1-3% of O 2 ) and HT(H 2 /HT=12000). The experiments showed considerable enhancement of the HTO production rate in the presence of excess ozone by UV-photons from a low pressure mercury lamp(5W). The time course of the reaction was reproduced quite well by computer simulation, indicating that the assumed reaction mechanism is valid. This is also supported by observations that computer simulation reproduced the experimentally observed dependence of ozone decomposition rate on ozone and hydrogen pressures under the UV-irradiation. Those results showed that UV-stimulated HT oxidation was accelerated by about 14000 times in the presence of excess ozone. It strongly suggests that the UV-stimulated oxidation in the presence of excess ozone will be applicable to tritium handling systems as a non-catalytic tritium removal method. (author)
The effects of heat treatment and environment on corrosion fatigue
International Nuclear Information System (INIS)
Ballinger, R.G.; Hwang, I.S.; Elliott, C.K.
1993-05-01
Alloy X-750 is a nickel-base alloy used extensively in Light Water Reactor (LWR) nuclear power systems due to its excellent corrosion resistance and high temperature strength. In spite of alloy X-750's exceptional high temperature properties, it has been found to be susceptible to environmentally assisted fatigue and stress corrosion cracking in relatively low temperature aqueous environments such as those that exist in LWR systems. In order to develop a better understanding of the role that microstructure plays in the fatigue behavior of alloy X-750, three thermal treatments were studied. The treatments used were as hot worked + : (1) 24 h at 885 degree C + 20 h at 704 degree C (AH), (2) lh at 982 degree C + 20 h at 704 degree C (BH), and (3) 1 h at 1093 degree C + 20 h at 704 degree C (HTH). Fatigue crack growth tests were conducted at frequencies of 0.1 and 10 Hz in the following aqueous environments: (1) high purity, air saturated water (8 ppM O 2 ) at 93 degree C and 288 degree C, (2) high purity, deoxygenated water (5 ppb O 2 ) at 93 degree C, and (3) simulated BWR water chemistry with hydrogen additions at 288 degree C. Crack growth rate data was collected at constant values of stress intensity factor range (ΔK). The results show that crack growth rates and morphology are a function of ΔK, frequency, thermal treatment and environment. Frequency effects were most significant for the AH material. Crack growth rates generally decrease, for a given value of ΔK, in the BH and HTH materials with the HTH material showing the lowest growth rate
Magazine Coverage of Child Sexual Abuse, 1992-2004
Cheit, Ross E.; Shavit, Yael; Reiss-Davis, Zachary
2010-01-01
This article analyzes trends in the coverage of child sexual abuse in popular magazines since the early 1990s. The article employs systematic analysis to identify and analyze articles in four popular magazines. Articles are analyzed by subject, length, and publication. The results affirm established theories of newsworthiness related to the…
School Bus Safety: What Can Our Schools Do to Protect Our Children?
Dargan, Thomas J.; Silverstone, Adam H.
2014-01-01
School districts and school bus contractors are entrusted with the most important of all road users--our nation's children. In the wake of recent newsworthy accidents and attention grabbing headlines regarding unfit bus drivers, claims premised upon school bus accidents have become increasingly tangential and, in turn, personal injury attorneys…
Srratr, James; Shelton, Stella
2001-01-01
One eager reporter plus a media-savvy parent can undermine a school system's image and educational mission. Districts are hampered by the Family Educational Rights and Privacy Act, which prohibits open discussion of an issue concerning a student and his/her parents. Newsworthy incidents illustrate advantages of a waiver policy. (MLH)
The Continued Influence of Implied and Explicitly Stated Misinformation in News Reports
Rich, Patrick R.; Zaragoza, Maria S.
2016-01-01
The piecemeal reporting of unfolding news events can lead to the reporting of mistaken information (or misinformation) about the cause of the newsworthy event, which later needs to be corrected. Studies of the "continued influence effect" have shown, however, that corrections are not entirely effective in reversing the effects of initial…
Students Write, Then "Sell" Ad Copy to Class.
Galician, Mary Lou
1986-01-01
Describes a course in commercial copywriting for electronic media in which students must also present orally their copy to the class to drive home two points: (1) the writing has to sell products, and (2) the writer has to sell the spot or campaign to the client or employers. (HTH)
Sluder, R. S.; Luder, Linda C.
1995-01-01
Notes that children with special needs often require specific considerations with regard to dental care. Discusses some of the physical disabilities and how they interfere with dental hygiene, and how child caregivers can modify daily routines and assist disabled children with areas of hygiene the children may find difficult. (HTH)
Timing of Childhood Events and Early-Adult Household Formation.
Hill, Martha S.; And Others
1996-01-01
Identified a number of risk factors contributing to early household formation. Found that for girls, factors included mother's educational level and birth order; for boys, parental divorce at any stage of childhood. Risk factors common to boys and girls were age of mother at time of child's birth and race. (HTH)
Directory of Open Access Journals (Sweden)
Redactie KITLV
1953-04-01
Full Text Available - G.J. Held, P.E. de Josselin de Jong, Minangkabau and Negri Sembilan; Socio-political structure in Indonesia, 1951, PhD thesis, Leiden, viii + 208 pp. H.Th. Fischer, C. Nooteboom, Trois problèmes d'ethnologie maritime, 1952, Rotterdam: Museum van Land- en Volkenkunde, 25 figuren.
Dunham, Diane
1995-01-01
Outlines a minicourse for the middle level, intended as a foundation for planning courses that meet the unique needs of each school and its students. The course, on the properties of silver, covers the curricular areas of science, social studies, language arts, math, creative arts, and vocational-career education. (HTH)
Teaching the 'A' Level Text: Emma.
Huband, David
1987-01-01
Notes how important it is that any critical writing assignments should take into account the individual reading, and that the teacher's role is to steer discussion that stems from a class of individual readings. Explores some of the aspects of Jane Austen's novel "Emma" to which students readily respond. (HTH)
News Values and the Vividness of Information.
Kennamer, J. David
Most journalism textbooks begin with lists of what have been called "news values." These are criteria to be used to judge the newsworthiness of issues, events, and persons. The list of news values that most journalists have memorized can be replaced with a single concept--vividness. Vividness is a characteristic of the information…
Children Today, 1994
1994-01-01
Notes that our capacity to diffuse conflict rests in our ability to recognize and verbalize feelings, develop empathy, and think of alternatives to violence. Explores the influence of role models and culture on violence and how the media can use violent images effectively in helping us confront a culture of violence. (HTH)
Brandou, Julian R.
1982-01-01
Suggests public relations strategies which science educators can adopt to spread the word about the importance of good science teaching. These include preparing a fact sheet summarizing a project/course/organization, tips on creating a newsworthy event (awards, displays at a mall, and others), and what to submit to the news media. (Author/JN)
Tritium removal using vanadium hydride
International Nuclear Information System (INIS)
Hill, F.B.; Wong, Y.W.; Chan, Y.N.
1978-01-01
The results of an initial examination of the feasibility of separation of tritium from gaseous protium-tritium mixtures using vanadium hydride in cyclic processes is reported. Interest was drawn to the vanadium-hydrogen system because of the so-called inverse isotope effect exhibited by this system. Thus the tritide is more stable than the protide, a fact which makes the system attractive for removal of tritium from a mixture in which the light isotope predominates. The initial results of three phases of the research program are reported, dealing with studies of the equilibrium and kinetics properties of isotope exchange, development of an equilibrium theory of isotope separation via heatless adsorption, and experiments on the performance of a single heatless adsorption stage. In the equilibrium and kinetics studies, measurements were made of pressure-composition isotherms, the HT--H 2 separation factors and rates of HT--H 2 exchange. This information was used to evaluate constants in the theory and to understand the performance of the heatless adsorption experiments. A recently developed equilibrium theory of heatless adsorption was applied to the HT--H 2 separation using vanadium hydride. Using the theory it was predicted that no separation would occur by pressure cycling wholly within the β phase but that separation would occur by cycling between the β and γ phases and using high purge-to-feed ratios. Heatless adsorption experiments conducted within the β phase led to inverse separations rather than no separation. A kinetic isotope effect may be responsible. Cycling between the β and γ phases led to separation but not to the predicted complete removal of HT from the product stream, possibly because of finite rates of exchange. Further experimental and theoretical work is suggested which may ultimately make possible assessment of the feasibility and practicability of hydrogen isotope separation by this approach
Shelf-Life of Chlorine Solutions Recommended in Ebola Virus Disease Response.
Directory of Open Access Journals (Sweden)
Qais Iqbal
Full Text Available In Ebola Virus Disease (EVD outbreaks, it is widely recommended to wash living things (handwashing with 0.05% (500 mg/L chlorine solution and non-living things (surfaces, personal protective equipment, dead bodies with 0.5% (5,000 mg/L chlorine solution. Chlorine solutions used in EVD response are primarily made from powdered calcium hypochlorite (HTH, granular sodium dichloroisocyanurate (NaDCC, and liquid sodium hypochlorite (NaOCl, and have a pH range of 5-11. Chlorine solutions degrade following a reaction highly dependent on, and unusually sensitive to, pH, temperature, and concentration. We determined the shelf-life of 0.05% and 0.5% chlorine solutions used in EVD response, including HTH, NaDCC, stabilized NaOCl, generated NaOCl, and neutralized NaOCl solutions. Solutions were stored for 30 days at 25, 30, and 35°C, and tested daily for chlorine concentration and pH. Maximum shelf-life was defined as days until initial concentration fell to 30 days. Models were developed for solutions with maximum shelf-lives between 1-30 days. Extrapolating to 40°C, the maximum predicted shelf-life for 0.05% and 0.5% NaDCC solutions were 0.38 and 0.82 hours, respectively; predicted shelf-life for 0.05% and 0.5% generated NaOCl solutions were >30 and 5.4 days, respectively. Each chlorine solution type offers advantages and disadvantages to responders, as: NaDCC is an easy-to-import high-concentration effervescent powder; HTH is similar, but forms a precipitate that may clog pipes; and, NaOCl solutions can be made locally, but are difficult to transport. We recommend responders chose the most appropriate source chlorine compound for their use, and ensure solutions are stored at appropriate temperatures and used or replaced before expiring.
International Nuclear Information System (INIS)
Wright, T.
1983-01-01
Consider a stratified population with L strata, so that a Poisson random variable is associated with each stratum. The parameter associated with the hth stratum is theta/sub h/, h = 1, 2, ..., L. Let ω/sub h/ be the known proportion of the population in the hth stratum, h = 1, 2, ..., L. The authors want to estimate the parameter theta = summation from h = 1 to L ω/sub h/theta/sub h/. We assume that prior information is available on theta/sub h/ and that it can be expressed in terms of a gamma distribution with parameters α/sub h/ and β/sub h/, h = 1, 2, ..., L. We also assume that the prior distributions are independent. Using squared error loss function, a Bayes allocation of total sample size with a cost constraint is given. The Bayes estimate using the Bayes allocation is shown to have an adjusted mean square error which is strictly less than the adjusted mean square error of the classical estimate using the classical allocation
Advertising and Invasion of Privacy.
Rohrer, Daniel Morgan
The right of privacy as it relates to advertising and the use of a person's name or likeness is discussed in this paper. After an introduction that traces some of the history of invasion of privacy in court decisions, the paper examines cases involving issues such as public figures and newsworthy items, right of privacy waived, right of privacy…
Toomela, Aaro, Ed.; Kikas, Eve, Ed.
2012-01-01
The Soviet Union collapsed more than 20 years ago, but the traces left in occupied countries by this monstrous system still affect the lives of millions of people. Under the glittering surface of newsworthy events that regularly appear in the mass media, there are many other wounds hard to heal. The system of education is one of the social…
Looking for ripples in the pond
Thompson, B
2003-01-01
The media coverage of the WSIS in developed countries has been low maybe because the outcomes - declaration and action plan - have been disappointingly un-newsworthy. But perhaps the real benefits gained from the summit will become evident in the new collaborations and alliances that will come about from the face to face contact it facilitated (3 pages)
Directory of Open Access Journals (Sweden)
María Eugenia Conforti
2016-01-01
Full Text Available The circulation of archaeological knowledge through local media contributes to the visibility and social significance of the discipline. In this sense, the media are considered to be non-formal education spaces due to their influence on the public. This communication is mediated by journalists, who are considered key actors. In this paper their opinions and perceptions are analyzed in relation to archeology and archaeological heritage in the city of Olavarria, Buenos Aires province, Argentina. The 'newsworthiness' potential of this information is also discussed. Interviews with journalists have allowed showing their lack of scientific knowledge and heritage awareness. Both aspects generate a stereotyped view of the past with no links with the present, which justify its exclusion from the media agenda. Nevertheless, there is a shared responsibility between archaeologists and journalists in order to find engaging ways to provide information. Taking the general lack of knowledge concerning the past as a starting point to give 'newsworthiness' to scientific information may promote a positive change, provide a better understanding of its value and contribute to form committed and sensitive citizens with their social and cultural contexts.
Media coverage of celebrity DUIs: teachable moments or problematic social modeling?
Smith, Katherine Clegg; Twum, Denise; Gielen, Andrea Carlson
2009-01-01
Alcohol in the media influences norms around use, particularly for young people. A recent spate of celebrity arrests for drinking and driving (DUI) has received considerable media attention. We asked whether these newsworthy events serve as teachable moments or problematic social modeling for young women. Qualitative analysis of US media coverage of four female celebrities (Michelle Rodriguez, Paris Hilton, Nicole Richie and Lindsay Lohan) was conducted over the year following their DUI arrest (December 2005 through June 2008). The media sample included five television and three print sources and resulted in 150 print and 16 television stories. Stories were brief, episodic and focused around glamorous celebrity images. They included routine discussion of the consequences of the DUI for the individual celebrities without much evidence of a consideration of the public health dimensions of drinking and driving or possible prevention measures. Our analysis found little material in the media coverage that dealt with preventing injury or promoting individual and collective responsibility for ensuring such protection. Media attention to such newsworthy events is a missed opportunity that can and should be addressed through media advocacy efforts.
Indian Academy of Sciences (India)
notes the total capital available for the survey, Co the over- head cost, Ch the cost of surveying a unit in the hth stratum and nh the number of units surveyed in the ... optimal allocation in the remaining strata by taking n -. Ej=l N hi as the sample size. It is shown below that a similar situation may also arise under the setup (ti).
Directory of Open Access Journals (Sweden)
Marlene K Wolfe
Full Text Available To prevent disease transmission, 0.05% chlorine solution is commonly recommended for handwashing in Ebola Treatment Units. In the 2014 West Africa outbreak this recommendation was widely extended to community settings, although many organizations recommend soap and hand sanitizer over chlorine. To evaluate skin irritation caused by frequent handwashing that may increase transmission risk in Ebola-affected communities, we conducted a randomized trial with 91 subjects who washed their hands 10 times a day for 28 days. Subjects used soap and water, sanitizer, or one of four chlorine solutions used by Ebola responders (calcium hypochlorite (HTH, sodium dichloroisocyanurate (NaDCC, and generated or pH-stabilized sodium hypochlorite (NaOCl. Outcomes were self-reported hand feel, irritation as measured by the Hand Eczema Score Index (HECSI (range 0-360, signs of transmission risk (e.g., cracking, and dermatitis diagnosis. All groups experienced statistically significant increases in HECSI score. Subjects using sanitizer had the smallest increases, followed by higher pH chlorine solutions (HTH and stabilized NaOCl, and soap and water. The greatest increases were among neutral pH chlorine solutions (NaDCC and generated NaOCl. Signs of irritation related to higher transmission risk were observed most frequently in subjects using soap and least frequently by those using sanitizer or HTH. Despite these irritation increases, all methods represented minor changes in HECSI score. Average HECSI score was only 9.10 at endline (range 1-33 and 4% (4/91 of subjects were diagnosed with dermatitis, one each in four groups. Each handwashing method has benefits and drawbacks: soap is widely available and inexpensive, but requires water and does not inactivate the virus; sanitizer is easy-to use and effective but expensive and unacceptable to many communities, and chlorine is easy-to-use but difficult to produce properly and distribute. Overall, we recommend Ebola
Wolfe, Marlene K; Wells, Emma; Mitro, Brittany; Desmarais, Anne Marie; Scheinman, Pamela; Lantagne, Daniele
2016-01-01
To prevent disease transmission, 0.05% chlorine solution is commonly recommended for handwashing in Ebola Treatment Units. In the 2014 West Africa outbreak this recommendation was widely extended to community settings, although many organizations recommend soap and hand sanitizer over chlorine. To evaluate skin irritation caused by frequent handwashing that may increase transmission risk in Ebola-affected communities, we conducted a randomized trial with 91 subjects who washed their hands 10 times a day for 28 days. Subjects used soap and water, sanitizer, or one of four chlorine solutions used by Ebola responders (calcium hypochlorite (HTH), sodium dichloroisocyanurate (NaDCC), and generated or pH-stabilized sodium hypochlorite (NaOCl)). Outcomes were self-reported hand feel, irritation as measured by the Hand Eczema Score Index (HECSI) (range 0-360), signs of transmission risk (e.g., cracking), and dermatitis diagnosis. All groups experienced statistically significant increases in HECSI score. Subjects using sanitizer had the smallest increases, followed by higher pH chlorine solutions (HTH and stabilized NaOCl), and soap and water. The greatest increases were among neutral pH chlorine solutions (NaDCC and generated NaOCl). Signs of irritation related to higher transmission risk were observed most frequently in subjects using soap and least frequently by those using sanitizer or HTH. Despite these irritation increases, all methods represented minor changes in HECSI score. Average HECSI score was only 9.10 at endline (range 1-33) and 4% (4/91) of subjects were diagnosed with dermatitis, one each in four groups. Each handwashing method has benefits and drawbacks: soap is widely available and inexpensive, but requires water and does not inactivate the virus; sanitizer is easy-to use and effective but expensive and unacceptable to many communities, and chlorine is easy-to-use but difficult to produce properly and distribute. Overall, we recommend Ebola responders and
Is the Army Communicating Effectively in Today’s Information Environment
2013-03-01
Associated Press.6 The source is likely a freelance reporter or an average citizen, snapping photos and video of newsworthy events on a 4 cell...required to perform include writing summary stories, shooting videos, taking photos, updating web content, conducting question and answer sessions with...situation before the military arrives, and with a unit 13 until the last troop has departed, will likely be a freelance or local national
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Limited partnerships, limited liability partnerships..., limited liability partnerships, limited liability companies, corporations, and other similar legal entities. (a) A limited partnership, limited liability partnership, limited liability company, corporation...
Directory of Open Access Journals (Sweden)
Ram Prakash Gupta
2017-11-01
Full Text Available During animal development, selector genes determine identities of body segments and those of individual organs. Selector genes are also misexpressed in cancers, although their contributions to tumor progression per se remain poorly understood. Using a model of cooperative tumorigenesis, we show that gain of selector genes results in tumor cooperation, but in only select developmental domains of the wing, haltere and eye-antennal imaginal discs of Drosophila larva. Thus, the field selector, Eyeless (Ey, and the segment selector, Ultrabithorax (Ubx, readily cooperate to bring about neoplastic transformation of cells displaying somatic loss of the tumor suppressor, Lgl, but in only those developmental domains that express the homeo-box protein, Homothorax (Hth, and/or the Zinc-finger protein, Teashirt (Tsh. In non-Hth/Tsh-expressing domains of these imaginal discs, however, gain of Ey in lgl− somatic clones induces neoplastic transformation in the distal wing disc and haltere, but not in the eye imaginal disc. Likewise, gain of Ubx in lgl− somatic clones induces transformation in the eye imaginal disc but not in its endogenous domain, namely, the haltere imaginal disc. Our results reveal that selector genes could behave as tumor drivers or inhibitors depending on the tissue contexts of their gains.
Kelley Reinsmith-Jones; James F. Anderson; Adam H. Langsam
2015-01-01
Newsmaking criminology argues that criminologists should interpret, influence, and even shape the direction of newsworthy information about crime and justice to the extent that they aggressively make their presence known by engaging the media. This article calls for an expansion in the practice of newsmaking criminology to also include criminal justicians, as well as social workers when it comes to the issue of school violence. Recently, a number of shootings have occurred on school campuses ...
Irradiation-assisted stress corrosion cracking of HTH Alloy X-750 and Alloy 625
International Nuclear Information System (INIS)
Bajaj, R.; Mills, W.J.; Lebo, M.R.; Hyatt, B.Z.; Burke, M.G.
1995-01-01
In-reactor testing of bolt-loaded compact tension specimens was performed in 360 C water. New data confirms previous results that high irradiation levels reduce SCC resistance in Alloy X-750. Low boron heats show improved IASCC (irradiation-assisted stress corrosion cracking). Alloy 625 is resistant to IASCC. Microstructural, microchemical, and deformation studies were carried out. Irradiation of X-750 caused significant strengthening and ductility loss associated with formation of cavities and dislocation loops. High irradiation did not cause segregation in X-750. Irradiation of 625 resulted in formation of small dislocation loops and a fine body-centered-orthorhombic phase. The strengthening due to loops and precipitates was apparently offset in 625 by partial dissolution of γ precipitates. Transmutation of boron to helium at grain boundaries, coupled with matrix strengthening, is believed to be responsible for IASCC in X-750, and the absence of these two effects results in superior IASCC resistance in 625
1984-01-01
350 STATE TOTAL 377 NEBRASKA ARMY TRACTORS WHEELED 111 CONTRACTOR TOTAL 488 PINE BUSH EQUIPMENT CO INC NEW YORK ARMY TRACTORS WHEELED 49 PSI MOBILE...ARMY VEHICULAR FURNITURE AND ACCESSORIES 48- AURORA CORD a CABLE CO INC ILLINOIS ARMY VEHICULAR FURNITURE AND ACCESSORIES 211 BARREN RV MTL HTH/MTL...MICHIGAN ARMY VEHICULAR BRAKE STEERING AXLE WHEEL COMP 702 PENN ARMY VEHICULAR BRAKE STEERING AXLE WHEEL COMP 32 CONTRACTOR TOTAL 734 RYAN CHRYSLER PLYMOUTH
Extraction of unexpected rules from Twitter hashtags and its application to sport events
Adedoyin-Olowe, Mariam; Gaber, Mohamed Medhat; Dancausa, Carlos Martin; Stahl, Frederic
2014-01-01
Twitter has become a dependable microblogging tool for real time information dissemination and newsworthy events broadcast. Its users sometimes break news on the network faster than traditional newsagents due to their presence at ongoing real life events at most times. Different topic detection methods are currently used to match Twitter posts to real life news of mainstream media. In this paper, we analyse tweets relating to the English FA Cup finals 2012 by applying our novel method named T...
Directory of Open Access Journals (Sweden)
Stafford Randall S
2006-09-01
Full Text Available Abstract Background Case management has emerged as a promising alternative approach to supplement traditional one-on-one sessions between patients and doctors for improving the quality of care in chronic diseases such as coronary heart disease (CHD. However, data are lacking in terms of its efficacy and cost-effectiveness when implemented in ethnic and low-income populations. Methods The Stanford and San Mateo Heart to Heart (HTH project is a randomized controlled clinical trial designed to rigorously evaluate the efficacy and cost-effectiveness of a multi-risk cardiovascular case management program in low-income, primarily ethnic minority patients served by a local county health care system in California. Randomization occurred at the patient level. The primary outcome measure is the absolute CHD risk over 10 years. Secondary outcome measures include adherence to guidelines on CHD prevention practice. We documented the study design, methodology, and baseline sociodemographic, clinical and lifestyle characteristics of 419 participants. Results We achieved equal distributions of the sociodemographic, biophysical and lifestyle characteristics between the two randomization groups. HTH participants had a mean age of 56 years, 63% were Latinos/Hispanics, 65% female, 61% less educated, and 62% were not employed. Twenty percent of participants reported having a prior cardiovascular event. 10-year CHD risk averaged 18% in men and 13% in women despite a modest low-density lipoprotein cholesterol level and a high on-treatment percentage at baseline. Sixty-three percent of participants were diagnosed with diabetes and an additional 22% had metabolic syndrome. In addition, many participants had depressed high-density lipoprotein (HDL cholesterol levels and elevated values of total cholesterol-to-HDL ratio, triglycerides, triglyceride-to-HDL ratio, and blood pressure. Furthermore, nearly 70% of participants were obese, 45% had a family history of CHD or
Cooperative interactions between paired domain and homeodomain.
Jun, S; Desplan, C
1996-09-01
The Pax proteins are a family of transcriptional regulators involved in many developmental processes in all higher eukaryotes. They are characterized by the presence of a paired domain (PD), a bipartite DNA binding domain composed of two helix-turn-helix (HTH) motifs,the PAI and RED domains. The PD is also often associated with a homeodomain (HD) which is itself able to form homo- and hetero-dimers on DNA. Many of these proteins therefore contain three HTH motifs each able to recognize DNA. However, all PDs recognize highly related DNA sequences, and most HDs also recognize almost identical sites. We show here that different Pax proteins use multiple combinations of their HTHs to recognize several types of target sites. For instance, the Drosophila Paired protein can bind, in vitro, exclusively through its PAI domain, or through a dimer of its HD, or through cooperative interaction between PAI domain and HD. However, prd function in vivo requires the synergistic action of both the PAI domain and the HD. Pax proteins with only a PD appear to require both PAI and RED domains, while a Pax-6 isoform and a new Pax protein, Lune, may rely on the RED domain and HD. We propose a model by which Pax proteins recognize different target genes in vivo through various combinations of their DNA binding domains, thus expanding their recognition repertoire.
News Media and the Öresund Region
DEFF Research Database (Denmark)
Falkheimer, Jesper; Ørsten, Mark; Eberholst, Mads Kæmsgaard
2017-01-01
Europeanisation, in other words, of the potential for increased communication linkages in news media content among European Union (EU) member states. We investigate this topic by analysing news content published by selected media outlets from 2002 to 2012 and by interviewing Danish and Swedish journalists who...... cover the region. We find that most news content does not mention the Öresund region, and that one reason for this lack might be that neither Danish nor Swedish reporters consider the region to be newsworthy....
International Nuclear Information System (INIS)
Glashow, S.L.
1976-01-01
These are scattered remarks concerning what is happening to (not in) elementary particle physics. New developments are unfolding with unprecedented speed, so that one does not even attempt to give a comprehensive review at this time. Mostly charm is discussed, both its phenomenology and its impact on belief in quarks, chromodynamics, and unified theories. Beneath the newsworthy experimental discoveries of the last two years lies a quieter and more profound theoretical development: the emergence of a theory of particle physics
Limits on fundamental limits to computation.
Markov, Igor L
2014-08-14
An indispensable part of our personal and working lives, computing has also become essential to industries and governments. Steady improvements in computer hardware have been supported by periodic doubling of transistor densities in integrated circuits over the past fifty years. Such Moore scaling now requires ever-increasing efforts, stimulating research in alternative hardware and stirring controversy. To help evaluate emerging technologies and increase our understanding of integrated-circuit scaling, here I review fundamental limits to computation in the areas of manufacturing, energy, physical space, design and verification effort, and algorithms. To outline what is achievable in principle and in practice, I recapitulate how some limits were circumvented, and compare loose and tight limits. Engineering difficulties encountered by emerging technologies may indicate yet unknown limits.
Partnerships – Limited partnerships and limited liability limited partnerships
Henning, Johan J.
2000-01-01
Consideration of the Limited Liability Partnership Act 2000 which introduced a new corporate entity, carrying the designations “partnership” and “limited” which allow members to limit their liability whilst organising themselves internally as a partnership. Article by Professor Johan Henning (Director of the Centre for Corporate Law and Practice, IALS and Dean of the Faculty of Law, University of the Free State, South Africa). Published in Amicus Curiae - Journal of the Institute of Advanced ...
The limitation and modification of flux-limited diffusion theory
International Nuclear Information System (INIS)
Liu Chengan; Huang Wenkai
1986-01-01
The limitation of various typical flux-limited diffusion theory and advantages of asymptotic diffusion theory with time absorption constant are analyzed and compared. The conclusions are as following: Though the flux-limited problem in neutron diffusion theory are theoretically solved by derived flux-limited diffusion equation, it's going too far to limit flux due to the inappropriate assumption in deriving flux-limited diffusion equation. The asymptotic diffusion theory with time absorption constant has eliminated the above-mentioned limitation, and it is more accurate than flux-limited diffusion theory in describing neutron transport problem
2016-07-01
possible, the site around the wash stations is graded to allow the wash water to run off to a pit, where it can seep into the earth or be collected...Caustic soda solution Radioisotopes /Nuclear Residuals Soap with warm water DS2 = Decontamination Solution 2 STB = Super Tropical bleach HTH = High... DATE (DD-MM-YYYY) 2. REPORT TYPE 3. DATES COVERED (From - To) 4. TITLE AND SUBTITLE 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER
Energy Technology Data Exchange (ETDEWEB)
Loescher, D.H. [Sandia National Labs., Albuquerque, NM (United States). Systems Surety Assessment Dept.; Noren, K. [Univ. of Idaho, Moscow, ID (United States). Dept. of Electrical Engineering
1996-09-01
The current that flows between the electrical test equipment and the nuclear explosive must be limited to safe levels during electrical tests conducted on nuclear explosives at the DOE Pantex facility. The safest way to limit the current is to use batteries that can provide only acceptably low current into a short circuit; unfortunately this is not always possible. When it is not possible, current limiters, along with other design features, are used to limit the current. Three types of current limiters, the fuse blower, the resistor limiter, and the MOSFET-pass-transistor limiters, are used extensively in Pantex test equipment. Detailed failure mode and effects analyses were conducted on these limiters. Two other types of limiters were also analyzed. It was found that there is no best type of limiter that should be used in all applications. The fuse blower has advantages when many circuits must be monitored, a low insertion voltage drop is important, and size and weight must be kept low. However, this limiter has many failure modes that can lead to the loss of over current protection. The resistor limiter is simple and inexpensive, but is normally usable only on circuits for which the nominal current is less than a few tens of milliamperes. The MOSFET limiter can be used on high current circuits, but it has a number of single point failure modes that can lead to a loss of protective action. Because bad component placement or poor wire routing can defeat any limiter, placement and routing must be designed carefully and documented thoroughly.
Beam-limiting and radiation-limiting interlocks
International Nuclear Information System (INIS)
Macek, R.J.
1996-01-01
This paper reviews several aspects of beam-limiting and radiation- limiting interlocks used for personnel protection at high-intensity accelerators. It is based heavily on the experience at the Los Alamos Neutron Science Center (LANSCE) where instrumentation-based protection is used extensively. Topics include the need for ''active'' protection systems, system requirements, design criteria, and means of achieving and assessing acceptable reliability. The experience with several specific devices (ion chamber-based beam loss interlock, beam current limiter interlock, and neutron radiation interlock) designed and/or deployed to these requirements and criteria is evaluated
Material limitations on the detection limit in refractometry.
Skafte-Pedersen, Peder; Nunes, Pedro S; Xiao, Sanshui; Mortensen, Niels Asger
2009-01-01
We discuss the detection limit for refractometric sensors relying on high-Q optical cavities and show that the ultimate classical detection limit is given by min {Δn} ≳ η, with n + iη being the complex refractive index of the material under refractometric investigation. Taking finite Q factors and filling fractions into account, the detection limit declines. As an example we discuss the fundamental limits of silicon-based high-Q resonators, such as photonic crystal resonators, for sensing in a bio-liquid environment, such as a water buffer. In the transparency window (λ ≳ 1100 nm) of silicon the detection limit becomes almost independent on the filling fraction, while in the visible, the detection limit depends strongly on the filling fraction because the silicon absorbs strongly.
Material Limitations on the Detection Limit in Refractometry
Directory of Open Access Journals (Sweden)
Niels Asger Mortensen
2009-10-01
Full Text Available We discuss the detection limit for refractometric sensors relying on high-Q optical cavities and show that the ultimate classical detection limit is given by min {Δn} ≳ η with n + iη being the complex refractive index of the material under refractometric investigation. Taking finite Q factors and filling fractions into account, the detection limit declines. As an example we discuss the fundamental limits of silicon-based high-Q resonators, such as photonic crystal resonators, for sensing in a bio-liquid environment, such as a water buffer. In the transparency window (λ ≳ 1100 nm of silicon the detection limit becomes almost independent on the filling fraction, while in the visible, the detection limit depends strongly on the filling fraction because the silicon absorbs strongly.
Energia nuclear na mídia: Jornalismo científico em portais de notícias nacionais
Directory of Open Access Journals (Sweden)
Ricardo Henrique Almeida Dias
2017-07-01
Full Text Available This study seeks to examine how the nuclear energy is conveyed by the news media. We used the newsworthiness criteria in journalistic discourse to analyse some science journalism texts on nuclear energy in Brazilian news websites. We selected some news and classified using news values such as conflict, proximity, novelty and relevance. We concluded that nuclear energy is conveyed by the media in a way that the advantages and disadvantages were discussed, and news values were useful to point how all these arguments worked.
Material Limitations on the Detection Limit in Refractometry
Skafte-Pedersen, Peder; Nunes, Pedro S.; Xiao, Sanshui; Mortensen, Niels Asger
2009-01-01
We discuss the detection limit for refractometric sensors relying on high-Q optical cavities and show that the ultimate classical detection limit is given by min {Δn} ≳ η with n + iη being the complex refractive index of the material under refractometric investigation. Taking finite Q factors and filling fractions into account, the detection limit declines. As an example we discuss the fundamental limits of silicon-based high-Q resonators, such as photonic crystal resonators, for sensing in a...
A Model of the Spatio-temporal Dynamics of Drosophila Eye Disc Development.
Fried, Patrick; Sánchez-Aragón, Máximo; Aguilar-Hidalgo, Daniel; Lehtinen, Birgitta; Casares, Fernando; Iber, Dagmar
2016-09-01
Patterning and growth are linked during early development and have to be tightly controlled to result in a functional tissue or organ. During the development of the Drosophila eye, this linkage is particularly clear: the growth of the eye primordium mainly results from proliferating cells ahead of the morphogenetic furrow (MF), a moving signaling wave that sweeps across the tissue from the posterior to the anterior side, that induces proliferating cells anterior to it to differentiate and become cell cycle quiescent in its wake. Therefore, final eye disc size depends on the proliferation rate of undifferentiated cells and on the speed with which the MF sweeps across the eye disc. We developed a spatio-temporal model of the growing eye disc based on the regulatory interactions controlled by the signals Decapentaplegic (Dpp), Hedgehog (Hh) and the transcription factor Homothorax (Hth) and explored how the signaling patterns affect the movement of the MF and impact on eye disc growth. We used published and new quantitative data to parameterize the model. In particular, two crucial parameter values, the degradation rate of Hth and the diffusion coefficient of Hh, were measured. The model is able to reproduce the linear movement of the MF and the termination of growth of the primordium. We further show that the model can explain several mutant phenotypes, but fails to reproduce the previously observed scaling of the Dpp gradient in the anterior compartment.
A Model of the Spatio-temporal Dynamics of Drosophila Eye Disc Development.
Directory of Open Access Journals (Sweden)
Patrick Fried
2016-09-01
Full Text Available Patterning and growth are linked during early development and have to be tightly controlled to result in a functional tissue or organ. During the development of the Drosophila eye, this linkage is particularly clear: the growth of the eye primordium mainly results from proliferating cells ahead of the morphogenetic furrow (MF, a moving signaling wave that sweeps across the tissue from the posterior to the anterior side, that induces proliferating cells anterior to it to differentiate and become cell cycle quiescent in its wake. Therefore, final eye disc size depends on the proliferation rate of undifferentiated cells and on the speed with which the MF sweeps across the eye disc. We developed a spatio-temporal model of the growing eye disc based on the regulatory interactions controlled by the signals Decapentaplegic (Dpp, Hedgehog (Hh and the transcription factor Homothorax (Hth and explored how the signaling patterns affect the movement of the MF and impact on eye disc growth. We used published and new quantitative data to parameterize the model. In particular, two crucial parameter values, the degradation rate of Hth and the diffusion coefficient of Hh, were measured. The model is able to reproduce the linear movement of the MF and the termination of growth of the primordium. We further show that the model can explain several mutant phenotypes, but fails to reproduce the previously observed scaling of the Dpp gradient in the anterior compartment.
Thermodynamic limit for coherence-limited solar power conversion
Mashaal, Heylal; Gordon, Jeffrey M.
2014-09-01
The spatial coherence of solar beam radiation is a key constraint in solar rectenna conversion. Here, we present a derivation of the thermodynamic limit for coherence-limited solar power conversion - an expansion of Landsberg's elegant basic bound, originally limited to incoherent converters at maximum flux concentration. First, we generalize Landsberg's work to arbitrary concentration and angular confinement. Then we derive how the values are further lowered for coherence-limited converters. The results do not depend on a particular conversion strategy. As such, they pertain to systems that span geometric to physical optics, as well as classical to quantum physics. Our findings indicate promising potential for solar rectenna conversion.
Penser aux/les limites de nos limites
Directory of Open Access Journals (Sweden)
Jacques Lévy
2010-12-01
Full Text Available Le mot « frontière » a beaucoup de succès, dans son sens propre mais plus encore comme métaphore d’une multitude de réalités qui ont à voir avec les limites, c’est-à-dire avec notre propension à découper le monde en objets séparables. Mais on constate une grande indétermination entre concept et métaphore et un usage trop facile de mélanges entre ceux-ci. Il faut donc d’abord admettre que la matérialité n’est qu’une des composantes de notre monde, mais que l’immatériel n’est pas l’irréel, le simulé ou le métaphorique. Après un détour par une théorie des limites et ses limites et une distinction entre le topographique (continu et le topologique (discontinu appliquée à l’intérieur et aux limites d’une aire, deux exemples sont développés qui visent à montrer que, si l’on trouve des frontières, ce n’est pas forcément là où on les attend et que l’appréciation juste de la place des frontières suppose la prise en compte de bien d’autres considérations que la seule limitation volontaire et brutale du franchissement d’une ligne imaginaire tracée au sol.Think about limits and the limits of our limitsThe word “boundary” has been very successful in its literal sense but even more so as a metaphor of a multitude of realities involving limits, that is, with regards to our tendency to divide the world into separable objects. However, one can observe a considerable uncertainty between the concept and the metaphor and an utilisation too easy of various mixtures of them. It becomes necessary therefore to first admit that materiality is only one of the components of our world whilst the immaterial is not unreal, simulated or metaphoric. After a detour consisting of examining a theory of limits and its limits and making the distinction between the topographic (continuous and the topologic (discontinuous applied to the interior and the limits of an area, two examples are developed which aim to
ICRF power limitation relation to density limit in ASDEX
International Nuclear Information System (INIS)
Ryter, F.
1992-01-01
Launching high ICRF power into ASDEX plasmas required good antenna-plasma coupling. This could be achieved by sufficient electron density in front of the antennas i.e. small antenna-plasma distance (1-2 cm) and moderate to high line-averaged electron density compared to the density window in ASDEX. These are conditions eventually close to the density limit. ICRF heated discharges terminated by plasma disruptions caused by the RF pulse limited the maximum RF power which can be injected into the plasma. The disruptions occurring in these cases have clear phenomenological similarities with those observed in density limit discharges. We show in this paper that the ICRF-power limitation by plasma disruptions in ASDEX was due to reaching the density limit. (orig.)
ICRF power limitation relation to density limit in ASDEX
International Nuclear Information System (INIS)
Ryter, F.
1992-01-01
Launching high ICRF power into ASDEX plasmas required good antenna-plasma coupling. This could be achieved by sufficient electron density in front of the antennas i.e. small antenna-plasma distance (1-2 cm) and moderate to high line-averaged electron density compared to the density window in ASDEX. These are conditions eventually close to the density limit. ICRF heated discharges terminated by plasma disruptions caused by the RF pulse limited the maximum RF power which can be injected into the plasma. The disruptions occurring in these cases have clear phenomenological similarities with those observed in density limit discharges. We show in this paper that the ICRF-power limitation by plasma disruptions in ASDEX was due to reaching the density limit. (author) 3 refs., 3 figs
International Nuclear Information System (INIS)
Sapinski, M.
2012-01-01
With thirteen beam induced quenches and numerous Machine Development tests, the current knowledge of LHC magnets quench limits still contains a lot of unknowns. Various approaches to determine the quench limits are reviewed and results of the tests are presented. Attempt to reconstruct a coherent picture emerging from these results is taken. The available methods of computation of the quench levels are presented together with dedicated particle shower simulations which are necessary to understand the tests. The future experiments, needed to reach better understanding of quench limits as well as limits for the machine operation are investigated. The possible strategies to set BLM (Beam Loss Monitor) thresholds are discussed. (author)
International Nuclear Information System (INIS)
Kumar, Raghwendra; Biswas, Debabrata
2008-01-01
For a nonrelativistic electron beam propagating in a cylindrical drift tube, it is shown that the limiting current density does not saturate to the electrostatic one-dimensional (1D) estimate with increasing beam radius. Fully electromagnetic particle-in-cell (PIC) simulation studies show that beyond a critical aspect ratio, the limiting current density is lower than the 1D electrostatic prediction. The lowering in the limiting current density is found to be due to the transition from the space charge limited to magnetically limited flow. An adaptation of Alfven's single particle trajectory method is used to estimate the magnetically limited current as well as the critical radius beyond which the flow is magnetically limited in a drift tube. The predictions are found to be in close agreement with PIC simulations
Material limitations on the detection limit in refractometry
DEFF Research Database (Denmark)
Skafte-Pedersen, Peder; Nunes, Pedro; Xiao, Sanshui
2009-01-01
We discuss the detection limit for refractometric sensors relying on high-Q optical cavities and show that the ultimate classical detection limit is given by min {Δn} ≳ η with n + iη being the complex refractive index of the material under refractometric investigation. Taking finite Q factors and...
Liu, Xi; Dai, Fangyin; Guo, Enen; Li, Kang; Ma, Li; Tian, Ling; Cao, Yang; Zhang, Guozheng; Palli, Subba R; Li, Sheng
2015-11-06
As revealed in a previous microarray study to identify genes regulated by 20-hydroxyecdysone (20E) and juvenile hormone (JH) in the silkworm, Bombyx mori, E93 expression in the fat body was markedly low prior to the wandering stage but abundant during larval-pupal metamorphosis. Induced by 20E and suppressed by JH, E93 expression follows this developmental profile in multiple silkworm alleles. The reduction of E93 expression by RNAi disrupted 20E signaling and the 20E-induced autophagy, caspase activity, and cell dissociation in the fat body. Reducing E93 expression also decreased the expression of the 20E-induced pupal-specific cuticle protein genes and prevented growth and differentiation of the wing discs. Importantly, the two HTH domains in E93 are critical for inducing the expression of a subset of 20E response genes, including EcR, USP, E74, Br-C, and Atg1. By contrast, the LLQHLL and PLDLSAK motifs in E93 inhibit its transcriptional activity. E93 binds to the EcR-USP complex via a physical association with USP through its LLQHLL motif; and this association is enhanced by 20E-induced EcR-USP interaction, which attenuates the transcriptional activity of E93. E93 acts through the two HTH domains to bind to GAGA-containing motifs present in the Atg1 promoter region for inducing gene expression. In conclusion, E93 transcriptionally modulates 20E signaling to promote Bombyx larval-pupal metamorphosis. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.
