Ion-beam spectroscopic studies of the 69As nucleus

International Nuclear Information System (INIS)

Badica, T.; Cojocaru, V.; Olariu, A.; Petre, M.; Popescu, I. V.; Gheboianu, A.

2009-01-01

Excited state of the neutron deficient 69 As nucleus were investigated in the 58 Ni( 14 N,2pn) reaction by ion-beam γ spectroscopic methods (excitation functions, γγ-coincidences, angular distributions and linear polarization gated with neutrons). A new more complete level scheme of 69 As has been proposed with spin-parity values. The structure of the nucleus is discussed in the framework of the interaction boson-fermion model (IBFM). (authors)

Excitations of one-valence-proton, one-valence-neutron nucleus {sup 210}Bi from cold-neutron capture

Energy Technology Data Exchange (ETDEWEB)

Cieplicka-Oryńczak, N. [INFN sezione di Milano, Via Celoria 16, 20133 Milano (Italy); Institute of Nuclear Physics, Polish Academy of Sciences, PL-31342 Kraków (Poland); Fornal, B.; Szpak, B. [Institute of Nuclear Physics, Polish Academy of Sciences, PL-31342 Kraków (Poland); Leoni, S.; Bottoni, S. [INFN sezione di Milano, Via Celoria 16, 20133 Milano (Italy); Università degli Studi di Milano, Via Celoria 16, 20133 Milano (Italy); Bazzacco, D. [Dipartimento di Fisica e Astronomia dell’Università, I-35131 Padova (Italy); INFN Sezione di Padova, I-35131 Padova (Italy); Blanc, A.; Jentschel, M.; Köster, U.; Mutti, P.; Soldner, T. [Institute Laue-Langevin, 6, rue Jules Horowitz, 38042 Grenoble Cedex 9 (France); Bocchi, G. [Università degli Studi di Milano, Via Celoria 16, 20133 Milano (Italy); France, G. de [GANIL, Bd. Becquerel, BP 55027, 14076 CAEN Cedex 05 (France); Simpson, G. [LPSC, Université Joseph Fourier Grenoble 1, CNRS/IN2P3, Institut National Polytechnique de Grenoble, F-38026 Grenoble Cedex (France); Ur, C. [INFN Sezione di Padova, Via F. Marzolo 8, I-35131 Padova (Italy); Urban, W. [Faculty of Physics, University of Warsaw, ul. Hoża 69, 02-681, Warszawa (Poland)

2015-10-15

The low-spin structure of one-proton, one-neutron {sup 210}Bi nucleus was investigated in cold-neutron capture reaction on {sup 209}Bi. The γ-coincidence measurements were performed with use of EXILL array consisted of 16 HPGe detectors. The experimental results were compared to shell-model calculations involving valence particles excitations. The {sup 210}Bi nucleus offers the potential to test the effective proton-neutron interactions because most of the states should arise from the proton-neutron excitations. Additionally, it was discovered that a few states should come from the couplings of valence particles to the 3{sup −} octupole vibration in {sup 208}Pb which provides also the possibility of testing the calculations involving the core excitations.

Powder neutron diffraction study on Pb2Sr2YCu3O8+δ(δ = 0.0 and 1.67)

International Nuclear Information System (INIS)

Fujishita, Hideshi; Sato, Masatoshi; Morii, Yukio; Funahashi, Satoru.

1993-01-01

Powder neutron diffraction patterns of Pb 2 Sr 2 YCu 3 O 8+δ (δ = 0.0 and 1.67) were analyzed by Rietveld method. For δ = 0, it had been indicated, by powder X-ray diffraction, that the structure was a monoclinic one. The R factors of the present analysis for the monoclinic structure were about 3/4 of those for the previous orthorhombic ones. The structure was almost the same as the previous X-ray result except z (02). For the annealed phase, the tetragonal and the orthorhombic structures had been presented by X-ray diffraction and by neutron diffraction, respectively. The R factors of the present analysis for the orthorhombic structure were about 5/6 of those for the tetragonal structure. The distance between the Pb plane and the oxygen deficient Cu plane was found to become larger in proportion to δ, though there occurs a phase separation in low δ region. (author)

Measurement of 167Er(n,p)167Ho reaction at 13.5 and 14.8 MeV

International Nuclear Information System (INIS)

Luo, Junhua; Liu, Jun; Han, Jiuning; Jiang, Li; Liu, Rong; Ge, Suhong; Liu, Zhenlai

2013-01-01

We have measured the 167 Er(n,p) 167 Ho cross-sections at two different neutron energies 13.5 and 14.8 MeV. Measurements were performed at Pd-300 neutron generator of Chinese Academy of Engineering Physics (CAEP) with monoenergetic neutrons produced via the 3 H(d,n) 4 He reaction using a tritium–titanium (T–Ti) target. Induced gamma activities were measured by a high-resolution gamma-ray spectrometer with high-purity germanium (HPGe) detector. The data for 167 Er(n,p) 167 Ho reaction cross-sections are reported to be 2.2±0.6 and 2.8±1.4 mb at 13.5±0.2 and 14.8±0.2 MeV incident neutron energies, respectively. The cross sections were also estimated with the TALYS-1.4 nuclear model code and compared with experimental data found in the literature, and with the comprehensive evaluation data in ENDF/B-VII.1 and JEFF-3.1/A libraries. - Highlights: • D–T neutron source was used to measure cross sections using activation method. • 27 Al(n,α) 24 Na was used as the monitor for the measurement. • The cross sections for the 167 Er(n,p) 167 Ho reactions have been measured. • Contribution of the interfering reaction 170 Er(n,α) 167 Dy was subtracted. • The results were compared with previous data and with evaluation data

Optical model calculation of neutron-nucleus scattering cross sections

International Nuclear Information System (INIS)

Smith, M.E.; Camarda, H.S.

1980-01-01

A program to calculate the total, elastic, reaction, and differential cross section of a neutron interacting with a nucleus is described. The interaction between the neutron and the nucleus is represented by a spherically symmetric complex potential that includes spin-orbit coupling. This optical model problem is solved numerically, and is treated with the partial-wave formalism of scattering theory. The necessary scattering theory required to solve this problem is briefly stated. Then, the numerical methods used to integrate the Schroedinger equation, calculate derivatives, etc., are described, and the results of various programming tests performed are presented. Finally, the program is discussed from a user's point of view, and it is pointed out how and where the program (OPTICAL) can be changed to satisfy particular needs

Fusion reaction using low energy neutron-excess nucleus beam

International Nuclear Information System (INIS)

Fukuda, Tomokazu

1994-01-01

The present state and the plan of the experiment of measuring the fusion reaction near barriers by using neutron-excess nucleus beam, which has been advanced at RIKEN are reported. One of the purposes of this experiment is the feasibility investigation of the fusion reaction by using neutron-excess nuclei, which is indispensable for synthesizing superheavy elements. It is intended to systematically explore some enhancing mechanism in the neutron-excess nuclei which are unfavorable in beam intensity. This research can become the good means to prove the dynamic behavior of the neutrons on the surfaces of nuclei in reaction. The fusion reaction of 27 Al + Au was measured by using the stable nucleus beam of 27 Al, and the results are shown. In order to know the low energy fusion reaction of 11 Li and 11 Be which are typical halo nuclei, the identification by characteristic α ray of composite nuclei is carried out in 7,9,11 Li + 209 Bi and 9,10,11 Be + 208 Pb. A new detector having high performance, New MUSIC, is being developed. As the experiment by using this detector, the efficient measurement of the fusion reaction by using heavy neutron-excess nuclei up to Ni is considered. An example of 8 Li + α → 11 B + n reaction for celestial body physics is mentioned. (K.I.)

First observation of excited structures in neutron-deficient 179Hg : evidence for multiple shape coexistence

International Nuclear Information System (INIS)

Kondev, F.G.; Carpenter, M.P.; Janssens, R.V.F.; Lister, C.J.; Abu Saleem, K.; Ahmad, I.; Amro, H.; Caggiano, J.; Davids, C.N.; Heinz, A.; Herskind, B.; Khoo, T.L.; Lauristen, T.; Ma, W.C.; Ressler, J.J.; Reviol, W.; Riedinger, L.L.; Sarantites, D.G.; Seweryniak, D.; Siem, S.; Sonzongni, A.A.; Varmette, P.G.; Wiedenhoever, I.

2002-01-01

Excited structures in the neutron-deficient nucleus 179 Hg have been established for the first time using the Gammasphere spectrometer in conjunction with the fragment mass analyzer. Competing states originating from three different minima associated with nearly spherical, oblate, and prolate deformations were found. This result can be contrasted with the situation in heavier odd-mass Hg isotopes where only two minima (oblate and prolate) have been seen. The implications of these three shapes at low spin and excitation energy are discussed in the general context of shape coexistence in this mass region.

Parity non-conserving effects in neutron-nucleus scattering

International Nuclear Information System (INIS)

Desplanques, B.

1990-01-01

The present lecture reviews the motivations which led to study the contribution of the neutron-nucleus component to parity-non-conserving effects observed in medium-heavy nuclei and considers its present status. It is shown that it cannot account for those experimental data. The order interpretation of these effects, which cannot lead to precise statements, is schematically described

Towards 100Sn: Studies on neutron-deficient even isotopes of tin

International Nuclear Information System (INIS)

Rathke, G.E.

1987-02-01

Neutron-deficient 108,106,104 Sn isotopes were produced by heavy ion induced fusion reactions using high-intensity 59 Ni beams from the UNILAC of the GSI. Their decay properties were studied by techniques of gamma and conversion electron spectroscopy employing the mass separator on-line to the UNILAC. Earlier information on the 108 Sn → 108 In and 106 Sn → 106 In decays was complemented and improved in the course of this work. The new nucleus 104 Sn and its decay to excited states in 104 In was identified and studied for the first time. These investigations yield the following results: the mass of 104 Sn and of nuclei linked to it by alpha decay or proton radioactivity, 108 Te, 112 Xe and 109 I, 113 Cs, respectively were determined from the measured Q EC value of 104 Sn and the known mass value of 104 In. These are nuclei very close or beyond the proton drip line. In addition, information on the quenching of the fast Gamow-Teller beta decay of the even neutron-deficient tin isotopes was obtained. This complements investigations on the N = 50 isotones 94 Ru and 96 Pd, and allows a systematic comparison of these transition strengths for nuclei near the doubly magic 100 Sn. The spreading of the vertical strokeπg 9/2 -1 vg 7/2 , 1 + > configuration over several states, due to residual interactions, and the centroid energies of these magnetic dipole states were determined for the corresponding odd-odd indium isotopes. (orig./HSI)

Re/Os cosmochronometer: measurement of neutron cross sections

International Nuclear Information System (INIS)

Mosconi, M.

2007-01-01

This experimental work is devoted to the improved assessment of the Re/Os cosmochronometer. The dating technique is based on the decay of 187 Re (t 1/2 =41.2 Gyr) into 187 Os and determines the age of the universe by the time of onset of nucleosynthesis. The nucleosynthesis mechanisms, which are responsible for the 187 Re/ 187 Os pair, provide the possibility to identify the radiogenic fraction of 187 Os exclusively by nuclear physics considerations. Apart from its radiogenic component, 187 Os can be synthesized otherwise only by the s process, which means that this missing fraction can be reliably determined and subtracted by proper s-process modeling. On the other hand, 187 Re is almost completely produced by the r process. The only information needed for the interpretation as a cosmic clock is the production rate of 187 Re as a function of time. The accuracy of the s-process calculations that are needed to determine the nucleosynthetic abundance of 187 Os depends on the quality of the neutron capture cross sections averaged over the thermal neutron spectrum at the s-process sites. Laboratory measurements of these cross sections have to be corrected for the effect of nuclear levels, which can be significantly populated at the high stellar temperatures during the s process. The neutron capture cross sections of 186 Os, 187 Os and 188 Os have been measured at the CERN n TOF facility in the range between 0.7 eV and 1 MeV. From these data, Maxwellian averaged cross sections have been determined for thermal energies from 5 to 100 keV with an accuracy around 4%, 3%, and 5% for 186 Os, 187 Os, and 188 Os, respectively. Since, the first excited state in 187 Os occurs at 9.75 keV, the cross section of this isotope requires a substantial correction for thermal population of low lying nuclear levels. This effect has been evaluated on the basis of resonance data derived in the (n, γ) experiments and by an improved measurements of the inelastic scattering cross section for

Spectroscopy of very neutron-deficient hafnium and tungsten isotopes

Energy Technology Data Exchange (ETDEWEB)

Dracoulis, G D; Fabricius, B; Davidson, P M [Australian National Univ., Canberra, ACT (Australia). Dept. of Nuclear Physics; Macchiavelli, A O; Oliviera, J; Burde, J; Stephens, F; Deleplanque, M A [Lawrence Berkeley Lab., CA (United States)

1992-08-01

Level schemes of the very neutron-deficient isotopes {sup 158}Hf and {sup 162}W have been identified, and that for {sup 164}W extended. Alignment of the H{sub 9/2} neutrons is suggested. (author). 12 refs., 7 figs.

Re/Os cosmochronometer: measurement of neutron cross sections

Energy Technology Data Exchange (ETDEWEB)

Mosconi, M.

2007-12-21

This experimental work is devoted to the improved assessment of the Re/Os cosmochronometer. The dating technique is based on the decay of {sup 187}Re (t{sub 1/2}=41.2 Gyr) into {sup 187}Os and determines the age of the universe by the time of onset of nucleosynthesis. The nucleosynthesis mechanisms, which are responsible for the {sup 187}Re/{sup 187}Os pair, provide the possibility to identify the radiogenic fraction of {sup 187}Os exclusively by nuclear physics considerations. Apart from its radiogenic component, {sup 187}Os can be synthesized otherwise only by the s process, which means that this missing fraction can be reliably determined and subtracted by proper s-process modeling. On the other hand, {sup 187}Re is almost completely produced by the r process. The only information needed for the interpretation as a cosmic clock is the production rate of {sup 187}Re as a function of time. The accuracy of the s-process calculations that are needed to determine the nucleosynthetic abundance of {sup 187}Os depends on the quality of the neutron capture cross sections averaged over the thermal neutron spectrum at the s-process sites. Laboratory measurements of these cross sections have to be corrected for the effect of nuclear levels, which can be significantly populated at the high stellar temperatures during the s process. The neutron capture cross sections of {sup 186}Os, {sup 187}Os and {sup 188}Os have been measured at the CERN n TOF facility in the range between 0.7 eV and 1 MeV. From these data, Maxwellian averaged cross sections have been determined for thermal energies from 5 to 100 keV with an accuracy around 4%, 3%, and 5% for {sup 186}Os, {sup 187}Os, and {sup 188}Os, respectively. Since, the first excited state in {sup 187}Os occurs at 9.75 keV, the cross section of this isotope requires a substantial correction for thermal population of low lying nuclear levels. This effect has been evaluated on the basis of resonance data derived in the (n, {gamma

Shape coexistence measurements in even-even neutron-deficient polonium isotopes by Coulomb excitation, using REX-ISOLDE and the Ge MINIBALL array

CERN Multimedia

Butler, P; Bastin, B; Kruecken, R; Voulot, D; Rahkila, P J; Orr, N A; Srebrny, J; Grahn, T; Clement, E; Paul, E S; Gernhaeuser, R A; Dorsival, A; Diriken, J V J; Huyse, M L; Iwanicki, J S

The neutron-deficient polonium isotopes with two protons outside the closed Z=82 shell represent a set of nuclei with a rich spectrum of nucleus structure phenomena. While the onset of the deformation in the light Po isotopes is well established experimentally, questions remain concerning the sign of deformation and the magnitude of the mixing between different configurations. Furthermore, controversy is present with respect to the transition from the vibrational-like character of the heavier Po isotopes to the shape coexistence mode observed in the lighter Po isotopes. We propose to study this transition in the even-mass neutron-deficient $^{198,200,202}$Po isotopes by using post-accelerated beams from REX-ISOLDE and "safe"-energy Coulomb excitation. $\\gamma$- rays will be detected by the MINIBALL array. The measurements of the Coulomb excitation differential cross section will allow us to deduce both the transition and diagonal matrix elements for these nuclei and, combined with lifetime measurements, the s...

Study of Neutron-Deficient $^{202-205}$Fr Isotopes with Collinear Resonance Ionization Spectroscopy

CERN Document Server

De Schepper, Stijn; Cocolios, Thomas; Budincevic, Ivan

The scope of this master’s thesis is the study of neutron-deficient $^{202−205}$Fr isotopes. These isotopes are inside the neutron-deficient lead region, a region that has shown evidence of shape coexistence. For this thesis, this discussion is limited to the phenomenon where a low lying excited state has a different shape than the ground state. Shape coexistence is caused by intruder states. These are single-particle Shell Model states that are perturbed in energy due to the interaction with a deformed core. In the neutron-deficient lead region the main proton intruder orbit is the 3s$_{1/2}$orbit. When going towards more neutron-deficient isotopes, deformation increases. The $\\pi3s_{1/2}$orbit will rise in energy and will eventually become the ground state in odd- A bismuth (Z=83) isotopes. It is also observed in odd-A astatine (Z=85) isotopes, already in less neutron-deficient nuclei. The same phenomenon is expected to be present francium (Z=87) isotopes already at $^{199}$Fr. Although it is currently ...

Influence of neutron halo in the interaction of 6He nucleus of 35 MeV/nucleon with 197Au and 238U

International Nuclear Information System (INIS)

Perier, Yann

1997-01-01

In this study, we have attempted to answer some of the questions still open concerning neutron halo nuclei. The interest of the latter lies in their very peculiar structure. The analysis of the kinematical features of the halo nucleus fragments originating from the dissociation following the interaction with a target nucleus is an essential tool for probing this structure. We studied the 6 He + Au, U at 35 A.MeV system with a new method. Simultaneous measurements of the halo nucleus core, the halo neutrons and the excitation energy deposited in the target nucleus assessed with ORION allowed us to obtain information about the formation of the 5 He nucleus and about the partial validity of the sudden approximation at moderate bombarding energy. The study of the core nucleus and neutron angular distributions confirmed that it is difficult to extract information on the internal structure at the halo neutrons from their widths. The halo neutron longitudinal momentum distributions were studied. Their widths were found to increase as the impact parameter decreases. The 4 He - core parallel momentum distributions were also investigated. The widths are weakly dependent on the excitation energy deposited in the target nucleus, but increase with the 4 He emission angle as for the halo neutrons. The ratio between one- and two-neutron stripping cross sections seems to indicate that the two halo neutrons are strongly correlated with a large dineutron component, as ascertained by a calculation in the framework of the Serber model. (author)

Measurements of electric quadrupole moments of neutron-deficient Au, Pt, and Ir nuclei with NMR-ON in hcp-Co

CERN Multimedia

Smolic, E; Hagn, E; Zech, E; Seewald, G

2002-01-01

The aim of the experiments is the measurement of $\\,$i) nuclear magnetic moments and electric quadrupole moments of neutron-deficient isotopes in the region Os-Ir-Pt-Au with the methods of quadrupole-interaction-resolved NMR on oriented nuclei " QI-NMR-ON " and modulated adiabatic passage on oriented nuclei " MAPON " and $\\,$ii) the magnetic hyperfine field, electric field gradient (EFG), and spin-lattice relaxation of 5d elements in ferromagnetic Fe, Ni, fcc-Co and hcp-Co.\\\\ The measurements on Au isotopes have been finished successfully. The quadrupole moments of $^{186}$Au, $^{193m}$Au, $^{195}$Au, $^{195m}$Au, $^{197m}$Au, $^{198}$Au and $^{199}$Au were determined with high precision.\\\\ For neutron-deficient Ir isotopes QI-NMR-ON measurements were performed after implantation of Hg precursors. The EFG of Ir in hcp-Co has been calibrated. Thus precise values for the spectroscopic quadrupole mo...