Liu, Xi; Dai, Fangyin; Guo, Enen; Li, Kang; Ma, Li; Tian, Ling; Cao, Yang; Zhang, Guozheng; Palli, Subba R.; Li, Sheng
2015-01-01
As revealed in a previous microarray study to identify genes regulated by 20-hydroxyecdysone (20E) and juvenile hormone (JH) in the silkworm, Bombyx mori, E93 expression in the fat body was markedly low prior to the wandering stage but abundant during larval-pupal metamorphosis. Induced by 20E and suppressed by JH, E93 expression follows this developmental profile in multiple silkworm alleles. The reduction of E93 expression by RNAi disrupted 20E signaling and the 20E-induced autophagy, caspase activity, and cell dissociation in the fat body. Reducing E93 expression also decreased the expression of the 20E-induced pupal-specific cuticle protein genes and prevented growth and differentiation of the wing discs. Importantly, the two HTH domains in E93 are critical for inducing the expression of a subset of 20E response genes, including EcR, USP, E74, Br-C, and Atg1. By contrast, the LLQHLL and PLDLSAK motifs in E93 inhibit its transcriptional activity. E93 binds to the EcR-USP complex via a physical association with USP through its LLQHLL motif; and this association is enhanced by 20E-induced EcR-USP interaction, which attenuates the transcriptional activity of E93. E93 acts through the two HTH domains to bind to GAGA-containing motifs present in the Atg1 promoter region for inducing gene expression. In conclusion, E93 transcriptionally modulates 20E signaling to promote Bombyx larval-pupal metamorphosis. PMID:26378227
Turning Science Results into News
Wanjek, Christopher
2006-09-01
Do you want to get into the New York Times? Aside from writing an angry letter or robbing a bank, getting into the news (with your science result) requires a well-crafted press release. Reaching out to reporters is very different from reaching out to fellow scientists. Scientific significance is not the same as newsworthiness, but many science results can be molded into interesting stories that reporters can relate to their audience. This presentation will present examples of science stories that made it big and some that flopped. We will also examine what makes a story attractive to newspaper and magazine editors.
Directory of Open Access Journals (Sweden)
Laura Valdemarca.
2011-01-01
Full Text Available This article is a case study of how the most important newspaper from the interior of Argentina treats the issue of domestic violence. It is based on a study of primary sources and supported, methodologically, by discourse analysis. The discursive analysis of images related to domestic violence rests on the understanding that the media constructs social representations from a news-worthy criteria. We emphasize the ways in which such a construction supports various widely-entrenched beliefs, making it difficult for readers to go beyond the victim-perpetrator dichotomy and become committed to resolving this social problem.
Paid celebrity endorsement in health promotion: a case study from Australia.
Chapman, S; Leask, J A
2001-12-01
In late 1998, Australian cricketer Shane Warne was allegedly paid A$200 000 ( pound78 060, US$123 000) by a pharmaceutical company to publicize his attempt to stop smoking. Warne failed to stop, and his continuing smoking remained newsworthy more than a year later. The arrangement caused considerable media controversy about the ethics of payment for charitable or socially worthy actions. This paper explores the community's reaction to payment for modelling a healthy behaviour, discussing the values that Warne transgressed and whether these mattered, given that the campaign caused an unprecedented rise in the use of nicotine replacement therapy.
Department of Housing and Urban Development — HOME Income Limits are calculated using the same methodology that HUD uses for calculating the income limits for the Section 8 program. These limits are based on HUD...
Hinnant, Amanda; Oh, Hyun Jee; Caburnay, Charlene A.; Kreuter, Matthew W.
2011-01-01
News stories reporting race-specific health information commonly emphasize disparities between racial groups. But recent research suggests this focus on disparities has unintended effects on African American audiences, generating negative emotions and less interest in preventive behaviors (Nicholson RA, Kreuter MW, Lapka C "et al." Unintended…
Ingram, WT
2012-01-01
Inverse limits provide a powerful tool for constructing complicated spaces from simple ones. They also turn the study of a dynamical system consisting of a space and a self-map into a study of a (likely more complicated) space and a self-homeomorphism. In four chapters along with an appendix containing background material the authors develop the theory of inverse limits. The book begins with an introduction through inverse limits on [0,1] before moving to a general treatment of the subject. Special topics in continuum theory complete the book. Although it is not a book on dynamics, the influen
Albers, Willem/Wim; Kallenberg, W.C.M.; Otten, G.D.
1997-01-01
Because of inaccuracies of the measurement process inspection of manufactured parts requires test limits which are more strict than the given specification limits. Test limits derived under the assumption of normality for product characteristics turn out to violate the prescribed bound on the
International Nuclear Information System (INIS)
Sonnenberg, K.; Deksnis, E.; Shaw, R.; Reiter, D.
1988-01-01
JET plans to install two pump limiter modules which can be used for belt-limiter, inner-wall and X-point discharges and, also, for 1-2s as the main limiter. A design is presented which is compatible with two diagnostic systems, and which allows partial removal of the pump limiter to provide access for remote-handling operations. The high heat-flux components are initially cooled during a pulse. Heat is removed between discharges by radiation and pressure contacts to a water-cooled support structure. The pumping edge will be made of annealed pyrolytic graphite. Exhaust efficiency has been estimated, for a 1-d edge model, using a Monte-Carlo calculation of neutral gas transport. When the pump limiter is operated together with other wall components we expect an efficiency of ≅ 5% (2.5 x 10 21 part/s). As a main limiter the efficiency increases to about 10%. (author)
International Nuclear Information System (INIS)
Ikuta, Kazunari; Miyahara, Akira.
1983-06-01
The concept of the limiter-divertor proposed by Mirnov is extended to a toroidal limiter-divertor (which we call moving toroidal limiter) using the stream of ferromagnetic balls coated with a low Z materials such as plastics, graphite and ceramics. An important advantage of the use of the ferromagnetic materials would be possible soft landing of the balls on a catcher, provided that the temperature of the balls is below Curie point. Moreover, moving toroidal limiter would work as a protector of the first wall not only against the vertical movement of plasma ring but also against the violent inward motion driven by major disruption because the orbit of the ball in the case of moving toroidal limiter distributes over the small major radius side of the toroidal plasma. (author)
International Nuclear Information System (INIS)
Rappaport, S.M.
1993-01-01
The development of exposure limits in the United States has always relied heavily upon the threshold limit values (TLVs) developed by the American Conference of Governmental Industrial Hygienists (ACGIH). In fact, the TLVs were adopted as official exposure limits by the Occupational Safety and Health Administration (OSHA) in 1972 and 1989. Given the continuing importance of the ACGIH limits, this paper compares the basis of the TLVs with that employed by OSHA de novo in its 12 new permissible exposure limits (PELs). Using benzene as an example, it is shown that OSHA's new PELs have been established following a rigorous assessment of the inherent risks and the feasibility of instituting the limit. The TLVs, on the other hand, have been developed by ad hoc procedures and appear to have traditionally reflected levels thought to be achievable at the time. However, this might be changing. Analysis of the historical reductions of TLVs, for 27 substances on the 1991-1992 list of intended changes, indicates smaller reductions in the past (median reduction of 2.0-2.5-fold between 1946 and 1988) compared to those currently being observed (median reduction of 7.5-fold between 1989 and 1991). Further analysis suggests a more aggressive policy of the ACGIH regarding TLVs for carcinogens but not for substances that produce effects other than cancer. Regardless of whether the basis of the TLVs has changed recently, it would take a relatively long time for the impact of any change to be felt, since the median age of the 1991-1992 TLVs is 16.5 years, and 75% of these limits are more than 10 years old. The implications of OSHA's continued reliance on the TLVs as a means of updating its PELs are discussed, and four alternatives are presented to the ACGIH regarding the future of its activities related to exposure limits. It is concluded that new mechanisms are needed for OSHA to update its PELs in a timely fashion so that the TLVs will not be adopted by default in the future
International Nuclear Information System (INIS)
Conn, R.W.
1984-05-01
Recent experiments with a scoop limiter without active internal pumping have been carried out in the PDX tokamak with up to 6MW of auxiliary neutral beam heating. Experiments have also been done with a rotating head pump limiter in the PLT tokamak in conjunction with RF plasma heating. Extensive experiments have been done in the ISX-B tokamak and first experiments have been completed with the ALT-I limiter in TEXTOR. The pump limiter modules in these latter two machines have internal getter pumping. Experiments in ISX-B are with ohmic and auxiliary neutral beam heating. The results in ISX-B and TEXTOR show that active density control and particle removal is achieved with pump limiters. In ISX-B, the boundary layer (or scape-off layer) plasma partially screens the core plasma from gas injection. In both ISX-B and TEXTOR, the pressure internal to the module scales linearly with plasma density but in ISX-B, with neutral beam injection, a nonlinear increase is observed at the highest densities studied. Plasma plugging is the suspected cause. Results from PDX suggest that a region may exist in which core plasma energy confinement improves using a pump limiter during neutral beam injection. Asymmetric radial profiles and an increased edge electron temperature are observed in discharges with improved confinement. The injection of small amounts of neon into ISX-B has more clearly shown an improved electron core energy confinement during neutral beam injection. While carried out with a regular limiter, this Z-mode of operation is ideal for use with pump limiters and should be a way to achieve energy confinement times similar to values for H-mode tokamak plasmas. The implication of all these results for the design of a reactor pump limiter is described
International Nuclear Information System (INIS)
Conn, R.W.; California Univ., Los Angeles
1984-01-01
Recent experiments with a scoop limiter without active internal pumping have been carried out in the PDX tokamak with up to 6 MW of auxiliary neutral beam heating. Experiments have also been performed with a rotating head pump limiter in the PLT tokamak in conjunction with RF plasma heating. Extensive experiments have been done in the ISX-B tokamak and first experiments have been completed with the ALT-I limiter in TEXTOR. The pump limiter modules in these latter two machines have internal getter pumping. Experiments in ISX-B are with ohmic and auxiliary neutral beam heating. The results in ISX-B and TEXTOR show that active density control and particle removal is achieved with pump limiters. In ISX-B, the boundary layer (or scrape-off layer) plasma partially screens the core plasma from gas injection. In both ISX-B and TEXTOR, the pressure internal to the module scales linearly with plasma density but in ISX-B, with neutral beam injection, a nonlinear increase is observed at the highest densities studied. Plasma plugging is the suspected cause. Results from PDX suggest that a regime may exist in which core plasma energy confinement improves using a pump limiter during neutral beam injection. Asymmetric radial profiles and an increased edge electron temperature are observed in discharges with improved confinement. The injection of small amounts of neon into ISX-B has more clearly shown an improved electron core energy confinement during neutral beam injection. While carried out with a regular limiter, this 'Z-mode' of operation is ideal for use with pump limiters and should be a way to achieve energy confinement times similar to values for H-mode tokamak plasmas. The implication of all these results for the design of a reactor pump limiter is described. (orig.)
International Nuclear Information System (INIS)
Fitoussi, L.
1987-12-01
The dose limit is defined to be the level of harmfulness which must not be exceeded, so that an activity can be exercised in a regular manner without running a risk unacceptable to man and the society. The paper examines the effects of radiation categorised into stochastic and non-stochastic. Dose limits for workers and the public are discussed
Energy Technology Data Exchange (ETDEWEB)
Underwood, D. G.
1998-07-13
Every detector has limitations in terms of solid angle, particular technologies chosen, cracks due to mechanical structure, etc. If all of the presently planned parts of STAR [Solenoidal Tracker At RHIC] were in place, these factors would not seriously limit our ability to exploit the spin physics possible in RHIC. What is of greater concern at the moment is the construction schedule for components such as the Electromagnetic Calorimeters, and the limited funding for various levels of triggers.
International Nuclear Information System (INIS)
Mioduszewski, P.K.; Edmonds, P.H.; Sheffield, J.
1982-01-01
Continuous removal of heat and particles becomes a vital necessity in future steady-state fusion devices. The pump limiter seems to be an attractive concept to combine these two tasks. On ISX, various schemes of pump limiters are being explored with the final goal to furnish the ISX--C device with a pump limiter to handle heat removal and particle control in steady state. The emphasis of the present paper is on pump limiters based on ballistic particle collection. If this concept turns out to be successful in supplying sufficient pumping efficiency, it may be possible to design pump limiters without a leading edge. Analytical calculations of the particle collection efficiency are given for various limiter configurations. Pumping efficiencies of approximately 4--10%, depending on the specific configuration, seem to be feasible and should be sufficient for steady-state operation. Initial experimental results on pump limiter studies in ISX--B confirm the calculated collection efficiencies. By measuring the ion saturation current to the limiter blade and the pressure buildup simultaneously, we found a correlation between the incident particle flux and the pressure rise that agrees well with a simple model
International Nuclear Information System (INIS)
Gallegos, F.R.
1996-01-01
The Radiation Security System (RSS) at the Los Alamos Neutron Science Center (LANSCE) provides personnel protection from prompt radiation due to accelerated beam. Active instrumentation, such as the Beam Current Limiter, is a component of the RSS. The current limiter is designed to limit the average current in a beam line below a specific level, thus minimizing the maximum current available for a beam spill accident. The beam current limiter is a self-contained, electrically isolated toroidal beam transformer which continuously monitors beam current. It is designed as fail-safe instrumentation. The design philosophy, hardware design, operation, and limitations of the device are described
Scrape-off layer based modelling of the density limit in beryllated JET limiter discharges
International Nuclear Information System (INIS)
Borrass, K.; Campbell, D.J.; Clement, S.; Vlases, G.C.
1993-01-01
The paper gives a scrape-off layer based interpretation of the density limit in beryllated JET limiter discharges. In these discharges, JET edge parameters show a complicated time evolution as the density limit is approached and the limit is manifested as a non-disruptive density maximum which cannot be exceeded by enhanced gas puffing. The occurrence of Marfes, the manner of density control and details of recycling are essential elements of the interpretation. Scalings for the maximum density are given and compared with JET data. The relation to disruptive density limits, previously observed in JET carbon limiter discharges, and to density limits in divertor discharges is discussed. (author). 18 refs, 10 figs, 1 tab
Preliminary disposal limits, plume interaction factors, and final disposal limits
Energy Technology Data Exchange (ETDEWEB)
Flach, G. [Savannah River Site (SRS), Aiken, SC (United States). Savannah River National Lab. (SRNL)
2018-01-11
In the 2008 E-Area Performance Assessment (PA), each final disposal limit was constructed as the product of a preliminary disposal limit and a plume interaction factor. The following mathematical development demonstrates that performance objectives are generally expected to be satisfied with high confidence under practical PA scenarios using this method. However, radionuclides that experience significant decay between a disposal unit and the 100-meter boundary, such as H-3 and Sr-90, can challenge performance objectives, depending on the disposed-of waste composition, facility geometry, and the significance of the plume interaction factor. Pros and cons of analyzing single disposal units or multiple disposal units as a group in the preliminary disposal limits analysis are also identified.
Altruism and Reproductive Limitations
Directory of Open Access Journals (Sweden)
Carey J. Fitzgerald
2009-04-01
Full Text Available We examined how different types of reproductive limitations — functional (schizoid personality disorder and schizophrenia, physical (malnutrition, and sexual (bisexuality and homosexuality — influenced altruistic intentions toward hypothetical target individuals of differing degrees of relatedness (r = 0, .25, and .50. Participants were 312 undergraduate students who completed a questionnaire on altruism toward hypothetical friends, half-siblings, and siblings with these different types of reproductive limitations. Genetic relatedness and reproductive limitations did not influence altruistic decision-making when the cost of altruism was low but did as the cost of altruism increased, with participants being more likely to help a sibling over a half-sibling and a half-sibling over a friend. Participants also indicated they were more likely to help a healthy (control person over people with a reproductive limitation. Of the three types of reproductive limitations, functional limitations had the strongest effect on altruistic decision-making, indicating that people were less likely to help those who exhibit abnormal social behavior.
Power limit and quality limit of natural circulation reactor
International Nuclear Information System (INIS)
Zhao Guochang; Ma Changwen
1997-01-01
The circulation characteristics of natural circulation reactor in boiling regime are researched. It is found that, the circulation mass flow rate and the power have a peak value at a mass quality respectively. Therefore, the natural circulation reactor has a power limit under certain technological condition. It can not be increased steadily by continually increasing the mass quality. Corresponding to this, the mass quality of natural circulation reactor has a reasonable limit. The relations between the maximum power and the reactor parameters, such as the resistance coefficient, the working pressure and so on, are analyzed. It is pointed out that the power limit of natural circulation reactor is about 1000 MW at present technological condition. Taking the above result and low quality stability experimental result into account, the authors recommend that the reasonable mass quality of natural circulation reactor working in boiling regime is from 2% to 3% under the researched working pressure
Compliance of feed limits, does not mean compliance of food limits
Directory of Open Access Journals (Sweden)
van Raamsdonk LWD.
2009-01-01
Full Text Available The carry-over of contaminants from feed to animal food products is an important aspect of the animal production chain. For a proper containment, limits for feed as well food products are fixed for a series of chemicals, e.g. dioxins and dioxin-like PCBs, lead, cadmium, some chlorinated pesticides, and aflatoxin B1 (and its metabolite M1 in milk. The relationship between feed and food limits is an important issue. An ideal goal is to assure that compliance to a feed limits automatically results in compliance to food limits. In order to collect information about this relationship, several simulation models and a large database on transfer factors have been developed. An optimal choice between either a model or an application of data from the Transfer Database is based on both the knowledge level, and on the circumstances of the specific situation. To reach and validate such an optimal choice an Expert System Carry-Over is currently in development, containing four different modules: 1 the different calculation models and the Transfer Database, 2 a decision tree for choosing the optimal strategy, 3 data tables indicating knowledge levels of compound/animal/product parameters, and 4 supporting databases containing information on consumption and composition of daily diets, animal parameters, and amounts of (daily production. Calculations indicate that for dioxins compliance to feed levels does not necessarily mean that food limits are complied as well. Besides an estimation of the compliance to limits, the expert system is a tool for feed related risk assessments, and for planning of future research.
Liberty through limits: The bill of rights as limited government provisions
Directory of Open Access Journals (Sweden)
Patrick M. Garry
2013-04-01
Full Text Available Under the modern view, individual autonomy has become the primary if not exclusive focus of the Bill of Rights. But the Bill of Rights came about not because of a desire to preserve individual autonomy, nor to insulate the individual from the democratic community. The impetus for the Bill of Rights arose from the same set of concerns that motivated the original Constitution. These concerns involved creating the appropriate structures so as to keep the new central government in check. The Bill of Rights sought to further ensure that the federal government would have limited power and operate in a limited role. Not only does this limited government model coincide with the original intent underlying the Bill of Rights, but it also provides for a more objective and manageable application. Under an individual autonomy view of the Bill of Rights, courts must define the ingredients necessary for such autonomy. However, this endeavor is fraught with ambiguity, and courts must constantly pit the individual against democratic society. But under the limited government model, the judicial role is more objective. Instead of trying to define an ambiguous individual autonomy, courts simply need to focus on whether a particular right is needed so as to maintain limited government. In addition, the limited government model does not put the Bill of Rights in conflict with democratic society. Instead, it just uses the Bill of Rights to maintain a check on government, just as the original Constitution seeks to do.
International Nuclear Information System (INIS)
Mioduszewski, P.K.
1984-01-01
The relevance of this experiment to the JET experiment is described. Data on the following issues are given: (1) thermo-mechanical properties of the Be-limiter; (2) particle flow to limiter; (3) heat flow to the limiter; (4) limiter-plasma-wall interaction; (5) plasma properties/operation; (6) active control of plasma-limiter operation; and (7) fault conditions
International Nuclear Information System (INIS)
2017-01-01
Since 2004, the environment programme of the IAEA has included activities aimed at developing a set of procedures for analytical measurements of radionuclides in food and the environment. Reliable, comparable and fit for purpose results are essential for any analytical measurement. Guidelines and national and international standards for laboratory practices to fulfil quality assurance requirements are extremely important when performing such measurements. The guidelines and standards should be comprehensive, clearly formulated and readily available to both the analyst and the customer. ISO 11929:2010 is the international standard on the determination of the characteristic limits (decision threshold, detection limit and limits of the confidence interval) for measuring ionizing radiation. For nuclear analytical laboratories involved in the measurement of radioactivity in food and the environment, robust determination of the characteristic limits of radioanalytical techniques is essential with regard to national and international regulations on permitted levels of radioactivity. However, characteristic limits defined in ISO 11929:2010 are complex, and the correct application of the standard in laboratories requires a full understanding of various concepts. This publication provides additional information to Member States in the understanding of the terminology, definitions and concepts in ISO 11929:2010, thus facilitating its implementation in Member State laboratories.
DEFF Research Database (Denmark)
Damkilde, Lars
2007-01-01
Limit State analysis has a long history and many prominent researchers have contributed. The theoretical foundation is based on the upper- and lower-bound theorems which give a very comprehensive and elegant formulation on complicated physical problems. In the pre-computer age Limit State analysis...... also enabled engineers to solve practical problems within reinforced concrete, steel structures and geotechnics....
Hansen, Janne Hedegaard
2012-01-01
In this article, I will argue that a theoretical identification of the limit to inclusion is needed in the conceptual identification of inclusion. On the one hand, inclusion is formulated as a vision that is, in principle, limitless. On the other hand, there seems to be an agreement that inclusion has a limit in the pedagogical practice. However,…
FED pumped limiter configuration issues
International Nuclear Information System (INIS)
Haines, J.R.; Fuller, G.M.
1983-01-01
Impurity control in the Fusion Engineering Device (FED) is provided by a toroidal belt pumped limiter. Limiter design issues addressed in this paper are (1) poloidal location of the limiter belt, (2) shape of the limiter surface facing the plasma, and (3) whether the belt is pumped from one or both sides. The criteria used for evaluation of limiter configuration features were sensitivity to plasma-edge conditions and ease of maintenance and fabrication. The evaluation resulted in the selection of a baseline FED limiter that is located at the bottom of the device and has a flat surface with a single leading edge
FED pumped limiter configuration issues
International Nuclear Information System (INIS)
Haines, J.R.; Fuller, G.M.
1983-01-01
Impurity control in the Fusion Engineering Device (FED) is provided by a toroidal belt pumped limiter. Limiter design issues addressed in this paper are (1) poloidal location of the limiter belt, (2) shape of the limiter surface facing the plasma, and (3) whether the belt is pumped from one or both sides. The criteria used for evaluation of limiter configuration features were sensitivity to plasma edge conditions and ease of maintenance and fabrication. The evaluation resulted in the selection of a baseline FED limiter that is located at the bottom of the device and has a flat surface with a single leading edge
Thermal-hydraulic limitations on water-cooled limiters
International Nuclear Information System (INIS)
Cha, Y.S.; Misra, B.
1984-08-01
An assessment of the cooling requirements for fusion reactor components, such as the first wall and limiter/divertor, was carried out using pressurized water as the coolant. In order to establish the coolant operating conditions, a survey of the literature on departure from nucleate boiling, critical heat flux, asymmetrical heating and heat transfer augmentation techniques was carried out. The experimental data and the empirical correlations indicate that thermal protection for the fusion reactor components based on current design concepts can be provided with an adequate margin of safety without resorting to either high coolant velocities, excessive coolant pressures, or heat transfer augmentation techniques. If, however, the future designs require heat transfer enhancement techniques, experimental verification would be necessary since no data on heat transfer augmentation techniques exist for complex geometries, especially under asymmetrically heated conditions. Since the data presented herein concern primarily thermal protection, the final design should consider other factors such as thermal stresses, temperature limits, and fatigue
Time-limited optimal dynamics beyond the Quantum Speed Limit
DEFF Research Database (Denmark)
Gajdacz, Miroslav; Das, Kunal K.; Arlt, Jan
2015-01-01
The quantum speed limit sets the minimum time required to transfer a quantum system completely into a given target state. At shorter times the higher operation speed has to be paid with a loss of fidelity. Here we quantify the trade-off between the fidelity and the duration in a system driven......-off expressed in terms of the direct Hilbert velocity provides a robust prediction of the quantum speed limit and allows to adapt the control optimization such that it yields a predefined fidelity. The results are verified numerically in a multilevel system with a constrained Hamiltonian, and a classification...
Directory of Open Access Journals (Sweden)
Oleg Svatos
2013-01-01
Full Text Available In this paper we analyze complexity of time limits we can find especially in regulated processes of public administration. First we review the most popular process modeling languages. There is defined an example scenario based on the current Czech legislature which is then captured in discussed process modeling languages. Analysis shows that the contemporary process modeling languages support capturing of the time limit only partially. This causes troubles to analysts and unnecessary complexity of the models. Upon unsatisfying results of the contemporary process modeling languages we analyze the complexity of the time limits in greater detail and outline lifecycles of a time limit using the multiple dynamic generalizations pattern. As an alternative to the popular process modeling languages there is presented PSD process modeling language, which supports the defined lifecycles of a time limit natively and therefore allows keeping the models simple and easy to understand.
Interference and memory capacity limitations.
Endress, Ansgar D; Szabó, Szilárd
2017-10-01
Working memory (WM) is thought to have a fixed and limited capacity. However, the origins of these capacity limitations are debated, and generally attributed to active, attentional processes. Here, we show that the existence of interference among items in memory mathematically guarantees fixed and limited capacity limits under very general conditions, irrespective of any processing assumptions. Assuming that interference (a) increases with the number of interfering items and (b) brings memory performance to chance levels for large numbers of interfering items, capacity limits are a simple function of the relative influence of memorization and interference. In contrast, we show that time-based memory limitations do not lead to fixed memory capacity limitations that are independent of the timing properties of an experiment. We show that interference can mimic both slot-like and continuous resource-like memory limitations, suggesting that these types of memory performance might not be as different as commonly believed. We speculate that slot-like WM limitations might arise from crowding-like phenomena in memory when participants have to retrieve items. Further, based on earlier research on parallel attention and enumeration, we suggest that crowding-like phenomena might be a common reason for the 3 major cognitive capacity limitations. As suggested by Miller (1956) and Cowan (2001), these capacity limitations might arise because of a common reason, even though they likely rely on distinct processes. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
Performance limitations at ISABELLE
International Nuclear Information System (INIS)
Keil, E.
1975-01-01
The transverse stability of coasting beams in the planned ISABELLE storage rings was studied. The beam--beam tune shift limitation at 0.005 can be avoided, and a computer simulation seems to show 0.005 is a pessimistic limit. For beams of reasonable smoothness on the edge, the actual limit should be somewhat higher. Some coupling effects due to the beam--beam interaction are also examined
International Nuclear Information System (INIS)
Watve, Apurva; Gupta, Mamta; Trivedi, Richa; Khushu, Subash; Rana, Poonam
2016-01-01
Moderate dose of radiation exposure occurs during radiation accidents or radiation therapy induces pathophysiological alterations in CNS that may persist for longer duration. Studies suggest that late delayed injury is irreversible leading to metabolic and cognitive impairment. Our earlier studies have illustrated the varied response of brain at acute and early delayed phase on exposure to cranial and whole body radiation. Hence in continuation with our previous studies, present study focuses on comparative microstructural changes in brain at late delayed phase of radiation injury using Diffusion Tensor Imaging (DTI) technique. Region of interest (ROIs) were drawn on corpus callosum (CC), hippocampus (HIP), sensory-motor cortex (SMC), thalamus (TH), hypothalamus (HTH), cingulum (CG), caudeto-putamen (CUP) and cerebral peduncle (CP). The differences in FA (Fractional Anisotropy) and MD (Mean Diffusivity) values generated from these regions of all the groups were evaluated by ANOVA with multiple comparisons using Bonferroni, Post Hoc test. Maximum changes have been observed in MD values mainly in cranial group showing significantly increased MD in CC and SMC region while both the groups showed changes in TH and CUP region as compared to control. FA showed more prominent changes in whole body radiation group than cranial group by decreasing significantly in CP region while in HTH and CUP region in both the groups. Reduced FA indicates compromised structural integrity due to the loss of glial progenitor cells causing transient demyelination while increased MD has been equated with cellular membrane disruption, cell death and vasogenic edema. Thus, present study reveals late delayed CNS response after cranial and whole body radiation exposure. These findings can help us differentiate and monitor the pathophysiological changes at later stages either due to accidental or intentional exposure to ionizing radiation
International Nuclear Information System (INIS)
Zouain, N.
1983-01-01
The static method for the evaluation of the limit loads of a perfectly elasto-plastic structure is presented. Using the static theorem of Limit Analysis and the Finite Element Method, a lower bound for the colapso load can be obtained through a linear programming problem. This formulation if then applied to symmetrically loaded shells of revolution and some numerical results of limit loads in nozzles are also presented. (Author) [pt
Solubility limits on radionuclide dissolution
Energy Technology Data Exchange (ETDEWEB)
Kerrisk, J.F.
1984-12-31
This paper examines the effects of solubility in limiting dissolution rates of a number of important radionuclides from spent fuel and high-level waste. Two simple dissolution models were used for calculations that would be characteristics of a Yucca Mountain repository. A saturation-limited dissolution model, in which the water flowing through the repository is assumed to be saturated with each waste element, is very conservative in that it overestimates dissolution rates. A diffusion-limited dissolution model, in which element-dissolution rates are limited by diffusion of waste elements into water flowing past the waste, is more realistic, but it is subject to some uncertainty at this time. Dissolution rates of some elements (Pu, Am, Sn, Th, Zr, Sm) are always limited by solubility. Dissolution rates of other elements (Cs, Tc, Np, Sr, C, I) are never solubility limited; their release would be limited by dissolution of the bulk waste form. Still other elements (U, Cm, Ni, Ra) show solubility-limited dissolution under some conditions. 9 references, 3 tables.
Fullwood, James; Wang, Dongxu
2018-01-01
We introduce a class of F-theory vacua whose smooth elliptic fibers admit a vanishing $j$-invariant, and construct a weak coupling limit associated with such vacua which we view as the `square' of the Sen limit. We find that while Sen's limit is naturally viewed as an orientifold theory, the universal tadpole relation which equates the D3 charge between the associated F-theory compactification and the limit we construct suggests that perhaps the limiting theory is in fact an oriented theory c...
International Nuclear Information System (INIS)
Rubbel, F.E.
1982-01-01
The very extensive use of limitations in the operational field between protection system and closed-loop controls is an important feature of German understanding of operational safety. The design of limitations is based on very large activities in the computational field but mostly on the high level of the plant-wide own commissioning experience of a turnkey contractor. Limitations combine intelligence features of closed-loop controls with the high availability of protection systems. (orig.)
1981-12-01
DTIC _JUN ,I 51982 UNITED STATES AIR FORCE AIR UNIVERSITY E AIR FORCE INSTITUTE OF TECHNOLOGY Wright-Patterson Air-force Base,Ohio S 2 B 14 Best...t’re Air F:or- e -ns"it’.,, e of Technclogy Air Uv-ýerz.tyj in Partial ulfilIThent Reýquirements fol- ,-hth D,ýýr.e c4" MastLer of’ OperaZ-ins...iesearc- VeTA 3 MohamedO ’’’’Jo SpD’ Fas.abal-la Lt. C ol. Egyplt.’.an Army Gradua~’p ( ler ons Research December 1981 Approcved fL~r pu>ý’ rclea.se
Magnetic shielding of a limiter
International Nuclear Information System (INIS)
Brevnov, N.N.; Stepanov, S.B.; Khimchenko, L.N.; Matthews, G.F.; Goodal, D.H.J.
1991-01-01
Localization of plasma interaction with material surfaces in a separate chamber, from where the escape of impurities is hardly realized, i.e. application of magnetic divertors or pump limiters, is the main technique for reduction of the impurity content in a plasma. In this case, the production of a divertor configuration requires a considerable power consumption and results in a less effective utilization of the magnetic field volume. Utilization of a pump limiter, for example the ICL-type, under tokamak-reactor conditions would result in the extremely high and forbidden local heat loadings onto the limiter surface. Moreover, the magnetically-shielded pump limiter (MSL) was proposed to combine positive properties of the divertor and the pump limiter. The idea of magnetic shielding is to locate the winding with current inside the limiter head so that the field lines of the resultant magnetic field do not intercept the limiter surface. In this case the plasma flows around the limiter leading edges and penetrates into the space under the limiter. The shielding magnetic field can be directed either counter the toroidal field or counter the poloidal one of a tokamak, dependent on the concrete diagram of the device. Such a limiter has a number of advantages: -opportunity to control over the particle and impurity recycling without practical influence upon the plasma column geometry, - perturbation of a plasma column magnetic configuration from the side of such a limiter is less than that from the side of the divertor coils. The main deficiency is the necessity to locate active windings inside the discharge chamber. (author) 5 refs., 3 figs
International Nuclear Information System (INIS)
Sabado, M.M.; Marcus, F.B.; Trester, P.W.; Wesley, J.C.
1979-10-01
The plasma limiter system for Doublet III is described. Initially, high-Z materials, Ta-10W for the primary limiter and Mo for the backup limiters, were selected as the most attractive metallic candidates from the standpoint of thermal and structural properties. For the purpose of evaluating the effect of material Z on plasma performance, the nonmagnetic, Ni-base alloy Inconel X-750 was selected for a medium-Z limiter material. Graphite, a low-Z material, will likely be the next limiter material for evaluation. Design and material selection criteria for the different Z ranges are presented. The performance of the high-Z limiters in Doublet III is reviewed for an operation period that included approximately 5000 plasma shots. Changes in surface appearance and metallurgical changes are characterized. Discussion is presented on how and to what extent the high-Z elements affected the performance of the plasma based on theory and measurements in Doublet III. The fabrication processes for the Inconel X-750 limiters are summarized, and, last, observations on early performance of the Inconel limiters are described
Energy Technology Data Exchange (ETDEWEB)
Sabado, M.M.; Marcus, F.B.; Trester, P.W.; Wesley, J.C.
1979-10-01
The plasma limiter system for Doublet III is described. Initially, high-Z materials, Ta-10W for the primary limiter and Mo for the backup limiters, were selected as the most attractive metallic candidates from the standpoint of thermal and structural properties. For the purpose of evaluating the effect of material Z on plasma performance, the nonmagnetic, Ni-base alloy Inconel X-750 was selected for a medium-Z limiter material. Graphite, a low-Z material, will likely be the next limiter material for evaluation. Design and material selection criteria for the different Z ranges are presented. The performance of the high-Z limiters in Doublet III is reviewed for an operation period that included approximately 5000 plasma shots. Changes in surface appearance and metallurgical changes are characterized. Discussion is presented on how and to what extent the high-Z elements affected the performance of the plasma based on theory and measurements in Doublet III. The fabrication processes for the Inconel X-750 limiters are summarized, and, last, observations on early performance of the Inconel limiters are described. (MOW)
FUEL CASK IMPACT LIMITER VULNERABILITIES
International Nuclear Information System (INIS)
Leduc, D.; England, J.; Rothermel, R.
2009-01-01
Cylindrical fuel casks often have impact limiters surrounding just the ends of the cask shaft in a typical 'dumbbell' arrangement. The primary purpose of these impact limiters is to absorb energy to reduce loads on the cask structure during impacts associated with a severe accident. Impact limiters are also credited in many packages with protecting closure seals and maintaining lower peak temperatures during fire events. For this credit to be taken in safety analyses, the impact limiter attachment system must be shown to retain the impact limiter following Normal Conditions of Transport (NCT) and Hypothetical Accident Conditions (HAC) impacts. Large casks are often certified by analysis only because of the costs associated with testing. Therefore, some cask impact limiter attachment systems have not been tested in real impacts. A recent structural analysis of the T-3 Spent Fuel Containment Cask found problems with the design of the impact limiter attachment system. Assumptions in the original Safety Analysis for Packaging (SARP) concerning the loading in the attachment bolts were found to be inaccurate in certain drop orientations. This paper documents the lessons learned and their applicability to impact limiter attachment system designs
Limit cycles in quantum systems
Energy Technology Data Exchange (ETDEWEB)
Niemann, Patrick
2015-04-27
In this thesis we investigate Limit Cycles in Quantum Systems. Limit cycles are a renormalization group (RG) topology. When degrees of freedom are integrated out, the coupling constants flow periodically in a closed curve. The presence of limit cycles is restricted by the necessary condition of discrete scale invariance. A signature of discrete scale invariance and limit cycles is log-periodic behavior. The first part of this thesis is concerned with the study of limit cycles with the similarity renormalization group (SRG). Limit cycles are mainly investigated within conventional renormalization group frameworks, where degrees of freedom, which are larger than a given cutoff, are integrated out. In contrast, in the SRG potentials are unitarily transformed and thereby obtain a band-diagonal structure. The width of the band structure can be regarded as an effective cutoff. We investigate the appearance of limit cycles in the SRG evolution. Our aim is to extract signatures as well as the scaling factor of the limit cycle. We consider the 1/R{sup 2}-potential in a two-body system and a three-body system with large scattering lengths. Both systems display a limit cycle. Besides the frequently used kinetic energy generator we apply the exponential and the inverse generator. In the second part of this thesis, Limit Cycles at Finite Density, we examine the pole structure of the scattering amplitude for distinguishable fermions at zero temperature in the medium. Unequal masses and a filled Fermi sphere for each fermion species are considered. We focus on negative scattering lengths and the unitary limit. The properties of the three-body spectrum in the medium and implications for the phase structure of ultracold Fermi gases are discussed.
International Nuclear Information System (INIS)
Taroco, E.; Feijoo, R.A.
1981-07-01
In this paper it is presented a variational method for the limit analysis of an ideal plastic solid. This method has been denominated as Modified Secundary Creep and enables to find the collapse loads through a minimization of a functional and a limit process. Given an ideal plastic material it is shown how to determinate the associated secundary creep constitutive equation. Finally, as an application, it is found the limit load in an pressurized von Mises rigid plastic sphere. (Author) [pt
Term limits and the tobacco industry.
Apollonio, Dorie E; Glantz, Stanton A; Bero, Lisa A
2014-03-01
In the 1990s several American states passed term limits on legislators with the stated intention of reducing the influence of wealthy industries on career legislators. Although term limits in the United States do not have a direct relationship to public health, the tobacco industry anticipated that term limits could have indirect effects by either limiting or expanding industry influence. We detail the strategy of the tobacco industry in the wake of term limits using internal tobacco company documents and a database of campaign contributions made to legislators in term limited states between 1988 and 2002. Despite some expectations that term limits would limit tobacco industry access to state legislators, term limits appear to have had the opposite effect. Copyright © 2013 Elsevier Ltd. All rights reserved.
Pawlik, Ralph; Krause, David; Bremenour, Frank
2011-01-01
The Force Limit System (FLS) was developed to protect test specimens from inadvertent overload. The load limit value is fully adjustable by the operator and works independently of the test system control as a mechanical (non-electrical) device. When a test specimen is loaded via an electromechanical or hydraulic test system, a chance of an overload condition exists. An overload applied to a specimen could result in irreparable damage to the specimen and/or fixturing. The FLS restricts the maximum load that an actuator can apply to a test specimen. When testing limited-run test articles or using very expensive fixtures, the use of such a device is highly recommended. Test setups typically use electronic peak protection, which can be the source of overload due to malfunctioning components or the inability to react quickly enough to load spikes. The FLS works independently of the electronic overload protection.
International Nuclear Information System (INIS)
Schultz, J.H.
1981-01-01
The use of limiter pumps as the principle plasma exhaust system of a magnetic confinement fusion device promises significant simplification, when compared to previously investigating divertor based systems. Further simplifications, such as the integration of the exhaust system with a radio frequency heating system and with the main reactor shield and structure are investigated below. The integrity of limiters in a reactor environment is threatened by many mechanisms, the most severe of which may be erosion by sputtering. Two novel topolgies are suggested which allow high erosion without limiter failure
International Nuclear Information System (INIS)
Schultz, J.H.
1981-01-01
The use of limiter pumps as the principle plasma exhaust system of a magnetic confinement fusion device promises significant simplification, when compared to previously investigating divertor based systems. Further simplifications, such as the integration of the exhaust system with a radio frequency heating system and with the main reactor shield and structure are investigated below. The integrity of limiters in a reactor environment is threatened by many mechanisms, the most severe of which may be erosion by sputtering. Two novel topologies are suggested which allow high erosion without limiter failure
Finite element limit analysis based plastic limit pressure solutions for cracked pipes
International Nuclear Information System (INIS)
Shim, Do Jun; Huh, Nam Su; Kim, Yun Jae; Kim, Young Jin
2002-01-01
Based on detailed FE limit analyses, the present paper provides tractable approximations for plastic limit pressure solutions for axial through-wall cracked pipe; axial (inner) surface cracked pipe; circumferential through-wall cracked pipe; and circumferential (inner) surface cracked pipe. Comparisons with existing analytical and empirical solutions show a large discrepancy in circumferential short through-wall cracks and in surface cracks (both axial and circumferential). Being based on detailed 3-D FE limit analysis, the present solutions are believed to be the most accurate, and thus to be valuable information not only for plastic collapse analysis of pressurised piping but also for estimating non-linear fracture mechanics parameters based on the reference stress approach
International Nuclear Information System (INIS)
Cox, D.C.; Baybutt, P.
1982-01-01
Approaches to the regulation of risk from technological systems, such as nuclear power plants or chemical process plants, in which potential accidents may result in a broad range of adverse consequences must take into account several different aspects of risk. These include overall or average risk, accidents posing high relative risks, the rate at which accident probability decreases with increasing accident consequences, and the impact of high frequency, low consequence accidents. A hypothetical complementary cumulative distribution function (CCDF), with appropriately chosen parametric form, meets all these requirements. The Farmer limit line, by contrast, places limits on the risks due to individual accident sequences, and cannot adequately account for overall risk. This reduces its usefulness as a regulatory tool. In practice, the CCDF is used in the Canadian nuclear licensing process, while the Farmer limit line approach, supplemented by separate qualitative limits on overall risk, is employed in the United Kingdom
Tokamak plasma interaction with limiters
International Nuclear Information System (INIS)
Pitcher, C.S.
1987-11-01
The importance of plasma purity is first discussed in terms of the general requirements of controlled thermonuclear fusion. The tokamak approach to fusion and its inherent problem of plasma contamination are introduced. A main source of impurities is due to the bombardment of the limiter by energetic particles and thus the three main aspects of the plasma-limiter interaction are reviewed, boundary plasma conditions, fuelling/recycling and impurity production. The experiments, carried out on the DITE tokamak at Culham Laboratory, UK, investigated these three topics and the results are compared with predicted behaviour; new physical phenomena are presented in all three areas. Simple one-dimensional fluid equations are found to adequately describe the SOL plasma, except in regard to the pre-sheath electric field and ambipolarity; that is, the electric field adjacent to the limiter surface appears to be weak and the associated plasma flow can be non-ambipolar. Recycling of fuel particles from the limiter is observed to be near unity at all times. The break-up behaviour of recycled and gas puffed D 2 molecules is dependent on the electron temperature, as expected. Impurity production at the limiter is chemical erosion of graphite being negligible. Deposition of limiter and wall-produced impurities is found on the limiter. The spatial distributions of impurities released from the limiter are observed and are in good agreement with a sputtered atom transport code. Finally, preliminary experiments on the transport of impurity ions along field lines away from the limiter have been performed and compared with simple analytic theory. The results suggest that the pre-sheath electric field in the SOL is much weaker than the simple fluid model would predict
International Nuclear Information System (INIS)
Vossier, Alexis; Gualdi, Federico; Dollet, Alain; Ares, Richard; Aimez, Vincent
2015-01-01
In principle, the upper efficiency limit of any solar cell technology can be determined using the detailed-balance limit formalism. However, “real” solar cells show efficiencies which are always below this theoretical value due to several limiting mechanisms. We study the ability of a solar cell architecture to approach its own theoretical limit, using a novel index introduced in this work, and the amplitude with which the different limiting mechanisms affect the cell efficiency is scrutinized as a function of the electronic gap and the illumination level to which the cell is submitted. The implications for future generations of solar cells aiming at an improved conversion of the solar spectrum are also addressed
Plane wave limits and T-duality
International Nuclear Information System (INIS)
Guven, R.
2000-04-01
The Penrose limit is generalized to show that, any leading order solution of the low-energy field equations in any one of the five string theories has a plane wave solution as a limit. This limiting procedure takes into account all the massless fields that may arise and commutes with the T-duality so that any dual solution has again a plane wave limit. The scaling rules used in the limit are unique and stem from the scaling property of the D = 11 supergravity action. Although the leading order dual solutions need not be exact or supersymmetric, their plane wave limits always preserve some portion of the Poincare supersymmetry and solve the relevant field equations in all powers of the string tension parameter. Further properties of the limiting procedure are discussed. (author)
Limitations of Human Visual Working Memory
Wesenick, Maria-Barbara
2004-01-01
The present empirical study investigates limitations of human visual working memory (VWM). The experiments of the present work involve the experimental paradigm of change detection using simple geometrical objects in the form of rectangles of different colour, length, and orientation. It can be shown, that a limited performance in the temporary storage of visual information has multiple sources. Limitations of VWM can be attributed to a limited capacity or a limited duration, but also to limi...
The Advanced Limiter Test-I (ALT-I) variable-geometry pump limiter module
International Nuclear Information System (INIS)
Pontau, A.E.; Malinowski, M.E.; Ver Berkmoes, A.A.; Guthrie, S.E.; Watson, R.D.; Goebel, D.M.; Campbell, G.A.
1984-01-01
The ALT-I variable geometry module has been designed to address many of the issues not previously settled by earlier experiments. The goal is to study the basic processes involved in pump limiter operation as well as demonstrate its utility and effect on the plasma. The flexibility and extensive instrumentation of ALT-I will offer a unique opportunity to parameterize operation and facilitate the engineering design of future pump limiters. (orig.)
Pump limiter studies in Tore Supra
International Nuclear Information System (INIS)
Chatelier, M.; Bonnel, P.; Bruneau, J.L.; Gil, C.; Grisolia, C.; Loarer, T.; Martin, G.; Pegourie, B.; Rodriguez, L.
1991-01-01
The aim of the Tore Supra pump limiter program is to study particle exhaust with a pump limiter system in long-pulse discharges with continuous pellet fueling and strong auxiliary heating. The pump limiter system consists of six vertical modules, located at the bottom of the machine, and one horizontal module at the outer midplane. The instrumentation of the limiter included pressure gauges, a residual gas analyser Langmuir probes, a spectrometer and water calorimeters. Initial results in low-density discharges, with the outboard limiter only, showed a modest effect on the plasma density, while large exhaust fluxes were measured in the pump limiter, without any external fueling
Passive fault current limiting device
Evans, Daniel J.; Cha, Yung S.
1999-01-01
A passive current limiting device and isolator is particularly adapted for use at high power levels for limiting excessive currents in a circuit in a fault condition such as an electrical short. The current limiting device comprises a magnetic core wound with two magnetically opposed, parallel connected coils of copper, a high temperature superconductor or other electrically conducting material, and a fault element connected in series with one of the coils. Under normal operating conditions, the magnetic flux density produced by the two coils cancel each other. Under a fault condition, the fault element is triggered to cause an imbalance in the magnetic flux density between the two coils which results in an increase in the impedance in the coils. While the fault element may be a separate current limiter, switch, fuse, bimetal strip or the like, it preferably is a superconductor current limiter conducting one-half of the current load compared to the same limiter wired to carry the total current of the circuit. The major voltage during a fault condition is in the coils wound on the common core in a preferred embodiment.
ALT-I pump limiter experiments
International Nuclear Information System (INIS)
Goebel, D.M.; Conn, R.W.; Campbell, G.A.
1987-09-01
Results from the ALT-I pump limiter experiments in TEXTOR are presented. ALT-I has demonstrated control of the plasma density in a high recycling tokamak by pumping up to 15% of the core efflux. The closed pump limiter designs with restricted entrance geometries to reduce the backflow of neutral gas to the plasma remove over 50% of the ion flux incident on the collection slot. Up to 80% of the entrance ion flux is removed when the edge electron temperature is less than 10 eV and plasma-neutral gas interactions are minimized inside the limiter. Results from a 3-D Monte Carlo neutral gas transport code agree closely with these experimental results. The compound curvature of the head is found to distribute the heat over the surface as predicted in the original designs. Impurity removal experiments demonstrate that significant helium exhaust can be achieved with a pump limiter. During ohmic heating in TEXTOR, the energy and particle confinement times are proportional to the line averaged core density. With ICRH auxiliary heating, tau/sub E/ follow L-mode scaling independent of particle removal by the pump limiter. Pump limiter operation does not directly modify the SOL plasma density and electron temperature, but controls the core plasma density by changing the global recycling at the boundary. The global particle confinement, the particle flux to the limiter, and the edge electron temperature follow the changes in the core density and auxiliary heating power. 25 refs
LANSCE Beam Current Limiter (XL)
International Nuclear Information System (INIS)
Gallegos, F.R.; Hall, M.J.
1997-01-01
The Radiation Security System (RSS) at the Los Alamos Neutron Science Center (LANSCE) is an engineered safety system that provides personnel protection from prompt radiation due to accelerated proton beams. The Beam Current Limiter (XL), as an active component of the RSS, limits the maximum average current in a beamline, thus the current available for a beam spill accident. Exceeding the pre-set limit initiates action by the RSS to mitigate the hazard (insertion of beam stoppers in the low energy beam transport). The beam limiter is an electrically isolated, toroidal transformer and associated electronics. The device was designed to continuously monitor beamline currents independent of any external timing. Fail-safe operation was a prime consideration in its development. Fail-safe operation is defined as functioning as intended (due to redundant circuitry), functioning with a more sensitive fault threshold, or generating a fault condition. This report describes the design philosophy, hardware, implementation, operation, and limitations of the device
Limits to magnetic resonance microscopy
International Nuclear Information System (INIS)
Glover, Paul; Mansfield, Peter
2002-01-01
The last quarter of the twentieth century saw the development of magnetic resonance imaging (MRI) grow from a laboratory demonstration to a multi-billion dollar worldwide industry. There is a clinical body scanner in almost every hospital of the developed nations. The field of magnetic resonance microscopy (MRM), after mostly being abandoned by researchers in the first decade of MRI, has become an established branch of the science. This paper reviews the development of MRM over the last decade with an emphasis on the current state of the art. The fundamental principles of imaging and signal detection are examined to determine the physical principles which limit the available resolution. The limits are discussed with reference to liquid, solid and gas phase microscopy. In each area, the novel approaches employed by researchers to push back the limits of resolution are discussed. Although the limits to resolution are well known, the developments and applications of MRM have not reached their limit. (author)
International Nuclear Information System (INIS)
Im, I.G.; Choi, H.S.; Jung, B.I.
2013-01-01
Highlights: •Fault current limiter was used a high-speed interrupter. •High-speed interrupter was operated to bypass to the current limiter line. •The size of the fault current was limited to about 80% after the fault occurred. •The fault current was limited quickly within a half-cycle after the fault occurred. -- Abstract: The increased electricity demands influenced by the recent industrial development make the electric power distribution system more comprehensive, and the risks are high to cause failures to steady state electric line due to the extended range of fault at the time of fault occurrence. Also, the high performance and the high precision electric appliances that sensitive to switching surge and fault current expose vulnerability of reduced life span and increased fault occurrence ratio. Therefore, this thesis analyzed the fault limiting characteristics by the fault types by applying the superconducting fault current limiter to the neutral line of the transformer in order to reduce the fault currents that flow such high performance appliances. A current transformer (CT) that detects the fault current in the simulated power distribution system, a switching control system that is self-developed and a transformer are used in constructing a circuit. When a fault occurs, the initial fault current is restricted by the superconducting fault current limiter and simultaneously detours the fault current by operating the SCR contact of the switching control system through the detection by CT. This thesis analyzed the limiting characteristics of the superconducting fault current limiter that are applied to the neutral line of the transformer by the fault types
Energy Technology Data Exchange (ETDEWEB)
Im, I.G., E-mail: asiligo@gmail.com; Choi, H.S., E-mail: hyosang@chosun.ac.kr; Jung, B.I.
2013-11-15
Highlights: •Fault current limiter was used a high-speed interrupter. •High-speed interrupter was operated to bypass to the current limiter line. •The size of the fault current was limited to about 80% after the fault occurred. •The fault current was limited quickly within a half-cycle after the fault occurred. -- Abstract: The increased electricity demands influenced by the recent industrial development make the electric power distribution system more comprehensive, and the risks are high to cause failures to steady state electric line due to the extended range of fault at the time of fault occurrence. Also, the high performance and the high precision electric appliances that sensitive to switching surge and fault current expose vulnerability of reduced life span and increased fault occurrence ratio. Therefore, this thesis analyzed the fault limiting characteristics by the fault types by applying the superconducting fault current limiter to the neutral line of the transformer in order to reduce the fault currents that flow such high performance appliances. A current transformer (CT) that detects the fault current in the simulated power distribution system, a switching control system that is self-developed and a transformer are used in constructing a circuit. When a fault occurs, the initial fault current is restricted by the superconducting fault current limiter and simultaneously detours the fault current by operating the SCR contact of the switching control system through the detection by CT. This thesis analyzed the limiting characteristics of the superconducting fault current limiter that are applied to the neutral line of the transformer by the fault types.
Indian Academy of Sciences (India)
Abstract. Let S be a scheme. Assume that we are given an action of the one dimen- sional split torus Gm,S on a smooth affine S-scheme X. We consider the limit (also called attractor) subfunctor Xλ consisting of points whose orbit under the given action. 'admits a limit at 0'. We show that Xλ is representable by a smooth ...
International Nuclear Information System (INIS)
Deksnis, E.
1988-09-01
The belt limiter system, comprising two full toroidal rings of limiter tiles, was installed in JET in 1987. In consists of water-cooled fins with the limiter material in form of tile inbetween. The tiles are designed to absorb heat fluxes during irradiation without the surface temperature exceeding 2000 0 C and to radiate this heat between pulses to the water cooled sink whose temperature is lower than that of the vacuum vessel. An important feature of the design is to maximise the area of the radiating surface facing the water cooled fin. This leads to a tile depth much greater than the width of the tile facing the heat flux. Limiter tiles intercept particles flowing out of the plasma through the area between the two belt limiter rings and through remaining surface area of the plasma column. Power deposition to a limiter tile depends strongly on the shape of the plasma, the edge plasma properties as well as on the surface profile of the tiles. This paper will discuss the methodology that was followed in producing an optimized surface profile of the tiles. This shaped profile has the feature that the resulting power deposition profile is roughly similar for a wide range of plasma parameters. (author)
Czech Academy of Sciences Publication Activity Database
Matoušek, Jaroslav; Piernikarczyk, R.J.J.; Týcová, Anna; Duraisamy, Ganesh Selvaraj; Kocábek, Tomáš; Steger, G.
2015-01-01
Roč. 183, JUL (2015), s. 85-94 ISSN 0176-1617 R&D Projects: GA ČR GCP501/10/J018 Institutional support: RVO:60077344 Keywords : mRNA target * RNA decay * Biolistic plant inoculation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.971, year: 2015
On the Limitations of Biological Knowledge
Dougherty, Edward R; Shmulevich, Ilya
2012-01-01
Scientific knowledge is grounded in a particular epistemology and, owing to the requirements of that epistemology, possesses limitations. Some limitations are intrinsic, in the sense that they depend inherently on the nature of scientific knowledge; others are contingent, depending on the present state of knowledge, including technology. Understanding limitations facilitates scientific research because one can then recognize when one is confronted by a limitation, as opposed to simply being unable to solve a problem within the existing bounds of possibility. In the hope that the role of limiting factors can be brought more clearly into focus and discussed, we consider several sources of limitation as they apply to biological knowledge: mathematical complexity, experimental constraints, validation, knowledge discovery, and human intellectual capacity. PMID:23633917
International Nuclear Information System (INIS)
Owen, James E.; Alvarez, Marcelo A.
2016-01-01
We have investigated the evaporation of close-in exoplanets irradiated by ionizing photons. We find that the properties of the flow are controlled by the ratio of the recombination time to the flow timescale. When the recombination timescale is short compared to the flow timescale, the flow is in approximate local ionization equilibrium with a thin ionization front where the photon mean free path is short compared to the flow scale. In this “recombination-limited” flow the mass-loss scales roughly with the square root of the incident flux. When the recombination time is long compared to the flow timescale the ionization front becomes thick and encompasses the entire flow with the mass-loss rate scaling linearly with flux. If the planet's potential is deep, then the flow is approximately “energy-limited”; however, if the planet's potential is shallow, then we identify a new limiting mass-loss regime, which we term “photon-limited.” In this scenario, the mass-loss rate is purely limited by the incoming flux of ionizing photons. We have developed a new numerical approach that takes into account the frequency dependence of the incoming ionizing spectrum and performed a large suite of 1D simulations to characterize UV driven mass-loss around low-mass planets. We find that the flow is “recombination-limited” at high fluxes but becomes “energy-limited” at low fluxes; however, the transition is broad occurring over several orders of magnitude in flux. Finally, we point out that the transitions between the different flow types do not occur at a single flux value but depend on the planet's properties, with higher-mass planets becoming “energy-limited” at lower fluxes
Further limitations on nuclear testing
International Nuclear Information System (INIS)
Brown, P.S.
1991-11-01
This document addresses a number of subjects related to further constraints on nuclear testing, briefly discussing each of the following topics: the current political situation, the kinds of steps that might next be taken in test limitations and the impacts of further testing limits, the need for a test ban readiness program, some issues related to verification, and the possibility of confidence building measures as alternative, or near-term, steps to further test limitations
Classical and sequential limit analysis revisited
Leblond, Jean-Baptiste; Kondo, Djimédo; Morin, Léo; Remmal, Almahdi
2018-04-01
Classical limit analysis applies to ideal plastic materials, and within a linearized geometrical framework implying small displacements and strains. Sequential limit analysis was proposed as a heuristic extension to materials exhibiting strain hardening, and within a fully general geometrical framework involving large displacements and strains. The purpose of this paper is to study and clearly state the precise conditions permitting such an extension. This is done by comparing the evolution equations of the full elastic-plastic problem, the equations of classical limit analysis, and those of sequential limit analysis. The main conclusion is that, whereas classical limit analysis applies to materials exhibiting elasticity - in the absence of hardening and within a linearized geometrical framework -, sequential limit analysis, to be applicable, strictly prohibits the presence of elasticity - although it tolerates strain hardening and large displacements and strains. For a given mechanical situation, the relevance of sequential limit analysis therefore essentially depends upon the importance of the elastic-plastic coupling in the specific case considered.
Physics considerations for the FED limiter
International Nuclear Information System (INIS)
Howe, H.C.
1981-07-01
The physics of the scrapeoff plasma and its interaction with a pumping limiter is reviewed. The governing equations for heat and particle transport in the scrapeoff are solved analytically with several simplifying assumptions. The assumed scrapeoff model is widely used and is presented here for completeness. From the solution, a shape for the limiter is derived which has a uniform heat loading on the front surface. The assumed crossfield transport coefficient is varied to examine the sensitivity of the heat loading to variations in plasma scrapeoff thickness. The heat flux to the limiter leading edge is an extremely sensitive function of variations in scrapeoff thickness, and we argue that uncertainties in the plasma crossfield transport preclude derivation of a believable limiter shape. We also discuss the problems involved with an edgeless, perforated limiter and with a global limiter. Finally, a solution is proposed using a flat-plate limiter with the heat flux to the leading edge controlled by major radius motion of the plasma
Hydrodynamic Limit of Multiple SLE
Hotta, Ikkei; Katori, Makoto
2018-04-01
Recently del Monaco and Schleißinger addressed an interesting problem whether one can take the limit of multiple Schramm-Loewner evolution (SLE) as the number of slits N goes to infinity. When the N slits grow from points on the real line R in a simultaneous way and go to infinity within the upper half plane H, an ordinary differential equation describing time evolution of the conformal map g_t(z) was derived in the N → ∞ limit, which is coupled with a complex Burgers equation in the inviscid limit. It is well known that the complex Burgers equation governs the hydrodynamic limit of the Dyson model defined on R studied in random matrix theory, and when all particles start from the origin, the solution of this Burgers equation is given by the Stieltjes transformation of the measure which follows a time-dependent version of Wigner's semicircle law. In the present paper, first we study the hydrodynamic limit of the multiple SLE in the case that all slits start from the origin. We show that the time-dependent version of Wigner's semicircle law determines the time evolution of the SLE hull, K_t \\subset H\\cup R, in this hydrodynamic limit. Next we consider the situation such that a half number of the slits start from a>0 and another half of slits start from -a exact solutions, we will discuss the universal long-term behavior of the multiple SLE and its hull K_t in the hydrodynamic limit.
TFTR movable limiter instrumentation and controls
International Nuclear Information System (INIS)
Frankenberg, J.; Collins, D.; Kaufmann, D.; Mamoun, A.
1983-01-01
The TFTR movable limiter is a single poloidal limiter located within one 18 /SUP o/ segment of the vacuum vessel. It consists of three (3) interconnected inconel backing plates covered with titanium carbide coated graphite tiles. The backing plates are positioned by three independent screw drive actuators. Cooling water is fed through the horizontal port cover to tubes brazed onto the backs of the backing plates. Thermocouples monitor the limiter temperature. (1) and more fully described in refs. (1) and (2). The positioning actuators are driven by independently controlled DC servo motors, controlled either locally or from CICADA. Drive motor shaft position is monitored by chain driven encoders and potentiometers. Limiter blade position can be varied to suit any plasma within the operating range. CICADA is programmed to keep the limiter stroke within safe operating limits. A microprocessor duplicates the CICADA protective function allowing limiter operation without CICADA. The potentiometer signal is sent to an analog computer, which safeguards the limiter against failure of the encoders or the micro-processor. Cooling water flows through the limiter in 3 separate paths, one for each blade. The flow rate and temperature rise through each loop are measured accurately to allow CICADA to calculate the heat into each blade. The water system is also interlocked and alarmed to prevent dumping of water into the vacuum vessel
48 CFR 1417.402 - Limitations.
2010-10-01
... CONTRACT TYPES SPECIAL CONTRACTING METHODS Leader Company Contracting 1417.402 Limitations. Use of leader company contracting for a product, subject to the limitations in FAR 17.402, shall require advance...
Adjusting estimative prediction limits
Masao Ueki; Kaoru Fueda
2007-01-01
This note presents a direct adjustment of the estimative prediction limit to reduce the coverage error from a target value to third-order accuracy. The adjustment is asymptotically equivalent to those of Barndorff-Nielsen & Cox (1994, 1996) and Vidoni (1998). It has a simpler form with a plug-in estimator of the coverage probability of the estimative limit at the target value. Copyright 2007, Oxford University Press.
The British Nuclear Fuels Limited (Payment and Loan Limit) Order 1976 No.1298
International Nuclear Information System (INIS)
1976-01-01
Sections 11(4) and 12(1) of the Atomic Energy Authority Act 1971 authorise the Secretary of State for Energy (with the consent of the Treasury) to subscribe for shares in British Nuclear Fuels Limited and (with the approval of the Treasury) to make loans to the Company. Section 13 of the Act imposes an overall limit on the total amounts which may be paid or lent to that Company by the Secretary of State or by the United Kingdom Atomic Energy Authority, or both collectively, of Pound 50 million, which may be increased to such greater sum not exceeding Pound 75 million as may be specified by the Secretary of State by order. This Order increases the limit to Pound 75 million. (G.B.) [fr
The density limit in JET diverted plasmas
Energy Technology Data Exchange (ETDEWEB)
Campbell, D J; Clement, S; Gottardi, N; Gowers, C; Harbour, P; Loarte, A; Horton, L; Lingertat, J; Lowry, C G; Saibene, G; Stamp, M; Stork, D [Commission of the European Communities, Abingdon (United Kingdom). JET Joint Undertaking; Monk, R [Royal Holloway Coll., London (United Kingdom). Dept. of Physics
1994-07-01
In JET limiter plasmas the density limit is associated with radiated power fractions of 100% and, in plasmas with carbon limiters, it is invariably disruptive. However, in discharges with solid beryllium limiters the limit is identified with the formation of a MARFE and disruptions are less frequent. In addition, the improved conditioning of the vessel arising from the use of beryllium has significantly improved the density limit scaling, so that the maximum density rises with the square root of the input power. In diverted plasmas several confinement regimes exist, making the characterization of the density limit more complex. While the density limit in L-mode plasmas is generally disruptive, the limit in ELMy and ELM-free H-modes generally prompts a return to the L-mode and a disruption is not inevitable. The density limit does rise with the increasing power, but the L-to-H transition complicates the analysis. Nevertheless, at low plasma currents (<2 MA), densities significantly above the Greenwald limit can be achieved, while at higher currents power handling limitations have constrained the range of density which can be achieved. (authors). 7 refs., 4 figs.
Grimm, Frauke; Dobler, Nadine; Dahl, Christiane
2010-03-01
Sulfur globules are formed as obligatory intermediates during the oxidation of reduced sulfur compounds in many environmentally important photo- and chemolithoautotrophic bacteria. It is well established that the so-called Dsr proteins are essential for the oxidation of zero-valent sulfur accumulated in the globules; however, hardly anything is known about the regulation of dsr gene expression. Here, we present a closer look at the regulation of the dsr genes in the phototrophic sulfur bacterium Allochromatium vinosum. The dsr genes are expressed in a reduced sulfur compound-dependent manner and neither sulfite, the product of the reverse-acting dissimilatory sulfite reductase DsrAB, nor the alternative electron donor malate inhibit the gene expression. Moreover, we show the oxidation of sulfur to sulfite to be the rate-limiting step in the oxidation of sulfur to sulfate as sulfate production starts concomitantly with the upregulation of the expression of the dsr genes. Real-time RT-PCR experiments suggest that the genes dsrC and dsrS are additionally expressed from secondary internal promoters, pointing to a special function of the encoded proteins. Earlier structural analyses indicated the presence of a helix-turn-helix (HTH)-like motif in DsrC. We therefore assessed the DNA-binding capability of the protein and provide evidence for a possible regulatory function of DsrC.
Information Processing and Limited Liability
Bartosz Mackowiak; Mirko Wiederholt
2012-01-01
Decision-makers often face limited liability and thus know that their loss will be bounded. We study how limited liability affects the behavior of an agent who chooses how much information to acquire and process in order to take a good decision. We find that an agent facing limited liability processes less information than an agent with unlimited liability. The informational gap between the two agents is larger in bad times than in good times and when information is more costly to process.
Effluent release limits, sources and control
International Nuclear Information System (INIS)
Swindell, G.E.
1977-01-01
Objectives of radiation protection in relation to releases. Environmental transfer models for radionuclides. Relationship between releases, environmental levels and doses to persons. Establishment of release limits: Limits based on critical population group concept critical pathway analysis and identification of critical group. Limits based on optimization of radiation protection individual dose limits, collective doses and dose commitments 1) differential cost benefit analysis 2) authorized and operational limits taking account of future exposures. Monitoring of releases to the environment: Objectives of effluent monitoring. Typical sources and composition of effluents; design and operation of monitoring programmes; recording and reporting of monitoring results; complementary environmental monitoring. (orig.) [de
Limitations on blanket performance
International Nuclear Information System (INIS)
Malang, S.
1999-01-01
The limitations on the performance of breeding blankets in a fusion power plant are evaluated. The breeding blankets will be key components of a plant and their limitations with regard to power density, thermal efficiency and lifetime could determine to a large degree the attractiveness of a power plant. The performance of two rather well known blanket concepts under development in the frame of the European Blanket Programme is assessed and their limitations are compared with more advanced (and more speculative) concepts. An important issue is the question of which material (structure, breeder, multiplier, coatings) will limit the performance and what improvement would be possible with a 'better' structural material. This evaluation is based on the premise that the performance of the power plant will be limited by the blankets (including first wall) and not by other components, e.g. divertors, or the plasma itself. However, the justness of this premise remains to be seen. It is shown that the different blanket concepts cover a large range of allowable power densities and achievable thermal efficiencies, and it is concluded that there is a high incentive to go for better performance in spite of possibly higher blanket cost. However, such high performance blankets are usually based on materials and technologies not yet developed and there is a rather high risk that the development could fail. Therefore, it is explained that a part of the development effort should be devoted to concepts where the materials and technologies are more or less in hand in order to ensure that blankets for a DEMO reactor can be developed and tested in a given time frame. (orig.)
Directory of Open Access Journals (Sweden)
Wenjun Huang
2017-01-01
Full Text Available Mechanical extending limit in horizontal drilling means the maximum horizontal extending length of a horizontal well under certain ground and down-hole mechanical constraint conditions. Around this concept, the constrained optimization model of mechanical extending limits is built and simplified analytical results for pick-up and slack-off operations are deduced. The horizontal extending limits for kinds of tubular strings under different drilling parameters are calculated and drawn. To improve extending limits, an optimal design model of drill strings is built and applied to a case study. The results indicate that horizontal extending limits are underestimated a lot when the effects of friction force on critical helical buckling loads are neglected. Horizontal extending limits firstly increase and tend to stable values with vertical depths. Horizontal extending limits increase faster but finally become smaller with the increase of horizontal pushing forces for tubular strings of smaller modulus-weight ratio. Sliding slack-off is the main limit operation and high axial friction is the main constraint factor constraining horizontal extending limits. A sophisticated installation of multiple tubular strings can greatly inhibit helical buckling and increase horizontal extending limits. The optimal design model is called only once to obtain design results, which greatly increases the calculation efficiency.
The Limits of Exercise Physiology
DEFF Research Database (Denmark)
Gabriel, Brendan M; Zierath, Juleen R
2017-01-01
Many of the established positive health benefits of exercise have been documented by historical discoveries in the field of exercise physiology. These investigations often assess limits: the limits of performance, or the limits of exercise-induced health benefits. Indeed, several key findings have...... been informed by studying highly trained athletes, in addition to healthy or unhealthy people. Recent progress has been made in regard to skeletal muscle metabolism and personalized exercise regimes. In this perspective, we review some of the historical milestones of exercise physiology, discuss how...
Ye, Yan-Qian; Lo, Chi Y
1986-01-01
Over the past two decades the theory of limit cycles, especially for quadratic differential systems, has progressed dramatically in China as well as in other countries. This monograph, updating the 1964 first edition, includes these recent developments, as revised by eight of the author's colleagues in their own areas of expertise. The first part of the book deals with limit cycles of general plane stationary systems, including their existence, nonexistence, stability, and uniqueness. The second section discusses the global topological structure of limit cycles and phase-portraits of quadratic systems. Finally, the last section collects important results that could not be included under the subject matter of the previous two sections or that have appeared in the literature very recently. The book as a whole serves as a reference for college seniors, graduate students, and researchers in mathematics and physics.
Halvorson, Halvor M; Sperfeld, Erik; Evans-White, Michelle A
2017-12-01
Resource quantity and quality are fundamental bottom-up constraints on consumers. Best understood in autotroph-based systems, co-occurrence of these constraints may be common but remains poorly studied in detrital-based systems. Here, we used a laboratory growth experiment to test limitation of the detritivorous caddisfly larvae Pycnopsyche lepida across a concurrent gradient of oak litter quantity (food supply) and quality (phosphorus : carbon [P:C ratios]). Growth increased simultaneously with quantity and quality, indicating co-limitation across the resource gradients. We merged approaches of ecological stoichiometry and co-limitation theory, showing how co-limitation reflected shifts in C and P acquisition throughout homeostatic regulation. Increased growth was best explained by elevated consumption rates and improved P assimilation, which both increased with elevated quantity and quality. Notably, C assimilation efficiencies remained unchanged and achieved maximum 18% at low quantity despite pronounced C limitation. Detrital C recalcitrance and substantive post-assimilatory C losses probably set a minimum quantity threshold to achieve positive C balance. Above this threshold, greater quality enhanced larval growth probably by improving P assimilation toward P-intensive growth. We suggest this interplay of C and P acquisition contributes to detritivore co-limitation, highlighting quantity and quality as potential simultaneous bottom-up controls in detrital-based ecosystems, including under anthropogenic change like nutrient enrichment. © 2017 by the Ecological Society of America.
International Nuclear Information System (INIS)
Shishkov, L. K.; Gorbaev, V. A.; Tsyganov, S. V.
2007-01-01
The paper touches upon the issues of NPP safety ensuring at the stage of fuel load design and operation by applying special limitations for a series of parameters, that is, design limits. Two following approaches are compared: the one used by west specialists for the PWR reactor and the Russian approach employed for the WWER reactor. The closeness of approaches is established, differences that are mainly peculiarities of terms are noted (Authors)
Determination of the Meteor Limiting Magnitude
Kingery, A.; Blaauw, R.; Cooke, W. J.
2016-01-01
The limiting meteor magnitude of a meteor camera system will depend on the camera hardware and software, sky conditions, and the location of the meteor radiant. Some of these factors are constants for a given meteor camera system, but many change between meteor shower or sporadic source and on both long and short timescales. Since the limiting meteor magnitude ultimately gets used to calculate the limiting meteor mass for a given data set, it is important to have an understanding of these factors and to monitor how they change throughout the night, as a 0.5 magnitude uncertainty in limiting magnitude translates to a uncertainty in limiting mass by a factor of two.
Anomalies and the Large N Limit
International Nuclear Information System (INIS)
Agarwal, A.; Akant, L.
2003-01-01
Operator algebra aspects of the Large N limit of Bosonic vector models are analyzed. It is shown that the Large N limit is a classical theory, and a general method, based on defromation quatization, for calculating the Poisson algebra of dynamical observables in the limiting classical theory is presented. The Poisson algebra of O(N) invariant observables of Bosonic vector models is constructed in this approach, and is shown to be a central extension of the Symplectic Lie algebra. The relation of the central term to anomalies is discussed. A comparision of the classical theories obtained in the Large N limit and that in the small (ℎ/2π) limit is also presented
Survey of beam-beam limitations
International Nuclear Information System (INIS)
Courant, E.; Cornacchia, M.; Donald, M.M.R.; Evans, L.R.; Tazzari, S.; Wilson, E.J.N.
1979-01-01
The effect of beam-beam interaction is known to limit the luminosity of electron-positron storage rings and will, no doubt, limit the proton-antiproton collision scheme for the SPS. While theorists are struggling to explain this phenomenon it is more instructive to list their failures than their rather limited successes, in the hope that experiments may emerge which will direct their endeavors. The search for a description of a nonlinear system as it approaches the limit in which ordered motion breaks down, is the nub of the problem. It has engaged many fine mathematical intellects for decades and will no doubt continue to do so long after ISABELLE, the p antip and LEP are past achievements. Empirical scaling laws are emerging which relate electron machines to each other but their extrapolation to proton machines remain a very speculative exercise. Experimental data on proton limits is confined to one machine, the ISR, which does not normally suffer the beam-beam effect and where it must be artificially induced or simulated. This machine is also very different in important ways from the p antip collider. The gloomy picture which has emerged recently is that the fixed limits which were conventionally assumed for proton and electron machines can only be said to be valid for the machines which engendered them - the best guess that could be made at the time. They are very difficult to extrapolate to other sets of parameters
International Nuclear Information System (INIS)
Rapp, J.; Koslowski, H.R.; Pospieszczyk, A.; Salzedas, F.; Vries, P.C. de; Schueller, F.C.; Hokin, S.; Messiaen, A.M.
2001-01-01
Ignition scenarios like those developed for ITER require plasma densities which will be close or above the Greenwald limit. Generally it is observed that exceeding this limit may lead to a degradation of plasma confinement or to a violent end of the discharge. The achievable density limit and the related processes, such as radiative instabilities and MHD phenomena, which eventually lead to disruption, have been investigated in the limiter tokamaks TEXTOR-94 and RTP. (author)
The estimation of derived limits
International Nuclear Information System (INIS)
Harrison, N.T.; Bryant, P.M.; Clarke, R.H.; Morley, F.
1979-08-01
In practical radiation protection, it is often necessary to calculate limits of intake of radionuclides associated with various quantities; such limits are needed, for example, to assess the adequacy of the control of environmental contamination. In publication 26 of the International Commission on Radiological Protection (ICRP), these limits, when related to the basic limits of dose-equivalent by a defined model, are referred to as Derived Limits (DLs). In the present report the principles to be adopted by the Board in calculating DLs to be recommended for general application within the United Kingdom are outlined. DLs will be recommended for a wide range of radionuclides and for circumstances relevant to the workplace, and, more frequently, the general environment. The latter will include DLs in foodstuffs and associated environmental materials, such as soil and grass, and DLs for discharges from stacks. DLs will be related to dose equivalents for workers or members of the public for stochastic or non-stochastic effects as appropriate. Consideration will be given to relevant data on radiosensitivity, metabolism and dosimetry for children and to the physicochemical forms of radionuclides. (author)
International Nuclear Information System (INIS)
Gimon, Eric G.; Sonnenschein, Jacob; Pando Zayas, Leopoldo A.
2002-01-01
The Penrose-Gueven limit simplifies a given supergravity solution into a pp-wave background. Aiming at clarifying its relation to renormalization group flow we study the Penrose-Guven limit of supergravity backgrounds that are dual to non-conformal gauge theories. The resulting backgrounds fall in a class simple enough that the quantum particle is exactly solvable. We propose a map between the effective time-dependent quantum mechanical problem and the RG flow in the gauge theory. As a testing ground we consider explicitly two Penrose limits of the infrared fixed point of the Pilch-Warner solution. We analyze the corresponding gauge theory picture and write down the operators which are the duals of the low lying string states. We also address RG flows of a different nature by considering the Penrose-Gueven limit of a stack of N D p branes. We note that in the far IR (for p<3)the limit generically has negative mass-squared. This phenomenon signals, in the world sheet picture, the necessity to transform to another description. In this regard, we consider explicitly the cases of M2 from D2 and F1 from D1. (author)
Superconducting dc fault current limiter
International Nuclear Information System (INIS)
Cointe, Y.
2007-12-01
Within the framework of the electric power market liberalization, DC networks have many interests compared to alternative ones, but their protections need to use new systems. Superconducting fault current limiters enable by an overstepping of the critical current to limit the fault current to a preset value, lower than the theoretical short-circuit current. For these applications, coated conductors offer excellent opportunities. We worked on the implementation of these materials and built a test bench. We carried out limiting experiments to estimate the quench homogeneity at various short-circuit parameters. An important point is the temperature measurement by deposited sensors on the ribbon, results are in good correlation with the theoretical models. Improved quench behaviours for temperatures close to the critical temperature have been confirmed. Our results enable to better understand the limitation mechanisms of coated conductors. (author)
Directory of Open Access Journals (Sweden)
Jade S. Sasser
2014-07-01
Full Text Available In this thematic section, authors consider the limitations on giving back that they faced in field research, or saw others face. For some authors, their attempts at giving back were severely limited by the scope of their projects, or their understandings of local cultures or histories. For others, very specific circumstances and historical interventions of foreigners in certain places can limit how and to what extent a researcher is able to have a reciprocal relationship with the participating community. Some authors, by virtue of their lesser positions of power relative to those that they were studying, simply decided not to give back to those communities. In each article it becomes apparent that how and in what ways people give back is unique (and limited both to their personal values and the contexts in which they do research.
International Nuclear Information System (INIS)
Breznik, B.; Kovac, A.
2001-01-01
Full text: Krsko Nuclear Power Plant is about 700 MW Pressurised Water Reactor plant located in Slovenia close to the border with Croatia. The authorised limit for the radioactive releases is basically set to 50 μSv effective dose per year to the members of the public. There is also additional limitation of total activities released in a year and concentration. The poster presents the effluents of the year 2000 and evaluated dose referring to the limits and to the natural and other sources of radiation around the plant. (author)
Approach to DOE threshold guidance limits
International Nuclear Information System (INIS)
Shuman, R.D.; Wickham, L.E.
1984-01-01
The need for less restrictive criteria governing disposal of extremely low-level radioactive waste has long been recognized. The Low-Level Waste Management Program has been directed by the Department of Energy (DOE) to aid in the development of a threshold guidance limit for DOE low-level waste facilities. Project objectives are concernd with the definition of a threshold limit dose and pathway analysis of radionuclide transport within selected exposure scenarios at DOE sites. Results of the pathway analysis will be used to determine waste radionuclide concentration guidelines that meet the defined threshold limit dose. Methods of measurement and verification of concentration limits round out the project's goals. Work on defining a threshold limit dose is nearing completion. Pathway analysis of sanitary landfill operations at the Savannah River Plant and the Idaho National Engineering Laboratory is in progress using the DOSTOMAN computer code. Concentration limit calculations and determination of implementation procedures shall follow completion of the pathways work. 4 references
Charter Halibut Limited Access Program
National Oceanic and Atmospheric Administration, Department of Commerce — This limited access system limits the number of charter vessels that may participate in the guided sport fishery for halibut in area 2C and 3A. NMFS issues a charter...
12 CFR 24.4 - Investment limits.
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false Investment limits. 24.4 Section 24.4 Banks and... ENTITIES, COMMUNITY DEVELOPMENT PROJECTS, AND OTHER PUBLIC WELFARE INVESTMENTS § 24.4 Investment limits. (a) Limits on aggregate outstanding investments. A national bank's aggregate outstanding investments under...
N-limited or N and P co-limited indications in the surface waters of three Mediterranean basins
Tanaka, T.; Thingstad, T. F.; Christaki, U.; Colombet, J.; Cornet-Barthaux, V.; Courties, C.; Grattepanche, J.-D.; Lagaria, A.; Nedoma, J.; Oriol, L.; Psarra, S.; Pujo-Pay, M.; van Wambeke, F.
2010-11-01
The limiting nutrient for the pelagic microbial food web in the Mediterranean Sea was investigated in the nutrient manipulated microcosms during summer 2008. Surface waters were collected into 12 carboys at a center of anticyclonic eddy at the Western Basin, the Ionian Basin, and the Levantine Basin, respectively. As compared to the Redfield ratio, the ratio of N to P in the collected waters was always smaller in the dissolved inorganic fraction but higher in both dissolved and particulate organic fractions. Four different treatments in triplicates (addition of ammonium, phosphate, a combination of both, and the unamended control) were set up for the carboys. Responses of chemical and biological parameters in these different treatments were measured during the incubation (3-4 days). Temporal changes of turnover time of phosphate and ATP, and alkaline phosphatase activity during the incubation suggested that the phytoplankton and heterotrophic prokaryotes (Hprok) communities were not purely P-limited at any studied stations. Statistical comparison between the treatments for a given parameter measured at the end of the incubation did not find pure P-limitation in any chemical and biological parameters at three study sites. Primary production was consistently limited by N, and Hprok growth was not limited by N nor P in the Western Basin, but N-limited in the Ionian Basin, and N and P co-limited in the Levantine Basin. Our results demonstrated the gap between biogeochemical features and biological responses in terms of the limiting nutrient. We question the general notion that Mediterranean surface waters are limited by P alone during the stratified period.
Density limit experiments on FTU
International Nuclear Information System (INIS)
Pucella, G.; Tudisco, O.; Apicella, M.L.; Apruzzese, G.; Artaserse, G.; Belli, F.; Boncagni, L.; Botrugno, A.; Buratti, P.; Calabrò, G.; Castaldo, C.; Cianfarani, C.; Cocilovo, V.; Dimatteo, L.; Esposito, B.; Frigione, D.; Gabellieri, L.; Giovannozzi, E.; Bin, W.; Granucci, G.
2013-01-01
One of the main problems in tokamak fusion devices concerns the capability to operate at a high plasma density, which is observed to be limited by the appearance of catastrophic events causing loss of plasma confinement. The commonly used empirical scaling law for the density limit is the Greenwald limit, predicting that the maximum achievable line-averaged density along a central chord depends only on the average plasma current density. However, the Greenwald density limit has been exceeded in tokamak experiments in the case of peaked density profiles, indicating that the edge density is the real parameter responsible for the density limit. Recently, it has been shown on the Frascati Tokamak Upgrade (FTU) that the Greenwald density limit is exceeded in gas-fuelled discharges with a high value of the edge safety factor. In order to understand this behaviour, dedicated density limit experiments were performed on FTU, in which the high density domain was explored in a wide range of values of plasma current (I p = 500–900 kA) and toroidal magnetic field (B T = 4–8 T). These experiments confirm the edge nature of the density limit, as a Greenwald-like scaling holds for the maximum achievable line-averaged density along a peripheral chord passing at r/a ≃ 4/5. On the other hand, the maximum achievable line-averaged density along a central chord does not depend on the average plasma current density and essentially depends on the toroidal magnetic field only. This behaviour is explained in terms of density profile peaking in the high density domain, with a peaking factor at the disruption depending on the edge safety factor. The possibility that the MARFE (multifaced asymmetric radiation from the edge) phenomenon is the cause of the peaking has been considered, with the MARFE believed to form a channel for the penetration of the neutral particles into deeper layers of the plasma. Finally, the magnetohydrodynamic (MHD) analysis has shown that also the central line
Truong, Sandra K; McCormick, Ryan F; Mullet, John E
2017-01-01
Bioenergy sorghum is targeted for production in water-limited annual cropland therefore traits that improve plant water capture, water use efficiency, and resilience to water deficit are necessary to maximize productivity. A crop modeling framework, APSIM, was adapted to predict the growth and biomass yield of energy sorghum and to identify potentially useful traits for crop improvement. APSIM simulations of energy sorghum development and biomass accumulation replicated results from field experiments across multiple years, patterns of rainfall, and irrigation schemes. Modeling showed that energy sorghum's long duration of vegetative growth increased water capture and biomass yield by ~30% compared to short season crops in a water-limited production region. Additionally, APSIM was extended to enable modeling of VPD-limited transpiration traits that reduce crop water use under high vapor pressure deficits (VPDs). The response of transpiration rate to increasing VPD was modeled as a linear response until a VPD threshold was reached, at which the slope of the response decreases, representing a range of responses to VPD observed in sorghum germplasm. Simulation results indicated that the VPD-limited transpiration trait is most beneficial in hot and dry regions of production where crops are exposed to extended periods without rainfall during the season or to a terminal drought. In these environments, slower but more efficient transpiration increases biomass yield and prevents or delays the exhaustion of soil water and onset of leaf senescence. The VPD-limited transpiration responses observed in sorghum germplasm increased biomass accumulation by 20% in years with lower summer rainfall, and the ability to drastically reduce transpiration under high VPD conditions could increase biomass by 6% on average across all years. This work indicates that the productivity and resilience of bioenergy sorghum grown in water-limited environments could be further enhanced by development
7 CFR 52.3185 - Moisture limits.
2010-01-01
... 7 Agriculture 2 2010-01-01 2010-01-01 false Moisture limits. 52.3185 Section 52.3185 Agriculture... United States Standards for Grades of Dried Prunes Moisture, Uniformity of Size, Defects § 52.3185 Moisture limits. Dried prunes shall not exceed the moisture limits for the applicable grades and kind and...
Subcritical limits for special fissile actinides
International Nuclear Information System (INIS)
Clark, H.K.
1980-01-01
Critical masses and subcritical mass limits in oxide-water mixtures were calculated for actinide nuclides other than 233 U, 235 U, and 239 Pu that have an odd number of neutrons in the nucleus: S/sub n/ transport theory was used together with cross sections, drawn from the GLASS multigroup library, developed to provide accurate forecasts of actinide production at Savannah River. The subcritical limits are 201 g for 241 Pu, 13 g for 242 /sup m/Am, 90 g for 243 Cm, 30 g for 245 Cm, 900 g for 247 Cm, 10 g for 249 Cf, and 5 g for 251 Cf. Association of 241 Pu with an equal mass of 240 Pu increases the 241 Pu limit to a value greater than that for pure 239 Pu. Association of 242 /sup m/Am with 241 Am increases the limit for the mixture to that for dry, theoretical density AmO 2 at isotopic concentrations of 242 /sup m/Am less than approx. 6%. Association of 245 Cm with 244 Cm increases the limit according to the formula 30 + 0.3 244 Cm/ 245 Cm up to the limit for dry CmO 2 . A limiting mass of 8.15 kg for plutonium containing at least 67% 238 Pu as oxide was calculated that applies (provided 240 Pu exceeds 241 Pu) with no limit on moderation. 1 figure, 5 tables
Model for movement of molten limiter material during the ISX-B beryllium limiter experiment
International Nuclear Information System (INIS)
Langley, R.A.; England, A.C.; Edmonds, P.H.; Hogan, J.T.; Neilson, G.H.