Iron deficiency regulated OsOPT7 is essential for iron homeostasis in rice.

Science.gov (United States)

Bashir, Khurram; Ishimaru, Yasuhiro; Itai, Reiko Nakanishi; Senoura, Takeshi; Takahashi, Michiko; An, Gynheung; Oikawa, Takaya; Ueda, Minoru; Sato, Aiko; Uozumi, Nobuyuki; Nakanishi, Hiromi; Nishizawa, Naoko K

2015-05-01

The molecular mechanism of iron (Fe) uptake and transport in plants are well-characterized; however, many components of Fe homeostasis remain unclear. We cloned iron-deficiency-regulated oligopeptide transporter 7 (OsOPT7) from rice. OsOPT7 localized to the plasma membrane and did not transport Fe(III)-DMA or Fe(II)-NA and GSH in Xenopus laevis oocytes. Furthermore OsOPT7 did not complement the growth of yeast fet3fet4 mutant. OsOPT7 was specifically upregulated in response to Fe-deficiency. Promoter GUS analysis revealed that OsOPT7 expresses in root tips, root vascular tissue and shoots as well as during seed development. Microarray analysis of OsOPT7 knockout 1 (opt7-1) revealed the upregulation of Fe-deficiency-responsive genes in plants grown under Fe-sufficient conditions, despite the high Fe and ferritin concentrations in shoot tissue indicating that Fe may not be available for physiological functions. Plants overexpressing OsOPT7 do not exhibit any phenotype and do not accumulate more Fe compared to wild type plants. These results indicate that OsOPT7 may be involved in Fe transport in rice.

Study of high-spin states in 181,182Os

International Nuclear Information System (INIS)

Kutsarova, T.; Fallon, P.; Howe, D.; Mokhtar, A.R.; Sharpey-Schafer, J.F.; Walker, P.; Chowdhury, P.; Fabricius, B.; Sletten, G.; Frauendorf, S.

1995-01-01

High-spin states in the nuclei 181,182 Os have been populated in the 150 Nd( 36 S,xn) reactions and studied with the ESSA30 array. The nucleus 181 Os has also been studied at the NBI tandem accelerator using the 167 Er( 18 O,4n) reaction. The previously known bands in both nuclei have been extended to higher spins and two new side bands have been found in 181 Os. In the latter nucleus the ground state has been established to have I π =(1)/(2) - . The extraction of the ratios of reduced transition probabilities B(M1)/B(E2) from branching and E2/M1 mixing ratios permitted configuration assignments for most of the bands in both nuclei. The analysis has been carried out within the semiclassical vector model for M1 radiation. The positive-parity yrare sequences in 182 Os and the band based on the I π = K π =(23)/(2) - state in 181 Os have been interpreted as t-bands arising from a rotation about a tilted axis. The alignment behaviour and the crossing frequencies are for most of the bands consistent with predictions of the cranked shell model. ((orig.))

Neutron resonances in the compound nucleus: Parity nonconservation to dynamic temperature measurements

International Nuclear Information System (INIS)

Yuan, V.W.

1997-08-01

Experiments using epithermal neutrons that interact to form compound-nuclear resonances serve a wide range of scientific applications. Changes in transmission which are correlated to polarization reversal in incident neutrons have been used to study parity nonconservation in the compound nucleus for a wide range of targets. The ensemble of measured parity asymmetries provides statistical information for the extraction of the rms parity-violating mean-square matrix element as a function of mass. Parity nonconservation in neutron resonances can also be used to determine the polarization of neutron beams. Finally the motion of target atoms results in an observed temperature-dependent Doppler broadening of resonance line widths. This broadening can be used to determine temperatures on a fast time scale of one microsecond or less

Calculating the mass distribution of heavy nucleus fission product by neutrons

International Nuclear Information System (INIS)

Gudkov, A.N.; Koldobskij, A.B.; Kolobashkin, V.M.; Semenova, E.V.

1981-01-01

The technique of calculating the fission product mass yields by neutrons which are necessary for performing nucleus physical calculations in designing nuclear reactor cores is considered. The technique is based on the approximation of fission product mass distribution over the whole mass range by five Gauss functions. New analytical expressions for determining energy weights of used gaussians are proposed. The results of comparison of experimental data with calculated values for fission product mass obtained for reference processes in the capacity of which the fission reactions are chosen: 233 U, 235 U fission by thermal neutrons, 232 Th, 233 U, 235 U, 238 U by fission spectrum neutrons and 14 MeV neutrons and for 232 Th fission reactions by 11 MeV neutrons and 238 U by 7.7 MeV neutrons. On the basis of the analysis of results obtained the conclusion is drawn on a good agreement of fission product mass yield calculation values obtained using recommended values of mass distribution parameters with experimental data [ru

A deficiência visual para os adolescentes: o olhar da enfermeira

OpenAIRE

Costa, Laura Emmanuela Lima

2010-01-01

138f. A deficiência visual é entendida como a perda visual que não pode ser corrigida com lentes. Sua detecção precoce, preferencialmente na infância, pode prevenir as complicações severas como o atraso no desenvolvimento neuropsicomotor e a interações sociais. No entanto, um campo onde os estudos se revelam incipientes, principalmente na compreensão das efetivas necessidades e desafios enfrentados pelas pessoas com deficiência visual, em especial os adolescentes, visto estarem num período...

α-decay chain and associated cluster emission from neutron deficient 237Cf nucleus

International Nuclear Information System (INIS)

Jain, Deepika; Sharma, Manoj K.

2015-01-01

We have studied the α-decay chain of 237 Cf nucleus, which has been observed in the 3n evaporation channel when the semi-magic projectile 36 S strikes on 204 Pbv nucleus. The calculations are carried out by using preformed cluster model (PCM), with choices of spherical and quadruple deformation with in cold optimum orientation approach. The calculated half-lives of α-decay chain find relatively in nice agreement with experimental data for the deformed fragmentation approach. Along with α emission, the possibility of heavier clusters is also worked out and corresponding half-lives are predicted. (author)

Deficiency in Monte Carlo simulations of coupled neutron-gamma-ray fields

NARCIS (Netherlands)

Maleka, Peane P.; Maucec, Marko; de Meijer, Robert J.

2011-01-01

The deficiency in Monte Carlo simulations of coupled neutron-gamma-ray field was investigated by benchmarking two simulation codes with experimental data. Simulations showed better correspondence with the experimental data for gamma-ray transport only. In simulations, the neutron interactions with

Study of the structure of light neutron rich nucleus with the Tonnerre array

International Nuclear Information System (INIS)

Pietri, St.

2003-06-01

This work concern the technical development made on the multidetector TONNERRE and the study of the 34 Si nucleus by a complete beta-neutron-gamma spectroscopy. In the first part various tests performed on modules of the detector in the 'Centre d'Etude de Bruyere le Chatel' are presented. A modification of the embassies of the photomultipliers tubes allows to gain more than 50% in the neutron efficiency and to obtain a threshold lower than 300 keV for the neutron energy. A complete C++ simulation of the neutron propagation in the array was carried out. It explains that the slow component of the light output of the scintillator may be responsible of the shape of the time-of-flight spectrum. The second part of these report presents the experiment devoted to the study of the structure of the 34 Si from the beta decay of the 34 Al. It was performed at the GANIL facility using the TONNERRE array and germanium of ENOGAM. The 34 Al was produced by projectile fragmentation of a 36 S beam of 50 MeV/A in a target of 9 Be. A complete beta scheme of the 34 Al is proposed. Eight neutron lines following the 34 Al decay were observed for the first time. Finally we suggest that a monopolar transition could occur in the 34 Si nucleus signing a O + 2 state at 2133 keV. (author)

Symmetry structure in neutron deficient xenon nuclei

International Nuclear Information System (INIS)

Govil, I. M.

1998-01-01

The paper describes the measurements of the lifetimes of the excited states in the ground state band of the Neutron deficient Xe nuclei ( 122,124 Xe) by recoil Distance Method (RDM). The lifetimes of the 2 + state in 122 Xe agrees with the RDM measurements but for 124 Xe it does not agree the RDM measurements but agrees with the earlier Coulomb-excitation experiment. The experimental results are compared with the existing theories to understand the changes in the symmetry structure of the Xe-nuclei as the Neutron number decreases from N=76( 130 Xe) to N=64( 118 Xe)

Symmetry structure in neutron deficient xenon nuclei

Science.gov (United States)

Govil, I. M.