1986-01-01
A model is proposed for the movement and erosion of limiter material during the Beryllium Limiter Experiment performed on the ISX-B Tokamak. This model is consistent with observed experimental results and plasma operational characteristics. Conclusions drawn from the model can provide an understanding of erosion mechanisms, thereby contributing to the development of future design criteria. (author)
47 CFR 73.1725 - Limited time.
2010-10-01
... 47 Telecommunication 4 2010-10-01 2010-10-01 false Limited time. 73.1725 Section 73.1725... Rules Applicable to All Broadcast Stations § 73.1725 Limited time. (a) Operation is applicable only to... stations on the channel. (b) No authorization will be granted for: (1) A new limited time station; (2) A...
2010-07-01
... missing participants. (b) Limitation on benefit value. The total actuarial present value of all benefits... Relating to Labor (Continued) PENSION BENEFIT GUARANTY CORPORATION PLAN TERMINATIONS MISSING PARTICIPANTS § 4050.11 Limitations. (a) Exclusive benefit. The benefits provided for under this part will be the only...
Biased limiter experiments on text
International Nuclear Information System (INIS)
Phillips, P.E.; Wootton, A.J.; Rowan, W.L.; Ritz, C.P.; Rhodes, T.L.; Bengtson, R.D.; Hodge, W.L.; Durst, R.D.; McCool, S.C.; Richards, B.; Gentle, K.W.; Schoch, P.; Forster, J.C.; Hickok, R.L.; Evans, T.E.
1987-01-01
Experiments using an electrically biased limiter have been performed on the Texas Experimental Tokamak (TEXT). A small movable limiter is inserted past the main poloidal ring limiter (which is electrically connected to the vacuum vessel) and biased at V Lim with respect to it. The floating potential, plasma potential and shear layer position can be controlled. With vertical strokeV Lim vertical stroke ≥ 50 V the plasma density increases. For V Lim Lim > 0 the results obtained are inconclusive. Variation of V Lim changes the electrostatic turbulence which may explain the observed total flux changes. (orig.)
Setting limits on supersymmetry using simplified models
Gutschow, C.
2012-01-01
Experimental limits on supersymmetry and similar theories are difficult to set because of the enormous available parameter space and difficult to generalize because of the complexity of single points. Therefore, more phenomenological, simplified models are becoming popular for setting experimental limits, as they have clearer physical implications. The use of these simplified model limits to set a real limit on a concrete theory has not, however, been demonstrated. This paper recasts simplified model limits into limits on a specific and complete supersymmetry model, minimal supergravity. Limits obtained under various physical assumptions are comparable to those produced by directed searches. A prescription is provided for calculating conservative and aggressive limits on additional theories. Using acceptance and efficiency tables along with the expected and observed numbers of events in various signal regions, LHC experimental results can be re-cast in this manner into almost any theoretical framework, includ...
A diffusion-limited reaction model for self-propagating Al/Pt multilayers with quench limits
Kittell, D. E.; Yarrington, C. D.; Hobbs, M. L.; Abere, M. J.; Adams, D. P.
2018-04-01
A diffusion-limited reaction model was calibrated for Al/Pt multilayers ignited on oxidized silicon, sapphire, and tungsten substrates, as well as for some Al/Pt multilayers ignited as free-standing foils. The model was implemented in a finite element analysis code and used to match experimental burn front velocity data collected from several years of testing at Sandia National Laboratories. Moreover, both the simulations and experiments reveal well-defined quench limits in the total Al + Pt layer (i.e., bilayer) thickness. At these limits, the heat generated from atomic diffusion is insufficient to support a self-propagating wave front on top of the substrates. Quench limits for reactive multilayers are seldom reported and are found to depend on the thermal properties of the individual layers. Here, the diffusion-limited reaction model is generalized to allow for temperature- and composition-dependent material properties, phase change, and anisotropic thermal conductivity. Utilizing this increase in model fidelity, excellent overall agreement is shown between the simulations and experimental results with a single calibrated parameter set. However, the burn front velocities of Al/Pt multilayers ignited on tungsten substrates are over-predicted. Possible sources of error are discussed and a higher activation energy (from 41.9 kJ/mol.at. to 47.5 kJ/mol.at.) is shown to bring the simulations into agreement with the velocity data observed on tungsten substrates. This higher activation energy suggests an inhibited diffusion mechanism present at lower heating rates.
Alignment of the TFTR bumper limiter
International Nuclear Information System (INIS)
Barnes, G.W.; Owens, D.K.; Loesser, G.D.; Ulrickson, M.
1989-01-01
The TFTR Bumper Limiter (BL) is an axisymmetric toroidal limiter mounted on the inner wall of the vacuum vessel. It subtends 120 degree poloidally and has a surface area of 22 m 2 . The plasma facing surface consists of 1,000 kg of graphite tiles mounted on watercooled Inconel backing plates. During the initial installation in the Spring of 1985, the limiter surface was aligned to the toroidal magnetic field by mechanical and magnetic measurements to an estimated accuracy of ±2 mm. During subsequent operation, especially in the 1988 run period in which 30 MW of Neutral Beam Injection routinely occurred, several tiles at points on the limiter which protruded slightly into the plasma were severely damaged. The damage, cracked and spalled tiles, is believed to be initiated by high energy disruptions and aggravated by normal high power operation. The damage pattern and temperature rise during normal operation are consistent with this interpretation. A vacuum vessel opening to replace the damaged tiles and realign the limiter was required. The bumper limiter was reshaped to be circular to ±0.5 mm at the midplane by means of mechanical measurements in order to better distribute the heat loads and eliminate hot spots. The ±0.5 mm accuracy is determined by the variation in individual tile thickness which is ±0.5 mm. This paper describes the methods used to mechanically align the limiter and presents evidence based on machine operation with plasma that the limiter is reasonably well aligned with the toroidal field. Future work dealing with the alignment of the total limiter to the toroidal field using mechanical and magnetic measurements and the replacement of a subset of the carbon tiles with carbon-carbon composite material is also discussed. 7 refs., 4 figs
Tube temperature rise limits: Boiling considerations
Energy Technology Data Exchange (ETDEWEB)
Vanderwater, R.G.
1952-03-26
A revision of tube power limits based on boiling considerations was presented earlier. The limits were given on a basis of tube power versus header pressure. However, for convenience of operation, the limits have been converted from tube power to permissible water temperature rise. The permissible {triangle}t`s water are given in this document.
Environmental radiation standards and risk limitation
International Nuclear Information System (INIS)
Kocher, D.C.
1987-01-01
The Environmental Protection Agency and Nuclear Regulatory Commission have established environmental radiation standards for specific practices which correspond to limits on risk to the public that vary by several orders of magnitude and often are much less than radiation risks that are essentially unregulated, e.g., risks from radon in homes. This paper discusses a proposed framework for environmental radiation standards that would improve the correspondence with limitation of risk. This framework includes the use of limits on annual effective dose equivalent averaged over a lifetime, rather than limits on dose equivalent to whole body or any organ for each year of exposure, and consideration of exposures of younger age groups as well as adults; limits on annual effective dose equivalent averaged over a lifetime no lower than 0.25 mSv (25 mrem) per practice; maintenance of all exposures as low as reasonably achievable (ALARA); and establishment of a generally applicable de minimis dose for public exposures. Implications of the proposed regulatory framework for the current system of standards for limiting public exposures are discussed. 20 refs
2010-07-01
... 31 Money and Finance: Treasury 2 2010-07-01 2010-07-01 false Limitations. 281.7 Section 281.7 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) FISCAL SERVICE, DEPARTMENT OF THE TREASURY FINANCIAL MANAGEMENT SERVICE FOREIGN EXCHANGE OPERATIONS § 281.7 Limitations. The...
Accuracy, Precision, Ease-Of-Use, and Cost of Methods to Test Ebola-Relevant Chlorine Solutions.
Directory of Open Access Journals (Sweden)
Emma Wells
Full Text Available To prevent transmission in Ebola Virus Disease (EVD outbreaks, it is recommended to disinfect living things (hands and people with 0.05% chlorine solution and non-living things (surfaces, personal protective equipment, dead bodies with 0.5% chlorine solution. In the current West African EVD outbreak, these solutions (manufactured from calcium hypochlorite (HTH, sodium dichloroisocyanurate (NaDCC, and sodium hypochlorite (NaOCl have been widely used in both Ebola Treatment Unit and community settings. To ensure solution quality, testing is necessary, however test method appropriateness for these Ebola-relevant concentrations has not previously been evaluated. We identified fourteen commercially-available methods to test Ebola-relevant chlorine solution concentrations, including two titration methods, four DPD dilution methods, and six test strips. We assessed these methods by: 1 determining accuracy and precision by measuring in quintuplicate five different 0.05% and 0.5% chlorine solutions manufactured from NaDCC, HTH, and NaOCl; 2 conducting volunteer testing to assess ease-of-use; and, 3 determining costs. Accuracy was greatest in titration methods (reference-12.4% error compared to reference method, then DPD dilution methods (2.4-19% error, then test strips (5.2-48% error; precision followed this same trend. Two methods had an accuracy of <10% error across all five chlorine solutions with good precision: Hach digital titration for 0.05% and 0.5% solutions (recommended for contexts with trained personnel and financial resources, and Serim test strips for 0.05% solutions (recommended for contexts where rapid, inexpensive, and low-training burden testing is needed. Measurement error from test methods not including pH adjustment varied significantly across the five chlorine solutions, which had pH values 5-11. Volunteers found test strip easiest and titration hardest; costs per 100 tests were $14-37 for test strips and $33-609 for titration
Multi-PAS domain-mediated protein oligomerization of PpsR from Rhodobacter sphaeroides
International Nuclear Information System (INIS)
Heintz, Udo; Meinhart, Anton; Winkler, Andreas
2014-01-01
Crystal structures of two truncated variants of the transcription factor PpsR from R. sphaeroides are presented that enabled the phasing of a triple PAS domain construct. Together, these structures reveal the importance of α-helical PAS extensions for multi-PAS domain-mediated protein oligomerization and function. Per–ARNT–Sim (PAS) domains are essential modules of many multi-domain signalling proteins that mediate protein interaction and/or sense environmental stimuli. Frequently, multiple PAS domains are present within single polypeptide chains, where their interplay is required for protein function. Although many isolated PAS domain structures have been reported over the last decades, only a few structures of multi-PAS proteins are known. Therefore, the molecular mechanism of multi-PAS domain-mediated protein oligomerization and function is poorly understood. The transcription factor PpsR from Rhodobacter sphaeroides is such a multi-PAS domain protein that, in addition to its three PAS domains, contains a glutamine-rich linker and a C-terminal helix–turn–helix DNA-binding motif. Here, crystal structures of two N-terminally and C-terminally truncated PpsR variants that comprise a single (PpsR Q-PAS1 ) and two (PpsR N-Q-PAS1 ) PAS domains, respectively, are presented and the multi-step strategy required for the phasing of a triple PAS domain construct (PpsR ΔHTH ) is illustrated. While parts of the biologically relevant dimerization interface can already be observed in the two shorter constructs, the PpsR ΔHTH structure reveals how three PAS domains enable the formation of multiple oligomeric states (dimer, tetramer and octamer), highlighting that not only the PAS cores but also their α-helical extensions are essential for protein oligomerization. The results demonstrate that the long helical glutamine-rich linker of PpsR results from a direct fusion of the N-cap of the PAS1 domain with the C-terminal extension of the N-domain that plays an important
Newspaper coverage of youth and tobacco: implications for public health.
Smith, Katherine Clegg; Wakefield, Melanie
2006-01-01
The presentation of smoking as a "youth" issue is a powerful component of current tobacco-control efforts. Agenda setting theory demonstrates that the media serve as a potent forum in which the consideration and presentation of perspectives of social problems take place. This analysis of 643 U.S. youth-focused newspaper articles examines the messages being conveyed to the public and policymakers through coverage of tobacco issues focused on youth. Data illustrate that the issue of youth tobacco use is newsworthy but also suggest that youth-focused issues garner little commentary coverage. Rather, straightforward reports of "feel good" stories dominate the coverage, and youth-focused articles tend to conceptualize the problem of tobacco as being one of a need for greater individual-level education rather than structural or policy changes.
The media treatment of nuclear risks
International Nuclear Information System (INIS)
Wilkinson, J.
1987-01-01
The way that newspapers, radio and television news work, is explained so that reporting of nuclear stories can be better understood. The media's attitude to what makes a story newsworthy is explained. This, coupled with a chronology of the rise of the anti-nuclear lobby, is used to explain why some stories have been given prominence. The secretive and evasive attitude of the nuclear industry coupled with poorly communicated information about leaks etc have contributed to a lack of trust and made the public more aware and concerned with nuclear matters. This has sometimes led to unbalanced reporting by the media. The coverage of the Chernobyl reactor accident is examined. Some general points about the openness of BNFL and the government's reporting of nuclear incidents are made. (UK)
International Nuclear Information System (INIS)
Alessandrini, C.; Ciotti, M.; Mattei, A. De; Maddaluno, G.; Mazzitelli, G.
1989-01-01
The control of the refuelling and recycling of the plasma is crucial in providing enhanced performances in tokamaks and steady-state operation in future reactors. In this paper, we report details of the design and analysis for the pump limiter to be incorporated into the FTU tokamak. The FTU, presently under commissioning, is a compact high field (B=8T), medium high density, circular cross section machine with small accesses. The dimensions of the equatorial port (width 8 cm) would reduce the length of the entrance throat to a few centimeters, which is unacceptable for efficient particle trapping. We have, therefore, designed a rotating blade of the pump limiter head that, in the working position, extends in the toroidal direction inside the vacuum chamber. (author) 8 refs., 4 figs
Directory of Open Access Journals (Sweden)
Melnyk R. S.
2017-04-01
Full Text Available Aluminium and copper heat pipes with grooved and metal fibrous capillary structure are high effective heat transfer devices. They are used in different cooling systems of electronic equipment like a LED modules, microprocessors, receive-transmit modules and so on. However thus heat pipes have heat transfer limitations. There are few types of this limitations: hydraulic limitation, boiling limitation, liquid entrainment by vapor flow and sonic limitation. There is necessity to know which one of these limitations is determinant for heat pipe due to design process. At a present article calculations of maximum heat transfer ability represented. All these calculations were made for LED cooling by using heat pipes with grooved and metal fibrous capillary structures. Pentane, acetone, isobutane and water were used as a coolants. It was shown that the main operation limit for axial grooved heat pipe, which determinate maximum heat transfer ability due to inclination angle for location of cooling zone higher than evaporation zone case, is entrainment limit for pentane and acetone coolants. Nevertheless, for isobutane coolant the main limitation is a boiling limit. However, for heat pipes with metal fibrous capillary structure the main limitation is a capillary limit. This limitation was a determinant for all calculated coolants: water, pentane and acetone. For high porosity range of capillary structure, capillary limit transfer to sonic limit for heat pipes with water, that means that the vapor velocity increases to sonic velocity and can't grow any more. Due to this, coolant cant in a needed quantity infill condensation zone and the last one drained. For heat pipes with acetone and pentane, capillary limit transfer to boiling limit. All calculations were made for vapor temperature equal to 50°C, and for porosity range from 30% to 90%.
Tachyons in the Galilean limit
Energy Technology Data Exchange (ETDEWEB)
Batlle, Carles [Departament de Matemàtiques and IOC, Universitat Politècnica de Catalunya, EPSEVG,Av. V. Balaguer 1, Vilanova i la Geltrú, E-08808 (Spain); Gomis, Joaquim [Departament de Física Quàntica i Astrofísica and Institut de Ciències del Cosmos (ICCUB),Universitat de Barcelona, Martí i Franquès 1, Barcelona, E-08028 (Spain); Mezincescu, Luca [Department of Physics, University of Miami,P.O. Box 248046, Coral Gables, FL, 33124 (United States); Townsend, Paul K. [Department of Applied Mathematics and Theoretical Physics, Centre for Mathematical Sciences,University of Cambridge, Wilberforce Road, Cambridge, CB3 0WA (United Kingdom)
2017-04-20
The Souriau massless Galilean particle of “colour” k and spin s is shown to be the Galilean limit of the Souriau tachyon of mass m=ik and spin s. We compare and contrast this result with the Galilean limit of the Nambu-Goto string and Green-Schwarz superstring.
ITER Experts' meeting on density limits
International Nuclear Information System (INIS)
Borrass, K.; Igitkhanov, Y.L.; Uckan, N.A.
1989-12-01
The necessity of achieving a prescribed wall load or fusion power essentially determines the plasma pressure in a device like ITER. The range of operation densities and temperatures compatible with this condition is constrained by the problems of power exhaust and the disruptive density limit. The maximum allowable heat loads on the divertor plates and the maximum allowable sheath edge temperature practically impose a lower limit on the operating densities, whereas the disruptive density limit imposes an upper limit. For most of the density limit scalings proposed in the past an overlap of the two constraints or at best a very narrow accessible density range is predicted for ITER. Improved understanding of the underlying mechanisms is therefore a crucial issue in order to provide a more reliable basis for extrapolation to ITER and to identify possible ways of alleviating the problem
International Nuclear Information System (INIS)
Jang, Hyun Min; Cho, Doo Ho; Kim, Young Jin; Huh, Nam Su; Shim, Do Jun; Choi, Young Hwan; Park, Jung Soon
2011-01-01
On the basis of detailed 3D finite-element (FE) limit analyses, the plastic limit load solutions for pipes with slanted circumferential through-wall cracks (TWCs) subjected to axial tension, global bending, and internal pressure are reported. The FE model and analysis procedure employed in the present numerical study were validated by comparing the present FE results with existing solutions for plastic limit loads of pipes with idealized TWCs. For the quantification of the effect of slanted crack on plastic limit load, slant correction factors for calculating the plastic limit loads of pipes with slanted TWCs from pipes with idealized TWCs are newly proposed from extensive 3D FE calculations. These slant-correction factors are presented in tabulated form for practical ranges of geometry and for each set of loading conditions
26 CFR 1.904(i)-1 - Limitation on use of deconsolidation to avoid foreign tax credit limitations.
2010-04-01
... foreign tax credit limitations. 1.904(i)-1 Section 1.904(i)-1 Internal Revenue INTERNAL REVENUE SERVICE... United States § 1.904(i)-1 Limitation on use of deconsolidation to avoid foreign tax credit limitations... applying the foreign tax credit provisions of section 59(a), sections 901 through 908, and section 960, the...
MHD stability, operational limits and disruptions
International Nuclear Information System (INIS)
1999-01-01
The present physics understandings of magnetohydrodynamic (MHD) stability of tokamak plasmas, the threshold conditions for onset of MHD instability, and the resulting operational limits on attainable plasma pressure (beta limit) and density (density limit), and the consequences of plasma disruption and disruption related effects are reviewed and assessed in the context of their application to a future DT burning reactor prototype tokamak experiment such as ITER. The principal considerations covered within the MHD stability and beta limit assessments are (i) magnetostatic equilibrium, ideal MHD stability and the resulting ideal MHD beta limit; (ii) sawtooth oscillations and the coupling of sawtooth activity to other types of MHD instability; (iii) neoclassical island resistive tearing modes and the corresponding limits on beta and energy confinement; (iv) wall stabilization of ideal MHD instabilities and resistive wall instabilities; (v) mode locking effects of non-axisymmetric error fields; (vi) edge localized MHD instabilities (ELMs, etc.); and (vii) MHD instabilities and beta/pressure gradient limits in plasmas with actively modified current and magnetic shear profiles. The principal considerations covered within the density limit assessments are (i) empirical density limits; (ii) edge power balance/radiative density limits in ohmic and L-mode plasmas; and (iii) edge parameter related density limits in H-mode plasmas. The principal considerations covered in the disruption assessments are (i) disruption causes, frequency and MHD instability onset; (ii) disruption thermal and current quench characteristics; (iii) vertical instabilities (VDEs), both before and after disruption, and plasma and in-vessel halo currents; (iv) after disruption runaway electron formation, confinement and loss; (v) fast plasma shutdown (rapid externally initiated dissipation of plasma thermal and magnetic energies); (vi) means for disruption avoidance and disruption effect mitigation; and
Multidimensional flux-limited advection schemes
International Nuclear Information System (INIS)
Thuburn, J.
1996-01-01
A general method for building multidimensional shape preserving advection schemes using flux limiters is presented. The method works for advected passive scalars in either compressible or incompressible flow and on arbitrary grids. With a minor modification it can be applied to the equation for fluid density. Schemes using the simplest form of the flux limiter can cause distortion of the advected profile, particularly sideways spreading, depending on the orientation of the flow relative to the grid. This is partly because the simple limiter is too restrictive. However, some straightforward refinements lead to a shape-preserving scheme that gives satisfactory results, with negligible grid-flow angle-dependent distortion
Nuclear Structure at the Limits
International Nuclear Information System (INIS)
Nazarewicz, W.
1998-01-01
One of the frontiers of todays nuclear science is the journey to the limits of atomic charge and nuclear mass, of neutron-to-proton ratio, and of angular momentum. The tour to the limits is not only a quest for new, exciting phenomena, but the new data are expected, as well, to bring qualitatively new information about the fundamental properties of the nucleonic many-body system, the nature of the nuclear interaction, and nucleonic correlations at various energy-distance scales. In this series of lectures, current developments in nuclear structure at the limits are discussed from a theoretical perspective, mainly concentrating on medium-mass and heavy nuclei
Department of Housing and Urban Development — In accordance with 24 CFR Part 92.252, HUD provides maximum HOME rent limits. The maximum HOME rents are the lesser of: The fair market rent for existing housing for...
Generalized Geometric Quantum Speed Limits
Directory of Open Access Journals (Sweden)
Diego Paiva Pires
2016-06-01
Full Text Available The attempt to gain a theoretical understanding of the concept of time in quantum mechanics has triggered significant progress towards the search for faster and more efficient quantum technologies. One of such advances consists in the interpretation of the time-energy uncertainty relations as lower bounds for the minimal evolution time between two distinguishable states of a quantum system, also known as quantum speed limits. We investigate how the nonuniqueness of a bona fide measure of distinguishability defined on the quantum-state space affects the quantum speed limits and can be exploited in order to derive improved bounds. Specifically, we establish an infinite family of quantum speed limits valid for unitary and nonunitary evolutions, based on an elegant information geometric formalism. Our work unifies and generalizes existing results on quantum speed limits and provides instances of novel bounds that are tighter than any established one based on the conventional quantum Fisher information. We illustrate our findings with relevant examples, demonstrating the importance of choosing different information metrics for open system dynamics, as well as clarifying the roles of classical populations versus quantum coherences, in the determination and saturation of the speed limits. Our results can find applications in the optimization and control of quantum technologies such as quantum computation and metrology, and might provide new insights in fundamental investigations of quantum thermodynamics.
International Nuclear Information System (INIS)
Cassel, R.; Donaldson, A.; Mattison, T.; Bowden, G.; Weaver, J.; Bulos, F.; Fiander, D.
1991-01-01
The SLC Damping Ring kicker magnets requires a fast magnetic field rise time of 58 nsec, a peak field of 800 gauss, a pulse amplitude stability of 0.01%, and a reasonable operational lifetime. The original kicker magnets designed by SLAC and at Fermi were not able to fulfill the SLC kicker requirements. Extensive studies were conducted to determine the limitation in the magnets, response of the ferrite in kicker magnet, and the modifications needed to improve the kicker magnet performance. The paper details the SLAC and Fermi kicker magnets limitation of performance
Optical shielding of nickel nanoparticle by a bubble: Optical limiting gets limited
Energy Technology Data Exchange (ETDEWEB)
Shukla, Vijay; Jayabalan, J., E-mail: jjaya@rrcat.gov.in; Chari, Rama [Ultrafast Spectroscopy Laboratory, Laser Physics Applications Section, Raja Ramanna Centre for Advanced Technology, Indore 452013 (India)
2016-06-13
We have demonstrated that in a nickel nanoparticle colloid, the optical limiting action reduces if a vapor bubble forms around the nanoparticle. The energy-dependent transmission and z-scan measurements on nickel nanoparticles in toluene show the onset of an additional process. At high fluence excitation, the particle becomes less visible to the later part of the incoming pulse due to the heat generated bubble formed around it. We have proposed a simple “particle-in-bubble” model which fits the optical limiting and z-scan curves quite well. Using this model, we have also estimated that the bubble radius increases at a rate of 4.5 m/s.
Optical shielding of nickel nanoparticle by a bubble: Optical limiting gets limited
International Nuclear Information System (INIS)
Shukla, Vijay; Jayabalan, J.; Chari, Rama
2016-01-01
We have demonstrated that in a nickel nanoparticle colloid, the optical limiting action reduces if a vapor bubble forms around the nanoparticle. The energy-dependent transmission and z-scan measurements on nickel nanoparticles in toluene show the onset of an additional process. At high fluence excitation, the particle becomes less visible to the later part of the incoming pulse due to the heat generated bubble formed around it. We have proposed a simple “particle-in-bubble” model which fits the optical limiting and z-scan curves quite well. Using this model, we have also estimated that the bubble radius increases at a rate of 4.5 m/s.
Numerical predicting of the structure and stresses state in hardened element made of tool steel
Directory of Open Access Journals (Sweden)
A. Bokota
2008-03-01
Full Text Available The paper presents numerical model of thcrmal phcnomcna, phasc transformation and mcchanical phcnomcna associated with hardeningof carbon tool steel. Model for evaluation or fractions OF phases and their kinetics bascd on continuous heating diagram (CHT andcontinuous cooling diagram (CCT. The stresses generated during hardening were assumed to rcsult from ~hermal load. stntcturaI plasticdeformations and transformation plasricity. Thc hardened material was assumed to be elastic-plastic, and in ordcr to mark plastic strains the non-isothermal plastic law of flow with the isotropic hardening and condition plasticity of Huber-Misses were used. TherrnophysicaI values of mechanical phenomena dependent on bo~hth e phase composition and temperature. In the numerical example thc simulated estimation of the phasc Fraction and strcss distributions in the hardened axisimmetrical elemcnt was performed.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Limitations. 13.47 Section 13.47 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY PROGRAM FRAUD CIVIL REMEDIES § 13.47 Limitations. (a) The notice of hearing with respect to a Claim or Statement must be served in the manner...
Limits of detection and decision. Part 4
International Nuclear Information System (INIS)
Voigtman, E.
2008-01-01
Probability density functions (PDFs) have been derived for a number of commonly used limit of detection definitions, including several variants of the Relative Standard Deviation of the Background-Background Equivalent Concentration (RSDB-BEC) method, for a simple linear chemical measurement system (CMS) having homoscedastic, Gaussian measurement noise and using ordinary least squares (OLS) processing. All of these detection limit definitions serve as both decision and detection limits, thereby implicitly resulting in 50% rates of Type 2 errors. It has been demonstrated that these are closely related to Currie decision limits, if the coverage factor, k, is properly defined, and that all of the PDFs are scaled reciprocals of noncentral t variates. All of the detection limits have well-defined upper and lower limits, thereby resulting in finite moments and confidence limits, and the problem of estimating the noncentrality parameter has been addressed. As in Parts 1-3, extensive Monte Carlo simulations were performed and all the simulation results were found to be in excellent agreement with the derived theoretical expressions. Specific recommendations for harmonization of detection limit methodology have also been made
Diffraction limit of refractive compound lens
International Nuclear Information System (INIS)
Kolchevsky, N.N.; Petrov, P.V.
2015-01-01
A compound X-ray and neutron lenses is an array of lenses with a common axis. The resolution limited by aberration and by diffraction. Diffraction limit comes from theory based on absorption aperture of the compound refractive lenses. Beam passing through transparent lenses form Airy pattern. Results of calculation of diffraction resolution limit for non-transparent X-ray and neutron lenses are discussed. (authors)
Frontiers of particle beams: Intensity limitations
International Nuclear Information System (INIS)
Dienes, M.; Month, M.; Turner, S.
1992-01-01
The present volume is the proceedings of the latest of these joint schools, held on Hilton Head Island, South Carolina, in 1990. This course dealt with intensity limitations and was centered on a series of lectures which could be divided into the following main categories: Self and environmental fields, Coherent instabilities and their simulation, Beam-beam interaction, Other multiparticle effects, Beam source limitations, Engineering limitations. (orig.)
The limits on trypanosomatid morphological diversity.
Directory of Open Access Journals (Sweden)
Richard John Wheeler
Full Text Available Cell shape is one, often overlooked, way in which protozoan parasites have adapted to a variety of host and vector environments and directional transmissions between these environments. Consequently, different parasite life cycle stages have characteristic morphologies. Trypanosomatid parasites are an excellent example of this in which large morphological variations between species and life cycle stage occur, despite sharing well-conserved cytoskeletal and membranous structures. Here, using previously published reports in the literature of the morphology of 248 isolates of trypanosomatid species from different hosts, we perform a meta-analysis of the occurrence and limits on morphological diversity of different classes of trypanosomatid morphology (trypomastigote, promastigote, etc. in the vertebrate bloodstream and invertebrate gut environments. We identified several limits on cell body length, cell body width and flagellum length diversity which can be interpreted as biomechanical limits on the capacity of the cell to attain particular dimensions. These limits differed for morphologies with and without a laterally attached flagellum which we suggest represent two morphological superclasses, the 'juxtaform' and 'liberform' superclasses. Further limits were identified consistent with a selective pressure from the mechanical properties of the vertebrate bloodstream environment; trypanosomatid size showed limits relative to host erythrocyte dimensions. This is the first comprehensive analysis of the limits of morphological diversity in any protozoan parasite, revealing the morphogenetic constraints and extrinsic selection pressures associated with the full diversity of trypanosomatid morphology.
Historical Drawbacks of Limited Liability
Directory of Open Access Journals (Sweden)
Denis Boyle
2016-07-01
Full Text Available Limited liability is a human invention which has facilitated enormous economic growth around the world, particularly since the time of its general application in advanced countries during the nineteenth century. The individual legal identity of companies, coupled with the limited liability of their owners, has provided protection for investors from the risks associated with their investments. It has thus contributed to increase the sources of capital available to finance projects which might otherwise have been considered unviable. However, the legal protection offered to investors has negative consequences for other participants in economies. Speculation in stock markets often damages society. It is very important to study the drawbacks of limited liability and to suggest modifications to achieve a more stable, less volatile, economic growth in the world. Although this article goes to some lengths to recognise the work of authors who emphasise the positive historical economic contribution of limited lability, its main objective is to provoke a reflection around texts which point out the drawbacks and propose solutions.
International Nuclear Information System (INIS)
Corradini, M.L.; Moses, G.A.
1985-01-01
The vapor explosion process involves the mixing of fuel with coolant prior to the explosion. A number of analysts have identified limits to the amount of fuel/coolant mixing that could occur within the reactor vessel following a core melt accident. Past models are reviewed and a sim plified approach is suggested to estimate the upper limit on the amount of fuel/coolant mixing pos sible. The approach uses concepts first advanced by Fauske in a different way. The results indicat that water depth is an important parameter as well as the mixing length scale D /SUB mix/ , and for large values of D /SUB mix/ the fuel mass mixed is limited to <7% of the core mass
Magnetic limiter for thermonuclear device
International Nuclear Information System (INIS)
Shimizu, Masatsugu; Nakamura, Hiroo; Takatsu, Hideyuki; Minato, Akihiko; Fukushima, Yutaka.
1979-01-01
Purpose: To decrease X-ray irradiation to coils by constituting magnetic limiters as a laminated structure of a carbon outer layer contacting to plasma and an inner molybdenum layer to thereby reduce braking radiation and secondary X-ray generation. Constitution: Magnetic limiters having a molybdenum substrate laminated with a carbon coating on the front surface is provided to a plasma-confining vacuum container. Fast electrons generated from plasma collide against the magnetic limiter and they are stopped by the carbon layer for suppressing the braking radiation, whereby the braking radiation is ended and the X-rays are decayed by the molybdenum layer. This can decrease the amount of X-rays irradiated on the coil. (Kawakami, Y.)
Universality, marginal operators, and limit cycles
International Nuclear Information System (INIS)
Glazek, Stanislaw D.; Wilson, Kenneth G.
2004-01-01
The universality of renormalization-group limit-cycle behavior is illustrated with a simple discrete Hamiltonian model. A nonperturbative renormalization-group equation for the model is soluble analytically at criticality and exhibits one marginal operator (made necessary by the limit cycle) and an infinite set of irrelevant operators. Relevant operators are absent. The model exhibits an infinite series of bound-state energy eigenvalues. This infinite series approaches an exact geometric series as the eigenvalues approach zero--also a consequence of the limit cycle. Wegner's eigenvalues for irrelevant operators are calculated generically for all choices of parameters in the model. We show that Wegner's eigenvalues are independent of location on the limit cycle, in contrast with Wegner's operators themselves, which vary depending on their location on the limit cycle. An example is then used to illustrate numerically how one can tune the initial Hamiltonian to eliminate the first two irrelevant operators. After tuning, the Hamiltonian's bound-state eigenvalues converge much more quickly than otherwise to an exact geometric series
Limiting factors in caribou population ecology
Directory of Open Access Journals (Sweden)
David R. Klein
1991-10-01
Full Text Available Caribou and wild reindeer populations fluctuate over time. On this fact there is general agreement. Factors responsible for population limitation and subsequent declines have been examined within the framework of animal population theory. There is, however, little agreement when factors limiting specific populations are generalized to Rangifer populations over broad geographic regions. Comparative examinations of wild Rangifer populations worldwide discloses that factors that have regulated those populations are highly variable between populations, apparently as a reflection of the differences in environmental variables unique to each population. Examples exist of populations where major regulating factors have been climatic extremes, predation, hunting mortality, food limitation, insects, parasites, disease, interspecific competition, and human developmental impacts or combinations of these factors. This diversity of limiting factors affecting caribou and wild reindeer populations is a reflection of the ecologial complexity of the species, a concept that has often been ignored in past efforts to reach management decisions by extrapolation from the limited localized knowledge available on the species.
Self-triggering superconducting fault current limiter
Yuan, Xing [Albany, NY; Tekletsadik, Kasegn [Rexford, NY
2008-10-21
A modular and scaleable Matrix Fault Current Limiter (MFCL) that functions as a "variable impedance" device in an electric power network, using components made of superconducting and non-superconducting electrically conductive materials. The matrix fault current limiter comprises a fault current limiter module that includes a superconductor which is electrically coupled in parallel with a trigger coil, wherein the trigger coil is magnetically coupled to the superconductor. The current surge doing a fault within the electrical power network will cause the superconductor to transition to its resistive state and also generate a uniform magnetic field in the trigger coil and simultaneously limit the voltage developed across the superconductor. This results in fast and uniform quenching of the superconductors, significantly reduces the burnout risk associated with non-uniformity often existing within the volume of superconductor materials. The fault current limiter modules may be electrically coupled together to form various "n" (rows).times."m" (columns) matrix configurations.
Fundamental gravitational limitations to quantum computing
International Nuclear Information System (INIS)
Gambini, R.; Porto, A.; Pullin, J.
2006-01-01
Lloyd has considered the ultimate limitations the fundamental laws of physics place on quantum computers. He concludes in particular that for an 'ultimate laptop' (a computer of one liter of volume and one kilogram of mass) the maximum number of operations per second is bounded by 10 51 . The limit is derived considering ordinary quantum mechanics. Here we consider additional limits that are placed by quantum gravity ideas, namely the use of a relational notion of time and fundamental gravitational limits that exist on time measurements. We then particularize for the case of an ultimate laptop and show that the maximum number of operations is further constrained to 10 47 per second. (authors)
The classical limit of W-algebras
International Nuclear Information System (INIS)
Figueroa-O'Farrill, J.M.; Ramos, E.
1992-01-01
We define and compute explicitly the classical limit of the realizations of W n appearing as hamiltonian structures of generalized KdV hierarchies. The classical limit is obtained by taking the commutative limit of the ring of pseudodifferential operators. These algebras - denoted w n - have free field realizations in which the generators are given by the elementary symmetric polynomials in the free fields. We compute the algebras explicitly and we show that they are all reductions of a new algebra w KP , which is proposed as the universal classical W-algebra for the w n series. As a deformation of this algebra we also obtain w 1+∞ , the classical limit of W 1+∞ . (orig.)
Recognizing limitations in eddy current testing
International Nuclear Information System (INIS)
Van Drunen, G.; Cecco, V.S.
1981-11-01
This paper addresses known limitations and constraints in eddy current nondestructive testing. Incomplete appreciation for eddy current limitations is believed to have contributed to both under-utilization and misapplication of the technique. Neither situation need arise if known limitations are recognized. Some, such as the skin depth effect, are inherent to electromagnetic test methods and define the role of eddy current testing. Others can be overcome with available technology such as surface probes to find circumferential cracks in tubes and magnetic saturation of ferromagnetic alloys to eliminate permeability effects. The variables responsible for limitations in eddy current testing are discussed and where alternative approaches exist, these are presented. Areas with potential for further research and development are also identified
Successional dynamics drive tropical forest nutrient limitation
Chou, C.; Hedin, L. O. O.
2017-12-01
It is increasingly recognized that nutrients such as N and P may significantly constrain the land carbon sink. However, we currently lack a complete understanding of these nutrient cycles in forest ecosystems and how to incorporate them into Earth System Models. We have developed a framework of dynamic forest nutrient limitation, focusing on the role of secondary forest succession and canopy gap disturbances as bottlenecks of high plant nutrient demand and limitation. We used succession biomass data to parameterize a simple ecosystem model and examined the dynamics of nutrient limitation throughout tropical secondary forest succession. Due to the patterns of biomass recovery in secondary tropical forests, we found high nutrient demand from rapid biomass accumulation in the earliest years of succession. Depending on previous land use scenarios, soil nutrient availability may also be low in this time period. Coupled together, this is evidence that there may be high biomass nutrient limitation early in succession, which is partially met by abundant symbiotic nitrogen fixation from certain tree species. We predict a switch from nitrogen limitation in early succession to one of three conditions: (i) phosphorus only, (ii) phosphorus plus nitrogen, or (iii) phosphorus, nitrogen, plus light co-limitation. We will discuss the mechanisms that govern the exact trajectory of limitation as forests build biomass. In addition, we used our model to explore scenarios of tropical secondary forest impermanence and the impacts of these dynamics on ecosystem nutrient limitation. We found that secondary forest impermanence exacerbates nutrient limitation and the need for nitrogen fixation early in succession. Together, these results indicate that biomass recovery dynamics early in succession as well as their connection to nutrient demand and limitation are fundamental for understanding and modeling nutrient limitation of the tropical forest carbon sink.
Dose limits for ionising radiation
International Nuclear Information System (INIS)
Gifford, D.
1989-01-01
Dose limits for exposure to ionising radiation are assessed to see if they give sufficient protection both for the occupationally exposed and for the general public. It is concluded that current limits give a level of safety that satisfies the necessary criteria in the light of present knowledge and further reductions would be unlikely to improve standards of safety. (author)
Oiticica: limites de uma experiência limite
Sara Cristiane Jara Grubert
2006-01-01
Este trabalho trata da trajetória artística de Hélio Oiticica, que se empenhou em entender e reformular o perfil do artista, seu lugar e papel na sociedade. Foi esse processo metódico e constante de experimentação e reflexão que o levou a expandir os limites dos suportes artísticos tradicionais, especialmente a partir de meados da década de 60. É realçada a importância da formação de Hélio Oiticica no Museu de Arte Moderna do Rio de Janeiro para sua atuação posterior, aberta ao diálogo com um...
Bennett, Crystal G; Hackney, Madeleine E
2018-06-01
Older adults with mobility limitations are at greater risk for aging-related declines in physical function. Line dancing is a popular form of exercise that can be modified, and is thus feasible for older adults with mobility limitations. The purpose of this study was to assess the effects of 8 weeks of line dancing on balance, muscle strength, lower extremity function, endurance, gait speed, and perceived mobility limitations. An experimental design randomly assigned older adults to either an 8-week line dancing or usual care group. The convenience sample consisted of 23 participants with mobility limitations (age range: 65-93 years). The intervention used simple routines from novice line dance classes. At baseline and at 8 weeks, balance, knee muscle strength, lower extremity function, endurance, gait speed, and mobility limitations were measured. ANCOVA tests were conducted on each dependent variable to assess the effects of the intervention over time. Results found significant positive differences for the intervention group in lower extremity function (p dancing significantly improved physical function and reduced self-reported mobility limitations in these individuals. Line dancing could be recommended by clinicians as a potential adjunct therapy that addresses mobility limitations. Implications for Rehabilitation Line dancing may be an alternative exercise for older adults who need modifications due to mobility limitations. Line dancing incorporates cognitive and motor control. Line dancing can be performed alone or in a group setting. Dancing improves balance which can reduce risk of falls.
Beam limiter for thermonuclear fusion devices
International Nuclear Information System (INIS)
Kaminsky, M.S.
1976-01-01
A beam limiter circumscribes the interior surface of a vacuum vessel to inhibit collisions of contained plasma and the vessel walls. The cross section of the material making up the limiter has a flatsided or slightly concave portion of increased width towards the plasma and portions of decreased width towards the interior surface of the vessel. This configuration is designed to prevent a major fraction of the material sputtered, vaporized and blistered from the limiter from reaching the plasma. It also allows adequate heat transfer from the wider to the narrower portions. The preferred materials for the beam limiter are solids of sintered, particulate materials of low atomic number with low vapor pressure and low sputtering and blistering yields. 7 claims, 3 figures
Limit of the radionuclides in granite
International Nuclear Information System (INIS)
Wang Shaling; Jiang Rangrong
2003-01-01
Granite is an important sort of building materials. Their radionuclide contents are limited by the national standard GB6566-2001 just as other building materials. This standard divides them into main materials and decorative materials, and relaxes the limit of the latter obviously. Owing to the consideration of public dose limit and environment protection, this method needs discussion. Otherwise, red granite contains high radionuclide contents relatively, especially the sort of Indian Red, and need be paid more attention
The Limited Liability Company: An Analysis
Wayne Wells; Gary Yoshimoto
1993-01-01
In recent years, businesses in many states have been given the opportunity to select a new form in which to conduct business called the limited liability company. This form provides the advantage of the personal liability protection of a corporation, while being taxed as a partnership. If most states create the limited liability company and current issues of uncertainty are favorably resolved, the limited liability company should become the most advantageous business form for most small and m...
On thermodynamic limits of entropy densities
Moriya, H; Van Enter, A
We give some sufficient conditions which guarantee that the entropy density in the thermodynamic limit is equal to the thermodynamic limit of the entropy densities of finite-volume (local) Gibbs states.
Impact limiter retention using a tape joint
International Nuclear Information System (INIS)
Gonzales, A.; Eakes, R.G.
1986-01-01
The Beneficial Uses Shipping System (BUSS) Cask employs polyurethane foam impact limiters that fit onto the ends of the cask. A foam impact limiter takes energy out of a system during a hypothetical accident condition by allowing foam crush and large deformations to occur. This, in turn, precludes high stresses or deformations from occurring to the cask. Because of the need to transmit significant amounts of heat to the environment, the BUSS cask impact limiters were designed to shield a minimum amount of the cask surface area. With this design impact limiter retention after the initial impact resulting from the 9 meter regulatory drops becomes a concern. Retention is essential to ensure the cask does not experience higher stresses during any secondary or rebound effects without impact limiters than it does during the 9 meter regulatory drop with impact limiters in place
Photonic limiters with enhanced dynamic range
Kononchuk, Rodion; Limberopoulos, Nicholaos; Anisimov, Igor; Vitebskiy, Ilya; Chabanov, Andrey
2018-02-01
Optical limiters transmit low intensity input light while blocking input light with the intensity exceeding certain limiting threshold. Conventional passive limiters utilize nonlinear optical materials, which are transparent at low light intensity and turn absorptive at high intensity. Strong nonlinear absorption, though, can result in over- heating and destruction of the limiter. Another problem is that the limiting threshold provided by the available optical material with nonlinear absorption is too high for many applications. To address the above problems, the nonlinear material can be incorporated in a photonic structure with engineered dispersion. At low intensity, the photonic structure can display resonant transmission via localized mode(s), while at high intensity the resonant transmission can disappear, and the entire stack can become highly re ective (not absorptive) within a broad frequency range. In the proposed design, the transition from the resonant transmission at low intensity to nearly total re ectivity at high intensity does not rely on nonlinear absorption; instead, it requires only a modest change in the refractive index of the nonlinear material. The latter implies a dramatic increase in the dynamic range of the limiter. The main idea is to eliminate the high-intensity resonant transmission by decoupling the localized (resonant) modes from the input light, rather than suppressing those modes using nonlinear absorption. Similar approach can be used for light modulation and switching.
Limited test data: The choice between confidence limits and inverse probability
International Nuclear Information System (INIS)
Nichols, P.
1975-01-01
For a unit which has been successfully designed to a high standard of reliability, any test programme of reasonable size will result in only a small number of failures. In these circumstances the failure rate estimated from the tests will depend on the statistical treatment applied. When a large number of units is to be manufactured, an unexpected high failure rate will certainly result in a large number of failures, so it is necessary to guard against optimistic unrepresentative test results by using a confidence limit approach. If only a small number of production units is involved, failures may not occur even with a higher than expected failure rate, and so one may be able to accept a method which allows for the possibility of either optimistic or pessimistic test results, and in this case an inverse probability approach, based on Bayes' theorem, might be used. The paper first draws attention to an apparently significant difference in the numerical results from the two methods, particularly for the overall probability of several units arranged in redundant logic. It then discusses a possible objection to the inverse method, followed by a demonstration that, for a large population and a very reasonable choice of prior probability, the inverse probability and confidence limit methods give the same numerical result. Finally, it is argued that a confidence limit approach is overpessimistic when a small number of production units is involved, and that both methods give the same answer for a large population. (author)
Laser-limiting materials for medical use
Podgaetsky, Vitaly M.; Kopylova, Tat'yana N.; Tereshchenko, Sergey A.; Reznichenko, Alexander V.; Selishchev, Sergey V.
2004-03-01
The important problem of modern laser medicine is the decrease of an exposure of biological tissues outside of an operational field and can be solved by optical radiation limiting. Organic dyes with reversibly darkening can be placed onto surfaces of irradiated tissues or can be introduced in solder for laser welding of vessels. The limiting properties of a set of nontoxic organic compounds were investigated. Nonlinear optical properties of dyes having reverse saturable absorption (pyran styryl derivatives, cyanine and porphyrine compounds) were studied under XeCl and YAG:Nd (II harmonics) lasers excitation. The effect of attenuation of a visible laser radiation is obtained for ethanol solutions of cyanines: radiation attenuation coefficient ( AC) = 25-35 at N/S = 100-250 MW/cm2. In water solutions of such compounds in UV spectrum range AC ~ 10. The spectral characteristics of compounds appeared expedient enough to operational use in laser limiters (broad passband in visible range of a spectrum). Under the data of Z-scanning (the scheme F/10) value AC ~ 70 was reached. The limiting of power laser radiation in visible (λ = 532 nm) and UV- (λ = 308 nm) spectral region and nanosecond pulse duration (7 -13 ns) across porphyrine solutions and their complexes with some metals (13 compounds) was investigated too. The comparative study of optical limiting dependence on intensity of laser radiation, solvent type and concentration of solutions was carried out for selecte wavelength. There was shown a possible use of pyran styryl derivatives DCM as limiters of visual laser radiation. To understand a mechanism of laser radiation limitation the light induced processes were experimentally and theoretically studied in organic molecules. The quantum-chemical investigation of one cyanine compound was carried out. There were noted the perspectives of laser radiation limiting by application of inverted schemes of traditional laser shutters. Usage of phenomena of light -induced
Park, Donguk
2012-03-01
The aim of this review was to assess current knowledge related to the occupational exposure limit (OEL) for fluid aerosols including either mineral or chemical oil that are generated in metalworking operations, and to discuss whether their OEL can be appropriately used to prevent several health risks that may vary among metalworking fluid (MWF) types. The OEL (time-weighted average; 5 mg/m(3), short-term exposure limit ; 15 mg/m(3)) has been applied to MWF aerosols without consideration of different fluid aerosol-size fractions. The OEL, is also based on the assumption that there are no significant differences in risk among fluid types, which may be contentious. Particularly, the health risks from exposure to water-soluble fluids may not have been sufficiently considered. Although adoption of The National Institute for Occupational Safety and Health's recommended exposure limit for MWF aerosol (0.5 mg/m(3)) would be an effective step towards minimizing and evaluating the upper respiratory irritation that may be caused by neat or diluted MWF, this would fail to address the hazards (e.g., asthma and hypersensitivity pneumonitis) caused by microbial contaminants generated only by the use of water-soluble fluids. The absence of an OEL for the water-soluble fluids used in approximately 80-90 % of all applicants may result in limitations of the protection from health risks caused by exposure to those fluids.
Marcum, Jeremy W.; Olson, Sandra L.; Ferkul, Paul V.
2016-01-01
The axisymmetric rod geometry in upward axial stagnation flow provides a simple way to measure normal gravity blowoff limits to compare with microgravity Burning and Suppression of Solids - II (BASS-II) results recently obtained aboard the International Space Station. This testing utilized the same BASS-II concurrent rod geometry, but with the addition of normal gravity buoyant flow. Cast polymethylmethacrylate (PMMA) rods of diameters ranging from 0.635 cm to 3.81 cm were burned at oxygen concentrations ranging from 14 to 18% by volume. The forced flow velocity where blowoff occurred was determined for each rod size and oxygen concentration. These blowoff limits compare favorably with the BASS-II results when the buoyant stretch is included and the flow is corrected by considering the blockage factor of the fuel. From these results, the normal gravity blowoff boundary for this axisymmetric rod geometry is determined to be linear, with oxygen concentration directly proportional to flow speed. We describe a new normal gravity 'upward flame spread test' method which extrapolates the linear blowoff boundary to the zero stretch limit in order to resolve microgravity flammability limits-something current methods cannot do. This new test method can improve spacecraft fire safety for future exploration missions by providing a tractable way to obtain good estimates of material flammability in low gravity.
Hadron collider luminosity limitations
Evans, Lyndon R
1992-01-01
The three colliders operated to date have taught us a great deal about the behaviour of both bunched and debunched beams in storage rings. The main luminosity limitations are now well enough understood that most of them can be stronglu attenuated or eliminated by approriate design precautions. Experience with the beam-beam interaction in both the SPS and the Tevatron allow us to predict the performance of the new generation of colliders with some degree of confidence. One of the main challenges that the accelerator physicist faces is the problem of the dynamic aperture limitations due to the lower field quality expected, imposed by economic and other constraints.
High density regimes and beta limits in JET
International Nuclear Information System (INIS)
Smeulders, P.
1990-01-01
Results are first presented on the density limit in JET discharges with graphite (C), Be gettered graphite and Be limiters. There is a clear improvement in the case of Be limiters. The Be gettered phase showed no increase in the gas fueled density limit, except with Ion Cyclotron Resonance Heating (ICRH), but, the limit changed character. During MARFE-formation, any further increase in density was prevented, leading to a soft density limit. The soft density limit was a function of input power and impurity content with a week dependence on q. Helium and pellet fuelled discharges exceeded the gas-fuelled global density limits, but essentially had the same edge limit. In the second part, results are presented of high β operation in low-B Double-Null (DN) X-point configurations with Be-gettered carbon target plates. The Troyon limit was reached during H-mode discharges and toroidal β values of 5.5% were obtained. At high beta, the sawteeth were modified and characterised by very rapid heat-waves and fishbone-like pre- and post-cursors with strongly ballooning character. 17 refs., 5 figs
Derived limits for surface contamination
Wrixon, A D; Linsley, G S; White, D F
1979-01-01
Derived limits (DLs) for surface contamination were first established for use in the nuclear energy industry where a wide variety of radionuclides is encountered. They were later used in factories, hospitals, and universities, where the radionuclides used are normally fewer in number, either known or readily identifiable, and often of low toxicity. In these situations the current limits are frequently over-restrictive. This report describes a reassessment of the values in the light of more recent information on the possible pathways of exposure and the dose equivalent limits given in ICRP Publication 26. The reassessment is prompted also by the introduction of SI units. The results of the reassessment are used to produce a classification of DLs for all radionuclides for active and inactive area surfaces and for skin.
Space-charge limits in linear accelerators
International Nuclear Information System (INIS)
Wangler, T.P.
1980-12-01
This report presents equations that allow an approximate evaluation of the limiting beam current for a large class of radio-frequency linear accelerators, which use quadrupole strong focusing. Included are the Alvarez, the Wideroe, and the radio-frequency quadrupole linacs. The limiting-current formulas are presented for both the longitudinal and the transverse degrees of freedom by assuming that the average space-charge force in the beam bunch arises from a uniformly distributed charge within an azimuthally symmetric three-dimensional ellipsoid. The Mathieu equation is obtained as an approximate, but general, form for the transverse equation of motion. The smooth-approximation method is used to obtain a solution and an expression for the transverse current limit. The form of the current-limit formulas for different linac constraints is discussed
HELIOS: Application for criticality limits assessment
International Nuclear Information System (INIS)
Simeonov, T.
2011-01-01
In the early years, after the discovery of fission, the criticality safety assessment and the established safety limits, have been mainly based on direct experiments. Later, following the advances in the theory, computational methods and computer hardware, theoretical methods have been elaborated to the level to become reliable assessment tools. The computer codes started replacing the experiments, while the experimental data became a valuable validation source for their models. An application of the two-dimensional transport theory code HELIOS for assessment of criticality limits is presented in this paper. The effect of the enrichment, the system dimensions, H/U5 ration and different reflectors were studied in heterogeneous and homogenized systems. Comparisons with published experimental data and evaluated safety limits are made here to demonstrate the range of HELIOS applicability and limitations. (Author)
Limiting effects in double EEX beamline
Ha, G.; Power, J. G.; Conde, M.; Doran, D. S.; Gai, W.
2017-07-01
The double emittance exchange (EEX) beamline is suggested to overcome the large horizontal emittance and transverse jitter issues associated with the single EEX beamline while preserving its powerful phase-space manipulation capability. However, the double EEX beamline also has potential limitations due to coherent synchrotron radiation (CSR) and transverse jitter. The former limitation arises because double EEX uses twice as many bending magnets as single EEX which means stronger CSR effects degrading the beam quality. The latter limitation arises because a longitudinal jitter in front of the first EEX beamline is converted into a transverse jitter in the middle section (between the EEX beamlines) which can cause beam loss or beam degradation. In this paper, we numerically explore the effects of these two limitations on the emittance and beam transport.
Limiting effects in double EEX beamline
International Nuclear Information System (INIS)
Ha, G; Power, J G; Conde, M; Doran, D S; Gai, W
2017-01-01
The double emittance exchange (EEX) beamline is suggested to overcome the large horizontal emittance and transverse jitter issues associated with the single EEX beamline while preserving its powerful phase-space manipulation capability. However, the double EEX beamline also has potential limitations due to coherent synchrotron radiation (CSR) and transverse jitter. The former limitation arises because double EEX uses twice as many bending magnets as single EEX which means stronger CSR effects degrading the beam quality. The latter limitation arises because a longitudinal jitter in front of the first EEX beamline is converted into a transverse jitter in the middle section (between the EEX beamlines) which can cause beam loss or beam degradation. In this paper, we numerically explore the effects of these two limitations on the emittance and beam transport. (paper)
Rivest, Sébastien; Vellend, Mark
2018-01-01
Studies of species' range limits focus most often on abiotic factors, although the strength of biotic interactions might also vary along environmental gradients and have strong demographic effects. For example, pollinator abundance might decrease at range limits due to harsh environmental conditions, and reduced plant density can reduce attractiveness to pollinators and increase or decrease herbivory. We tested for variation in the strength of pollen limitation and herbivory by ungulates along a gradient leading to the upper elevational range limits of Trillium erectum (Melanthiaceae) and Erythronium americanum (Liliaceae) in Mont Mégantic National Park, Québec, Canada. In T. erectum, pollen limitation was higher at the range limit, but seed set decreased only slightly with elevation and only in one of two years. In contrast, herbivory of T. erectum increased from 60% at the upper elevational range limit. In E. americanum , we found no evidence of pollen limitation despite a significant decrease in seed set with elevation, and herbivory was low across the entire gradient. Overall, our results demonstrate the potential for relatively strong negative interactions (herbivory) and weak positive interactions (pollination) at plant range edges, although this was clearly species specific. To the extent that these interactions have important demographic consequences-highly likely for herbivory on Trillium , based on previous studies-such interactions might play a role in determining plant species' range limits along putatively climatic gradients.
New Penrose limits and AdS/CFT
DEFF Research Database (Denmark)
Grignani, Gianluca; Harmark, Troels; Marini, Andrea
2010-01-01
We find a new Penrose limit of AdS 5 × S 5 giving the maximally supersymmetric pp-wave background with two explicit space-like isometries. This is an important missing piece in studying the AdS/CFT correspondence in certain subsectors. In particular whereas the Penrose limit giving one space......-like isometry is useful for the SU(2) sector of N = 4 SYM, this new Penrose limit is instead useful for studying the SU(2|3) and SU(1, 2|3) sectors. In addition to the new Penrose limit of AdS 5 × S 5 we also find a new Penrose limit of AdS4 × ℂP 3....
Directory of Open Access Journals (Sweden)
Younès, Chris
2006-11-01
Full Text Available La manière de tracer des limites et d’opérer des passages par transferts, incursions, interférences notamment, rend compte du mode d’expression propre à l’architecture et de sa façon d’agencer le stable et l’instable, le délimité et l’illimité, la mesure et l’incommensurable, la continuité et la discontinuité. L’art de les mettre en œuvre par le projet architectural, urbain et paysager est une des problématiques de recherche du laboratoire interdisciplinaire Gerjau (philosophie architecture urbain qui a conduit différentes études sur ce sujet et en particulier du point de vue des rapports entre nature et culture./The way in which limits are drawn and passageways are operated for transfers, incursions, and specially interferences, show how architecture has it’s own way of expression that deals with the stable and the unstable, the limited and the unlimited, etc.
Allen Greb, G.; Johnson, Gerald W.
1983-10-01
Following World War II, American scientists and politicians proposed in the Baruch plan a radical solution to the problem of nuclear weapons: to eliminate them forever under the auspices of an international nuclear development authority. The Soviets, who as yet did not possess the bomb, rejected this plan. Another approach suggested by Secretary of War Henry Stimson to negotiate directly with the Soviet Union was not accepted by the American leadership. These initial arms limitation failures both reflected and exacerbated the hostile political relationship of the superpowers in the 1950s and 1960s. Since 1969, the more modest focus of the Soviet-American arms control process has been on limiting the numbers and sizes of both defensive and offensive strategic systems. The format for this effort has been the Strategic Arms Limitatins Talks (Salt) and more recently the Strategic Arms Reduction Talks (START). Both sides came to these negotiations convinced that nuclear arsenals had grown so large that some for of mutual restraint was needed. Although the SALT/START process has been slow and ponderous, it has produced several concrete the agreements and collateral benefits. The 1972 ABM Treaty restricts the deployment of ballistic missile defense systems, the 1972 Interim Agreement places a quantitative freeze on each side's land based and sea based strategic launchers, and the as yet unratified 1979 SALT II Treaty sets numerical limits on all offensive strategic systems and sublimits on MIRVed systems. Collateral benefits include improved verification procedures, working definitions and counting rules, and permanent bureaucratic apparatus which enhance stability and increase the chances for achieving additional agreements.
Tokamak advanced pump limiter experiments and analysis
International Nuclear Information System (INIS)
Conn, R.W.
1983-06-01
Experiments with pump limiter modules on several operating tokamaks establish such limiters as efficient collectors of particles and has demonstrated the importance of ballistic scattering as predicted theoretically. Plasma interaction with recycling neutral gas appears to become important as the plasma density increases and the effective ionization mean free path within the module decreases. In limiters with particle collection but without active internal pumping, the neutral gas pressure is found to vary nonlinearly with the edge plasma density at the highest densities studies. Both experiments and theory indicate that the energy spectrum of gas atoms in the pump ducting is non-thermal, consistent with the results of Monte Carlo neutral atom transport calculations. The distribution of plasma power over the front surface of such modules has been measured and appears to be consistent with the predictions of simple theory. Initial results from the latest experiment on the ISX-B tokamak with an actively pumped limiter module demonstrates that the core plasma density can be controlled with a pump limiter and that the scrape-off layer plasma can partially screen the core plasma from gas injection. The results from module pump limiter experiments and from the theory and design analysis of advanced pump limiters for reactors are used to suggest the major features of a definitive, axisymmetric, toroidal belt pump limiter experiment
Quantum speed limits for Bell-diagonal states
International Nuclear Information System (INIS)
Han Wei; Jiang Ke-Xia; Zhang Ying-Jie; Xia Yun-Jie
2015-01-01
The lower bounds of the evolution time between two distinguishable states of a system, defined as quantum speed limit time, can characterize the maximal speed of quantum computers and communication channels. We study the quantum speed limit time between the composite quantum states and their target states in the presence of nondissipative decoherence. For the initial states with maximally mixed marginals, we obtain the exact expressions of the quantum speed limit time which mainly depend on the parameters of the initial states and the decoherence channels. Furthermore, by calculating the quantum speed limit time for the time-dependent states started from a class of initial states, we discover that the quantum speed limit time gradually decreases in time, and the decay rate of the quantum speed limit time would show a sudden change at a certain critical time. Interestingly, at the same critical time, the composite system dynamics would exhibit a sudden transition from classical decoherence to quantum decoherence. (paper)
Equilibrium 𝛽-limits in classical stellarators
Loizu, J.; Hudson, S. R.; Nührenberg, C.; Geiger, J.; Helander, P.
2017-12-01
A numerical investigation is carried out to understand the equilibrium -limit in a classical stellarator. The stepped-pressure equilibrium code (Hudson et al., Phys. Plasmas, vol. 19 (11), 2012) is used in order to assess whether or not magnetic islands and stochastic field-lines can emerge at high . Two modes of operation are considered: a zero-net-current stellarator and a fixed-iota stellarator. Despite the fact that relaxation is allowed (Taylor, Rev. Mod. Phys., vol. 58 (3), 1986, pp. 741-763), the former is shown to maintain good flux surfaces up to the equilibrium -limit predicted by ideal-magnetohydrodynamics (MHD), above which a separatrix forms. The latter, which has no ideal equilibrium -limit, is shown to develop regions of magnetic islands and chaos at sufficiently high , thereby providing a `non-ideal -limit'. Perhaps surprisingly, however, the value of at which the Shafranov shift of the axis reaches a fraction of the minor radius follows in all cases the scaling laws predicted by ideal-MHD. We compare our results to the High-Beta-Stellarator theory of Freidberg (Ideal MHD, 2014, Cambridge University Press) and derive a new prediction for the non-ideal equilibrium -limit above which chaos emerges.
17 CFR 210.8-07 - Limited partnerships.
2010-04-01
..., PUBLIC UTILITY HOLDING COMPANY ACT OF 1935, INVESTMENT COMPANY ACT OF 1940, INVESTMENT ADVISERS ACT OF... Reporting Companies § 210.8-07 Limited partnerships. (a) Smaller reporting companies that are limited... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Limited partnerships. 210.8-07...
Should nuclear liability limits be removed. No
International Nuclear Information System (INIS)
Pape, E.C.
1985-01-01
The opposing view to the proposition that limits on nuclear liability under the Price-Anderson Act should be removed cites the historical recognition of the need to protect the public as it was defined in 1957. The limit on liability today is $630 million per nuclear incident, with total protection continuing to increase as new plants come on line and additional purchased insurance becomes available. The limit gives the industry an incentive to commit capital and technical resources to develop new technology. Removing the limit would increase costs, but not benefits, for electric consumers, and would require a new way to protect the public other than through purchased insurance or the utility's resources. The industry will support raising the limit, however
Limiting law excess sum rule for polyelectrolytes.
Landy, Jonathan; Lee, YongJin; Jho, YongSeok
2013-11-01
We revisit the mean-field limiting law screening excess sum rule that holds for rodlike polyelectrolytes. We present an efficient derivation of this law that clarifies its region of applicability: The law holds in the limit of small polymer radius, measured relative to the Debye screening length. From the limiting law, we determine the individual ion excess values for single-salt electrolytes. We also consider the mean-field excess sum away from the limiting region, and we relate this quantity to the osmotic pressure of a dilute polyelectrolyte solution. Finally, we consider numerical simulations of many-body polymer-electrolyte solutions. We conclude that the limiting law often accurately describes the screening of physical charged polymers of interest, such as extended DNA.
Mitigating greenhouse: Limited time, limited options
International Nuclear Information System (INIS)
Moriarty, Patrick; Honnery, Damon
2008-01-01
Most human-caused climate change comes from fossil fuel combustion emissions. To avoid the risk of serious climate change, very recent research suggests that emission reductions will need to be both large and rapidly implemented. We argue that technical solutions-improving energy efficiency, use of renewable and nuclear energy, and carbon capture and sequestration-can only be of minor importance, mainly given the limited time available to take effective climate action. Only curbing energy use, perhaps through 'social efficiency' gains, particularly in the high-energy consumption countries, can provide the rapid emissions reductions needed. The social efficiency approach requires a basic rethinking in how we can satisfy our human needs with low environmental impacts. Large cuts in emissions could then occur rapidly, but only if resistance to such changes can be overcome. Particularly in transport, there are also serious potential conflicts between the technical and the social efficiency approaches, requiring a choice to be made
Limited Memory, Categorization, and Competition
Yuxin Chen; Ganesh Iyer; Amit Pazgal
2010-01-01
This paper investigates the effects of a limited consumer memory on the price competition between firms. It studies a specific aspect of memory--namely, the categorization of available price information that the consumers may need to recall for decision making. This paper analyzes competition between firms in a market with uninformed consumers who do not compare prices, informed consumers who compare prices but with limited memory, and informed consumers who have perfect memory. Consumers, aw...
Beam limiter for thermonuclear fusion devices
International Nuclear Information System (INIS)
Kaminsky, M.S.
1977-01-01
The invention pertains to a beam limiter to prevent collisions between a plasma and the inner surface of a hollow body in which the plasma is confined. The patent claims pertain to suitable geometrical shapes of the beam limiter. (GG) [de
34 CFR 300.27 - Limited English proficient.
2010-07-01
... 34 Education 2 2010-07-01 2010-07-01 false Limited English proficient. 300.27 Section 300.27... CHILDREN WITH DISABILITIES General Definitions Used in This Part § 300.27 Limited English proficient. Limited English proficient has the meaning given the term in section 9101(25) of the ESEA. (Authority: 20...
Directory of Open Access Journals (Sweden)
Donguk Park
2012-03-01
Full Text Available The aim of this review was to assess current knowledge related to the occupational exposure limit (OEL for fluid aerosols including either mineral or chemical oil that are generated in metalworking operations, and to discuss whether their OEL can be appropriately used to prevent several health risks that may vary among metalworking fluid (MWF types. The OEL (time-weighted average; 5 mg/m3, short-term exposure limit ; 15 mg/m3 has been applied to MWF aerosols without consideration of different fluid aerosol-size fractions. The OEL, is also based on the assumption that there are no significant differences in risk among fluid types, which may be contentious. Particularly, the health risks from exposure to water-soluble fluids may not have been sufficiently considered. Although adoption of The National Institute for Occupational Safety and Health's recommended exposure limit for MWF aerosol (0.5 mg/m3 would be an effective step towards minimizing and evaluating the upper respiratory irritation that may be caused by neat or diluted MWF, this would fail to address the hazards (e.g., asthma and hypersensitivity pneumonitis caused by microbial contaminants generated only by the use of water-soluble fluids. The absence of an OEL for the water-soluble fluids used in approximately 80-90 % of all applicants may result in limitations of the protection from health risks caused by exposure to those fluids.
A constant heat flux plasma limiter for TEXTOR
International Nuclear Information System (INIS)
Mioduszewski, P.
1980-10-01
In future large tokamak machines heat removal from the plasma is going to play an important role. In TEXTOR the total plasma power is expected to be in the range of 0.5-2.5 MW. Typical fractions of about 50% of this power have to be removed from the plasma by limiters. The power flux from the limiter scrape-off layer to the limiter surface decays rapidly with distance into the scrape-off layer resulting in a highly space-dependent heat load on the limiter. Therefore, limiters are shaped in a way to smooth of the heat load, and the ideal limiter shape should produce a constant heat flux over the whole limiter surface. The ideally shaped limiter offers a better chance to handle the high heat loads with the preferred materials like stainless steel (or inconel 625 as in the case of TEXTOR). (orig./GG)
Magnetic and material limiter discharges in Tokapole II
International Nuclear Information System (INIS)
Moyer, R.A.
1988-01-01
Disruptive instabilities have been studied in Tokapole II, a small poloidal divertor tokamak, in magnetic and material limiter configurations. In the magnetic limiter configuration, the divertor separatrix defines the tokamak current channel boundary. Limiters or neutralizer plates are not used to remove plasma in the scrape-off region. The relatively hot, dense plasma in the scrape-off region carries 5--20% of the current. In the material limiter configuration, limiter plates are inserted to the separatrix to remove plasma and current in the scrape-off region. The plates vary the tokamak current channel boundary condition in a controlled manner, and provide a benchmark for comparison with other tokamaks. Internal and external disruptions have been studied, and several unique features in the magnetic limiter configuration have been identified. The magnitic limiter configuration enables routine passing of the stability barriers at q(a) = 2 and q(a) = 1, where q(a) is the the edge safety factor, without a close fitting wall, external windings, or detailed profile control techniques. Passing the q(a) = 1 barrier permits operation in the q < 1 regime where total reconnection of the sawtooth does not occur. Discharges with q < 1 are also obtained in the material limiter configuration, suggesting that partial reconnection is characteristic of the sawteeth, and not the magnetic limiter configuration. The magnetic limiter configuration suppresses current termination in a major disruption. Current termination occurs in material limiter discharges due to enhanced interaction with the inboard limiter following the post-disruptive shift in major radius
Pushing the limits of NAA. Accuracy, uncertainty and detection limits
International Nuclear Information System (INIS)
Greenberg, R.R.
2008-01-01
This paper describes some highlights from the author's efforts to improve neutron activation analysis (NAA) detection limits through development and optimization of radiochemical separations, as well as to improve the overall accuracy of NAA measurements by identifying, quantifying and reducing measurement biases and uncertainties. Efforts to demonstrate the metrological basis of NAA, and to establish it as a 'Primary Method of Measurement' will be discussed. (author)
Flux-limited diffusion models in radiation hydrodynamics
International Nuclear Information System (INIS)
Pomraning, G.C.; Szilard, R.H.
1993-01-01
The authors discuss certain flux-limited diffusion theories which approximately describe radiative transfer in the presence of steep spatial gradients. A new formulation is presented which generalizes a flux-limited description currently in widespread use for large radiation hydrodynamic calculations. This new formation allows more than one Case discrete mode to be described by a flux-limited diffusion equation. Such behavior is not extant in existing formulations. Numerical results predicted by these flux-limited diffusion models are presented for radiation penetration into an initially cold halfspace. 37 refs., 5 figs
Impact-limiting materials characterization
International Nuclear Information System (INIS)
Glass, R.E.; Duffey, T.A.; McConnell, P.
1993-01-01
Three types of impact-limiting materials have been characterized which have applications in packages for the transport of radioactive materials. These materials are aluminum honeycombs, polyurethane foams, and aluminum foams. The results of the materials characterization have indicated strengths and weaknesses for each type of material. The polyurethane foams provide good impact limiting ability and excellent thermal insulation. However, they burn when subjected to the regulatory thermal event in the presence of air. The aluminum honeycombs provide excellent impact resistance in specific impact orientations. However, they provide relatively poor resistance to thermal assault. Finally, the aluminum foams exhibit relatively poor impact energy absorption capacities, significant variability in energy absorption, and limited thermal insulation. The development of the figures of merit examined the response of the materials to the impact event with the intent of maximizing the energy absorption of the materials with respect to either the volume or mass of the materials. Three figures of merit will be presented for the structural response. The figure of merit for the thermal event is based on minimizing the heat flux to the containment boundary. The paper presents a discussion of the test methods, a summary of the data and the figures of merit for each material. (J.P.N.)
47 CFR 74.663 - Modulation limits.
2010-10-01
... 47 Telecommunication 4 2010-10-01 2010-10-01 false Modulation limits. 74.663 Section 74.663 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) BROADCAST RADIO SERVICES EXPERIMENTAL RADIO... Stations § 74.663 Modulation limits. If amplitude modulation is employed, negative modulation peaks shall...
Compliance of feed limits, does not mean compliance of food limits
Raamsdonk, van L.W.D.; Eijkeren, van J.C.H.; Meijer, G.A.L.; Rennen, M.; Zeilmaker, M.J.; Hoogenboom, L.A.P.; Mengelers, M.J.B.
2009-01-01
The carry-over of contaminants from feed to animal food products is an important aspect of the animal production chain. For a proper containment, limits for feed as well food products are fixed for a series of chemicals, e.g. dioxins and dioxin-like PCBs, lead, cadmium, some chlorinated pesticides,
Noncommuting limits of oscillator wave functions
International Nuclear Information System (INIS)
Daboul, J.; Pogosyan, G. S.; Wolf, K. B.
2007-01-01
Quantum harmonic oscillators with spring constants k > 0 plus constant forces f exhibit rescaled and displaced Hermite-Gaussian wave functions, and discrete, lower bound spectra. We examine their limits when (k, f) → (0, 0) along two different paths. When f → 0 and then k → 0, the contraction is standard: the system becomes free with a double continuous, positive spectrum, and the wave functions limit to plane waves of definite parity. On the other hand, when k → 0 first, the contraction path passes through the free-fall system, with a continuous, nondegenerate, unbounded spectrum and displaced Airy wave functions, while parity is lost. The subsequent f → 0 limit of the nonstandard path shows the dc hysteresis phenomenon of noncommuting contractions: the lost parity reappears as an infinitely oscillating superposition of the two limiting solutions that are related by the symmetry
ICRP-recommendations on dose limits for workers
International Nuclear Information System (INIS)
Beninson, D.J.
1976-01-01
Dose limits proposed by the ICRP have been incorporated in most national and international standards and their respect has caused a distribution of doses with a average not exceeding 1/10 of the maximum permissible dose. This distribution corresponds to a risk which is well within the risks in 'safe industries'. There are at present some inconsistancies in the current system of recommended limits, for example having the same limit of 5 rem for the whole-body and also for some organs. Hopefully, this incosistancy will be removed in the next recommendation of the ICRP. But the whole-body limit of 5 rem in a year has been safe and there is little ground to reduce this limit on the basis of comparisons with 'safe industries'. (orig./HP) [de
Poročanje o sporu glede otočja Diaoyu/Diaoyutai/Senkaku v izbranih slovenskih medijih
Directory of Open Access Journals (Sweden)
Sasa ISTENIČ
2015-07-01
Full Text Available The dispute over the sovereignty of the Diaoyu/Diaoyutai/Senkaku islands remains a source of significant international tension. Given that any miscalculation could lead to a war with unimaginable consequences, the issue has gained media attention across the world. Buttressed with the general newsworthiness of an international conflict, Slovene media has also been attentive to report on the islands’ controversy. Although the remote East Asian region is far down the list of Slovenia’s priorities and ambitions of its politicians, national commercial considerations are connected with a stable and secure environment in East Asia. By applying a combined quantitative and qualitative content analysis of the news stories on the dispute published in Slovene major print and online daily newspapers between 2010 and 2013, the present paper examines Slovene media’s coverage of the islands’ dispute.
Philosophy as news: bioethics, journalism and public policy.
Goodman, K W
1999-04-01
News media accounts of issues in bioethics gain significance to the extent that the media influence public policy and inform personal decision making. The increasingly frequent appearance of bioethics in the news thus imposes responsibilities on journalists and their sources. These responsibilities are identified and discussed, as is (i) the concept of "news-worthiness" as applied to bioethics, (ii) the variable quality of bioethics reportage and (iii) journalists' reliance on ethicists to pass judgment. Because of the potential social and other benefits of high quality reporting on ethical issues, it is argued that journalists and their bioethics sources should explore and accommodate more productive relationships. An optimal journalism-ethics relationship will be one characterized by "para-ethics," in which journalistic constraints are noted but also in which issues and arguments are presented without oversimplification and credible disagreement is given appropriate attention.
International Nuclear Information System (INIS)
Vasseur, G.
1996-03-01
Is the photon mass strictly null as it is told in quantum electrodynamics. In fact, a coherent theory can be build with a massive photon. Experiences have been regularly led to try to make obvious an eventual non null photon mass. Superior limits more and more strict have been found. Here is given a general survey of the consequences of a non null photon mass, different methods to measure it and the achieved limits. (author). 30 refs., 1 fig
Major Limitations of Satellite images
Al-Wassai, Firouz A.; Kalyankar, N. V.
2013-01-01
Remote sensing has proven to be a powerful tool for the monitoring of the Earth surface to improve our perception of our surroundings has led to unprecedented developments in sensor and information technologies. However, technologies for effective use of the data and for extracting useful information from the data of Remote sensing are still very limited since no single sensor combines the optimal spectral, spatial and temporal resolution. This paper briefly reviews the limitations of satelli...
Pump limiter experiment in the TFR tokamak
International Nuclear Information System (INIS)
Anon.
1987-01-01
Pump limiter experiments are carried out in the TFR Tokamak. The first TFR pump limiter is located in the outer part of the torus, its double-throat head is made of graphite tiles, the neutralizer plates are made of stainless steel, and it is pumped by a 3500 l s -1 titanium sublimation pump. The first attempts showed that the exhaust efficiency ε of this pump limiter was low (1.5% of the total plasma particle efflux). To improve on these results, a new limiter head with a single longer throat has been built. The particles were better trapped and the pumping achieved an important decrease of the recycling coefficient. Geometric features and also the highly non linear regime of pressure in the pump limiter as a function of the density at the entrance slot could explain the increase by a factor 3.5 of the exhaust efficiency (ε = 5%). Ion temperatures of the order of a few eV have been deduced from Doppler broadening measurements at the neutralizer plate of the pump limiter. (orig.)
ITER Operating Limits and Conditions
International Nuclear Information System (INIS)
Ciattaglia, S.; Barabaschi, P.; Carretero, J.A.
2006-01-01
The Operating Limits and Conditions (OLCs) are operating parameters and conditions, chosen among all system/components, which together define the domain of the safe operation of ITER in all foreseen ITER status (operation, maintenance, commissioning). At the same time they are selected to guarantee the required operation flexibility which is a critical factor for the success of an experimental machine such as ITER. System and components important for personnel or public safety (Safety Important Class, SIC) are identified from the overall plant safety analysis on functional importance to safety of the components. SIC classification has to be presented already inside the preliminary safety analysis report and approved by the licensing safety authority before the relevant construction. OLCs comprise the safety limits, i.e. that if exceeded could result in a potential safety hazard, the relevant settings that determine the intervention of SIC systems and the operational limits on equipment which warn from or stop a functional departure from a planned operational status that could challenge equipment and functions. The safety limits have to indicate clearly states that leave the nominal safety state of ITER; they are derived from the safety analysis of ITER. OLCs can represent in some cases few parameters grouping together. Some operational conditions, e.g. inventories, will be controlled through no real time measurements and procedures. Operating experience from present tokamaks, in particular JET, and from nuclear plants is considered at the maximum possible extent. This paper presents the guidelines to develop the ITER OLCs with particular reference to safety limits. A few examples are reported as well as open issues on some OLCs control and measurement and the relevant R-and-D planned to solve the issues. (author)
Heat deposition on the partial limiter
International Nuclear Information System (INIS)
Itoh, Kimitaka; Itoh, Sanae-I; Nagasaki, Kazunobu.
1990-01-01
The effect of the partial limiter in the outermost magnetic surface of toroidal plasmas is studied. The power deposition on the partial limiter and its effect on the temperature profile are analysed. Interpretation in terms of the perpendicular heat conductivity is also discussed. (author)
Smooth massless limit of field theories
International Nuclear Information System (INIS)
Fronsdal, C.
1980-01-01
The massless limit of Fierz-Pauli field theories, describing fields with fixed mass and spin interacting with external sources, is examined. Results are obtained for spins, 1, 3/2, 2 and 3 using conventional models, and then for all half-integral spins in a relatively model-independent manner. It is found that the massless limit is smooth provided that the sources satisfy certain conditions. In the massless limit these conditions reduce to the conservation laws required by internal consistency of massless field theory. Smoothness simply requires that quantities that vanish in the massless case approach zero in a certain well-defined manner. (orig.)
Modular pump limiter systems for large tokamaks
International Nuclear Information System (INIS)
Uckan, T.; Klepper, C.C.; Mioduszewski, P.K.; McGrath, R.T.
1987-09-01
Long-pulse (>10-s) operation of large tokamaks with high-power (>10-MW) heating and extensive external fueling will require correspondingly efficient particle exhaust for density control. A pump limiter can provide the needed exhaust capability by removing a small percentage of the particles, which would otherwise be recycled. Single pump limiter modules have been operated successfully on ISX-B, PDX, TEXTOR, and PLT. An axisymmetric pump limiter is now being installed and will be studied in TEXTOR. A third type of pump limiter is a system that consists of several modules and exhibits performance different from that of a single module. To take advantage of the flexibility of a modular pump limiter system in a high-power, long-pulse device, the power load must be distributed among a number of modules. Because each added module changes the performance of all the others, a set of design criteria must be defined for the overall limiter system. The design parameters for the modules are then determined from the system requirements for particle and power removal. Design criteria and parameters are presented, and the impact on module design of the state of the art in engineering technology is discussed. The relationship between modules are considered from the standpoint of flux coverage and shadowing effects. The results are applied to the Tore Supra tokamak. A preliminary conceptual design for the Tore Supra pump limiter system is discussed, and the design parameters of the limiter modules are presented. 21 refs., 12 figs
Towards Improved Optical Limiters
National Research Council Canada - National Science Library
Huffman, Peter
2002-01-01
.... The first approach was to synthesize and study soluble thallium phthalocyanines. Thallium, due to its proximity to lead and indium on the periodic table, should exhibit favorable optical limiting properties...
ITER operating limit definition criteria
International Nuclear Information System (INIS)
Ciattaglia, S.; Barabaschi, P.; Carretero, J.A.; Chiocchio, S.; Hureau, D.; Girard, J.Ph.; Gordon, C.; Portone, A.; Rodrigo, L. Rodriguez; Roldan, C.; Saibene, G.; Uzan-Elbez, J.
2009-01-01
The operating limits and conditions (OLCs) are operating parameters and conditions, chosen among all system/components, which, together, define the domain of the safe operation of ITER in all foreseen ITER states (operation, maintenance, commissioning). At the same time they are selected to guarantee the required operation flexibility which is a critical factor for the success of an experimental machine such as ITER. System and components that are important for personnel or public safety (safety important class, SIC) are identified considering their functional importance in the overall plant safety analysis. SIC classification has to be presented already in the preliminary safety analysis report and approved by the licensing authority before manufacturing and construction. OLCs comprise the safety limits that, if exceeded, could result in a potential safety hazard, the relevant settings that determine the intervention of SIC systems, and the operational limits on equipment which warn against or stop a functional deviation from a planned operational status that could challenge equipment and functions. Some operational conditions, e.g. in-Vacuum Vessel (VV) radioactive inventories, will be controlled through procedures. Operating experience from present tokamaks, in particular JET, and from nuclear plants, is considered to the maximum possible extent. This paper presents the guidelines for the development of the ITER OLCs with particular reference to safety limits.
International Nuclear Information System (INIS)
Fried, H.M.; Avan, J.
2000-01-01
A new, non-perturbative, eikonal method called the ''quasi abelian limit'' (QAL) is suggested for high energy quark (nucleon) scattering involving the exchange of all possible, non-interacting, non-abelian gluons (mesons). With this method, those functional integrals defining, e.g., the exchange of color coordinates in quark-quark scattering, are replaced by a finite number of quadratures over a subset of their coordinates. Mathematically, this procedure is not rigourous, because an unjustified interchange of limits has been performed; physically, it corresponds to the observation that the non-perturbative sum over all color-moment fluctuations can vanish at arbitrarily high energies. The QAL generates a result in agreement with a corrected, ''contiguity'' calculation, when the latter is summed over all perturbative orders. (orig.)
Operational limits and disruptions in ITER
Energy Technology Data Exchange (ETDEWEB)
Tsunematsu, T; Mizoguchi, T; Yoshino, R [Japan Atomic Energy Research Inst., Tokyo (Japan); Borrass, K; Engelmann, F; Pacher, G; Pacher, H [Max-Planck-Institut fuer Plasmaphysik, Garching (Germany, F.R.). NET Design Team; Cohen, S; Post, D [Princeton Univ., NJ (USA). Plasma Physics Lab.; Hogan, J; Uckan, N A [Oak Ridge National Lab., TN (USA); Krasheninnikov, S; Mukhovatov, V; Parail, V
1990-12-15
Detailed knowledge of the operational limits for beta, q and the plasma density will be required for successful and flexible operation of ITER. In this paper, the present data base and guidelines on operational limits and disruptions in the ITER design are presented. 10 refs., 1 fig.
Quantum remnants in the classical limit
International Nuclear Information System (INIS)
Kowalski, A.M.; Plastino, A.
2016-01-01
We analyze here the common features of two dynamical regimes: a quantum and a classical one. We deal with a well known semi-classic system in its route towards the classical limit, together with its purely classic counterpart. We wish to ascertain i) whether some quantum remnants can be found in the classical limit and ii) the details of the quantum-classic transition. The so-called mutual information is the appropriate quantifier for this task. Additionally, we study the Bandt–Pompe's symbolic patterns that characterize dynamical time series (representative of the semi-classical system under scrutiny) in their evolution towards the classical limit. - Highlights: • We investigate the classical limit (CL) of a well known semi classical model. • The study is made by reference to the Bandt Pompe symbolic approach. • The number and type of associated symbols changes as one proceeds towards the CL. • We ascertain which symbols pertaining to the quantum zone remain in the CL.
Density limit studies on DIII-D
International Nuclear Information System (INIS)
Maingi, R.; Mahdavi, M.A.; Petrie, T.W.
1998-08-01
The authors have studied the processes limiting plasma density and successfully achieved discharges with density ∼50% above the empirical Greenwald density limit with H-mode confinement. This was accomplished by density profile control, enabled through pellet injection and divertor pumping. By examining carefully the criterion for MARFE formation, the authors have derived an edge density limit with scaling very similar to Greenwald scaling. Finally, they have looked in detail at the first and most common density limit process in DIII-D, total divertor detachment, and found that the local upstream separatrix density (n e sep,det ) at detachment onset (partial detachment) increases with the scrape-off layer heating power, P heat , i.e., n e sep,det ∼ P heat 0.76 . This is in marked contrast to the line-average density at detachment which is insensitive to the heating power. The data are in reasonable agreement with the Borass model, which predicted that the upstream density at detachment would increase as P heat 0.7
Stable convergence and stable limit theorems
Häusler, Erich
2015-01-01
The authors present a concise but complete exposition of the mathematical theory of stable convergence and give various applications in different areas of probability theory and mathematical statistics to illustrate the usefulness of this concept. Stable convergence holds in many limit theorems of probability theory and statistics – such as the classical central limit theorem – which are usually formulated in terms of convergence in distribution. Originated by Alfred Rényi, the notion of stable convergence is stronger than the classical weak convergence of probability measures. A variety of methods is described which can be used to establish this stronger stable convergence in many limit theorems which were originally formulated only in terms of weak convergence. Naturally, these stronger limit theorems have new and stronger consequences which should not be missed by neglecting the notion of stable convergence. The presentation will be accessible to researchers and advanced students at the master's level...