1998-12-01

The paper describes the measurements of the lifetimes of the excited states in the ground state band of the Neutron deficient Xe nuclei (122,124Xe) by recoil Distance Method (RDM). The lifetimes of the 2+ state in 122Xe agrees with the RDM measurements but for 124Xe it does not agree the RDM measurements but agrees with the earlier Coulomb-excitation experiment. The experimental results are compared with the existing theories to understand the changes in the symmetry structure of the Xe-nuclei as the Neutron number decreases from N=76(130Xe) to N=64(118Xe).

OsPRX2 contributes to stomatal closure and improves potassium deficiency tolerance in rice.

Science.gov (United States)

Mao, Xiaohui; Zheng, Yanmei; Xiao, Kaizhuan; Wei, Yidong; Zhu, Yongsheng; Cai, Qiuhua; Chen, Liping; Xie, Huaan; Zhang, Jianfu

2018-01-01

Peroxiredoxins (Prxs) which are thiol-based peroxidases have been implicated in the toxic reduction and intracellular concentration regulation of hydrogen peroxide. In Arabidopsis thaliana At2-CysPrxB (At5g06290) has been demonstrated to be essential in maintaining the water-water cycle for proper H 2 O 2 scavenging. Although the mechanisms of 2-Cys Prxs have been extensively studied in Arabidopsis thaliana, the function of 2-Cys Prxs in rice is unclear. In this study, a rice homologue gene of At2-CysPrxB, OsPRX2 was investigated aiming to characterize the effect of 2-Cys Prxs on the K + -deficiency tolerance in rice. We found that OsPRX2 was localized in the chloroplast. Overexpressed OsPRX2 causes the stomatal closing and K + -deficiency tolerance increasing, while knockout of OsPRX2 lead to serious defects in leaves phenotype and the stomatal opening under the K + -deficiency tolerance. Detection of K + accumulation, antioxidant activity of transgenic plants under the starvation of potassium, further confirmed that OsPRX2 is a potential target for engineering plants with improved potassium deficiency tolerance. Copyright © 2017 Elsevier Inc. All rights reserved.

Determination of (187)Os in molybdenite by ICP-MS with neutron-induced (186)Os and (188)Os spikes.

Science.gov (United States)

Qu, W; Du, A; Zhao, D

2001-10-31

The article describes a method for the determination of (187)Os in molybdenite by isotope dilution inductively coupled plasma-mass spectrometry (ID-ICP-MS) with neutron-induced (186)Os and (188)Os spike. The spike used in the present work was prepared in line with the principle by which artificial nuclides are produced in a nuclear reaction. The concentration and isotopic composition of osmium in the prepared spike were evaluated accurately with the isotope dilution method, using negative thermal ion mass spectrometry (N-TIMS). The advantage of this method is that using (186)Os and (188)Os double spikes can effectively compensate for the mass discrimination effects of ICP-MS. Thus, the common correction practice for mass bias in the isotope dilution method with a single spike is unnecessary. In addition, the method enables one to reduce the determined error arising from instrumental instability. The precision for the (187)Os/((186)Os+(188)Os) ratio was approximately 2% (2sigma, RSD), but in the case of (187)Os/(186)Os, (187)Os/(188)Os and (186)Os/(188)Os, precision ranged from 2.0 to 8% (2sigma, RSD). The results for (187)Os concentration in a molybdenite sample determined with this method showed good agreement with reference values.

Study of asymmetric fission yield behavior from neutron-deficient Hg isotope

International Nuclear Information System (INIS)

Perkasa, Y. S.; Waris, A.; Kurniadi, R.; Su'ud, Z.

2014-01-01

A study of asymmetric fission yield behavior from a neutron-deficient Hg isotope has been conducted. The fission yield calculation of the neutron-deficient Hg isotope using Brownian Metropolis shape had showed unusual result at decreasing energy. In this paper, this interesting feature will be validated by using nine degree of scission shapes parameterization from Brosa model that had been implemented in TALYS nuclear reaction code. This validation is intended to show agreement between both model and the experiment result. The expected result from these models considered to be different due to dynamical properties that implemented in both models

Coulomb excitation of $^{182-184}$ Hg: Shape coexistence in the neutron-deficient lead region

CERN Multimedia

We put forward a study of the interplay between individual nucleon behavior and collective degrees of freedom in the nucleus, as manifested in shape coexistence in the neutron-deficient lead region. As a first step of this experimental campaign, we propose to perform Coulomb excitation on light mercury isotopes to probe their excited states and determine transitional and diagonal E2 matrix elements, especially reducing the current uncertainties. The results from previous Coulomb excitation measurements in this mass region performed with 2.85 MeV/u beams from REX-ISOLDE have shown the feasibility of these experiments. Based on our past experience and the results obtained, we propose a detailed study of the $^{182-184}$Hg nuclei, that exhibit a pronounced mixing between 2 low-lying excited states of apparently different deformation character, using the higher energy beams from HIE-ISOLDE which are crucial to reach our goal. The higher beam energy should result in an increased sensitivity with respect to the qua...

Wobbling mode in 167Ta

International Nuclear Information System (INIS)

Hartley, D. J.; Ludington, A.; Pifer, R.; Seyfried, E. P.; Vanhoy, J. R.; Janssens, R. V. F.; Carpenter, M. P.; Lauritsen, T.; McCutchan, E. A.; Zhu, S.; Riedinger, L. L.; Darby, I. G.; Riley, M. A.; Aguilar, A.; Wang, X.; Chiara, C. J.; Chowdhury, P.; Lakshmi, S.; Tandel, S. K.; Tandel, U.

2009-01-01

The collective wobbling mode, the strongest signature for the rotation of a triaxial nucleus, has previously been seen only in a few Lu isotopes in spite of extensive searches in nearby isotopes. A sequence of transitions in the N=94 167 Ta nucleus exhibiting features similar to those attributed to the wobbling bands in the Lu nuclei has now been found. This band feeds into the πi 13/2 band at a relative energy similar to that seen in the established wobbling bands and its dynamic moment of inertia and alignment properties are nearly identical to the i 13/2 structure over a significant frequency range. Given these characteristics, it is likely that the wobbling mode has been observed for the first time in a nucleus other than Lu, making this collective motion a more general phenomenon.

Systematic structure of the neutron drip-line {sup 22}C nucleus

Energy Technology Data Exchange (ETDEWEB)

Ismail, Atef [Fundamental and Applied Sciences Department, Universiti Teknologi Petronas, Bandar Seri Iskandar, 31750 Tronoh, Perak, Malaysia and Department of Physics, Al-Azhar University, 71524 Assiut (Egypt); Cheong, Lee Yen; Yahya, Noorhana [Fundamental and Applied Sciences Department, Universiti Teknologi PETRONAS, Bandar Seri Iskandar, 31750 Tronoh, Perak (Malaysia); Tammam, M. [Department of Physics, Al-Azhar University, 71524 Assiut (Egypt)

2014-10-24

In the present work we systematically discuss the nuclear structure of the the heaviest particle-bound carbon isotope, {sup 22}C. The ground state wave function of the carbon isotope is calculated using the {sup 20}C core plus two-valence neutron based on a phenomenological mean-field MF potential. We apply the deduced wave function to provide the nuclear matter density which is necessary in the calculations of the total reaction cross section. Calculations show that there is a reasonable good description of the experimental binding energy BE and root-mean square RMS radius. The exotic structure and configuration of the ground state carbon isotope is explained and a consistent explanation on the two-neutron halo (Borromean) nucleus is given.

Development of axial asymmetry in the neutron-rich nucleus {sup 110}Mo

Energy Technology Data Exchange (ETDEWEB)

Watanabe, H., E-mail: hiroshi@ribf.riken.jp [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Yamaguchi, K.; Odahara, A. [Department of Physics, Osaka University, Machikaneyama-machi 1-1, Osaka 560-0043 Toyonaka (Japan); Sumikama, T. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Nishimura, S. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Yoshinaga, K. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Li, Z. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Miyashita, Y. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Sato, K. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Prochniak, L. [Institute of Physics, Maria Curie-Sklodowska University, pl. M. Curie-Sklodowskiej 1, 20-031 Lublin (Poland); Baba, H. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Berryman, J.S. [Nuclear Science Division, Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Blasi, N. [INFN, Sezione di Milano, via Celoria 16, I-20133 Milano (Italy); Bracco, A.; Camera, F. [INFN, Sezione di Milano, via Celoria 16, I-20133 Milano (Italy); Dipartimento di Fisica, Universita di Milano, via Celoria 16, I-20133 Milano (Italy); Chiba, J. [Department of Physics, Faculty of Science and Technology, Tokyo University of Science, 2641 Yamazaki, Noda, Chiba (Japan); Doornenbal, P. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Go, S.; Hashimoto, T.; Hayakawa, S. [Center for Nuclear Study, University of Tokyo, Hirosawa 2-1, Wako, Saitama 351-0198 (Japan)

2011-10-19

The neutron-rich nucleus {sup 110}Mo has been investigated by means of {gamma}-ray spectroscopy following the {beta}-decay of {sup 110}Nb, produced using in-flight fission of a {sup 238}U beam at 345 MeV/nucleon at the RIBF facility. In addition to the ground-band members reported previously, spectroscopic information on the low-lying levels of the quasi-{gamma} band built on the second 2{sup +} state at 494 keV has been obtained for the first time. The experimental finding of the second 2{sup +} state being lower than the yrast 4{sup +} level suggests that axially-asymmetric {gamma} softness is substantially enhanced in this nucleus. The experimental results are compared with model calculations based on the general Bohr Hamiltonian method. The systematics of the low-lying levels in even-even A{approx}110 nuclei is discussed in comparison with that in the neutron-rich A{approx}190 region, by introducing the quantity E{sub S}/E(2{sub 1}{sup +}), E{sub S}=E(2{sub 2}{sup +})-E(4{sub 1}{sup +}), as a global signature of the structural evolution involving axial asymmetry.