Quantum remnants in the classical limit
Energy Technology Data Exchange (ETDEWEB)
Kowalski, A.M., E-mail: kowalski@fisica.unlp.edu.ar [Instituto de Física (IFLP-CCT-Conicet), Universidad Nacional de La Plata, C.C. 727, 1900 La Plata (Argentina); Comision de Investigaciones Científicas (CIC) (Argentina); Plastino, A., E-mail: plastino@fisica.unlp.edu.ar [Instituto de Física (IFLP-CCT-Conicet), Universidad Nacional de La Plata, C.C. 727, 1900 La Plata (Argentina); Argentina' s National Research Council (CONICET) (Argentina); SThAR, EPFL Innovation Park, Lausanne (Switzerland)
2016-09-16
We analyze here the common features of two dynamical regimes: a quantum and a classical one. We deal with a well known semi-classic system in its route towards the classical limit, together with its purely classic counterpart. We wish to ascertain i) whether some quantum remnants can be found in the classical limit and ii) the details of the quantum-classic transition. The so-called mutual information is the appropriate quantifier for this task. Additionally, we study the Bandt–Pompe's symbolic patterns that characterize dynamical time series (representative of the semi-classical system under scrutiny) in their evolution towards the classical limit. - Highlights: • We investigate the classical limit (CL) of a well known semi classical model. • The study is made by reference to the Bandt Pompe symbolic approach. • The number and type of associated symbols changes as one proceeds towards the CL. • We ascertain which symbols pertaining to the quantum zone remain in the CL.
Time Limits : Effects on Recall
Hirano, Kinue
2000-01-01
This study investigates the effects of differing time limits and the level of language proficiency on the written recalls of 66 Japanese EFL undergraduates. Results showed that different time limits affected total recall, but not main ideas recalled. Regardless of proficiency level, the 20-minute group (Group 2) recalled a greater number of idea units than the 8-minute group (Group 1). However, no significant difference was found between Groups 1 and 2 regarding the recall of main ideas, alth...
International Nuclear Information System (INIS)
Mattas, R.F.; Billone, M.; Hassanein, A.
1996-08-01
The recent U.S. effort on the ITER (International Thermonuclear Experimental Reactor) shield has been focused on the limiter module design. This is a multi-disciplinary effort that covers design layout, fabrication, thermal hydraulics, materials evaluation, thermo- mechanical response, and predicted response during off-normal events. The results of design analyses are presented. Conclusions and recommendations are also presented concerning, the capability of the limiter modules to meet performance goals and to be fabricated within design specifications using existing technology
Department of Housing and Urban Development — Income limits used to determine the income eligibility of applicants for assistance under three programs authorized by the National Housing Act. These programs are...
U.S. Department of Health & Human Services — Affordable Care Act Federal Upper Limits (FUL) based on the weighted average of the most recently reported monthly average manufacturer price (AMP) for...
Experimental result of poloidal limiter baking of Aditya tokamak
International Nuclear Information System (INIS)
Jadeja, K.A.; Arambhadiya, B.G.; Bhatt, S.B.; Bora, D.
2005-01-01
In tokamak Aditya, Poloidal limiter function as the operational limiter and are subjected to very high particles load and heat flux during plasma discharge. In addition, Poloidal limiter is the first material surface to come in contact with the hot plasma. In plasma discharge, the impurity generations from limiter are mostly by adsorbed particles. The baking of limiter provides high degassing rate and thermal desorption of adsorbed particles of limiter to reduce impurities from the limiter tiles. The series of experiments are done with different conditions like, Baking of limiter SS ring by heating element with and without limiter tiles in atmosphere and vacuum. Than Poloidal limiter is structured with 14 numbers of graphite tiles and electrical isolated to the vessel and support structure. As a heating element and for electrical isolation, Nychrome wire and ceramic block with ceramic tubes are used. In addition, Thermo couple and two DC power supply (0-10 Ampere) are used for limiter baking. Mass analyzer gives partial pressures of different species to observe effect of limiter baking. For the period of Poloidal limiter baking in Aditya, the partial pressures of different species like hydrogen, water vapor, and oxygen are extremely increased with time duration. This paper presents series of experimental results of poloidal limiter baking. (author)
Open Platform for Limit Protection with Carefree Maneuver Applications
Jeram, Geoffrey J.
2004-01-01
This Open Platform for Limit Protection guides the open design of maneuver limit protection systems in general, and manned, rotorcraft, aerospace applications in particular. The platform uses three stages of limit protection modules: limit cue creation, limit cue arbitration, and control system interface. A common set of limit cue modules provides commands that can include constraints, alerts, transfer functions, and friction. An arbitration module selects the "best" limit protection cues and distributes them to the most appropriate control path interface. This platform adopts a holistic approach to limit protection whereby it considers all potential interface points, including the pilot's visual, aural, and tactile displays; and automatic command restraint shaping for autonomous limit protection. For each functional module, this thesis guides the control system designer through the design choices and information interfaces among the modules. Limit cue module design choices include type of prediction, prediction mechanism, method of critical control calculation, and type of limit cue. Special consideration is given to the nature of the limit, particularly the level of knowledge about it, and the ramifications for limit protection design, especially with respect to intelligent control methods such as fuzzy inference systems and neural networks.
47 CFR 78.115 - Modulation limits.
2010-10-01
... 47 Telecommunication 4 2010-10-01 2010-10-01 false Modulation limits. 78.115 Section 78.115... SERVICE Technical Regulations § 78.115 Modulation limits. (a) If amplitude modulation is employed, negative modulation peaks shall not exceed 100 percent modulation. [37 FR 3292, Feb. 12, 1972, as amended...
2010-04-01
... 26 Internal Revenue 9 2010-04-01 2010-04-01 false Limitations. 1.851-2 Section 1.851-2 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Regulated Investment Companies and Real Estate Investment Trusts § 1.851-2 Limitations. (a...
50 CFR 20.61 - Importation limits.
2010-10-01
... PLANTS (CONTINUED) MIGRATORY BIRD HUNTING Importations § 20.61 Importation limits. No person shall import migratory game birds in excess of the following importation limits: (a) Doves and pigeons. (1) From any foreign country except Mexico, during any one calendar week beginning on Sunday, not to exceed 25 doves...
14 CFR 141.23 - Advertising limitations.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Advertising limitations. 141.23 Section 141...) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS General § 141.23 Advertising limitations. (a) The... certificate may not advertise that the school is certificated unless it clearly differentiates between courses...
Pushing the Limit: A Class Project
Odafe, Victor U.
2012-01-01
Instructors are constantly struggling to help students understand mathematical concepts as well as the relevance of mathematics to the real world. In calculus, students possess misconceptions of the limit concept. "Pushing the Limit" refers to a semester-long calculus class project that required students to read about, interview calculus…
2010-07-01
... Small Municipal Waste Combustion Limits 2 Table 2 to Subpart JJJ of Part 62 Protection of Environment... Combustion Units Constructed on or Before August 30, 1999 Pt. 62, Subpt. JJJ, Table 2 Table 2 to Subpart JJJ of Part 62—Class I Emission Limits for Existing Small Municipal Waste Combustion Limits ER31JA03.006...
Beam-beam limit in e+e- circular colliders
International Nuclear Information System (INIS)
Ohmi, K.; Tawada, M.; Kamada, S.; Oide, K.; Cai, Y.; Qiang, J.
2004-01-01
Beam-beam effects limit the luminosity of circular colliders. Once the bunch population exceeds a threshold, the luminosity increases at a slower rate. This phenomenon is called the beam-beam limit. Onset of the beam-beam limit has been analyzed with various simulation methods based on the weak-strong and strong-strong models. We have observed that an incoherent phenomenon is mainly concerned in the beam-beam limit. The simulation have shown that equilibrium distributions of the two colliding beams are distorted from Gaussians when the luminosity is limited. The beam-beam limit is estimated to be ξ∼0.1 for a B factory with damping time of several thousand turns
International Nuclear Information System (INIS)
Oh, Chang Sik; Kim, Yun Jae
2006-01-01
In the present paper, approximate plastic limit load solutions for pipe bends under combined internal pressure and bending are obtained from detailed three-dimensional (3-D) FE limit analyses based on elastic-perfectly plastic materials with the small geometry change option. The present FE results show that existing limit load solutions for pipe bends are lower bounds but can be very different from the present FE results in some cases, particularly for bending. Accordingly closed-form approximations are proposed for pipe bends under combined pressure and in-plane bending based on the present FE results. The proposed limit load solutions would be a basis of defective pipe bends and be useful to estimate non-linear fracture mechanics parameters based on the reference stress approach
A biased review of tau neutrino mass limits
Energy Technology Data Exchange (ETDEWEB)
Duboscq, J.E
2001-04-01
After a quick review of astrophysically relevant limits, I present a summary of MeV scale tau neutrino mass limits derived from accelerator based experiments. I argue that the current published limits appear to be too consistent, and that we therefore cannot conclude that the tau neutrino mass limit is as low as usually claimed. I provide motivational arguments calling into question the assumed statistical properties of the usual maximum likelihood estimators, and provide a prescription for deriving a more robust and understandable mass limit.
14 CFR 27.337 - Limit maneuvering load factor.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Limit maneuvering load factor. 27.337... Limit maneuvering load factor. The rotorcraft must be designed for— (a) A limit maneuvering load factor... load factor not less than 2.0 and any negative limit maneuvering load factor of not less than −0.5 for...
14 CFR 29.337 - Limit maneuvering load factor.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Limit maneuvering load factor. 29.337... Limit maneuvering load factor. The rotorcraft must be designed for— (a) A limit maneuvering load factor... load factor not less than 2.0 and any negative limit maneuvering load factor of not less than −0.5 for...
Atterberg Limits Prediction Comparing SVM with ANFIS Model
Directory of Open Access Journals (Sweden)
Mohammad Murtaza Sherzoy
2017-03-01
Full Text Available Support Vector Machine (SVM and Adaptive Neuro-Fuzzy inference Systems (ANFIS both analytical methods are used to predict the values of Atterberg limits, such as the liquid limit, plastic limit and plasticity index. The main objective of this study is to make a comparison between both forecasts (SVM & ANFIS methods. All data of 54 soil samples are used and taken from the area of Peninsular Malaysian and tested for different parameters containing liquid limit, plastic limit, plasticity index and grain size distribution and were. The input parameter used in for this case are the fraction of grain size distribution which are the percentage of silt, clay and sand. The actual and predicted values of Atterberg limit which obtained from the SVM and ANFIS models are compared by using the correlation coefficient R2 and root mean squared error (RMSE value. The outcome of the study show that the ANFIS model shows higher accuracy than SVM model for the liquid limit (R2 = 0.987, plastic limit (R2 = 0.949 and plastic index (R2 = 0966. RMSE value that obtained for both methods have shown that the ANFIS model has represent the best performance than SVM model to predict the Atterberg Limits as a whole.
Superconductive AC current limiter
International Nuclear Information System (INIS)
Bekhaled, M.
1987-01-01
This patent describes an AC current limiter for a power transport line including a power supply circuit and feeding a load circuit via an overload circuit-breaker member. The limiter comprises a transformer having a primary winding connected in series between the power supply circuit and the load circuit and at least one secondary winding of superconductor material contained in a cryogenic enclosure and short-circuited on itself. The leakage reactance of the transformer as seen from the primary winding is low, and the resistance of the at least one secondary winding when in the non-superconducting state and as seen from the primary is much greater than the nominal impedance of the transformer. The improvement whereby the at least one secondary winding of the transformer comprises an active winding in association with a set of auxiliary windings. The set of auxiliary windings is constituted by an even number of series-connected auxiliary windings wound in opposite directions, with the total number of turns in one direction being equal to the total number of turns in the opposite direction, and with the thermal capacity of the secondary winding as a whole being sufficiently high to limit the expansion thereof to a value which remains small during the time it takes the circuit-breaking member to operate
Extreme Physics and Informational/Computational Limits
Energy Technology Data Exchange (ETDEWEB)
Di Sia, Paolo, E-mail: paolo.disia@univr.it, E-mail: 10alla33@virgilio.it [Department of Computer Science, Faculty of Science, Verona University, Strada Le Grazie 15, I-37134 Verona (Italy) and Faculty of Computer Science, Free University of Bozen, Piazza Domenicani 3, I-39100 Bozen-Bolzano (Italy)
2011-07-08
A sector of the current theoretical physics, even called 'extreme physics', deals with topics concerning superstring theories, multiverse, quantum teleportation, negative energy, and more, that only few years ago were considered scientific imaginations or purely speculative physics. Present experimental lines of evidence and implications of cosmological observations seem on the contrary support such theories. These new physical developments lead to informational limits, as the quantity of information, that a physical system can record, and computational limits, resulting from considerations regarding black holes and space-time fluctuations. In this paper I consider important limits for information and computation resulting in particular from string theories and its foundations.
Extreme Physics and Informational/Computational Limits
International Nuclear Information System (INIS)
Di Sia, Paolo
2011-01-01
A sector of the current theoretical physics, even called 'extreme physics', deals with topics concerning superstring theories, multiverse, quantum teleportation, negative energy, and more, that only few years ago were considered scientific imaginations or purely speculative physics. Present experimental lines of evidence and implications of cosmological observations seem on the contrary support such theories. These new physical developments lead to informational limits, as the quantity of information, that a physical system can record, and computational limits, resulting from considerations regarding black holes and space-time fluctuations. In this paper I consider important limits for information and computation resulting in particular from string theories and its foundations.
Reverse engineering of inductive fault current limiters
Energy Technology Data Exchange (ETDEWEB)
Pina, J M; Neves, M Ventim; Rodrigues, A L [Centre of Technology and Systems Faculdade de Ciencias e Tecnologia, Nova University of Lisbon Monte de Caparica, 2829-516 Caparica (Portugal); Suarez, P; Alvarez, A, E-mail: jmmp@fct.unl.p [' Benito Mahedero' Group of Electrical Applications of Superconductors Escuela de IngenierIas Industrials, University of Extremadura Avenida de Elvas s/n, 06006 Badajoz (Spain)
2010-06-01
The inductive fault current limiter is less compact and harder to scale to high voltage networks than the resistive one. Nevertheless, its simple construction and mechanical robustness make it attractive in low voltage grids. Thus, it might be an enabling technology for the advent of microgrids, low voltage networks with dispersed generation, controllable loads and energy storage. A new methodology for reverse engineering of inductive fault current limiters based on the independent analysis of iron cores and HTS cylinders is presented in this paper. Their electromagnetic characteristics are used to predict the devices' hysteresis loops and consequently their dynamic behavior. Previous models based on the separate analysis of the limiters' components were already derived, e.g. in transformer like equivalent models. Nevertheless, the assumptions usually made may limit these models' application, as shown in the paper. The proposed methodology obviates these limitations. Results are validated through simulations.
Reverse engineering of inductive fault current limiters
International Nuclear Information System (INIS)
Pina, J M; Neves, M Ventim; Rodrigues, A L; Suarez, P; Alvarez, A
2010-01-01
The inductive fault current limiter is less compact and harder to scale to high voltage networks than the resistive one. Nevertheless, its simple construction and mechanical robustness make it attractive in low voltage grids. Thus, it might be an enabling technology for the advent of microgrids, low voltage networks with dispersed generation, controllable loads and energy storage. A new methodology for reverse engineering of inductive fault current limiters based on the independent analysis of iron cores and HTS cylinders is presented in this paper. Their electromagnetic characteristics are used to predict the devices' hysteresis loops and consequently their dynamic behavior. Previous models based on the separate analysis of the limiters' components were already derived, e.g. in transformer like equivalent models. Nevertheless, the assumptions usually made may limit these models' application, as shown in the paper. The proposed methodology obviates these limitations. Results are validated through simulations.
DEFF Research Database (Denmark)
Garcia, Monica; Fernández, N.; Villagarcía, L.
2014-01-01
surface fluxes using MODIS data; and (ii) provide insights about the factors most affecting the accuracy of results. Factors considered included the type of climatic control on evapotranspiration, λE, (i.e. water-limited vs. energy-limited), the quality of Tair estimates, the heterogeneity of land cover...
National Oceanic and Atmospheric Administration, Department of Commerce — The Annual Catch Limit (ACL) dataset within the Species Information System (SIS) contains information and data related to management reference points and catch data.
2010-07-01
... 40 Protection of Environment 32 2010-07-01 2010-07-01 false Page limits. 1502.7 Section 1502.7 Protection of Environment COUNCIL ON ENVIRONMENTAL QUALITY ENVIRONMENTAL IMPACT STATEMENT § 1502.7 Page limits. The text of final environmental impact statements (e.g., paragraphs (d) through (g) of § 1502.10...
14 CFR 142.31 - Advertising limitations.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Advertising limitations. 142.31 Section 142...) SCHOOLS AND OTHER CERTIFICATED AGENCIES TRAINING CENTERS General § 142.31 Advertising limitations. (a) A certificate holder may not conduct, and may not advertise to conduct, any training, testing, and checking that...
7 CFR 761.8 - Loan Limitations.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Loan Limitations. 761.8 Section 761.8 Agriculture... SPECIAL PROGRAMS GENERAL PROGRAM ADMINISTRATION General Provisions § 761.8 Loan Limitations. (a) Dollar... cannot exceed any of the following at the time of loan closing or assumption of indebtedness. If the...
Classical limit for quantum mechanical energy eigenfunctions
International Nuclear Information System (INIS)
Sen, D.; Sengupta, S.
2004-01-01
The classical limit problem is discussed for the quantum mechanical energy eigenfunctions using the Wentzel-Kramers-Brillouin approximation, free from the problem at the classical turning points. A proper perspective of the whole issue is sought to appreciate the significance of the discussion. It is observed that for bound states in arbitrary potential, appropriate limiting condition is definable in terms of a dimensionless classical limit parameter leading smoothly to all observable classical results. Most important results are the emergence of classical phase space, keeping the observable distribution functions non-zero only within the so-called classical region at the limit point and resolution of some well-known paradoxes. (author)
Fault-current limiter using a superconducting coil
International Nuclear Information System (INIS)
Boenig, H.J.; Paice, D.A.
1982-01-01
A novel circuit, consisting of solid-state diodes and a biased superconducting coil, for limiting the fault currents in three-phase ac systems is presented. A modification of the basic circuit results in a solid-state ac breaker with current-limiting features. The operating characteristics of the fault-current limiter and the ac breaker are analyzed. An optimization procedure for sizing the superconducting coil is derived
Investigation of limiter recycling in the divertor tokamak ASDEX
International Nuclear Information System (INIS)
Wagner, F.
1981-08-01
A divertor experiment like the ASDEX tokamak is especially suited for studying ion recycling at a material limiter, because the plasma can alternatively be limited by a magnetic limiter (separatrix) or by a material limiter. The role of the material limiter in ion recycling is documented by observing the increase in charge exchange flux emitted at the limiter position, and the decrease in external gas input necessary to keep the plasma line density invariant, when the material limiter is moved to the plasma. Ion recycling occurs predominantly at the outside section of a ring limiter. The limiter material saturates shortly after the start of the discharge. About 60% of the total recycling occurs at the limiter, which is nearly 100% of the ion recycling. The remaining 40% of the total recycling is carried by charge exchange neutrals. Due to saturation, the recycling coefficient at the limiter is 1; the recycling coefficient of the charge exchange neutrals at the wall is approximately 0.5 giving rise to a total recycling coefficient of limiter discharges of 0.8-0.9. It is observed that the plasma resistivity increases when the material limiter is moved toward the separatrix. The increase in Zsub(eff) can tentatively be explained by proton sputtering. (orig.)
U.S. Department of Health & Human Services — Information for those with limited income and resources (those who may qualify for or already have the Low Income Subsidy to lower their prescription drug coverage...
Limited Denial of Participation
Department of Housing and Urban Development — A Limited Denial of Participation (LDP) is an action taken by a HUD Field Office or the Deputy Assistant Secretary for Single Family (DASSF) or Multifamily (DASMF)...
Concentration and limit behaviors of stationary measures
Huang, Wen; Ji, Min; Liu, Zhenxin; Yi, Yingfei
2018-04-01
In this paper, we study limit behaviors of stationary measures of the Fokker-Planck equations associated with a system of ordinary differential equations perturbed by a class of multiplicative noise including additive white noise case. As the noises are vanishing, various results on the invariance and concentration of the limit measures are obtained. In particular, we show that if the noise perturbed systems admit a uniform Lyapunov function, then the stationary measures form a relatively sequentially compact set whose weak∗-limits are invariant measures of the unperturbed system concentrated on its global attractor. In the case that the global attractor contains a strong local attractor, we further show that there exists a family of admissible multiplicative noises with respect to which all limit measures are actually concentrated on the local attractor; and on the contrary, in the presence of a strong local repeller in the global attractor, there exists a family of admissible multiplicative noises with respect to which no limit measure can be concentrated on the local repeller. Moreover, we show that if there is a strongly repelling equilibrium in the global attractor, then limit measures with respect to typical families of multiplicative noises are always concentrated away from the equilibrium. As applications of these results, an example of stochastic Hopf bifurcation and an example with non-decomposable ω-limit sets are provided. Our study is closely related to the problem of noise stability of compact invariant sets and invariant measures of the unperturbed system.
Moeller, David A; Geber, Monica A; Eckhart, Vincent M; Tiffin, Peter
2012-05-01
Mutualisms are well known to influence individual fitness and the population dynamics of partner species, but little is known about whether they influence species distributions and the location of geographic range limits. Here, we examine the contribution of plant-pollinator interactions to the geographic range limit of the California endemic plant Clarkia xantiana ssp. xantiana. We show that pollinator availability declined from the center to the margin of the geographic range consistently across four years of study. This decline in pollinator availability was caused to a greater extent by variation in the abundance of generalist rather than specialist bee pollinators. Climate data suggest that patterns of precipitation in the current and previous year drove variation in bee abundance because of its effects on cues for bee emergence in the current year and the abundance of floral resources in the previous year. Experimental floral manipulations showed that marginal populations had greater outcross pollen limitation of reproduction, in parallel with the decline in pollinator abundance. Although plants are self-compatible, we found no evidence that autonomous selfing contributes to reproduction, and thus no evidence that it alleviates outcross pollen limitation in marginal populations. Furthermore, we found no association between the distance to the range edge and selfing rate, as estimated from sequence and microsatellite variation, indicating that the mating system has not evolved in response to the pollination environment at the range periphery. Overall, our results suggest that dependence on pollinators for reproduction may be an important constraint limiting range expansion in this system.
Hardin, Amy Peykoff; Hackell, Jesse M
2017-09-01
Pediatrics is a multifaceted specialty that encompasses children's physical, psychosocial, developmental, and mental health. Pediatric care may begin periconceptionally and continues through gestation, infancy, childhood, adolescence, and young adulthood. Although adolescence and young adulthood are recognizable phases of life, an upper age limit is not easily demarcated and varies depending on the individual patient. The establishment of arbitrary age limits on pediatric care by health care providers should be discouraged. The decision to continue care with a pediatrician or pediatric medical or surgical subspecialist should be made solely by the patient (and family, when appropriate) and the physician and must take into account the physical and psychosocial needs of the patient and the abilities of the pediatric provider to meet these needs. Copyright © 2017 by the American Academy of Pediatrics.
Limiter and first wall of the fusion reactor blanket
International Nuclear Information System (INIS)
Danilov, I.; Skladnov, K.; Kolganov, V.
1994-01-01
Previous designing of the first wall and limiter has allowed to determine their possible embodiment depending on the parameters and operation conditions of the blanket. As a rule limiter is a separate structure located on the plasma facing surface of the blanket assembly. Possible versions of the limiter/FW which may be considered: (1) limiters with mechanical attachment of the protective part; (2) limiters with the attachment with brazing; (3) limiters with common/separate cooling system; (4) limiter as a substitute of the FW. Generally the FW/limiter structure includes protective shield and its cooling system which consist of protective coating, heat accumulator, conductive layer and attachment locks
Analysis of truncation limit in probabilistic safety assessment
International Nuclear Information System (INIS)
Cepin, Marko
2005-01-01
A truncation limit defines the boundaries of what is considered in the probabilistic safety assessment and what is neglected. The truncation limit that is the focus here is the truncation limit on the size of the minimal cut set contribution at which to cut off. A new method was developed, which defines truncation limit in probabilistic safety assessment. The method specifies truncation limits with more stringency than presenting existing documents dealing with truncation criteria in probabilistic safety assessment do. The results of this paper indicate that the truncation limits for more complex probabilistic safety assessments, which consist of larger number of basic events, should be more severe than presently recommended in existing documents if more accuracy is desired. The truncation limits defined by the new method reduce the relative errors of importance measures and produce more accurate results for probabilistic safety assessment applications. The reduced relative errors of importance measures can prevent situations, where the acceptability of change of equipment under investigation according to RG 1.174 would be shifted from region, where changes can be accepted, to region, where changes cannot be accepted, if the results would be calculated with smaller truncation limit
Energy Technology Data Exchange (ETDEWEB)
Castillo D, R.; Ortiz V, J. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico); Calleros M, G. [CFE, CNLV, Alto Lucero, Veracruz (Mexico)]. e-mail: rcd@nuclear.inin.mx
2003-07-01
The boiling water reactors (BWRs) are designed for usually to operate in a stable-lineal regime. In a limit cycle the behavior of the one system is no lineal-stable. In a BWR, instabilities of nuclear- thermohydraulics nature can take the reactor to a limit cycle. The limit cycles should to be avoided since the oscillations of power can cause thermal fatigue to the fuel and/or shroud. In this work the employment of the delays method is analyzed for its application in the detection of limit cycles in a nuclear power plant. The foundations of the method and it application to power signals to different operation conditions are presented. The analyzed signals are: to steady state, nuclear-thermohydraulic instability, a non linear transitory and, finally, failure of a controller plant . Among the main results it was found that the delays method can be applied to detect limit cycles in the power monitors of the BWR reactors. It was also found that the first zero of the autocorrelation function is an appropriate approach to select the delay in the detection of limit cycles, for the analyzed cases. (Author)
50 CFR 640.21 - Harvest limitations.
2010-10-01
... § 640.21 Harvest limitations. (a) Berried lobsters. A berried (egg-bearing) spiny lobster or slipper...) Undersized attractants. A live spiny lobster under the minimum size limit specified in paragraph (b)(1) of... future use as an attractant in a trap provided it is held in a live well aboard the vessel. No more than...
Density limit studies on DIII-D
Energy Technology Data Exchange (ETDEWEB)
Maingi, R. [Oak Ridge National Lab., TN (United States); Mahdavi, M.A.; Petrie, T.W. [General Atomics, San Diego, CA (United States)] [and others
1998-08-01
The authors have studied the processes limiting plasma density and successfully achieved discharges with density {approximately}50% above the empirical Greenwald density limit with H-mode confinement. This was accomplished by density profile control, enabled through pellet injection and divertor pumping. By examining carefully the criterion for MARFE formation, the authors have derived an edge density limit with scaling very similar to Greenwald scaling. Finally, they have looked in detail at the first and most common density limit process in DIII-D, total divertor detachment, and found that the local upstream separatrix density (n{sub e}{sup sep,det}) at detachment onset (partial detachment) increases with the scrape-off layer heating power, P{sub heat}, i.e., n{sub e}{sup sep,det} {approximately} P{sub heat}{sup 0.76}. This is in marked contrast to the line-average density at detachment which is insensitive to the heating power. The data are in reasonable agreement with the Borass model, which predicted that the upstream density at detachment would increase as P{sub heat}{sup 0.7}.
Limiting rotational period of neutron stars
Glendenning, Norman K.
1992-11-01
We seek an absolute limit on the rotational period for a neutron star as a function of its mass, based on the minimal constraints imposed by Einstein's theory of relativity, Le Chatelier's principle, causality, and a low-density equation of state, uncertainties in which can be evaluated as to their effect on the result. This establishes a limiting curve in the mass-period plane below which no pulsar that is a neutron star can lie. For example, the minimum possible Kepler period, which is an absolute limit on rotation below which mass shedding would occur, is 0.33 ms for a M=1.442Msolar neutron star (the mass of PSR1913+16). A still lower curve, based only on the structure of Einstein's equations, limits any star whatsoever to lie in the plane above it. Hypothetical stars such as strange stars, if the matter of which they are made is self-bound in bulk at a sufficiently large equilibrium energy density, can lie in the region above the general-relativistic forbidden region, and in the region forbidden to neutron stars.
Limiting rotational period of neutron stars
International Nuclear Information System (INIS)
Glendenning, N.K.
1992-01-01
We seek an absolute limit on the rotational period for a neutron star as a function of its mass, based on the minimal constraints imposed by Einstein's theory of relativity, Le Chatelier's principle, causality, and a low-density equation of state, uncertainties in which can be evaluated as to their effect on the result. This establishes a limiting curve in the mass-period plane below which no pulsar that is a neutron star can lie. For example, the minimum possible Kepler period, which is an absolute limit on rotation below which mass shedding would occur, is 0.33 ms for a M=1.442M circle-dot neutron star (the mass of PSR1913+16). A still lower curve, based only on the structure of Einstein's equations, limits any star whatsoever to lie in the plane above it. Hypothetical stars such as strange stars, if the matter of which they are made is self-bound in bulk at a sufficiently large equilibrium energy density, can lie in the region above the general-relativistic forbidden region, and in the region forbidden to neutron stars
Genetics Home Reference: familial male-limited precocious puberty
... male-limited precocious puberty Familial male-limited precocious puberty Printable PDF Open All Close All Enable Javascript ... expand/collapse boxes. Description Familial male-limited precocious puberty is a condition that causes early sexual development ...
Matrix model calculations beyond the spherical limit
International Nuclear Information System (INIS)
Ambjoern, J.; Chekhov, L.; Kristjansen, C.F.; Makeenko, Yu.
1993-01-01
We propose an improved iterative scheme for calculating higher genus contributions to the multi-loop (or multi-point) correlators and the partition function of the hermitian one matrix model. We present explicit results up to genus two. We develop a version which gives directly the result in the double scaling limit and present explicit results up to genus four. Using the latter version we prove that the hermitian and the complex matrix model are equivalent in the double scaling limit and that in this limit they are both equivalent to the Kontsevich model. We discuss how our results away from the double scaling limit are related to the structure of moduli space. (orig.)
Plasma vertical instability in a tokamak with rail limiters
International Nuclear Information System (INIS)
Belashob, V.I.; Brevnov, N.N.; Gribov, Yu.V.; Putvinskij, S.V.
1989-01-01
An effect of currents between rail limiters on plasma equilibrium in the tokamak is studied theoretically and experimentally. Limiter currents can emerge at fast changes of plasma position along rail limiters for example when compression along major radius takes place and result in additional electrodynamic loadings on to the chamber and limiters. It is shown that at high currents between the limiters, the behaviour of discharge depends on limiter voltage polarity. When the plasma - limiter contact points are asymmetrically located respective to an equatorial plane a radial component of the limiter current emerges. The interaction of the component with the toroidal magnetic field can result in a vertical plasma filament instability. 9 refs.; 10 figs
Inviscid incompressible limits on expanding domains
Czech Academy of Sciences Publication Activity Database
Feireisl, Eduard; Nečasová, Šárka; Sun, Y.
2014-01-01
Roč. 27, č. 10 (2014), s. 2465-2477 ISSN 0951-7715 R&D Projects: GA ČR GA13-00522S Institutional support: RVO:67985840 Keywords : compressible Navier-Stokes system * large domain * inviscid limit * incompressible limit Subject RIV: BA - General Mathematics Impact factor: 1.208, year: 2014 http://iopscience.iop.org/0951-7715/27/10/2465/
Gaussian limit of compact spin systems
International Nuclear Information System (INIS)
Bellissard, J.; Angelis, G.F. de
1981-01-01
It is shown that the Wilson and Wilson-Villain U(1) models reproduce, in the low coupling limit, the gaussian lattice approximation of the Euclidean electromagnetic field. By the same methods it is also possible to prove that the plane rotator and the Villain model share a common gaussian behaviour in the low temperature limit. (Auth.)
7 CFR 770.5 - Loan limitations.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Loan limitations. 770.5 Section 770.5 Agriculture... SPECIAL PROGRAMS INDIAN TRIBAL LAND ACQUISITION LOANS § 770.5 Loan limitations. (a) Loan funds may not be... title. (b) The amount of loan funds used to acquire land may not exceed the market value of the land...
47 CFR 90.669 - Emission limits.
2010-10-01
... 896-901/935-940 Mhz Band § 90.669 Emission limits. (a) On any frequency in an MTA licensee's spectrum block that is adjacent to a non-MTA frequency, the power of any emission shall be attenuated below the... 47 Telecommunication 5 2010-10-01 2010-10-01 false Emission limits. 90.669 Section 90.669...
Application of fault current limiters
Energy Technology Data Exchange (ETDEWEB)
Neumann, A.
2007-11-30
This report presents the results of a study commissioned by the Department for Business, Enterprise and Industry (BERR; formerly the Department of Trade and Industry) into the application of fault current limiters in the UK. The study reviewed the current state of fault current limiter (FCL) technology and regulatory position in relation to all types of current limiters. It identified significant research and development work with respect to medium voltage FCLs and a move to high voltage. Appropriate FCL technologies being developed include: solid state breakers; superconducting FCLs (including superconducting transformers); magnetic FCLs; and active network controllers. Commercialisation of these products depends on successful field tests and experience, plus material development in the case of high temperature superconducting FCL technologies. The report describes FCL techniques, the current state of FCL technologies, practical applications and future outlook for FCL technologies, distribution fault level analysis and an outline methodology for assessing the materiality of the fault level problem. A roadmap is presented that provides an 'action agenda' to advance the fault level issues associated with low carbon networks.
Limiting currents in superconducting composites
International Nuclear Information System (INIS)
Keilin, V.E.; Romanovskii, V.R.
1992-01-01
In this paper the results of numerical and analytical calculations of the process of current charging into a round superconducting composite with properties homogenized over cross-section are presented. In the numerical solution taken was into account a common proceeding of the thermal and electromagnetic processes. A wire with real volt-ampere characteristics approximated by exponential dependence was considered. The calculations carried out at various rates of current charging, voltampere characteristics, matrix materials, heat transfer coefficients and other parameters showed: the existence of characteristic limiting value of current below which the wire remains in a superconducting state if the current charging ceases and above which changes into a normal state; this current is somewhat less than a quench current; the existence of finite value for limiting current at any low heat transfer from a surface. The analytical solution of the problem is given. It permitted to write the stability criterion from which the dependence of limiting currents on initial parameters follows. The wire nonisothermality, its heat capacity, thermal and electric conductivities are taken into account additionally, as compared to results published earlier
Secondary limits of exposure in facilities handling uranium
International Nuclear Information System (INIS)
Raghavayya, M.
1999-08-01
Annual limits of exposure and intake for radiation workers in nuclear installations have been recommended by the International Commission on Radiological Protection and the same have been adopted by the Indian Atomic Energy Regulatory Board for all the radionuclides of interest. The prescribed limits cannot be directly used for day to day radiation protection work. Hence secondary limits have to be derived for routine applications. The modeling steps may be simple in some situations and more complicated in some others. The limits recommended are for individual radionuclides. But in facilities handling natural or enriched uranium the radionuclides (isotopes of uranium and its decay products) generally occur together in specific ratios. Derivation of secondary limits has to take this into consideration. The present document is an attempt at deriving the secondary limits required for routine application in facilities handling uranium (Mine, mill, refineries and fuel fabrication etc.). Secondary limits of exposure have been derived in this document for air borne activity, activity in water, surface contamination and internal exposures. (author)
Characterizing Mobility Limitations Among Older African American Men.
Mitchell, Jamie A; Johnson-Lawrence, Vicki; Williams, Ed-Dee G; Thorpe, Roland
2018-04-01
This study represents an effort to contribute to the limited body of research on biopsychosocial contextual factors that influence or contribute to mobility limitations for older African American men. Specifically, we were interested in examining associations between socio-demographic, physical and emotional health experiences with mobility limitations. A secondary analysis of 1666 older African American men was performed to investigate socio-demographic, mental and physical health correlates to a specific measures of mobility limitation. In the final model, difficulty with self-care, severe pain interference, and problems with usual activities were most strongly associated with mobility limitations. Men who were married were significantly less likely to experience mobility limitations. Findings highlighted the relationship between mobility limitations and difficulty performing activities of daily living. Additional research should examine the impact of poor emotional health and the buffering effects of marriage on mobility for older African American men, a population at high risk of experiencing disparate health outcomes. Copyright © 2018 National Medical Association. Published by Elsevier Inc. All rights reserved.
A study on flammability limits of fuel mixtures.
Kondo, Shigeo; Takizawa, Kenji; Takahashi, Akifumi; Tokuhashi, Kazuaki; Sekiya, Akira
2008-07-15
Flammability limit measurements were made for various binary and ternary mixtures prepared from nine different compounds. The compounds treated are methane, propane, ethylene, propylene, methyl ether, methyl formate, 1,1-difluoroethane, ammonia, and carbon monoxide. The observed values of lower flammability limits of mixtures were found to be in good agreement to the calculated values by Le Chatelier's formula. As for the upper limits, however, some are close to the calculated values but some are not. It has been found that the deviations of the observed values of upper flammability limits from the calculated ones are mostly to lower concentrations. Modification of Le Chatelier's formula was made to better fit to the observed values of upper flammability limits. This procedure reduced the average difference between the observed and calculated values of upper flammability limits to one-third of the initial value.
Confinement and gas fueling in LHD limiter discharges
International Nuclear Information System (INIS)
Nishimura, K.; Kawahata, K.; Narihara, K.; Morisaki, T.; Masuzaki, S.; Sakakibara, S.; Tanaka, K.
2003-01-01
Plasma discharges in the Large Helical Device are normally open helical divertor discharges. To compare limiter discharges with open divertor discharges and to examine the role of the peripheral region, a radial movable limiter, whose head was made of carbon with high heat conductivity, was inserted into the plasma from the high field side (near the helical coil). The electron temperature was bounded well by the limiter. A high temperature gradient at the edge region was observed in both open divertor and limiter discharges. Formation of such a high temperature gradient led to good energy confinement even in the limiter discharges and an enhancement factor of 1.1±0.3 for International Stellarator Scaling 95 (ISS95) scaling was observed at every limiter position (0.75 ax =3.75 m prevents gas fueling by puffing
Asymptotic limits of a statistical transport description
International Nuclear Information System (INIS)
Malvagi, F.; Levermore, C.D.; Pomraning, G.C.; Department of Mathematics, University of Arizona, Tucson, AZ 85721)
1989-01-01
We consider three different asymptotic limits of a model describing linear particle transport in a stochastic medium consisting of two randomly mixed immiscible fluids. These three limits are: (1) the fluid packets are small compared to the particle mean free path in the packet; (2) a small amount of large cross section fluid is admixed with a large amount of small cross section fluid; and (3) the angular dependence of the intensity (angular flux) is nearly isotropic. The first two limits reduce the underlying model, which consists of two coupled transport equations, to a single transport equation of the usual form. The third limit yields a two-equation diffusion approximation, and a boundary layer analysis gives boundary conditions for these two coupled diffusion equations
The Cognitive Limits to Economic Cluster Formation
Directory of Open Access Journals (Sweden)
Michael C. Carrol
2012-01-01
Full Text Available There has been increasing interest in the social dimensions of economic clusters. The literature now includes select examples of social network analysis plus an extensive discussion of learning regions. Unfortunately, much of this work treats the network as the primary unit of analysis. It may be that network attributes such as density, centrality, and power are primarily dependent on human limitations and not instituted factors. In other words, a human’s limited ability to process information may be a better determinant of cluster success than economic or network theory. The purpose of this paper is to highlight human limits in cluster formation. To do this, we draw on recent developments in the cognitive psychology and communications literatures. We explain that many of the factors that lead to underperforming cluster policies are the result of a human’s inability to develop and sustain a large number of social interactions. Any cluster policy must be cognizant of such limitations and carefully address these limits in the formation of the initial strategy.
Numerical Limit Analysis of Precast Concrete Structures
DEFF Research Database (Denmark)
Herfelt, Morten Andersen
Precast concrete elements are widely used in the construction industry as they provide a number of advantages over the conventional in-situ cast concrete structures. Joints cast on the construction site are needed to connect the precast elements, which poses several challenges. Moreover, the curr...... problems are solved efficiently using state-of-the-art solvers. It is concluded that the framework and developed joint models have the potential to enable efficient design of precast concrete structures in the near future......., the current practice is to design the joints as the weakest part of the structure, which makes analysis of the ultimate limit state behaviour by general purpose software difficult and inaccurate. Manual methods of analysis based on limit analysis have been used for several decades. The methods provide...... of the ultimate limit state behaviour. This thesis introduces a framework based on finite element limit analysis, a numerical method based on the same extremum principles as the manual limit analysis. The framework allows for efficient analysis and design in a rigorous manner by use of mathematical optimisation...
Occupational dose equivalent limits
International Nuclear Information System (INIS)
Goldfinch, E.P.
1980-01-01
This paper considers methods of limiting individual radiation risks by recognizing the variation of risk with age at exposure, taking into account both somatic and genetic risks and proposes a simple formula for controlling individual cumulative exposure and hence risk. (Author)
Optical limiting properties of fullerenes and related materials
Riggs, Jason Eric
Optical limiting properties of fullerene C60 and different C60 derivatives (methano-, pyrrolidino-, and amino-) towards nanosecond laser pulses at 532 nm were studied. The results show that optical limiting responses of the C60 derivatives are similar to those of the parent C60 despite their different linear absorption and emission properties. For C60 and the derivatives in room-temperature solutions of varying concentrations and optical path length, the optical limiting responses are strongly concentration dependent. The concentration dependence is not due to any optical artifacts since the results obtained under the same experimental conditions for reference systems show no such dependence. Similarly, optical limiting results of fullerenes are strongly dependent on the medium viscosity, with responses in viscous media weaker than that in room-temperature solutions. The solution concentration and medium viscosity dependencies are not limited to fullerenes. In fact, the results from a systematic investigation of several classes of nonlinear absorptive organic dyes show that the optical limiting responses are also concentration and medium viscosity dependent. Interestingly, however, such dependencies are uniquely absent in the optical limiting responses of metallophthalocyanines. In classical photophysics, the strong solution concentration and medium viscosity dependencies are indicative of significant contributions from photoexcited-state bimolecular processes. Thus, the experimental results are discussed in terms of a significantly modified five-level reverse saturable absorption mechanism. Optical limiting properties of single-walled and multiple-walled carbon nanotubes toward nanosecond laser pulses at 532 nm were also investigated. When suspended in water, the single-walled and multiple-walled carbon nanotubes exhibit essentially the same optical limiting responses, and the results are also comparable with those of carbon black aqueous suspension. For
Addition of multiple limiting resources reduces grassland diversity
Harpole, W Stanley; Sullivan, Lauren L; Lind, Eric M; Firn, Jennifer; Adler, Peter B; Borer, Elizabeth T; Chase, Jonathan; Fay, Philip A; Hautier, Yann; Hillebrand, Helmut; MacDougall, Andrew S; Seabloom, Eric W; Williams, Ryan; Bakker, Jonathan D; Cadotte, Marc W; Chaneton, Enrique J; Chu, Chengjin; Cleland, Elsa E; D'Antonio, Carla; Davies, Kendi F; Gruner, Daniel S; Hagenah, Nicole; Kirkman, Kevin; Knops, Johannes M H; La Pierre, Kimberly J; McCulley, Rebecca L; Moore, Joslin L; Morgan, John W; Prober, Suzanne M; Risch, Anita C; Schuetz, Martin; Stevens, Carly J; Wragg, Peter D
2016-01-01
Niche dimensionality provides a general theoretical explanation for biodiversity-more niches, defined by more limiting factors, allow for more ways that species can coexist. Because plant species compete for the same set of limiting resources, theory predicts that addition of a limiting resource
The thermal limits to life on Earth
Clarke, Andrew
2014-04-01
Living organisms on Earth are characterized by three necessary features: a set of internal instructions encoded in DNA (software), a suite of proteins and associated macromolecules providing a boundary and internal structure (hardware), and a flux of energy. In addition, they replicate themselves through reproduction, a process that renders evolutionary change inevitable in a resource-limited world. Temperature has a profound effect on all of these features, and yet life is sufficiently adaptable to be found almost everywhere water is liquid. The thermal limits to survival are well documented for many types of organisms, but the thermal limits to completion of the life cycle are much more difficult to establish, especially for organisms that inhabit thermally variable environments. Current data suggest that the thermal limits to completion of the life cycle differ between the three major domains of life, bacteria, archaea and eukaryotes. At the very highest temperatures only archaea are found with the current high-temperature limit for growth being 122 °C. Bacteria can grow up to 100 °C, but no eukaryote appears to be able to complete its life cycle above ~60 °C and most not above 40 °C. The lower thermal limit for growth in bacteria, archaea, unicellular eukaryotes where ice is present appears to be set by vitrification of the cell interior, and lies at ~-20 °C. Lichens appear to be able to grow down to ~-10 °C. Higher plants and invertebrates living at high latitudes can survive down to ~-70 °C, but the lower limit for completion of the life cycle in multicellular organisms appears to be ~-2 °C.
A predictive model for the tokamak density limit
International Nuclear Information System (INIS)
Teng, Q.; Brennan, D. P.; Delgado-Aparicio, L.; Gates, D. A.; Swerdlow, J.; White, R. B.
2016-01-01
We reproduce the Greenwald density limit, in all tokamak experiments by using a phenomenologically correct model with parameters in the range of experiments. A simple model of equilibrium evolution and local power balance inside the island has been implemented to calculate the radiation-driven thermo-resistive tearing mode growth and explain the density limit. Strong destabilization of the tearing mode due to an imbalance of local Ohmic heating and radiative cooling in the island predicts the density limit within a few percent. Furthermore, we found the density limit and it is a local edge limit and weakly dependent on impurity densities. Our results are robust to a substantial variation in model parameters within the range of experiments.
On radiative density limits in stellarators
International Nuclear Information System (INIS)
Wobig, H.
2001-01-01
Density limits in stellarators are caused mainly by enhanced impurity radiation leading to a collapse of the temperature. A simple model can be established, which computes the temperature in the plasma with a fixed heating profile and a temperature-dependent radiation profile. If the temperature-dependent radiation function has one or several extrema, multiple solutions of the transport equation exist and radiative collapse occurs when the high temperature branch merges with the unstable temperature branch. At this bifurcation point the temperature decreases to a stable low temperature solution. The bifurcation point is a function of the heating power and the plasma density. Thus a density limit can be defined as the point where bifurcation occurs. It is shown that bifurcation and sudden temperature collapse does not occur below a power threshold. Anomalous thermal conductivity and the details of the impurity radiation, which in the present model is assumed to be in corona equilibrium, determine the scaling of the density limit. A model of the anomalous transport is developed, which leads to Gyro-Bohm scaling of the confinement time. The density limit based on this transport model is close to experimental findings in Wendelstein 7-AS. (author)
Analysis of forming limit in tube hydroforming
International Nuclear Information System (INIS)
Kim, Chan Il; Yang, Seung Hang; Kim, Young Suk
2013-01-01
The automotive industry has shown increasing interest in tube hydroforming. Despite many automobile structural parts being produced from cylindrical tubes, failures frequently occur during tube hydroforming under improper forming conditions. These problems include wrinkling, buckling, folding back, and bursting. We perform analytical studies to determine forming limits in tube hydroforming and demonstrate how these forming limits are influenced by the loading path. Theoretical results for the forming limits of wrinkling and bursting are compared with experimental results for an aluminum tube.
Radioecological activity limits for radioactive waste disposal
International Nuclear Information System (INIS)
Ahmet, E. Osmanlioglu
2006-01-01
Full text: Near surface disposal is an option used by many countries for the disposal of radioactive waste containing mainly short lived radionuclides. Near surface disposal term includes broad range of facilities from simple trenches to concrete vaults. Principally, disposal of radioactive waste requires the implementation of measures that will provide safety for human health and environment now and in the future. For this reason preliminary activity limits should be determined to avoid radioecological problems. Radioactive waste has to be safely disposed in a regulated manner, consistent with internationally agreed principles and standards and with national legislations to avoid serious radioecological problems. The purpose of this study, presents a safety assessment approach to derive operational and post-closure radioecological activity limits for the disposal of radioactive waste. Disposal system has three components; the waste, the facility (incl. engineered barriers) and the site (natural barriers). Form of the waste (unconditioned or conditioned) is effective at the beginning of the migration scenerio. Existence of the engineered barriers in the facility will provide long term isolation of the waste from environment. The site characteristics (geology, groundwater, seismicity, climate etc.) are important for the safety of the system. Occupational exposure of a worker shall be controlled so that the following dose limits are not exceeded: an effective dose of 20mSv/y averaged over 5 consecutive years; and an effective dose of 50mSv in any single year. The effective dose limit for members of the public recommended by ICRP and IAEA is 1 mSv/y for exposures from all man-made sources [1,2]. Dose constraints are typically a fraction of the dose limit and ICRP recommendations (0.3 mSv/y) could be applied [3,4]. Radioecological activity concentration limits of each radionuclide in the waste (Bq/kg) were calculated. As a result of this study radioecological activity
Analysis of performance limitations for superconducting cavities
International Nuclear Information System (INIS)
J. R. Delayen; L. R. Doolittle; C. E. Reece
1998-01-01
The performance of superconducting cavities in accelerators can be limited by several factors, such as: field emission, quenches, arcing, rf power; and the maximum gradient at which a cavity can operate will be determined by the lowest of these limitations for that particular cavity. The CEBAF accelerator operates with over 300 cavities and, for each of them, the authors have determined the maximum operating gradient and its limiting factor. They have developed a model that allows them to determine the distribution of gradients that could be achieved for each of these limitations independently of the others. The result of this analysis can guide an R and D program to achieve the best overall performance improvement. The same model can be used to relate the performance of single-cell and multi-cell cavities
Second-generation speed limit map updating applications
DEFF Research Database (Denmark)
Tradisauskas, Nerius; Agerholm, Niels; Juhl, Jens
2011-01-01
Intelligent Speed Adaptation is an Intelligent Transport System developed to significantly improve road safety in helping car drivers maintain appropriate driving behaviour. The system works in connection with the speed limits on the road network. It is thus essential to keep the speed limit map...... used in the Intelligent Speed Adaptation scheme updated. The traditional method of updating speed limit maps on the basis of long time interval observations needed to be replaced by a more efficient speed limit updating tool. In a Danish Intelligent Speed Adaptation trial a web-based tool was therefore...... for map updating should preferably be made on the basis of a commercial map provider, 2 such as Google Maps and that the real challenge is to oblige road authorities to carry out updates....
Torque limit of PM motors for field-weakening region operation
Royak, Semyon [Beachwood, OH; Harbaugh, Mark M [Richfield, OH
2012-02-14
The invention includes a motor controller and technique for controlling a permanent magnet motor. In accordance with one aspect of the present technique, a permanent magnet motor is controlled by receiving a torque command, determining a physical torque limit based on a stator frequency, determining a theoretical torque limit based on a maximum available voltage and motor inductance ratio, and limiting the torque command to the smaller of the physical torque limit and the theoretical torque limit. Receiving the torque command may include normalizing the torque command to obtain a normalized torque command, determining the physical torque limit may include determining a normalized physical torque limit, determining a theoretical torque limit may include determining a normalized theoretical torque limit, and limiting the torque command may include limiting the normalized torque command to the smaller of the normalized physical torque limit and the normalized theoretical torque limit.
Magnetic- and material-limiter discharges in Tokapole II
International Nuclear Information System (INIS)
Moyer, R.A.
1988-01-01
Disruptive instabilities were studied in Tokapole II, a small poloidal-divertor tokamak, in magnetic- and material-limiter configurations. In the magnetic limiter configuration, the divertor separatrix defines the tokamak current channel boundary. Limiters or neutralizer plate are not used to remove plasma in the scrape-off region. The relatively hot, dense plasma in the scrape-off region carries 5-20% of the current. In the material-limiter configuration, limiter plates are inserted to the separatrix to remove plasma and current in the scrape-off region. The plates vary the tokamak current-channel boundary condition in a controlled manner, and provide a benchmark for comparison with other tokamaks. Internal and external disruptions have been studied, and several unique features in the magnetic-limiter configuration were identified. The magnetic-limiter configuration enables routine passing of the stability barriers at q(a) = 2 and q(a) = 1, where q(a) is the edge safety factor, without a close-fitting wall, external windings, or detailed profile control techniques. Passing the q(a) = 1 barrier permits operation in the q < 1 regime where total reconnection of the sawtooth does not occur
Quantum Limits of Space-to-Ground Optical Communications
Hemmati, H.; Dolinar, S.
2012-01-01
For a pure loss channel, the ultimate capacity can be achieved with classical coherent states (i.e., ideal laser light): (1) Capacity-achieving receiver (measurement) is yet to be determined. (2) Heterodyne detection approaches the ultimate capacity at high mean photon numbers. (3) Photon-counting approaches the ultimate capacity at low mean photon numbers. A number of current technology limits drive the achievable performance of free-space communication links. Approaching fundamental limits in the bandwidth-limited regime: (1) Heterodyne detection with high-order coherent-state modulation approaches ultimate limits. SOA improvements to laser phase noise, adaptive optics systems for atmospheric transmission would help. (2) High-order intensity modulation and photon-counting can approach heterodyne detection within approximately a factor of 2. This may have advantages over coherent detection in the presence of turbulence. Approaching fundamental limits in the photon-limited regime (1) Low-duty cycle binary coherent-state modulation (OOK, PPM) approaches ultimate limits. SOA improvements to laser extinction ratio, receiver dark noise, jitter, and blocking would help. (2) In some link geometries (near field links) number-state transmission could improve over coherent-state transmission
Hayflick, his limit, and cellular ageing.
Shay, J W; Wright, W E
2000-10-01
Almost 40 years ago, Leonard Hayflick discovered that cultured normal human cells have limited capacity to divide, after which they become senescent -- a phenomenon now known as the 'Hayflick limit'. Hayflick's findings were strongly challenged at the time, and continue to be questioned in a few circles, but his achievements have enabled others to make considerable progress towards understanding and manipulating the molecular mechanisms of ageing.
Current limiter circuit system
Witcher, Joseph Brandon; Bredemann, Michael V.
2017-09-05
An apparatus comprising a steady state sensing circuit, a switching circuit, and a detection circuit. The steady state sensing circuit is connected to a first, a second and a third node. The first node is connected to a first device, the second node is connected to a second device, and the steady state sensing circuit causes a scaled current to flow at the third node. The scaled current is proportional to a voltage difference between the first and second node. The switching circuit limits an amount of current that flows between the first and second device. The detection circuit is connected to the third node and the switching circuit. The detection circuit monitors the scaled current at the third node and controls the switching circuit to limit the amount of the current that flows between the first and second device when the scaled current is greater than a desired level.
Toward Modeling Limited Plasticity in Ceramic Materials
National Research Council Canada - National Science Library
Grinfeld, Michael; Schoenfeld, Scott E; Wright, Tim W
2008-01-01
The characteristic features of many armor-related ceramic materials are the anisotropy on the micro-scale level and the very limited, though non-vanishing, plasticity due to limited number of the planes for plastic slip...
48 CFR 352.231-70 - Salary rate limitation.
2010-10-01
... 48 Federal Acquisition Regulations System 4 2010-10-01 2010-10-01 false Salary rate limitation... Salary rate limitation. As prescribed in 331.101-70, the Contracting Officer shall insert the following clause: Salary Rate Limitation (January 2010) (a) Pursuant to the current and applicable prior HHS...
Limits of Spalling of Fire-Exposed Concrete
DEFF Research Database (Denmark)
Hertz, Kristian Dahl
2003-01-01
on the nature of spalling, add the latest findings from the research of the author, and derives limits within which spalling should not take place. Some guidelines are formulated based on experience from research and practise for reducing the spalling risk for constructions beyond the safe design limits....... The limits provided are those, which can be stated at present, but further research is in progress, identifying more precisely the range of materials susceptible to spalling and contributing to the full understanding of the phenomenon....
On the temperature dependence of flammability limits of gases.
Kondo, Shigeo; Takizawa, Kenji; Takahashi, Akifumi; Tokuhashi, Kazuaki
2011-03-15
Flammability limits of several combustible gases were measured at temperatures from 5 to 100 °C in a 12-l spherical flask basically following ASHRAE method. The measurements were done for methane, propane, isobutane, ethylene, propylene, dimethyl ether, methyl formate, 1,1-difluoroethane, ammonia, and carbon monoxide. As the temperature rises, the lower flammability limits are gradually shifted down and the upper limits are shifted up. Both the limits shift almost linearly to temperature within the range examined. The linear temperature dependence of the lower flammability limits is explained well using a limiting flame temperature concept at the lower concentration limit (LFL)--'White's rule'. The geometric mean of the flammability limits has been found to be relatively constant for many compounds over the temperature range studied (5-100 °C). Based on this fact, the temperature dependence of the upper flammability limit (UFL) can be predicted reasonably using the temperature coefficient calculated for the LFL. However, some compounds such as ethylene and dimethyl ether, in particular, have a more complex temperature dependence. Copyright © 2011 Elsevier B.V. All rights reserved.
Maximum time-dependent space-charge limited diode currents
Energy Technology Data Exchange (ETDEWEB)
Griswold, M. E. [Tri Alpha Energy, Inc., Rancho Santa Margarita, California 92688 (United States); Fisch, N. J. [Princeton Plasma Physics Laboratory, Princeton University, Princeton, New Jersey 08543 (United States)
2016-01-15
Recent papers claim that a one dimensional (1D) diode with a time-varying voltage drop can transmit current densities that exceed the Child-Langmuir (CL) limit on average, apparently contradicting a previous conjecture that there is a hard limit on the average current density across any 1D diode, as t → ∞, that is equal to the CL limit. However, these claims rest on a different definition of the CL limit, namely, a comparison between the time-averaged diode current and the adiabatic average of the expression for the stationary CL limit. If the current were considered as a function of the maximum applied voltage, rather than the average applied voltage, then the original conjecture would not have been refuted.
Thermal background noise limitations
Gulkis, S.
1982-01-01
Modern detection systems are increasingly limited in sensitivity by the background thermal photons which enter the receiving system. Expressions for the fluctuations of detected thermal radiation are derived. Incoherent and heterodyne detection processes are considered. References to the subject of photon detection statistics are given.
Summary of Dissolved Concentration Limits
International Nuclear Information System (INIS)
Yueting Chen
2001-01-01
According to the Technical Work Plan titled Technical Work Plan for Waste Form Degradation Process Model Report for SR (CRWMS M and O 2000a), the purpose of this study is to perform abstractions on solubility limits of radioactive elements based on the process-level information and thermodynamic databases provided by Natural Environment Program Operations (NEPO) and Waste Package Operations (WPO). The scope of this analysis is to produce solubility limits as functions, distributions, or constants for all transported radioactive elements identified by the Performance Assessment Operations (PAO) radioisotope screening. Results from an expert elicitation for solubility limits of most radioactive elements were used in the previous Total System Performance Assessments (TSPAs). However, the elicitation conducted in 1993 does not meet the criteria set forth by the U.S. Nuclear Regulatory Commission (NRC) due to lack of documentation and traceability (Kotra et al. 1996, Section 3). Therefore, at the Waste Form Abstraction Workshop held on February 2-4, 1999, at Albuquerque, New Mexico, the Yucca Mountain Site Characterization Project (YMP) decided to develop geochemical models to study solubility for the proposed Monitored Geologic Repository. WPO/NEPO is to develop process-level solubility models, including review and compilation of relevant thermodynamic data. PAO's responsibility is to perform abstractions based on the process models and chemical conditions and to produce solubility distributions or response surfaces applicable to the proposed repository. The results of this analysis and conceptual model will feed the performance assessment for Total System Performance Assessment--Site Recommendation (TSPA-SR) and Total System Performance Assessment--License Application (TSPA-LA), and to the Waste Form Degradation Process Model Report section on concentration limits
Summary of Dissolved Concentration Limits
Energy Technology Data Exchange (ETDEWEB)
Yueting Chen
2001-06-11
According to the Technical Work Plan titled Technical Work Plan for Waste Form Degradation Process Model Report for SR (CRWMS M&O 2000a), the purpose of this study is to perform abstractions on solubility limits of radioactive elements based on the process-level information and thermodynamic databases provided by Natural Environment Program Operations (NEPO) and Waste Package Operations (WPO). The scope of this analysis is to produce solubility limits as functions, distributions, or constants for all transported radioactive elements identified by the Performance Assessment Operations (PAO) radioisotope screening. Results from an expert elicitation for solubility limits of most radioactive elements were used in the previous Total System Performance Assessments (TSPAs). However, the elicitation conducted in 1993 does not meet the criteria set forth by the U.S. Nuclear Regulatory Commission (NRC) due to lack of documentation and traceability (Kotra et al. 1996, Section 3). Therefore, at the Waste Form Abstraction Workshop held on February 2-4, 1999, at Albuquerque, New Mexico, the Yucca Mountain Site Characterization Project (YMP) decided to develop geochemical models to study solubility for the proposed Monitored Geologic Repository. WPO/NEPO is to develop process-level solubility models, including review and compilation of relevant thermodynamic data. PAO's responsibility is to perform abstractions based on the process models and chemical conditions and to produce solubility distributions or response surfaces applicable to the proposed repository. The results of this analysis and conceptual model will feed the performance assessment for Total System Performance Assessment--Site Recommendation (TSPA-SR) and Total System Performance Assessment--License Application (TSPA-LA), and to the Waste Form Degradation Process Model Report section on concentration limits.
National Research Council Canada - National Science Library
Peters, Patrick
1996-01-01
This report presents the results of the HAVE GRIP flight test program. This program performed a limited investigation of the effects of stick dynamics and elevator rate limiting on longitudinal pilot induced oscillations (PIOs...
Workshop on confidence limits. Proceedings
International Nuclear Information System (INIS)
James, F.; Lyons, L.; Perrin, Y.
2000-01-01
The First Workshop on Confidence Limits was held at CERN on 17-18 January 2000. It was devoted to the problem of setting confidence limits in difficult cases: number of observed events is small or zero, background is larger than signal, background not well known, and measurements near a physical boundary. Among the many examples in high-energy physics are searches for the Higgs, searches for neutrino oscillations, B s mixing, SUSY, compositeness, neutrino masses, and dark matter. Several different methods are on the market: the CL s methods used by the LEP Higgs searches; Bayesian methods; Feldman-Cousins and modifications thereof; empirical and combined methods. The Workshop generated considerable interest, and attendance was finally limited by the seating capacity of the CERN Council Chamber where all the sessions took place. These proceedings contain all the papers presented, as well as the full text of the discussions after each paper and of course the last session which was a discussion session. The list of participants and the 'required reading', which was expected to be part of the prior knowledge of all participants, are also included. (orig.)
Design and analysis of the TFTR fixed limiters - 1
International Nuclear Information System (INIS)
Winkler, P.; Fixler, S.; Timlen, W.V.
1981-01-01
The operation of the Tokamak Fusion Test Reactor (TFTR) consists of two phases. In the first phase, the Tokamak systems will be tested and an ohmic heated plasma of 4 MW produced. The plasma limiter system for this phase consists of a set of movable and a set of fixed limiters. Because of the low power level during this phase, a design of passively cooled fixed limiters without tiles will satisfy the requirements. This limiter will be replaced by an actively cooled tile-covered axisymmetric limiter in the second phase. This paper discusses the design of the first phase fixed limiters only
14 CFR 25.27 - Center of gravity limits.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Center of gravity limits. 25.27 Section 25... AIRWORTHINESS STANDARDS: TRANSPORT CATEGORY AIRPLANES Flight General § 25.27 Center of gravity limits. The extreme forward and the extreme aft center of gravity limitations must be established for each practicably...
14 CFR 29.1517 - Limiting height-speed envelope.
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Limiting height-speed envelope. 29.1517... Operating Limitations § 29.1517 Limiting height-speed envelope. For Category A rotorcraft, if a range of... following power failure, the range of heights and its variation with forward speed must be established...
Self-organizing maps based on limit cycle attractors.
Huang, Di-Wei; Gentili, Rodolphe J; Reggia, James A
2015-03-01
Recent efforts to develop large-scale brain and neurocognitive architectures have paid relatively little attention to the use of self-organizing maps (SOMs). Part of the reason for this is that most conventional SOMs use a static encoding representation: each input pattern or sequence is effectively represented as a fixed point activation pattern in the map layer, something that is inconsistent with the rhythmic oscillatory activity observed in the brain. Here we develop and study an alternative encoding scheme that instead uses sparsely-coded limit cycles to represent external input patterns/sequences. We establish conditions under which learned limit cycle representations arise reliably and dominate the dynamics in a SOM. These limit cycles tend to be relatively unique for different inputs, robust to perturbations, and fairly insensitive to timing. In spite of the continually changing activity in the map layer when a limit cycle representation is used, map formation continues to occur reliably. In a two-SOM architecture where each SOM represents a different sensory modality, we also show that after learning, limit cycles in one SOM can correctly evoke corresponding limit cycles in the other, and thus there is the potential for multi-SOM systems using limit cycles to work effectively as hetero-associative memories. While the results presented here are only first steps, they establish the viability of SOM models based on limit cycle activity patterns, and suggest that such models merit further study. Copyright © 2014 Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
Kamada, Yutaka; Hosogane, Nobuyuki; Hirayama, Toshio; Tsunematsu, Toshihide
1990-05-01
This report studies mainly the density limit for a series of gas- and pellet-fuelled limiter discharges in JT-60. With the pellet injection into high-current/low-q (q(a)=2.3∼2.5) discharges, the Murakami factor reaches up to 10∼13 x 10 19 m -2 T -1 . The values are about factors of 1.5∼2.0 higher than those for usual gas-fuelled discharges. The pellet injected discharges have high central density, whereas the electron density in the outer region (a/2 abs and n e 2 (r=50 cm) x Z eff (r=50 cm). (author)
Mass limits for the muon neutrino
International Nuclear Information System (INIS)
Hoffman, C.M.; Sandberg, V.D.
1982-01-01
The possibility of improving the present limit on the mass of the muon neutrino is discussed. It is found that decays of muons and pions are not useful means to significantly improve this limit. On the other hand, the decays K 0 /sub L/ → π/sup +-/μ/sup -+/nu/sub μ/ and K + → π 0 μ + nu/sub μ/ appear to be quite promising. Possible experiments are discussed
Loop quantization as a continuum limit
International Nuclear Information System (INIS)
Manrique, Elisa; Oeckl, Robert; Weber, Axel; Zapata, Jose A
2006-01-01
We present an implementation of Wilson's renormalization group and a continuum limit tailored for loop quantization. The dynamics of loop-quantized theories is constructed as a continuum limit of the dynamics of effective theories. After presenting the general formalism we show as a first explicit example the 2D Ising field theory, an interacting relativistic quantum field theory with local degrees of freedom quantized by loop quantization techniques
Limits of the petroleum consumption in Brazil; Limites do consumo de petroleo no Brasil
Energy Technology Data Exchange (ETDEWEB)
Galbieri, Rodrigo [Universidade Estadual de Campinas (UNICAMP), SP (Brazil). Fac. de Engenharia Mecanica], email: galbieri@fem.unicamp.br; Simoes, Andre Felipe [Universidade de Sao Paulo (EACH/USP), SP (Brazil). Escola de Artes, Ciencias e Humanidades], email: afsimoes@usp.br
2010-07-01
The great demand of Diesel oil for cargoes transportation, added to the technical limitations in refining capacity in Brazil, do not allow the level of the feedstock balance itself with the demand of derivatives (especially because of high demand of Diesel oil), making Brazil an importer of Diesel, naphtha and LPG and exporter of fuel oil and gasoline A. This fact sets the country in a vulnerable situation due to oscillate in oil prices and the value of national currency, that might sometimes bring trade deficits of billions of dollars to the country. Due to economic growth, ever greater volumes of oil are needed. This present paper analyzes the main limiting factors for expansion of oil consumption in Brazil. (author)
Nuclide-related exemption limits for radioactive materials
International Nuclear Information System (INIS)
Przyborowski, S.; Scheler, R.
1984-01-01
A procedure has been proposed for setting nuclide-related exemption limits for radioactive materials. It consists in grading the radionuclides into 4 groups of radiotoxicity and assigning only one activity limit to each of them. Examples are given for about 200 radionuclides. The radiation exposures resulting from a continuous steady release of activity fractions or from short-period release of the entire activity were assessed to remain below 0.1 ALI in both of these borderline cases, thus justifying the license-free utilization of radioactive materials below the exemption limits. (author)
Fractional Diffusion Limit for Collisional Kinetic Equations
Mellet, Antoine
2010-08-20
This paper is devoted to diffusion limits of linear Boltzmann equations. When the equilibrium distribution function is a Maxwellian distribution, it is well known that for an appropriate time scale, the small mean free path limit gives rise to a diffusion equation. In this paper, we consider situations in which the equilibrium distribution function is a heavy-tailed distribution with infinite variance. We then show that for an appropriate time scale, the small mean free path limit gives rise to a fractional diffusion equation. © 2010 Springer-Verlag.
Long wavelength limit of the current convective instability
International Nuclear Information System (INIS)
Huba, J.D.
1984-01-01
A linear theory is presented of the current convective instability in the long wavelength limit, i.e., kL >ω) and inertial (ν/sub i/n>>ω) limits where ω is the wave frequency and ν/sub i/n is the ion-neutral collision frequency. It is shown that the growth rate scales as k in the collisional limit and as k/sup 2/3/ in the inertial limit. The analytical solutions are compared to exact numerical solutions, and very good agreement is found. Applications to the auroral ionosphere are discussed
Fundamental limit of light trapping in grating structures
Yu, Zongfu
2010-08-11
We use a rigorous electromagnetic approach to analyze the fundamental limit of light-trapping enhancement in grating structures. This limit can exceed the bulk limit of 4n 2, but has significant angular dependency. We explicitly show that 2D gratings provide more enhancement than 1D gratings. We also show the effects of the grating profile’s symmetry on the absorption enhancement limit. Numerical simulations are applied to support the theory. Our findings provide general guidance for the design of grating structures for light-trapping solar cells.
37 CFR 10.78 - Limiting liability to client.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Limiting liability to client... Office Code of Professional Responsibility § 10.78 Limiting liability to client. A practitioner shall not attempt to exonerate himself or herself from, or limit his or her liability to, a client for his or her...
47 CFR 22.535 - Effective radiated power limits.
2010-10-01
... limits. The effective radiated power (ERP) of transmitters operating on the channels listed in § 22.531 must not exceed the limits in this section. (a) Maximum ERP. The ERP must not exceed the applicable limits in this paragraph under any circumstances. Frequency range (MHz) Maximum ERP (Watts) 35-36 600 43...
Media attention and the market for "green" consumer products
DEFF Research Database (Denmark)
Thøgersen, John
Environmental protection has been an issue with remarkable staying power on the public agenda in Europe and North America in the past two to three decades (Dunlap, 2002) and many companies have prospered by seizing the opportunities offered by the growing "green" market. However, now...... of drama, and misconduct in businesses with a "green" image has a taste of hypocrisy, both of which make for highly newsworthy events. Hence, despite a large and loyal customer base, many "green" companies now find themselves in a much more hostile environment than a decade ago....... there are signs of a general "counter attack" being or-chestrated against the "greens." In this paper I survey the evidence regarding an "issue-attention" cycle (Downs, 1972) in environmental concern in Western Europe and North America and discus the role of the news media in creating the cycle. It is well...
Stylistic analysis of headlines in science journalism: A case study of New Scientist.
Molek-Kozakowska, Katarzyna
2017-11-01
This article explores science journalism in the context of the media competition for readers' attention. It offers a qualitative stylistic perspective on how popular journalism colonizes science communication. It examines a sample of 400 headlines collected over the period of 15 months from the ranking of five 'most-read' articles on the website of the international magazine New Scientist. Dominant lexical properties of the sample are first identified through frequency and keyness survey and then analysed qualitatively from the perspective of the stylistic projection of newsworthiness. The analysis illustrates various degrees of stylistic 'hybridity' in online popularization of scientific research. Stylistic patterns that celebrate, domesticate or personalize science coverage (characteristic of popular journalism) are intertwined with devices that foreground tentativeness, precision and informativeness (characteristic of science communication). The article reflects on the implications of including various proportions of academic and popular styles in science journalism.
Bader, Rasha K; Shtaiwi, Aisha S; Shihab, Rawan A; Obeidat, Nour A; Hawari, Feras I
2017-07-16
News media play a critical role in tobacco control. To strengthen this role in Jordan, four newspapers were searched and 1 145 articles between 2011 and 2015 were coded for mention of MPOWER topics and for tone of coverage (neutral, pro-, or anti-tobacco control). Monthly counts, mention of tobacco control topics and the tones were examined. The monthly count of tobacco control-related news items showed an upward trend with an average monthly growth of 16%. Peaks in coverage were observed in synchrony with national tobacco control developments. 'Warn' was the topic most frequently mentioned (46%). 'Protect' was the only topic that showed a statistically significant upward trend over time. A pro-tobacco control tone was more prevalent than an antitobacco control or neutral tone. Thus, efforts are needed to enhance the newsworthiness of certain topics, boost influence on decision-makers and pre-empt industry interference.
Morgan, Caroline
1993-01-01
The evolution and functions of Australia's Copyright Agency Limited are described. The agency is a copyright collecting organization which collectively administers the rights of authors and publishers whose works are copied in education, and enters into blanket agreements with educational authorities outside the existing statutory license. Some…
Fractional Diffusion Limit for Collisional Kinetic Equations
Mellet, Antoine; Mischler, Sté phane; Mouhot, Clé ment
2010-01-01
This paper is devoted to diffusion limits of linear Boltzmann equations. When the equilibrium distribution function is a Maxwellian distribution, it is well known that for an appropriate time scale, the small mean free path limit gives rise to a
Results from the DITE pump-limiter experiment
International Nuclear Information System (INIS)
Johnson, P.C.; Fielding, S.J.; Matthews, G.F.; Pitts, R.; Pritchard, J.; Vayakis, G.
1989-01-01
Experiments have been carried out on the DITE tokamak with a large poloidal pump limiter of a relatively simple design. A particle exhaust into the pump limiter of 6% of the total particle flux leaving the plasma has been achieved. (orig.)
76 FR 72875 - Passive Activity Losses and Credits Limited
2011-11-28
... partnership is limited under applicable State law; or (B) the liability of the holder of such interest for... interests in limited liability partnerships and LLCs were not interests in limited partnerships because... participate in the management and control of the partnership without losing their limited liability. As a...
International Nuclear Information System (INIS)
Meuschke, R.E.; Boyd, C.H.
1989-01-01
This patent describes a method of limiting the movement of a thermal shield of a nuclear reactor. It comprises: machining at least four (4) pockets in upper portions of a thermal shield circumferentially about a core barrel of a nuclear reactor to receive key-wave inserts; tapping bolt holes in the pockets of the thermal shield to receive bolts; positioning key-wave inserts into the pockets of the thermal shield to be bolted in place with the bolt holes; machining dowel holes at least partially through the positioned key-way inserts and the thermal shield to receive dowel pins; positioning dowel pins in the dowel holes in the key-way insert and thermal shield to tangentially restrain movement of the thermal shield relative to the core barrel; sliding limiter keys into the key-way inserts and bolting the limiter keys to the core barrel to tangentially restrain movement of the thermal shield relative and the core barrel while allowing radial and axial movement of the thermal shield relative to the core barrel; machining dowel holes through the limiter key and at least partially through the core barrel to receive dowel pins; positioning dowel pins in the dowel holes in the limiter key and core barrel to restrain tangential movement of the thermal shield relative to the core barrel of the nuclear reactor
Variable Eddington factors and flux-limiting diffusion coefficients
International Nuclear Information System (INIS)
Whalen, P.P.
1982-01-01
Variable Eddington factors and flux limiting diffusion coefficients arise in two common techniques of closing the moment equations of transport. The first two moment equations of the full transport equation are still frequently used to solve many problems of radiative or particle transport. An approximate analysis, developed by Levermore, exhibits the relation between the coefficients of the two different techniques. This analysis is described and then used to test the validity of several commonly used flux limiters and Eddington factors. All of the ad-hoc flux limiters have limited validity. All of the variable Eddington factors derived from some underlying description of the angular distribution function are generally valid. The use of coefficients from Minerbo's elegant maximum entropy Eddington factor analysis is suggested for use in either flux limited diffusion or variable Eddington factor equations
Liquid tin limiter for FTU tokamak
Energy Technology Data Exchange (ETDEWEB)
Vertkov, A., E-mail: avertkov@yandex.ru [JSC “Red Star”, Moscow (Russian Federation); Lyublinski, I. [JSC “Red Star”, Moscow (Russian Federation); NRNU MEPhI, Moscow (Russian Federation); Zharkov, M. [JSC “Red Star”, Moscow (Russian Federation); Mazzitelli, G.; Apicella, M.L.; Iafrati, M. [Associazione EURATOM-ENEA sulla Fusione, C. R. Frascati, Frascati, Rome, Italy, (Italy)
2017-04-15
Highlights: • First steady state operating liquid tin limiter TLL is under study on FTU tokamak. • The cooling system with water spray coolant for TLL has been developed and tested. • High corrosion resistance of W and Mo in molten Sn confirmed up to 1000 °C. • Wetting process with Sn has been developed for Mo and W. - Abstract: The liquid Sn in a matrix of Capillary Porous System (CPS) has a high potential as plasma facing material in steady state operating fusion reactor owing to its physicochemical properties. However, up to now it has no experimental confirmation in tokamak conditions. First steady state operating limiter based on the CPS with liquid Sn installed on FTU tokamak and its experimental study is in progress. Several aspects of the design, structural materials and operation parameters of limiter based on tungsten CPS with liquid Sn are considered. Results of investigation of corrosion resistance of Mo and W in Sn and their wetting process are presented. The heat removal for limiter steady state operation is provided by evaporation of flowing gaswater spray. The effectiveness of such heat removal system is confirmed in modelling tests with power flux up to 5 MW/m2.
Aluminum limiter experiment in ST tokamak
International Nuclear Information System (INIS)
Meservey, E.B.; Bretz, N.; Dimock, D.L.; Hinnov, E.
1976-01-01
In order to investigate the effects of a light-element limiter on plasma parameters, aluminum rail limiters interchangeable with Mo rails were installed top, bottom, and outside directions in the ST tokamak. The inside limiter remained a fixed Mo rail. Compared with discharges produced immediately before and after with the usual Mo limiters, the ''aluminum'' discharges showed an increase of T/sub e/ (by factors of 1.4-2 near the center) and of energy confinement (by factors of 2 to 3 in el. energy/power input, depending on time of observation). H 2 and He discharges showed practically identical effects. In plasma composition, the Mo concentration dropped significantly, but Fe only slightly if at all; the Al concentration was about 3-5 percent (i.e., large compared to the heavier metals), whereas oxygen, about 4 to 8 percent to start with, dropped to insignificance, probably as a result of Al evaporation. The z/sub eff/ from resistivity increased 20-30 percent although the resistance dropped because of the higher T/sub e/. The improved T/sub e/ and energy confinement are thought to be the result of cumulative effects of more favorable radial current and power input distributions rather than direct energy losses by radiation
On the density limit of Tokamaks
International Nuclear Information System (INIS)
Lehnert, B.
1982-12-01
Under the conditions of so far performed quasi-steady tokamak experiments near the density limit, the plasma pressure gradient in the outer layers of the plasma body becomes mainly determined by the plasma-neutral gas balance. An earlier analysis of ballooning instabilities driven by this gradient in regions of bad curvature has been extended to deduce an explicit stability criterion which determines the density limit. This criterion is closely related to the empirical Murakami limit. At relevant tokamak data, the deduced limit becomes proportional to J(sub)zR(sup)1/2 where J(sub)z is the average current density and R the major plasma radius. It is further found to be independent of the toroidal magnetic field strength and anomalous transport, as well as to be a slow function of the outer layer temperature and the mass number. The deduced stability criterion is consistent with so far performed experiments. Provided that the present analysis can be extrapolated to a wider range of parameter data and be combined with Alcator scaling, conditions near ignition appear to become realizable in small tokamaks by ohmic heating alone. These conditions can be satisfied at relevant magnetic field strengths and plasma currents, by imposing a high plasma current density. (author)
Low-temperature operating regime of the tokamak evacuating limiter
International Nuclear Information System (INIS)
Tokar', M.Z.
1987-01-01
The conditions for realizing the regime of strong recycling of a cold dense plasma of an evacuating limiter were determined based on a previously proposed model for describing the limiter layer of a tokamak. The scaling for the dependence of the gas pressure in the evacuation system on the average plasma density in the limiter layer was found, and agreed quantitatively with the results of measurements on the Alcator and ISX-B tokamaks. For the tokamak reactor of the INTOR scale the calculations show that the low-temperature operating regime of the evacuating limiter can be realized with a quite low pumping rate. It has the advantages of reduced erosion of the limiter and small fluxes of impurities into the working volume of the reactor. In addition, the relative concentration of the helium ash in the limiter layer does not exceed 2-3%, but the density of the main plasma is comparable to the proposed average density in the reactor. The concept of a stochastic limiter is of interest for lowering the plasma density in the limiter layer and lowering the thermal loads on the limiter
Limit on the tau neutrino mass
International Nuclear Information System (INIS)
Cinabro, D.; Henderson, S.; Kinoshita, K.; Liu, T.; Saulnier, M.; Wilson, R.; Yamamoto, H.; Sadoff, A.J.; Ammar, R.; Ball, S.; Baringer, P.; Coppage, D.; Copty, N.; Davis, R.; Hancock, N.; Kelly, M.; Kwak, N.; Lam, H.; Kubota, Y.; Lattery, M.; Nelson, J.K.; Patton, S.; Perticone, D.; Poling, R.; Savinov, V.; Schrenk, S.; Wang, R.; Alam, M.S.; Kim, I.J.; Nemati, B.; O'Neill, J.J.; Romero, V.; Severini, H.; Sun, C.R.; Zoeller, M.M.; Crawford, G.; Fulton, R.; Fujino, D.; Gan, K.K.; Kagan, H.; Kass, R.; Lee, J.; Malchow, R.; Morrow, F.; Skovpen, Y.; Sung, M.; White, C.; Whitmore, J.; Wilson, P.; Butler, F.; Fu, X.; Kalbfleisch, G.; Lambrecht, M.; Ross, W.R.; Skubic, P.; Snow, J.; Wang, P.L.; Wood, M.; Bortoletto, D.; Brown, D.N.; Dominick, J.; McIlwain, R.L.; Miao, T.; Miller, D.H.; Modesitt, M.; Schaffner, S.F.; Shibata, E.I.; Shipsey, I.P.J.; Wang, P.N.; Battle, M.; Ernst, J.; Kroha, H.; Roberts, S.; Sparks, K.; Thorndike, E.H.; Wang, C.H.; Sanghera, S.; Skwarnicki, T.; Stroynowski, R.; Artuso, M.; He, D.; Goldberg, M.; Horwitz, N.; Kennett, R.; Moneti, G.C.; Muheim, F.; Mukhin, Y.; Playfer, S.; Rozen, Y.; Rubin, P.; Stone, S.; Thulasidas, M.; Vasseur, G.; Zhu, G.; Barnes, A.V.; Bartelt, J.; Csorna, S.E.; Egyed, Z.; Jain, V.; Sheldon, P.; Akerib, D.S.; Barish, B.; Chadha, M.; Chan, S.; Cowen, D.F.; Eigen, G.; Miller, J.S.; Urheim, J.; Weinstein, A.J.; Acosta, D.; Athanas, M.; Masek, G.; Ong, B.; Paar, H.; Sivertz, M.; Bean, A.; Gronberg, J.; Kutschke, R.; Menary, S.; Morrison, R.J.; Nakanishi, S.; Nelson, H.N.; Nelson, T.K.; Richman, J.D.; Tajima, H.; Schmidt, D.; Sperka, D.; Witherell, M.S.; Procario, M.; Yang, S.; Balest, R.; Cho, K.; Daoudi, M.; Ford, W.T.; Johnson, D.R.; Lingel, K.; Lohner, M.; Rankin, P.; Smith, J.G.; Alexander, J.P.; Bebek, C.; Berkelman, K.; Besson, D.; Browder, T.E.; Cassel, D.G.; Cho, H.A.; Coffman, D.M.; Drell, P.S.; Ehrlich, R.; Galik, R.S.; Garcia-Sciveres, M.; Geiser, B.; Gittelman, B.; Gray, S.W.; Hartill, D.L.; Heltsley, B.
1993-01-01
A limit on the tau neutrino mass M ντ is obtained from a study of tau decays in the reaction e + e-→τ + τ - at center-of-mass energies ∼10.6 GeV. The result is based on an end-point analysis of the invariant mass spectrum of the decay products in the decay modes τ - →3h - 2h + ν τ and τ - →2h - h+2π 0 ν τ . The data sample used in this analysis contains 1.77x10 6 tau pairs, corresponding to an integrated luminosity of 1.92 fb -1 , and is substantially larger than previous data samples used to place a limit on M ντ . The limit obtained for both five-hadron modes together is 32.6 MeV at 95% C.L
Variable Speed Limit (VSL) - Best Management Practice
2012-07-01
The Variable Speed Limit (VSL) system on the I-4 corridor in Orlando was implemented by Florida Department of Transportation in 2008, and since its deployment, it was revealed that the majority of traffic exceeds the speed limit by more mph when the ...
Back to Classics: Teaching Limits through Infinitesimals.
Todorov, Todor D.
2001-01-01
Criticizes the method of using calculators for the purpose of selecting candidates for L, for the limit value of a function. Suggests an alternative: a working formula for calculating the limit value L of a real function in terms of infinitesimals. (Author/ASK)
Limits and signatures of relativistic spaceflight
Yurtsever, Ulvi; Wilkinson, Steven
2018-01-01
While special relativity imposes an absolute speed limit at the speed of light, our Universe is not empty Minkowski spacetime. The constituents that fill the interstellar/intergalactic vacuum, including the cosmic microwave background photons, impose a lower speed limit on any object travelling at relativistic velocities. Scattering of cosmic microwave photons from an ultra-relativistic object may create radiation with a characteristic signature allowing the detection of such objects at large distances.
First pump limiter experiments in Tore Supra
International Nuclear Information System (INIS)
Chatelier, M.; Bruneau, J.L.; Chappuis, P.; Gil, C.; Guilhem, D.; Lipa, M.; Rodriguez, L.; Vallet, J.C.; Van Houtte, D.; Watkins, J.G.