Inelastic neutron scattering study of crystal field levels in PrOs4As12

International Nuclear Information System (INIS)

Chi, Songxue; Dai, Pengcheng; Barnes, T.F.E.; Kang, H. J.; Lynn, J. W.; Ye, Feng; Maple, M. B.

2008-01-01

We use neutron scattering to study the Pr 3+ crystalline electric field (CEF) excitations in the filled skutterudite PrOs 4 As 12 . By comparing the observed levels and their strengths under neutron excitation with the theoretical spectrum and neutron excitation intensities, we identify the Pr 3+ CEF levels, and show that the ground state is a magnetic Γ 4 (2) triplet, and the excited states Γ 1 , Γ 4 (1) and Γ 23 are at 0.4, 13 and 23 meV, respectively. A comparison of the observed CEF levels in PrOs 4 As 12 with the heavy fermion superconductor PrOs 4 Sb 12 reveals the microscopic origin of the differences in the ground states of these two filled skutterudites

FUP1--an unified program for calculating all fast neutron data of fissile nucleus

International Nuclear Information System (INIS)

Cai Chonghai; Zuo Yixin

1990-01-01

FUP1 is the first edition of an unified program for calculating all the fast neutron data in ENDF/B-4 format for fissile nucleus. Following data are calculated with FUP1 code: the total cross section, elastic scattering cross section, nonelastic cross section, total including up to 40 isolated levels and continuum state inelastic cross sections. In FUP1 the energy region of incident neutron is restricted to 10 Kev to 20 Mev. The advantages of this program are its perfect function, convenient to users and running very fast

Two-neutron transfer in Pt and Os nuclei and the IBA

International Nuclear Information System (INIS)

Cizewski, J.A.

1980-01-01

Two-neutron transfer studies in Pt and Os were investigated. The extracted relative enhancement factors in Pt were found to be in excellent agreement with the 0(6) limit predictions. The differences in transfer strength between Pt and Os (t,p) could not be reproduced within the present framework of the Interacting Boson Approximation Model. 3 figures

Spectroscopy of the doubly magic nucleus 100Sn and its decay

International Nuclear Information System (INIS)

Hinke, Christoph B.

2010-01-01

The nucleus 100 Sn has been the aim of a number of experimental approaches. It is of great interest for various reasons. It is presumably the heaviest particle-stable N=Z nucleus and at the same time doubly magic. Its beta decay is of particular importance because it is expected to be the purest Gamow-Teller decay in the nuclear chart and thus allows to study the question of the missing Gamow-Teller strength/the Gamow-Teller quenching due to core polarisation effects. From the beta-coincident decay spectroscopy of the daughter nucleus 100 In information about the proton-neutron interaction in this region of the nuclear chart can be obtained. Simultaneously with the implantation of the nucleus in the detector setup after production the search for delayed gamma radiation from a predicted isomeric state in 100 Sn could yield first insight into the structure of excited states in this exotic nucleus. This work presents investigation results concerning the spectroscopy of the doubly magic nucleus 100 Sn and its decay. The experiment was performed in March 2008 at the accelerator facilities of the GSI Helmholtz Zentrum Darmstadt. The neutron deficient nucleus was produced in a projectile fragmentation reaction of a 124 Xe primary beam impinging on a Beryllium target with an energy of 1 GeV x A. After a separation from other fragmentation products and a unique identification 100 Sn was stopped in an implantation detector consisting of highly segmented silicon strip detectors for decay spectroscopy. Beside the determination of the half life it was possible to detect the total energy of the emitted particle radiation in the implantation detector as well as the emitted gamma radiation with a surrounding array of Germanium detectors. With a number of approximately 70 successfully observed decays of 100 Sn a half life of T 1/2 =1.16±0.20s was obtained. The beta endpoint energy of the single channel decay yielded a value of E β 0 =3.29±0.20 MeV. The resultant Gamow

Skin Dose Equivalent Measurement from Neutron-Deficient Isotopes

International Nuclear Information System (INIS)

Hsu, Hsiao-Hua; Costigan, Steve A.; Romero, Leonard L.; Whicker, Jeffrey J.

1997-12-01

Neutron-deficient-isotopes decay via positron emission and/or electron capture often followed by x-ray, gamma-ray, and 0.511 MeV photons from positron annihilation. For cases of significant area and/or personnel contamination with these isotopes, determination of skin dose equivalent (SDE) is required by 10CFR835. For assessment of SDE, we evaluated the MICROSPEC-2(TM) system manufactured by Bubble Technology Industries of Canada which uses three different probes for dose measurement. We used two probes: (1) the X-probe which measures lower energy (4 - 120 keV) photon energy distributions and determines deep dose equivalent, SDE and dose equivalent to eyes, and (2) the B-probe which measures electron (positron) energy distributions, and determines skin dose equivalent. Also, the measured photon and beta spectra can be used to identify radioactive isotopes in the contaminated area. Measurements with several neutron-deficient sources showed that this system provided reasonably accurate SDE rate measurements when compared with calculated benchmark SDE rates with an average percent difference of 40%. Variations were expected because of differences between the assumed geometries used by MlCROSPEC-2 and the calculations when compared to the measurement conditions

Fluorescent atom coincidence spectroscopy of extremely neutron-deficient barium isotopes

International Nuclear Information System (INIS)

Wells, S.A.; Evans, D.E.; Griffith, J.A.R.; Eastham, D.A.; Groves, J.; Smith, J.R.H.; Tolfree, D.W.L.; Warner, D.D.; Billowes, J.; Grant, I.S.; Walker, P.M.

1988-01-01

Fluorescent atom coincidence spectroscopy (FACS) has been used to measure the nuclear mean square radii and moments of the extremely neutron-deficient isotopes 120-124 Ba. At N=65 an abrupt change in nuclear mean square charge radii is observed which can be understood in terms of the occupation of the spin-orbit partner g 7/2 5/2[413] neutron and g 9/2 9/2[404] proton orbitals and the consequent enhancement of the n-p interaction. (orig.)

Multi-quark effects in high energy nucleon-nucleon and nucleus-nucleus collisions

International Nuclear Information System (INIS)

Besliu, C.; Caraciuc, I.; Jipa, A.; Olariu, A.; Topor-Pop, R.; Cotorobai, F.; Pantea, D.; Popa, L.; Popa, V.; Topor-Pop, V.

1988-02-01

Recent data obtained in two experiments performed in the framework of the Bucharest-Dubna collaboration are presented, i.e.: the observation of narrow dibaryonic resonances is neutron-proton interactions in 1mHBC at different momenta of incident neutrons in the range 1-5 GeV/c, and the cumulative production of negative pions in nucleus-nucleus interactions in SKM-200 streamer chamber at 4.5 GeV/c. (authors)

Measurement of the 169Tm (n ,3 n ) 167Tm cross section and the associated branching ratios in the decay of 167Tm

Science.gov (United States)

Champine, B.; Gooden, M. E.; Krishichayan, Norman, E. B.; Scielzo, N. D.; Stoyer, M. A.; Thomas, K. J.; Tonchev, A. P.; Tornow, W.; Wang, B. S.

2016-01-01

The cross section for the 169Tm(n ,3 n ) 167Tm reaction was measured from 17 to 22 MeV using quasimonoenergetic neutrons produced by the 2H(d ,n ) 3He reaction. This energy range was studied to resolve the discrepancy between previous (n ,3 n ) cross-section measurements. In addition, the absolute γ -ray branching ratios following the electron-capture decay of 167Tm were measured. These results provide more reliable nuclear data for an important diagnostic that is used at the National Ignition Facility to estimate the yield of reaction-in-flight neutrons produced via the inertial-confinement-fusion plasma in deuterium-tritium capsules.

Charge radii of neutron-deficient Ca isotopes

Science.gov (United States)

Miller, A. J.; Minamisono, K.; Klose, A.; Everett, N.; Kalman, C.; Powel, R. C.; Watkins, J.; Garand, D.; Sumithrarachchi, C.; Krämer, J.; Maa, B.; Nörtershäuser, W.; Rossi, D. M.; Kujawa, C.; Pineda, S.; Lantis, J.; Liu, Y.; Mantica, P. F.; Pearson, M. R.

2017-09-01

Nucleon shell closures are generally associated with a local minimum in mean-square charge radii, 〈r2 〉 , along an isotopic chain. The 〈r2 〉 of 18Ar and 19K isotopes, however, do not show this signature at the N = 20 neutron shell closure. To gain a microscopic understanding of this abnormal behavior, measurements of 〈r2 〉 of neutron-deficient Ca isotopes below N = 20 have been proposed at the BEam COoling and LAser spectroscopy (BECOLA) facility at NSCL/MSU. Preliminary results will be presented and the deduced charge radii will be compared to theoretical calculations and the trends in the nearby isotopic chains. Work supported in part by NSF Grant PHY-15-65546, U.S. DOE Grant DE-NA0002924 and by the Deutsche Forschungsgemeinschaft through Grant SFB 1245.

Calculated inclusive neutron production from 400 GeV proton-nucleus collisions

International Nuclear Information System (INIS)

Alsmiller, R.G. Jr.; Alsmiller, F.S.; Hermann, O.W.