1989-01-01
The thermal load and the particle pumping effects on the outboard pump limiters (OPL), in Tore Supra are analyzed. The investigations are performed for the plasma either in contact with the OPL/ONPL (outboard non pumped limiters) alone or with the OPL and the vertical limiters together. Calorimetric measurements provide estimates of the time-integrated balance of the energy flow at the plasma edge. Radiated and charge exchange energy losses are deduced from the inner vessel calorimetry (R=242cm, a=94cm). Conductive/convective losses on the OPL and vertical (top and bottom) limiters are independently measured, as well as the integrated energy flow on the ergodic divertors. The calorimetric results, the bolometric measurements of the radiated power and the Ohmic power estimates, are indicated. The central line density from interferometric measurement for the two successive shots, with the ONPL and with the OPL, are given
Bailey, Stephen K.
This discussion, presented at the Regent's Trustees' Conference, February 1973, reviews the limits of accountability in higher education. Managerial efficiency is suggested to assist in eliminating educational and financial waste. This, however, is the secondary concept emphasized. The primary emphasis indicates the legitimacy of the claims that a…
Risk based limits for Operational Safety Requirements
International Nuclear Information System (INIS)
Cappucci, A.J. Jr.
1993-01-01
OSR limits are designed to protect the assumptions made in the facility safety analysis in order to preserve the safety envelope during facility operation. Normally, limits are set based on ''worst case conditions'' without regard to the likelihood (frequency) of a credible event occurring. In special cases where the accident analyses are based on ''time at risk'' arguments, it may be desirable to control the time at which the facility is at risk. A methodology has been developed to use OSR limits to control the source terms and the times these source terms would be available, thus controlling the acceptable risk to a nuclear process facility. The methodology defines a new term ''gram-days''. This term represents the area under a source term (inventory) vs time curve which represents the risk to the facility. Using the concept of gram-days (normalized to one year) allows the use of an accounting scheme to control the risk under the inventory vs time curve. The methodology results in at least three OSR limits: (1) control of the maximum inventory or source term, (2) control of the maximum gram-days for the period based on a source term weighted average, and (3) control of the maximum gram-days at the individual source term levels. Basing OSR limits on risk based safety analysis is feasible, and a basis for development of risk based limits is defensible. However, monitoring inventories and the frequencies required to maintain facility operation within the safety envelope may be complex and time consuming
Directory of Open Access Journals (Sweden)
Johansson S.
2013-06-01
Full Text Available Biofuel production is dependent upon agriculture and forestry systems, and the expectations of future biofuel potential are high. A study of the global food production and biofuel production from edible crops implies that biofuel produced from edible parts of crops lead to a global deficit of food. This is rather well known, which is why there is a strong urge to develop biofuel systems that make use of residues or products from forest to eliminate competition with food production. However, biofuel from agro-residues still depend upon the crop production system, and there are many parameters to deal with in order to investigate the sustainability of biofuel production. There is a theoretical limit to how much biofuel can be achieved globally from agro-residues and this amounts to approximately one third of todays’ use of fossil fuels in the transport sector. In reality this theoretical potential may be eliminated by the energy use in the biomass-conversion technologies and production systems, depending on what type of assessment method is used. By surveying existing studies on biofuel conversion the theoretical limit of biofuels from 2010 years’ agricultural production was found to be either non-existent due to energy consumption in the conversion process, or up to 2–6000TWh (biogas from residues and waste and ethanol from woody biomass in the more optimistic cases.
Johansson, S.
2013-06-01
Biofuel production is dependent upon agriculture and forestry systems, and the expectations of future biofuel potential are high. A study of the global food production and biofuel production from edible crops implies that biofuel produced from edible parts of crops lead to a global deficit of food. This is rather well known, which is why there is a strong urge to develop biofuel systems that make use of residues or products from forest to eliminate competition with food production. However, biofuel from agro-residues still depend upon the crop production system, and there are many parameters to deal with in order to investigate the sustainability of biofuel production. There is a theoretical limit to how much biofuel can be achieved globally from agro-residues and this amounts to approximately one third of todays' use of fossil fuels in the transport sector. In reality this theoretical potential may be eliminated by the energy use in the biomass-conversion technologies and production systems, depending on what type of assessment method is used. By surveying existing studies on biofuel conversion the theoretical limit of biofuels from 2010 years' agricultural production was found to be either non-existent due to energy consumption in the conversion process, or up to 2-6000TWh (biogas from residues and waste and ethanol from woody biomass) in the more optimistic cases.
Heat removal in INTOR via a toroidal limiter
International Nuclear Information System (INIS)
Mioduszewski, P.
1981-01-01
In the present paper the potential of removing about 100 MW of thermal plasma power via a toroidal limiter in INTOR is studied. The heat flux distributions on various limiter configurations are calculated and the thermal response of a graphite tile limiter is estimated on the base of a one-dimensional heat conduction approach. The evaporation rates which have to be expected for the given energy flux densities and radiation cooled graphite tiles are evaluated. According to the present understanding it should be possible to remove 100 MW power from the INTOR plasma via a radiation cooled toroidal limiter. (author)
Parker limit for monopoles with large magnetic charge
International Nuclear Information System (INIS)
Hodges, H.M.; Kolb, E.W.; Turner, M.S.
1986-01-01
The survival of galactic magnetic fields places a limit on the flux of magnetic monopoles, the so-called ''Parker limit.'' Previous discussions of the Parker limit have assumed that the charge of the monopole is the Dirac value, g/sub Dirac/ = 2π/e. However, if the grand unified group is broken by Wilson lines, as is assumed in some superstring models, the minimum value of the magnetic charge is not the Dirac quantum, but an integer multiple of it. In this brief report we investigate the dependence of the Parker limit on the charge of the magnetic monopole. 10 refs., 1 fig
36 CFR 1004.11 - Load, weight and size limits.
2010-07-01
... § 1004.11 Load, weight and size limits. (a) Vehicle load, weight and size limits established by State law... following are prohibited: (1) Operating a vehicle that exceeds a load, weight or size limit designated by... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false Load, weight and size limits...
Modelling of particles collection by vented limiters
International Nuclear Information System (INIS)
Tsitrone, E.; Pegourie, B.; Granata, G.
1995-01-01
This document deals with the use of vented limiters for the collection of neutral particles in Tore Supra. The model developed for experiments is presented together with its experimental validation. Some possible improvements to the present limiter are also proposed. (TEC). 5 refs., 3 figs
Analysis of a T-10 graphite limiter
International Nuclear Information System (INIS)
Hildebrandt, D.; Laux, M.; Lingertat, J.; Pech, P.; Reiner, H.D.; Strusny, H.; Wolff, H.
1981-01-01
Parts of a T-10 graphite limiter used during ohmic heated discharges have been investigated. Erosion and deposition phenomena have been studied by morphological and elemental surface analysis methods. From the results estimates of the plasma parameters near the limiter surface have been made. (orig.)
78 FR 57790 - Extension of Time Limits
2013-09-20
.... Thus, this modification makes explicit that parties may request extensions for any time limit... Department's attention more quickly, thus increasing the chance that the Department will be able to...; only if the questionnaire is divided into separate sections is the time limit for individual sections...
40 CFR 76.10 - Alternative emission limitations.
2010-07-01
... 40 Protection of Environment 16 2010-07-01 2010-07-01 false Alternative emission limitations. 76.10 Section 76.10 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) ACID RAIN NITROGEN OXIDES EMISSION REDUCTION PROGRAM § 76.10 Alternative emission limitations. (a...
Investigation of density limit processes in DIII-D
International Nuclear Information System (INIS)
Maingi, R.; Mahdavi, M.A.; Petrie, T.W.
1999-02-01
A series of experiments has been conducted in DIII-D to investigate density-limiting processes. The authors have studied divertor detachment and MARFEs on closed field lines and find semi-quantitative agreement with theoretical calculations of onset conditions. They have shown that the critical density for MARFE onset at low edge temperature scales as I p /a 2 , i.e. similar to Greenwald scaling. They have also shown that the scaling of the critical separatrix density with heating power at partial detachment onset agrees with Borass' model. Both of these processes yield high edge density limits for reactors such as ITER. By using divertor pumping and pellet fueling they have avoided these and other processes and accessed densities > 1.5x Greenwald limit scaling with H-mode confinement, demonstrating that the Greenwald limit is not a fundamental limit on the core density
Investigation of density limit processes in DIII-D
International Nuclear Information System (INIS)
Maingi, R.; Baylor, L.R.; Jernigan, T.
2001-01-01
A series of experiments has been conducted in DIII-D to investigate density-limiting processes. We have studied divertor detachment and MARFEs on closed field lines and find semi-quantitative agreement with theoretical calculations of onset conditions. We have shown that the critical density for MARFE onset at low edge temperature scales as I p /a 2 , i.e. similar to Greenwald scaling. We have also shown that the scaling of the critical separatrix density with heating power at partial detachment onset agrees with Borass' model. Both of these processes yield high edge density limits for reactors such as ITER. By using divertor pumping and pellet fueling we have avoided these and other processes and accessed densities >1.5x Greenwald limit scaling with H-mode confinement, demonstrating that the Greenwald limit is not a fundamental limit on the core density. (author)
Investigation of density limit processes in DIII-D
International Nuclear Information System (INIS)
Maingi, R.; Mahdavi, M.A.; Petrie, T.W.
1999-01-01
A series of experiments has been conducted in DIII-D to investigate density-limiting processes. We have studied divertor detachment and MARFEs on closed field lines and find semi-quantitative agreement with theoretical calculations of onset conditions. We have shown that the critical density for MARFE onset at low edge temperature scales as I p /a 2 , i.e. similar to Greenwald scaling. We have also shown that the scaling of the critical separatrix density with heating power at partial detachment onset agrees with Borass' model. Both of these processes yield high edge density limits for reactors such as ITER. By using divertor pumping and pellet fueling we have avoided these and other processes and accessed densities > 1.5x Greenwald limit scaling with H-mode confinement, demonstrating that the Greenwald limit is not a fundamental limit on the core density. (author)
Proposed derivation of skin contamination and skin decontamination limits
International Nuclear Information System (INIS)
Schieferdecker, H.; Koelzer, W.; Henrichs, K.
1986-01-01
From the primary dose limits for the skin, secondary dose limits were derived for skin contamination which can be used in practical radiation protection work. Analogous to the secondary dose limit for the maximum permissible body burden in the case of incorporation, dose limits for the 'maximum permissible skin burden' were calculated, with the help of dose factors, for application in the case of skin contamination. They can be derived from the skin dose limit values. For conditions in which the skin is exposed to temporary contamination, a limit of skin contamination was derived for immediately removable contamination and for one day of exposure. For non-removable contamination a dose limit of annual skin contamination was defined, taking into account the renewal of the skin. An investigation level for skin contamination was assumed, as a threshold, above which certain measures must be taken; these to include appropriate washing not more than three times, with the subsequent procedure determined by the level of residual contamination. The dose limits are indicated for selected radionuclides. (author)
Digital limiter for a self-excited loop
International Nuclear Information System (INIS)
Joshi, G.; Singh, P.; Agarwal, V.; Kumar, G.
2015-01-01
Limiter is one of the main signal processing modules of a self-excited loop (SEL). It plays a crucial role in initiating and stabilizing the amplitude of the RF field in a free running SEL. In a recently reported implementation of a self excited loop in digital domain, the limiter has been realized at based band in the form of a feedback loop. This feedback loop stabilizes the amplitude of the RF phasor present at its input without affecting its phase. In the present work we study the suitability of this implementation of limiter through analysis and simulations. An approximate equivalent model of an SEL, incorporating the digital limiter, is created in analog domain. It is demonstrated that even in the presence for large transients, such as, at the start up of oscillations, SEL continues to exhibit smooth and predictable response. In free running mode of operation the coupling from loop oscillation frequency change to resonator field amplitude change is absent, thus avoiding instability due to electro-mechanical coupling. In the locked mode, the transmission of amplitude jitter through the limiter is far exceeded by that through the controller gain thereby keeping the behavior of the digital SEL close to its analog counterpart. (author)
Shot-Noise Limited Time-Encoded Raman Spectroscopy
Directory of Open Access Journals (Sweden)
Sebastian Karpf
2017-01-01
Full Text Available Raman scattering, an inelastic scattering mechanism, provides information about molecular excitation energies and can be used to identify chemical compounds. Albeit being a powerful analysis tool, especially for label-free biomedical imaging with molecular contrast, it suffers from inherently low signal levels. This practical limitation can be overcome by nonlinear enhancement techniques like stimulated Raman scattering (SRS. In SRS, an additional light source stimulates the Raman scattering process. This can lead to orders of magnitude increase in signal levels and hence faster acquisition in biomedical imaging. However, achieving a broad spectral coverage in SRS is technically challenging and the signal is no longer background-free, as either stimulated Raman gain (SRG or loss (SRL is measured, turning a sensitivity limit into a dynamic range limit. Thus, the signal has to be isolated from the laser background light, requiring elaborate methods for minimizing detection noise. Here, we analyze the detection sensitivity of a shot-noise limited broadband stimulated time-encoded Raman (TICO-Raman system in detail. In time-encoded Raman, a wavelength-swept Fourier domain mode locking (FDML laser covers a broad range of Raman transition energies while allowing a dual-balanced detection for lowering the detection noise to the fundamental shot-noise limit.
H-mode development in TEXT-U limiter plasmas
International Nuclear Information System (INIS)
Roberts, D.R.; Bravenec, R.V.; Bengtson, R.D.
1996-01-01
H-mode transitions in TEXT-U limiter plasmas have been observed at q a ∼ 3 and I p ∼ 250 kA (P OH ∼ 300 kW) with at least 300 kW of central electron-cyclotron heating (ECH). These are dithering transitions which are induced by sawtooth crashes and display the typical signatures of H-modes (D α drop, spontaneous density increase, evidence of a transport barrier). However, they show only a slight improvement over L-mode energy confinement. The vessel walls are boronized and conditioned prior to experiments to achieve low-impurity influx and particle recycling. Discharges which undergo transitions are fuelled almost entirely on residual recycling. Transitions are observed when limited on a toroidally localized top or bottom limiter and, more often, when the limiter surface is 'fresh', which is achieved by alternating between top and bottom limiters on successive shots. No strong dependence upon the distance from the low-field-side limiter has been found. Transitions are not yet observed when limited on the high-field-side wall tiles or in the case of TEXT-U diverted configurations. Preliminary measurements with the 2 MeV heavy-ion beam probe (HIBP) (in the core) and Langmuir probes (in the edge) indicate that the plasma potential drops outside the q = 1 radius while only small changes are observed in the density fluctuations level. (author)
Gulf of Mexico mud toxicity limitations
Energy Technology Data Exchange (ETDEWEB)
Dunn, H.E.; Beardmore, D.H. (Phillips Petroleum Co., Bartlesville, OK (USA)); Stewart, W.S. (Drilling Specialties Co. (US))
1989-10-01
Because of the Environmental Protection Agency's recent toxicity limits on drilling mud discharges for offshore Gulf of Mexico, Phillips Petroleum conducted a mud toxicity study based on both field and lab tests. The study, discussed in this article, found the polyanionic cellulose-sulfomethylated quebracho-chrome lignosulfonate mud Phillips had been using would comfortably pass the toxicity limitations. The study also found barite and thinners were of low toxicity, and hydrocarbons and surfactants were highly toxic.
Limiting currents of overcompensated electron beams
International Nuclear Information System (INIS)
Malafaev, V.A.
1990-01-01
A possibility of producing recompensated electron beam and increasing its limiting currents in the magnetic field is experimentally investigated. It is shown that such a possibility is realized when the beam is surrounded by a cylindrical net placed into the tube located under the positive potential relative to the net. In this case an increase of limiting current at the expense of increasing the ion life time, takes place. Current, exceeding the Pierce threshold 1.5 times, is obtained
Altitudinal distribution limits of aquatic macroinvertebrates
DEFF Research Database (Denmark)
Madsen, Philip B.; Morabowen, Andrés; Andino, Patricio
2015-01-01
1. Temperature and oxygen are recognised as the main drivers of altitudinal limits of species distributions. However, the two factors are linked, and both decrease with altitude, why their effects are difficult to disentangle. 2. This was experimentally addressed using aquatic macroinvertebrates...... relatively small differences in temperature and oxygen may produce effects explaining ecological patterns, and depending on the taxon, either water temperature or oxygen saturation, without clear interacting effects, are important drivers of altitudinal limits....
Evaluation of concentration limits of radionuclides produced by accelerators
International Nuclear Information System (INIS)
Shibata, Tokushi; Ohkubo, Tohru; Uwamino, Yoshitomo; Iwai, Satoshi; Satoh, Osamu; Rintsu, Yukoh; Fukumoto, Toshiharu.
1992-01-01
This report describes the evaluation of concentration limits of 78 radionuclides typically produced by accelerator facilities and not listed in ICRP Pub. 30. The evaluation method and system have been developed in the present study. The evaluated values were compared with tremendously severe concentration limits given in the Annex Table 2 of the Science and Technology Agency Notification No. 15 which describes the concentration limits of the nuclides of which concentration limits are not given in the Annex Table 1 of the Agency Notification No. 15. The results show that two to nine order larger limits should be used. The new limits rationalize greatly the internal exposure control and the design of accelerator facilities. Simple and convenient techniques are also discussed for finding concentration limits of very-short-lived nuclides without knowing detail information about the nuclides such as decay scheme and metabolic data. (author)
Formation of carbon containing layers on tungsten test limiters
International Nuclear Information System (INIS)
Rubel, M.; Philipps, V.; Huber, A.; Tanabe, T.
1999-01-01
Tungsten test limiters of mushroom shape and a plasma facing area of approximately 100 cm 2 were exposed at the TEXTOR-94 tokamak to a number of deuterium fuelled discharges performed under various operation conditions. Two types of limiters were tested: a sole tungsten limiter and a twin limiter consisting of two halves, one made of tungsten and another of graphite. The exposed surfaces were examined with ion beam analysis methods and laser profilometry. The formation of some deposition zones was observed near the edges of the limiters. The deuterium-to-carbon concentration ratio was in the range from 0.04 to 0.11 and around 0.2 for the sole tungsten and the twin limiter, respectively. Significant amounts of the co-deposited tungsten and silicon atoms were found on the graphite part of the twin limiter indicating the formation of mixed W-C-Si compounds. (orig.)
Relationship of employee-reported work limitations to work productivity.
Lerner, Debra; Amick, Benjamin C; Lee, Jennifer C; Rooney, Ted; Rogers, William H; Chang, Hong; Berndt, Ernst R
2003-05-01
Work limitation rates are crucial indicators of the health status of working people. If related to work productivity, work limitation rates may also supply important information about the economic burden of illness. Our objective was to assess the productivity impact of on-the-job work limitations due to employees' physical or mental health problems. Subjects were asked to complete a self-administered survey on the job during 3 consecutive months. Using robust regression analysis, we tested the relationship of objectively-measured work productivity to employee-reported work limitations. We attempted to survey employees of a large firm within 3 different jobs. The survey response rate was 2245 (85.9%). Full survey and productivity data were available for 1827 respondents. Each survey included a validated self-report instrument, the Work Limitations Questionnaire (WLQ). The firm provided objective, employee-level work productivity data. In adjusted regression analyses (n = 1827), employee work productivity (measured as the log of units produced/hour) was significantly associated with 3 dimensions of work limitations: limitations handling the job's time and scheduling demands (P = 0.003), physical job demands (P = 0.001), and output demands (P = 0.006). For every 10% increase in on-the-job work limitations reported on each of the 3 WLQ scales, work productivity declined approximately 4 to 5%. Employee work limitations have a negative impact on work productivity. Employee assessments of their work limitations supply important proxies for the economic burden of health problems.
Photon and graviton mass limits
International Nuclear Information System (INIS)
Goldhaber, Alfred Scharff; Nieto, Michael Martin
2010-01-01
Efforts to place limits on deviations from canonical formulations of electromagnetism and gravity have probed length scales increasing dramatically over time. Historically, these studies have passed through three stages: (1) testing the power in the inverse-square laws of Newton and Coulomb, (2) seeking a nonzero value for the rest mass of photon or graviton, and (3) considering more degrees of freedom, allowing mass while preserving explicit gauge or general-coordinate invariance. Since the previous review the lower limit on the photon Compton wavelength has improved by four orders of magnitude, to about one astronomical unit, and rapid current progress in astronomy makes further advance likely. For gravity there have been vigorous debates about even the concept of graviton rest mass. Meanwhile there are striking observations of astronomical motions that do not fit Einstein gravity with visible sources. ''Cold dark matter'' (slow, invisible classical particles) fits well at large scales. ''Modified Newtonian dynamics'' provides the best phenomenology at galactic scales. Satisfying this phenomenology is a requirement if dark matter, perhaps as invisible classical fields, could be correct here too. ''Dark energy''might be explained by a graviton-mass-like effect, with associated Compton wavelength comparable to the radius of the visible universe. Significant mass limits are summarized in a table.
Photon and graviton mass limits
Goldhaber, Alfred Scharff; Nieto, Michael Martin
2010-01-01
Efforts to place limits on deviations from canonical formulations of electromagnetism and gravity have probed length scales increasing dramatically over time. Historically, these studies have passed through three stages: (1) testing the power in the inverse-square laws of Newton and Coulomb, (2) seeking a nonzero value for the rest mass of photon or graviton, and (3) considering more degrees of freedom, allowing mass while preserving explicit gauge or general-coordinate invariance. Since the previous review the lower limit on the photon Compton wavelength has improved by four orders of magnitude, to about one astronomical unit, and rapid current progress in astronomy makes further advance likely. For gravity there have been vigorous debates about even the concept of graviton rest mass. Meanwhile there are striking observations of astronomical motions that do not fit Einstein gravity with visible sources. “Cold dark matter” (slow, invisible classical particles) fits well at large scales. “Modified Newtonian dynamics” provides the best phenomenology at galactic scales. Satisfying this phenomenology is a requirement if dark matter, perhaps as invisible classical fields, could be correct here too. “Dark energy” might be explained by a graviton-mass-like effect, with associated Compton wavelength comparable to the radius of the visible universe. Significant mass limits are summarized in a table.
Habitable zone limits for dry planets.
Abe, Yutaka; Abe-Ouchi, Ayako; Sleep, Norman H; Zahnle, Kevin J
2011-06-01
Most discussion of habitable planets has focused on Earth-like planets with globally abundant liquid water. For an "aqua planet" like Earth, the surface freezes if far from its sun, and the water vapor greenhouse effect runs away if too close. Here we show that "land planets" (desert worlds with limited surface water) have wider habitable zones than aqua planets. For planets at the inner edge of the habitable zone, a land planet has two advantages over an aqua planet: (i) the tropics can emit longwave radiation at rates above the traditional runaway limit because the air is unsaturated and (ii) the dry air creates a dry stratosphere that limits hydrogen escape. At the outer limits of the habitable zone, the land planet better resists global freezing because there is less water for clouds, snow, and ice. Here we describe a series of numerical experiments using a simple three-dimensional global climate model for Earth-sized planets. Other things (CO(2), rotation rate, surface pressure) unchanged, we found that liquid water remains stable at the poles of a low-obliquity land planet until net insolation exceeds 415 W/m(2) (170% that of modern Earth), compared to 330 W/m(2) (135%) for the aqua planet. At the outer limits, we found that a low-obliquity land planet freezes at 77%, while the aqua planet freezes at 90%. High-obliquity land and aqua planets freeze at 58% and 72%, respectively, with the poles offering the last refuge. We show that it is possible that, as the Sun brightens, an aqua planet like Earth can lose most of its hydrogen and become a land planet without first passing through a sterilizing runaway greenhouse. It is possible that Venus was a habitable land planet as recently as 1 billion years ago.
10 CFR 602.15 - Indirect cost limitations.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Indirect cost limitations. 602.15 Section 602.15 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS EPIDEMIOLOGY AND OTHER HEALTH STUDIES FINANCIAL ASSISTANCE PROGRAM § 602.15 Indirect cost limitations. Awards issued under this part for conferences and...
Elastic stability and the limit of strength
International Nuclear Information System (INIS)
Morris Jr., J.W.; Krenn, C.R.; Roundy, D.; Cohen, Marvin L.
2002-01-01
The upper limit of strength (the ''theoretical strength'') has been an active subject of research and speculation for the better part of a century. The subject has recently become important, for two reasons. First, given recent advances in ab initio techniques and computing machines, the limits of strength can be calculated with considerable accuracy, making this one of the very few problems in mechanical behavior that can actually be solved. Second, given recent advances in materials engineering, the limits of strength are being approached in some systems, such as hardened or defect-free films, and their relevance is becoming recognized in others. The present paper discusses some interesting results from recent research on the limits of strength, with an intermixture of speculations based on those results. Topics include the inherent nature of {100} cleavage and ''pencil slip'' in bcc metals, the inherent ductility of fcc metals, the anomalous properties of Al, and the possibility of measuring ideal strength with nanoindentation
The Omega-Infinity Limit of Single Spikes
Axenides, Minos; Linardopoulos, Georgios
A new infinite-size limit of strings in RxS2 is presented. The limit is obtained from single spike strings by letting their angular velocity omega become infinite. We derive the energy-momenta relation of omega-infinity single spikes as their linear velocity v-->1 and their angular momentum J-->1. Generally, the v-->1, J-->1 limit of single spikes is singular and has to be excluded from the spectrum and be studied separately. We discover that the dispersion relation of omega-infinity single spikes contains logarithms in the limit J-->1. This result is somewhat surprising, since the logarithmic behavior in the string spectra is typically associated with their motion in non-compact spaces such as AdS. Omega-infinity single spikes seem to completely cover the surface of the 2-sphere they occupy, so that they may essentially be viewed as some sort of "brany strings". A proof of the sphere-filling property of omega-infinity single spikes is given in the appendix.
Effect of pump limiter throat on pumping efficiency
International Nuclear Information System (INIS)
Ghendrih, P.; Grosman, A.; Samain, A.; Capes, H.; Morera, J.P.
1988-01-01
The necessary control of plasma edge density has led to the development of pump limiters to achieve this task. On Tore Supra, where a large part of the program is devoted to plasma edge studies, two types of such density control apparatus have been implemented, a set of pump limiters and the pumps associated to the ergodic divertor (magnetically assisted pump limiters). Generally two different kinds of pump limiters can be used, those with a throat which drives the plasma from the open edge plasma (SOL) to the neutralizer plate, and those without or with a very short throat. We are interested here in this aspect of the pump limiter concept, i.e. on the throat effect on neutral density build-up in the vicinity of the pumping plates (and hence on pumping efficieny). The underlying idea of this throat effect can be readily understood; indeed while the neutral capture in pump limiters without throats is only a ballistic effect, on expects the plasma to improve the efficiency of pump-limiters via plasma-neutral-sidewall interactions in the throat. This problem has been studied both numerically and analytically. The paper is divided as follows. In section 2, we describe the basic features of pump-limiters which are modelized by the numerical code Cezanne. Section 3 is devoted to the throat length effect considering in particular the neutral density profile in the throat and the neutral density buil-up as a function of the throat lenght. In section 4, we show that the plugging effect occurs for reasonnable values of throat lengths. An analytical value of the plugging length is discussed and compared to the values obtained numerically
Detection limit calculations for different total reflection techniques
International Nuclear Information System (INIS)
Sanchez, H.J.
2000-01-01
In this work, theoretical calculations of detection limits for different total-reflection techniques are presented.. Calculations include grazing incidence (TXRF) and gracing exit (GEXRF) conditions. These calculations are compared with detection limits obtained for conventional x-ray fluorescence (XRF). In order to compute detection limits the Shiraiwa and Fujino's model to calculate x-ray fluorescence intensities was used. This model made certain assumptions and approximations to achieve the calculations, specially in the case of the geometrical conditions of the sample, and the incident and takeoff beams. Nevertheless the calculated data of detection limits for conventional XRF and total-reflection XRF show a good agreement with previous results. The model proposed here allows to analyze the different sources of background and the influence of the excitation geometry, which contribute to the understanding of the physical processes involved in the XRF analysis by total reflection. Finally, a comparison between detection limits in total-reflection analysis at grazing incidence and at grazing exit is carried out. Here a good agreement with the theoretical predictions of the reversibility principle is found, showing that detection limits are similar for both techniques. (author)
[Sleep duration and functional limitations in older adult].
Eumann Mesas, Arthur; López-García, Esther; Rodríguez-Artalejo, Fernando
2011-04-30
To examine the association between sleep duration and functional limitation in older adults from Spain. Cross-sectional study with 3,708 individuals representative of the non-institutionalized population aged ≥ 60 years in Spain. Sleep duration was self-reported, and the functional limitations in the instrumental activities of daily living (IADL) were assessed. Functional limitations in IADL were identified in 1,424 (38.4%) participants. In analyses adjusted for sociodemographic and lifestyle variables, the percentage of participants with limitation in IADL was higher in those who slept ≤ 5 hours (odds ratio [OR]=1.56; 95% confidence interval [CI]=1.18-2.06) or ≥ 10 hours (OR=2.08; 95%CI=1.67-2.60; p for trendlimitations held even after adjustment for comorbidity and sleep quality (OR=1.77; 95%CI=1.38-2.28) while the association between short sleep (≤ 5 hours) and functional limitation no longer held after this adjustment (OR=1.10; 95%CI=0.80-1.50). In older adults, long sleep duration is a marker of functional limitations independent of comorbidity. Copyright © 2010 Elsevier España, S.L. All rights reserved.
Diffusion-limited mixing by incompressible flows
Miles, Christopher J.; Doering, Charles R.
2018-05-01
Incompressible flows can be effective mixers by appropriately advecting a passive tracer to produce small filamentation length scales. In addition, diffusion is generally perceived as beneficial to mixing due to its ability to homogenize a passive tracer. However we provide numerical evidence that, in cases where advection and diffusion are both actively present, diffusion may produce negative effects by limiting the mixing effectiveness of incompressible optimal flows. This limitation appears to be due to the presence of a limiting length scale given by a generalised Batchelor length (Batchelor 1959 J. Fluid Mech. 5 113–33). This length scale limitation may in turn affect long-term mixing rates. More specifically, we consider local-in-time flow optimisation under energy and enstrophy flow constraints with the objective of maximising the mixing rate. We observe that, for enstrophy-bounded optimal flows, the strength of diffusion may not impact the long-term mixing rate. For energy-constrained optimal flows, however, an increase in the strength of diffusion can decrease the mixing rate. We provide analytical lower bounds on mixing rates and length scales achievable under related constraints (point-wise bounded speed and rate-of-strain) by extending the work of Lin et al (2011 J. Fluid Mech. 675 465–76) and Poon (1996 Commun. PDE 21 521–39).
DISSOLVED CONCENTRATION LIMITS OF RADIOACTIVE ELEMENTS
Energy Technology Data Exchange (ETDEWEB)
NA
2004-11-22
The purpose of this study is to evaluate dissolved concentration limits (also referred to as solubility limits) of elements with radioactive isotopes under probable repository conditions, based on geochemical modeling calculations using geochemical modeling tools, thermodynamic databases, field measurements, and laboratory experiments. The scope of this modeling activity is to predict dissolved concentrations or solubility limits for 14 elements with radioactive isotopes (actinium, americium, carbon, cesium, iodine, lead, neptunium, plutonium, protactinium, radium, strontium, technetium, thorium, and uranium) important to calculated dose. Model outputs for uranium, plutonium, neptunium, thorium, americium, and protactinium are in the form of tabulated functions with pH and log (line integral) CO{sub 2} as independent variables, plus one or more uncertainty terms. The solubility limits for the remaining elements are either in the form of distributions or single values. The output data from this report are fundamental inputs for Total System Performance Assessment for the License Application (TSPA-LA) to determine the estimated release of these elements from waste packages and the engineered barrier system. Consistent modeling approaches and environmental conditions were used to develop solubility models for all of the actinides. These models cover broad ranges of environmental conditions so that they are applicable to both waste packages and the invert. Uncertainties from thermodynamic data, water chemistry, temperature variation, and activity coefficients have been quantified or otherwise addressed.
Activation analysis. Detection limits
International Nuclear Information System (INIS)
Revel, G.
1999-01-01
Numerical data and limits of detection related to the four irradiation modes, often used in activation analysis (reactor neutrons, 14 MeV neutrons, photon gamma and charged particles) are presented here. The technical presentation of the activation analysis is detailed in the paper P 2565 of Techniques de l'Ingenieur. (A.L.B.)
Low temperature plasma near a tokamak reactor limiter
International Nuclear Information System (INIS)
Braams, B.J.; Singer, C.E.
1985-01-01
Analytic and two-dimensional computational solutions for the plasma parameters near a toroidally symmetric limiter are illustrated for the projected parameters of a Tokamak Fusion Core Experiment (TFCX). The temperature near the limiter plate is below 20 eV, except when the density 10 cm inside the limiter contact is 8 x 10 13 cm -3 or less and the thermal diffusivity in the edge region is 2 x 10 4 cm 2 /s or less. Extrapolation of recent experimental data suggests that neither of these conditions is likely to be met near ignition in TFCX, so a low plasma temperature near the limiter should be considered a likely possibility
On the approximation of the limit cycles function
Directory of Open Access Journals (Sweden)
L. Cherkas
2007-11-01
Full Text Available We consider planar vector fields depending on a real parameter. It is assumed that this vector field has a family of limit cycles which can be described by means of the limit cycles function $l$. We prove a relationship between the multiplicity of a limit cycle of this family and the order of a zero of the limit cycles function. Moreover, we present a procedure to approximate $l(x$, which is based on the Newton scheme applied to the Poincaré function and represents a continuation method. Finally, we demonstrate the effectiveness of the proposed procedure by means of a Liénard system.
50 CFR 300.132 - Lobster harvest limitations.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Lobster harvest limitations. 300.132... FISHERIES REGULATIONS Vessels of the United States Fishing in Colombian Treaty Waters § 300.132 Lobster harvest limitations. (a) Berried lobsters. A berried (egg-bearing) lobster in treaty waters may not be...
10 CFR 605.16 - Indirect cost limitations.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Indirect cost limitations. 605.16 Section 605.16 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS THE OFFICE OF ENERGY RESEARCH FINANCIAL ASSISTANCE PROGRAM § 605.16 Indirect cost limitations. Awards issued under this part for conferences and scientific...
2010-01-01
... REGULATIONS REPRESENTATIVES OF THE ADMINISTRATOR Organization Designation Authorization § 183.55 Limitations... structure), no Unit member may perform that function until the Administrator is notified of the change, and...
2010-10-01
... AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Leader Company Contracting 817.402 Limitations. (a... company contracts. (b) The DSPE may designate a contracting officer to enter into a leader company...
Density limit in FTU tokamak during Ohmic operation
International Nuclear Information System (INIS)
Frigione, D.; Pieroni, L.
1993-01-01
The understanding of the physical mechanisms that regulate the density limit in a Tokamak is very important in view of a future fusion reactor. On one hand density enters as a factor in the figure of merit needed to achieve a burning plasma, and on the other hand a high edge density is a prerequisite for avoiding excessive erosion of the first walls and to limit the impurity influx into the hot plasma core. Furthermore a reactor should work in a safe zone of the operation parameters in order to avoid disruptive instabilities. The density limit problem has been tackled since the 70's, but so far a unique physics picture has not still emerged. In the last few years, due to the availability of better diagnostics, especially for the plasma edge, the use of pellet injectors to fuel the plasma and the experience gained on many different Tokamak, a consensus has been reached on the edge density as the real parameter responsible for the density limit. There are still two main mechanisms invoked to explain this limit: one refers to the power balance between the heat conducted and/or convected across the plasma radius and the power lost by impurity line radiation at the edge. When the latter overcomes the former, shrinking of the current channel occurs, which leads to instabilities due to tearing modes (usually the m/n=2/1) and then to disruption. The other explanation, for now valid for divertor machines, is based on the particle and energy balance in the scrape off layer (SOL). The limit in the edge density is then associated with the thermal collapse of the divertor plasma. In this work we describe the experiments on the density limit in FTU with Ohmic heating, the reason why we also believe that the limit is on the edge density, and discuss its relation to a simple model based on the SOL power balance valid for a limiter Tokamak. (author) 7 refs., 4 figs
Pumped-limiter study for Alcator DCT
International Nuclear Information System (INIS)
Brooks, J.N.; Mattas, R.F.; Cha, Y.S.; Hassanein, A.M.; Majumdar, S.
1983-06-01
A study was performed for a pumped-limiter design for the proposed Alcator DCT device. The study focused on reactor-relevant issues. The main issues examined were configuration, surface erosion, thermal hydraulics, and the choice of structural and surface materials. A bottom, flat limiter, with a copper-alloy substrate, seems to be a reasonable design and should provide an opportunity to test high power and particle loadings. Carbon is recommended as a surface material if acceptable redeposition properties can be demonstrated
Pumped-limiter study for Alcator DCT
Energy Technology Data Exchange (ETDEWEB)
Brooks, J.N.; Mattas, R.F.; Cha, Y.S.; Hassanein, A.M.; Majumdar, S.
1983-06-01
A study was performed for a pumped-limiter design for the proposed Alcator DCT device. The study focused on reactor-relevant issues. The main issues examined were configuration, surface erosion, thermal hydraulics, and the choice of structural and surface materials. A bottom, flat limiter, with a copper-alloy substrate, seems to be a reasonable design and should provide an opportunity to test high power and particle loadings. Carbon is recommended as a surface material if acceptable redeposition properties can be demonstrated.
Relativistic classical limit of quantum theory
International Nuclear Information System (INIS)
Shin, G.R.; Rafelski, J.
1993-01-01
We study the classical limit of the equal-time relativistic quantum transport theory. We discuss in qualitative terms the need to fold first the Wigner function with a coarse-graining function. Only then does the singularity at ℎ→0 seem to be manageable. In the limit ℎ→0, we obtain the relativistic Vlasov equations for the particle and the antiparticle sector of the Fock space. Similarly, we address the evolution equations of the spin and the magnetic-moment density
Proposal for derivation of limit values for skin contamination
International Nuclear Information System (INIS)
Schieferdecker, H.; Koelzer, W.; Henrichs, K.
1985-04-01
From the primary limit value for the skin dose secondary limit values are derived for skin contamination which can be used in practical radiation protection work. In analogy to the secondary limit value for the maximum permissible body burden in case of incorporation, limit values for the 'maximum permissible skin burden' are calculated with the help of dose factors for application in case of skin contamination. They can be derived from the skin dose limit values. Considering that the skin is exposed to contamination but temporarily, in analogy to the annual limit on intake in case of incorporation a 'limit value of skin contamination' is derived for immediately removable contaminations and for one day of exposure, whereas with respect to non-removable contamination and taking into account the renewal of the skin, a limit value of annual skin contamination is defined for non-removable skin contaminations. An investigation level for skin contamination is assumed as a threshold above which defined measures must be taken. Regarding these measures not more than three times appropriate washing is recommended with the subsequent procedure determined by the level of residual contamination. The respective limit values are indicated for some radionuclides selected as examples (C-14, Co-60, Sr-90, Y-90, I-131, Cs-137, Ce-141, Pu-239). (orig./HP) [de
2010-07-01
... performance test was conducted that deviated from any emission limitation. (b) The deviation report must be... deviation from the operating limits or the emission limitations? 60.2215 Section 60.2215 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) STANDARDS OF PERFORMANCE FOR...
2010-07-01
..., or if a performance test was conducted that showed a deviation from any emission limitation. (b) The... deviation from the operating limits or the emission limitations? 60.2957 Section 60.2957 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) STANDARDS OF PERFORMANCE FOR...
Tolerance limits of X-ray image intensity
International Nuclear Information System (INIS)
Stargardt, A.; Juran, R.; Brandt, G.A.
1985-01-01
Evaluation of the tolerance limits of X-ray image density accepted by the radiologist shows that for different kinds of examinations, deviations of more than 50% from optimal density lead to images which cannot be used diagnostically. Within this range diagnostic accuracy shows a distinct maximum and diminishes to the limits by 20%. These figures are related to differences in the intensifying factor of screens, sensitivity of films, sensitometric parameters of film processing as well as the doses employed with automatic exposure control devices, measured in clinical conditions. Maximum permissible tolerance limits of the whole imaging system and of its constituents are discussed using the Gaussian law of error addition. (author)
Establishment of limits of detection and decision
International Nuclear Information System (INIS)
Mende, O.; Michel, R.
1995-01-01
The purpose of this project was to develop and test procedures to establish limits of decision and detection for spectrometric nuclear radiation measurements. Beside the determination of the limits of application of DIN 25482 part 2 and 5 - both primarily suitable for high resoluted spectra areas -the statistical model was expanded in such a way that henceforth blanks and influences of sample treatment can also be taken into account; the corresponding procedures to calculate the limits of decision and detection have a high precision. Additional procedures of calculation were developed to take the special characteristics of the analysis of complex spectra areas into account. (orig.) [de
Electrical characteristics of an ideal tokamak limiter
International Nuclear Information System (INIS)
Motley, R.W.
1981-01-01
The intrusion of an equipotential poloidal limiter into the edge plasma of a circular tokamak discharge distorts the axisymmetry in several ways: (1) it (partially) shorts out the top-to-bottom Pfirsch-Schlueter potentials, (2) it creates zones of reversed equilibrium current flow into the limiter, and (3) it generates an electrostatic field opposing the loop current. The resulting boundary mismatch between the outer layers and the inner axisymmetric Pfirsch-Schlueter layer increases the free energy available to drive the edge plasma unstable. A number of special limiters are proposed to symmetrize the edge plasma and thereby reduce the electrical and MHD activity in the boundary layer. (author)
Application of tungsten for plasma limiters in TEXTOR
International Nuclear Information System (INIS)
Tanabe, T.; Wada, M.; Ohgo, T.; Philipps, V.; Rubel, M.; Huber, A.; Seggern, J. von; Ohya, K.; Pospieszczyk, A.; Schweer, B.
2000-01-01
Three different types of W limiters were exposed in the TEXTOR plasma and the response of the plasma and materials performance of the limiters were investigated. - A W bulk limiter operated with preheating above 800 K withstood a plasma heat load of about ∼20 MW/m 2 for a few seconds with some slight surface melting during the highest heat load shot. However, it was severely damaged when operated at around 500 K. - A C/W twin test limiter, half made of bulk W and the other half of graphite (EK-98) gave very useful information on how low- and high-Z materials behave under conditions of simultaneous utilization as PFM such as cross-contamination and the influence of a large mass difference on hydrogen reflection and deposition. - Two sets of main poloidal W limiters made of vacuum vapor sprayed (VPS)-W deposited on graphite (IG-430U) with a Re interlayer could absorb about 60% of the total convection heat and the ohmic plasma with a density as high as 5 x 10 13 cm -3 was sustained. Most of the VPS-W coated limiters tolerated a heat load of ∼20 MW/m 2 . This series of W limiters experiments in TEXTOR has shown that W is applicable as a PFM, if its central accumulation is avoided by NBI and/or ICRH heating. Nevertheless, some concerns still remain, including difficulty of plasma start-up, W behavior in higher temperature plasmas, and materials' selection
Estimating uncertainty of data limited stock assessments
DEFF Research Database (Denmark)
Kokkalis, Alexandros; Eikeset, Anne Maria; Thygesen, Uffe Høgsbro
2017-01-01
-limited. Particular emphasis is put on providing uncertainty estimates of the data-limited assessment. We assess four cod stocks in the North-East Atlantic and compare our estimates of stock status (F/Fmsy) with the official assessments. The estimated stock status of all four cod stocks followed the established stock...
Central Limit Theorem for Coloured Hard Dimers
Directory of Open Access Journals (Sweden)
Maria Simonetta Bernabei
2010-01-01
Full Text Available We study the central limit theorem for a class of coloured graphs. This means that we investigate the limit behavior of certain random variables whose values are combinatorial parameters associated to these graphs. The techniques used at arriving this result comprise combinatorics, generating functions, and conditional expectations.