1989-08-01

Calculated inclusive neutron production from 400 GeV proton-nucleus collisions is presented and compared with experimental data. Target nuclei H, Be, Cu, and Pb are considered and the comparisons cover the laboratory energy range of 20 to 400 GeV, and angular range 0.7 to 10 mr. Moderately good agreement between the calculated and experimental data is found, but the agreement in the case of Be, Cu and Pb is significantly better than in the case of H. 8 refs., 4 figs

Gamma spectrum following neutron capture in {sup 167}Er

Energy Technology Data Exchange (ETDEWEB)

Visser, D.; Khoo, T.L.; Lister, C.J. [and others

1995-08-01

Statistical decay from a highly excited state samples all the lower-lying states and, hence, provides a sensitive measure of the level density. Pairing has a major impact on the level density, e.g. creating a pair gap between the 0- and 2-quasiparticle configurations. Hence the shape of the statistical spectrum contains information on pairing, and can be used to provide information on the reduction of pairing with thermal excitation energy. For this reason, we measured the complete spectrum of {gamma}rays following thermal neutron capture in {sup 167}Er. The experiment was performed at the Brookhaven reactor using Compton-suppressed Ge detectors from TESSA. The spectrum, which was corrected for detector response and efficiency, reveals primary (first-step, high-energy) transitions up to nearly 8 MeV, secondary (last-step, lower-energy) transitions, as we as a continuous statistical component. Effort was expanded to identify all lines from contaminant sources and an upper limit of 5% was tentatively set for their contributions. The spectral shape of the statistical spectrum will be compared with theoretical spectra obtained from a calculation of pairing which accounts for a stepwise reduction of the pair correlations as the number of quasiparticles increases. The primary lines which decay directly to the near-yrast states will also be used to deduce the level densities.

Inclusão e fracasso escolar: o que pensam os alunos com deficiência mental?

Directory of Open Access Journals (Sweden)

Enicéia Gonçalves Mendes

2009-04-01

Full Text Available O objetivo deste estudo é identificar a percepção dos alunos com deficiência mental sobre a aprendizagem do conteúdo curricular numa classe comum de uma escola regular. Participaram do estudo 10 alunos com deficiência mental, egressos de espaços da Educação Especial e matriculados nas classes comuns das escolas regulares. O procedimento de coleta de dados envolveu entrevistas com os 10 alunos. A análise dos dados para as respostas das entrevistas foi feita a partir da análise de conteúdo. Os resultados mostram que os alunos, apesar de evidenciarem gostar da escola, afirmam ter dificuldades com a aprendizagem do conteúdo curricular, especialmente porque não há adequação do ensino às necessidades dos alunos. Os dados indicam a importância de que as escolas organizem novas situações de ensino-aprendizagem que de fato atendam a diversidade, além do sistema educacional rever a produção do fracasso escolar para que de fato possamos desenvolver práticas pedagógicas inclusivas bem-sucedidas. Palavras-chave: Educação Especial. Inclusão Escolar. Deficiência Mental.

Neutron cross section measurements using the ORELA: 40Ar(n,x), 40Ca(n,x), 22Ne(n,γ), 187Os(n,n') 186187188Os(n,nn'γ), the stable tellurium isotopes (n,γ), and 205Tl(n,nγ). Progress report, September 1, 1982-August 31, 1983

International Nuclear Information System (INIS)

Winters, R.R.

1983-09-01

The research performed during this reporting period consisted primarily of (1) measurement, analysis, and publication of the 187 Os(n,n') cross section near 30 keV, (2) measurement and analysis of the 148 149 159 Sm(n,γ) cross sections, (3) development and publication of a significantly better approximation to the average neutron scattering function as determined by total cross section measurements at the Oak Ridge Electron Linear Accelerator (ORELA), and (4) providing support for the neutron capture facility at ORELA as in the corrections made to the 60 Ni(n,γ) data discussed in a paper included with this report. The major result of the 187 Os(n,n') cross section measurement was the 30 keV average value for that cross section anti sigma/sub nn'/ approx. = 1.5 +- 0.2 b and the implication that the duration of stellar nucleosynthesis, as derived from the 187 Re → 187 Os beta decay, is estimated to be (8.9 +- 2.0) x 10 9 year consistent with an earlier estimate reported by Winters and Macklin. The Sm(n,γ) measurement has already resulted in an estimate of the importance of branching in the s-process in the samarium mass region. We estimate the average neutron density during s-process nucleosynthesis in the vicinity of the solar system to be between less than or equal to (1.1 + 0.7) and (1.1 - 0.6) x 10 8 neutrons/cm 3 . In the optical model analysis of neutron total cross sections we continue to find that orbital angular momentum dependent well depths are required if the spherical optical model is used to describe the neutron-nucleus interaction at low neutron energies

O que os empregadores pensam sobre o trabalho da pessoa com deficiência? What do the employers think about the working of deficient person?

Directory of Open Access Journals (Sweden)

Eliza Dieko Oshiro Tanaka

2005-08-01

Full Text Available Este estudo teve o objetivo de identificar o ponto de vista dos empregadores sobre a pessoa com deficiência, o seu trabalho e a sua admissão como funcionária da empresa. Os dados foram coletados por meio de entrevista semi-estruturada, junto a seis responsáveis pelo setor de recursos humanos de empresas pertencentes aos ramos de comércio, indústria e prestação de serviços. Os resultados indicaram que essas empresas possuíam funcionários com diferentes tipos de deficiência e a sua contratação ocorreu, predominantemente, pela obrigatoriedade da lei. Os entrevistados acreditavam que as pessoas com deficiência tinham condições de exercer um trabalho, mas apontaram algumas dificuldades em função: a dela própria - falta de escolaridade, de interesse e de preparação profissional e social; b da empresa - condições inadequadas do ambiente físico e social, falta de conhecimento sobre a deficiência; c das instituições especiais - inadequação dos programas de treinamento profissional e social, falta de contato com as empresas para conhecer as suas necessidades; d do governo - de proporcionar acesso à escola e ao transporte, falta de incentivo para as empresas promoverem adaptações ergonômicas e desenvolverem programas de responsabilidade social. Os cargos que os funcionários com deficiência ocupavam exigiam pouca qualificação e o seu treinamento era realizado no próprio local de trabalho. A concepção de que as dificuldades desse trabalhador eram decorrentes das suas condições orgânicas prevaleceu na fala desses entrevistados.The aim of this study was to identify the view of the employers about the deficient people, their job and their admission in the company. The data were collected by semi-structured interview with six persons responsible for the Human Resources Department. The branches of these companies were commerce, industry and services. Results indicated that the enterprises had employers with different

A new version of PIRK (elastic pion-nucleus scattering) to handle differing proton and neutron radii

International Nuclear Information System (INIS)

Funsten, H.O.

1979-01-01

This program is a modification of the Eisenstein-Miller program (1974) for calculating elastic pion-nucleus differential cross sections using free π-N scattering amplitudes. This revision permits the use of separate proton and neutron radii for the nuclear density function rho(r). (Auth.)

Neutron emission from 9Be nucleus under the action of β+ and γ radiation emitted in radioactive decay

International Nuclear Information System (INIS)

Vo Dak Bang; Gangrskij, Yu.P.; Miller, M.B.; Mikhajlov, L.V.; Fam Zui Khien; Kharisov, I.F.

1980-01-01

The neutron yield from the 9 Be nucleus under the action of beta and gamma-radiation emitted at the radiative decay of 11 C, 62 Cu, 66 Ga, 74 Br isotopes is measured. These isotopes differ essentially by the emitted radiation spectra. The contribution of various processes ((γ, n)-reactions, inelastic scattering and positron nonradiative annihilation) to the neutron yield observed is determined [ru

Formation of light particles in nucleus-nucleus collisions

International Nuclear Information System (INIS)

Zagrebaev, V.; Penionzhkevich, Yu.

1993-01-01

The principal experimental results on the yield of the light charged particles in nucleus-nucleus collisions at the low and intermediate energies are reviewed. Inclusive spectra of light particles and their coincidences with the characteristic KX-rays, γ-rays, neutrons, projectile-like fragments, other light particles, fission fragments, and evaporation residues are analyzed. The main theoretical models used for the description of the light particle formation are briefly outlined together with their merits and shortcomings. The unsolved problems of fast light particle formation, in particular, and of nucleus-nucleus interaction dynamics, on the whole, are discussed with the outlooks of new experiments able to clear up some of these problems. (author) 144 refs., 40 figs., 2 tabs

Influence of neutron halo in the interaction of {sup 6}He nucleus of 35 MeV/nucleon with {sup 197}Au and {sup 238}U; Influence du halo de neutrons dans l`interaction du noyau {sup 6}He de 35 MeV/nucleon avec {sup 197}Au et {sup 238}U

Energy Technology Data Exchange (ETDEWEB)

Perier, Yann [Grand Accelerateur National d`Ions Lourds (GANIL), 14 - Caen (France)

1997-10-27

In this study, we have attempted to answer some of the questions still open concerning neutron halo nuclei. The interest of the latter lies in their very peculiar structure. The analysis of the kinematical features of the halo nucleus fragments originating from the dissociation following the interaction with a target nucleus is an essential tool for probing this structure. We studied the {sup 6}He + Au, U at 35 A.MeV system with a new method. Simultaneous measurements of the halo nucleus core, the halo neutrons and the excitation energy deposited in the target nucleus assessed with ORION allowed us to obtain information about the formation of the {sup 5}He nucleus and about the partial validity of the sudden approximation at moderate bombarding energy. The study of the core nucleus and neutron angular distributions confirmed that it is difficult to extract information on the internal structure at the halo neutrons from their widths. The halo neutron longitudinal momentum distributions were studied. Their widths were found to increase as the impact parameter decreases. The {sup 4}He - core parallel momentum distributions were also investigated. The widths are weakly dependent on the excitation energy deposited in the target nucleus, but increase with the {sup 4}He emission angle as for the halo neutrons. The ratio between one- and two-neutron stripping cross sections seems to indicate that the two halo neutrons are strongly correlated with a large dineutron component, as ascertained by a calculation in the framework of the Serber model. (author) 84 refs., 98 figs., 17 tabs.

Spectroscopy of the doubly magic nucleus {sup 100}Sn and its decay

Energy Technology Data Exchange (ETDEWEB)

Hinke, Christoph B.

2010-07-23

The nucleus {sup 100}Sn has been the aim of a number of experimental approaches. It is of great interest for various reasons. It is presumably the heaviest particle-stable N=Z nucleus and at the same time doubly magic. Its beta decay is of particular importance because it is expected to be the purest Gamow-Teller decay in the nuclear chart and thus allows to study the question of the missing Gamow-Teller strength/the Gamow-Teller quenching due to core polarisation effects. From the beta-coincident decay spectroscopy of the daughter nucleus {sup 100}In information about the proton-neutron interaction in this region of the nuclear chart can be obtained. Simultaneously with the implantation of the nucleus in the detector setup after production the search for delayed gamma radiation from a predicted isomeric state in {sup 100}Sn could yield first insight into the structure of excited states in this exotic nucleus. This work presents investigation results concerning the spectroscopy of the doubly magic nucleus {sup 100}Sn and its decay. The experiment was performed in March 2008 at the accelerator facilities of the GSI Helmholtz Zentrum Darmstadt. The neutron deficient nucleus was produced in a projectile fragmentation reaction of a {sup 124}Xe primary beam impinging on a Beryllium target with an energy of 1 GeV x A. After a separation from other fragmentation products and a unique identification {sup 100}Sn was stopped in an implantation detector consisting of highly segmented silicon strip detectors for decay spectroscopy. Beside the determination of the half life it was possible to detect the total energy of the emitted particle radiation in the implantation detector as well as the emitted gamma radiation with a surrounding array of Germanium detectors. With a number of approximately 70 successfully observed decays of {sup 100}Sn a half life of T{sub 1/2}=1.16{+-}0.20s was obtained. The beta endpoint energy of the single channel decay yielded a value of E{sub {beta

The BiCu{sub 1−x}OS oxysulfide: Copper deficiency and electronic properties

Energy Technology Data Exchange (ETDEWEB)

Berthebaud, D.; Guilmeau, E.; Lebedev, O.I. [Laboratoire CRISMAT, UMR 6508 CNRS/ENSICAEN/UCBN, 6 bd du Maréchal Juin, F-14050 CAEN Cedex 4 (France); Maignan, A., E-mail: antoine.maignan@ensicaen.fr [Laboratoire CRISMAT, UMR 6508 CNRS/ENSICAEN/UCBN, 6 bd du Maréchal Juin, F-14050 CAEN Cedex 4 (France); Gamon, J.; Barboux, P. [Institut de Recherche de Chimie de Paris, Ecole Nationale Supérieure de Chimie de Paris, 11 rue Pierre et Marie Curie, 75231 Paris Cedex 09 France (France)

2016-05-15

An oxysulfide series of nominal compositions BiCu{sub 1−x}OS with x<0.20 has been prepared and its structural properties characterized by combining powder X-ray diffraction and transmission electron microscopy techniques. It is found that this oxysulfide, crystallizing in the P4/nmm space group, tends to adopt a constant amount of copper vacancy corresponding to x=0.05 in the BiCu{sub 1−x}OS formula. The presence of Cu vacancies is confirmed by HAADF-STEM analysis showing, in the Cu atomic columns, alternating peaks of different intensities in some very localized regions. For larger Cu deficiencies (x>0.05 in the nominal composition), other types of structural nanodefects are evidenced such as bismuth oxysulfides of the “BiOS” ternary system which might explain the report of superconductivity for the BiCu{sub 1−x}OS oxysulfide. Local epitaxial growth of the BiCuOS oxysulfide on top of CuO is also observed. In marked contrast to the BiCu{sub 1−x}OSe oxyselenide, these results give an explanation to the limited impact of Cu deficiency on the Seebeck coefficient in BiCu{sub 1−x}OS compounds. - Graphical abstract: High resolution TEM image showing a Bi(Cu)OS/Bi{sub 2}O{sub 2}S interface and corresponding dislocation region. The Bi(Cu)OS structure adopts a rather constant Cu content (near 0.95); starting from BiCuOS leads to the formation of defects such as the Bi{sub 2}O{sub 2}S oxysulfide.

A new version of DWPI (inelastic pion-nucleus scattering) to incorporate microscopic form factors and differing proton and neutron radii

International Nuclear Information System (INIS)

Funsten, H.O.

1979-01-01

This is a modification of the Eisenstein-Miller program for calculation of collective inelastic pion-nucleus differential cross sections using free π-N scattering amplitudes. This revision permits the additional use of microscopic (shell model) proton and neutron form factors. It also incorporates separate proton and neutron radii for the nuclear density rho(r) generating the distorted wave optical potential. (Auth.)

Shape coexistence in the neutron-deficient Pt isotopes in a configuration mixing IBM

International Nuclear Information System (INIS)

Morales, Irving O.; Vargas, Carlos E.; Frank, Alejandro

2004-01-01

The recently proposed matrix-coherent state approach for configuration mixing IBM is used to describe the evolving geometry of the neutron deficient Pt isotopes. It is found that the Potential Energy Surface (PES) of the Platinum isotopes evolves, when the number of neutrons decreases, from spherical to oblate and then to prolate shapes, in agreement with experimental measurements. Oblate-Prolate shape coexistence is observed in 194,192Pt isotopes

Experimental studies of nucleon-nucleon and pion-nucleus interactions at intermediate energies

International Nuclear Information System (INIS)

1990-01-01

This report summarizes the work on experimental research in intermediate energy nuclear and particle physics carried out by New Mexico State University in 1988--91. Most of these studies have involved investigations of neutron-proton and pion-nucleus interactions. The neutron-proton research is part of a program of studies of interactions between polarized nucleons that we have been involved with for more than ten years. Its purpose has been to help complete the determination of the full set of ten complex nucleon-nucleon amplitudes at energies up to 800 MeV, as well as to continue investigating the possibility of the existence of dibaryon resonances. The give complex isospin-one amplitudes have been fairly well determined, partly as a result of this work. Our work in this period has involved measurements and analysis of data on elastic scattering and total cross sections for polarized neutrons on polarized protons. The pion-nucleus research continues our studies of this interaction in regions where it has not been well explored. One set of experiments includes studies of pion elastic and double-charge-exchange scattering at energies between 300 and 550 MeV, where our data is unique. Another involves elastic and single-charge-exchange scattering of pions from polarized nuclear targets, a new field of research which will give the first extensive set of information on spin-dependent pion-nucleus amplitudes. Still another involves the first set of detailed studies of the kinematic correlations among particles emitted following pion absorption in nuclei

OsWRKY74, a WRKY transcription factor, modulates tolerance to phosphate starvation in rice.

Science.gov (United States)

Dai, Xiaoyan; Wang, Yuanyuan; Zhang, Wen-Hao

2016-02-01

The WRKY transcription factor family has 109 members in the rice genome, and has been reported to be involved in the regulation of biotic and abiotic stress in plants. Here, we demonstrated that a rice OsWRKY74 belonging to group III of the WRKY transcription factor family was involved in tolerance to phosphate (Pi) starvation. OsWRKY74 was localized in the nucleus and mainly expressed in roots and leaves. Overexpression of OsWRKY74 significantly enhanced tolerance to Pi starvation, whereas transgenic lines with down-regulation of OsWRKY74 were sensitive to Pi starvation. Root and shoot biomass, and phosphorus (P) concentration in rice OsWRKY74-overexpressing plants were ~16% higher than those of wild-type (WT) plants in Pi-deficient hydroponic solution. In soil pot experiments, >24% increases in tiller number, grain weight and P concentration were observed in rice OsWRKY74-overexpressing plants compared to WT plants when grown in P-deficient medium. Furthermore, Pi starvation-induced changes in root system architecture were more profound in OsWRKY74-overexpressing plants than in WT plants. Expression patterns of a number of Pi-responsive genes were altered in the OsWRKY74-overexpressing and RNA interference lines. In addition, OsWRKY74 may also be involved in the response to deficiencies in iron (Fe) and nitrogen (N) as well as cold stress in rice. In Pi-deficient conditions, OsWRKY74-overexpressing plants exhibited greater accumulation of Fe and up-regulation of the cold-responsive genes than WT plants. These findings highlight the role of OsWRKY74 in modulation of Pi homeostasis and potential crosstalk between P starvation and Fe starvation, and cold stress in rice. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.

Spallation production of neutron deficient radioisotopes in North America

International Nuclear Information System (INIS)

Jamriska, D.J.; Peterson, E.J.; Carty, J.

1997-01-01

The United States Department of Energy produces a number of neutron deficient radioisotopes by high energy proton induced spallation reactions in accelerators at Los Alamos National Laboratory in New Mexico and Brookhaven National Laboratory in New York. Research isotopes are also recovered from targets irradiated at TRIUMF in British Columbia, Canada. The radioisotopes recovered are distributed for use in nuclear medicine, environmental research, physics research, and industry worldwide. In addition to the main product line of Sr-82 from either Mo or Rb targets, Cu-67 from ZnO targets, and Ge-68 from RbBr targets, these irradiation facilities also produce some unique isotopes in quantities not available from any other source such as Be-10, Al-26, Mg-28, Si-32, El-44, Fe-52, Gd-248, and Hg-194. We will describe the accelerator irradiation facilities at the Los Alamos and Brookhaven National Laboratories. The high level radiochemical processing facilities at Los Alamos and brief chemical processes from Los Alamos and Brookhaven will be described. Chemical separation techniques have been developed to recover the radioisotopes of interest in both high radiochemical purity and yield and at the same time trying to reduce or eliminate the generation of mixed waste. nearly 75 neutron deficient radioisotopes produced in spallation targets have been produced and distributed to researchers around the world since the inception of the program in 1974

Theory of neutron emission in fission

International Nuclear Information System (INIS)

Madland, D.G.

1998-01-01

A survey of theoretical representations of two of the observables in neutron emission in fission is given, namely, the prompt fission neutron spectrum N(E) and the average prompt neutron multiplicity bar ν p . Early representations of the two observables are presented and their deficiencies are discussed. This is followed by summaries and some examples of recent theoretical models for the calculation of these quantities. Emphasis is placed upon the predictability and accuracy of the recent models. In particular, the dependencies of N(E) and bar ν p upon the fissioning nucleus and its excitation energy are treated in detail for the Los Alamos model. Recent work in the calculation of the prompt fission neutron spectrum matrix N(E, E n ), where E n is the energy of the neutron inducing fission, is then discussed. Concluding remarks address the current status of the ability to calculate these observables with confidence, the direction of future theoretical efforts, and limitations to current (and future) approaches. This paper is an extension of a similar paper presented at the International Centre for Theoretical Physics in 1996

Post-scission fission theory: Neutron emission in fission

International Nuclear Information System (INIS)

Madland, D.G.

1997-01-01

A survey of theoretical representations of two of the observables in neutron emission in fission is given, namely, the prompt fission neutron spectrum N (E) and the average prompt neutron multiplicity bar ν p . Early representations of the two observables are presented and their deficiencies are discussed. This is followed by summaries and examples of recent theoretical models for the calculation of these quantities. Emphasis is placed upon the predictability and accuracy of the recent models. In particular, the dependencies of N (E) and bar ν p upon the fissioning nucleus and its excitation energy are treated. Recent work in the calculation of the prompt fission neutron spectrum matrix N (E, E n ), where E n is the energy of the neutron inducing fission, is then discussed. Concluding remarks address the current status of our ability to calculate these observables with confidence, the direction of future theoretical efforts, and limitations to current (and future) approaches

Search for low lying dipole strength in the neutron rich nucleus Ne{sup 26}

Energy Technology Data Exchange (ETDEWEB)

Gibelin, J

2005-11-15

We carried out the Coulomb excitation, on a lead target, of an exotic beam of neutron-rich nucleus Ne{sup 26} at 58 MeV/n, in order to study the possible existence of a pygmy dipole resonance above the neutron emission threshold. The experiment was performed at the Riken Research Facility, in Tokyo (Japan) and included a gamma-ray detector, a charged fragment hodoscope and a neutron detector. Using the invariant mass method in the Ne{sup 25} + n decay channel, and by comparing the reaction cross section on the lead target and a light target of aluminum, we observe a sizable amount of E1 strength between the one neutron and the two neutron emission thresholds. The corresponding Ne{sup 26} angular distribution confirms its nature and we deduce its reduced dipole transition probability value of B(E1) = 0.54 {+-} 0.18 e{sup 2}fm{sup 2}. Our method also enables us to extract for the first time the decay pattern of a pygmy resonance. By detecting the decay photons from the excited states below the neutron emission threshold and by analyzing the angular distribution of the inelastically scattered Ne{sup 26} we deduce the reduced transition probability of the first 2{sup +} state, from the ground state. The value obtained of B(E2) = 87 {+-} 13 e{sup 2}fm{sup 4} being in disagreement with a previous result. (author)

A systematics of optical model compound nucleus formation cross sections for neutrons, proton, deuteron, 3He and alpha particle incidents

International Nuclear Information System (INIS)

Murata, Toru

2000-01-01

Simple formulae to reproduce the optical model compound nucleus formation cross sections for neutron, proton, deuteron, triton, 3 He and alpha particles are presented for target nuclei of light to medium weight mass region. (author)

Shell and isotopic effects in neutron interaction with nuclei. [Optical model and nucleus asymmetry correlations

Energy Technology Data Exchange (ETDEWEB)

Pasechnik, M V

1978-01-01

Major results of investigations into the shell structure of deformed nuclei with the number of neutrons of approximately 100, as well as new isotopic effects in the inelastic scattering of fast neutrons with nuclei are reported. The experiments conducted at the WWR-M research reactor have shown a substantial dependence of the nuclear excited energy-level density on the mass number and the number of neutrons. The fact resulted in a conclusion that the deformed nuclei possess filled shells, that was an incentive to revise the whole nuclear shell concept. In particular it was established that the property of magicity rests not only on the sphericity of nuclei but it may be also observed in strongly deformed nuclei. The isotope-spin dependence of the nuclear potential was studied at the AG-5 pulse electrostatic generator. The parameters of the potential were determined by comparing the experimental data on inelastic scattering and polarization of fast neutrons by nuclei from /sup 48/Ti to /sup 209/Bi with the calculations in terms of the optical model. Simple correlations were established between the optical potential and the nucleus asymmetry parameter ..cap alpha..=N-Z/A in wide ranges of mass numbers and neutron energy.

Theoretical models of neutron emission in fission

International Nuclear Information System (INIS)

Madland, D.G.

1992-01-01

A brief survey of theoretical representations of two of the observables in neutron emission in fission is given, namely, the prompt fission neutron spectrum N(E) and the average prompt neutron multiplicity bar v p . Early representations of the two observables are presented and their deficiencies are discussed. This is followed by summaries and examples of recent theoretical models for the calculation of these quantities. Emphasis is placed upon the predictability and accuracy of the new models. In particular, the dependencies of N(E) and bar v p upon the fissioning nucleus and its excitation energy are treated. Recent work in the calculation of the prompt fission neutron spectrum matrix N(E,E n ), where E n is the energy of the neutron inducing fission, is then discussed. Concluding remarks address the current status of our ability to calculate these observables with confidence, the direction of future theoretical efforts, and limititations to current and future calculations. Finally, recommendations are presented as to which model should be used currently and which model should be pursued in future efforts

Exclusive measurement of breakup reactions with the one-neutron halo nucleus sup 1 sup 1 Be

CERN Document Server

Palit, R; Aumann, T; Boretzky, K; Carlson, B V; Cortina-Gil, D; Elze, T W; Emling, H; Geissel, H; Hellström, M; Jones, K L; Kratz, J V; Kulessa, R; Leifels, Y; Leistenschneider, A; Münzenberg, G; Nociforo, C; Reiter, P; Simon, H; Sümmerer, K; Walús, W

2003-01-01

Electromagnetic and nuclear inelastic scattering of the halo nucleus sup 1 sup 1 Be have been investigated by a measurement of the one-neutron removal channel, utilizing a secondary sup 1 sup 1 Be beam with an energy of 520 MeV/nucleon impinging on lead and carbon targets. All decay products, i.e. sup 1 sup 0 Be fragments, neutrons, and gamma-rays have been detected in coincidence. Partial cross sections for the population of ground and excited states in sup 1 sup 0 Be were determined for nuclear diffractive breakup as well as for electromagnetically induced breakup. The partial cross sections for ground-state transitions have been differentiated further with respect to excitation energy, and the dipole-strength function associated solely with transitions of the halo 2s sub 1 sub / sub 2 neutron to the continuum has been derived. The extracted dipole strength integrated from the neutron threshold up to 6.1 MeV excitation energy amounts to 0.90(6) e sup 2 fm sup 2. A spectroscopic factor for the nu 2s sub 1 su...

Collinear Resonance Ionization Spectroscopy of Neutron-Deficient Francium Isotopes

CERN Document Server

Flanagan, K T; Ruiz, R F Garcia; Budincevic, I; Procter, T J; Fedosseev, V N; Lynch, K M; Cocolios, T E; Marsh, B A; Neyens, G; Strashnov, I; Stroke, H H; Rossel, R E; Heylen, H; Billowes, J; Rothe, S; Bissell, M L; Wendt, K D A; de Groote, R P; De Schepper, S

2013-01-01

The magnetic moments and isotope shifts of the neutron-deficient francium isotopes Fr202-205 were measured at ISOLDE-CERN with use of collinear resonance ionization spectroscopy. A production-to-detection efficiency of 1\\% was measured for Fr-202. The background from nonresonant and collisional ionization was maintained below one ion in 10(5) beam particles. Through a comparison of the measured charge radii with predictions from the spherical droplet model, it is concluded that the ground-state wave function remains spherical down to Fr-205, with a departure observed in Fr-203 (N = 116).

Study of fragmentation reactions of light nucleus

International Nuclear Information System (INIS)

Toneli, David Arruda; Carlson, Brett Vern

2011-01-01

Full text: The decay of the compound nucleus is traditionally calculated using a sequential emission model, such as the Weisskopf-Ewing or Hauser-Feshbach ones, in which the compound nucleus decays through a series of residual nuclei by emitting one particle at a time until there is no longer sufficient energy for further emission. In light compound nucleus, however, the excitation energy necessary to fully disintegrate the system is relatively easy to attain. In such cases, decay by simultaneous emission of two or more particles becomes important. A model which takes into account all these decay is the Fermi fragmentation model. Recently, the equivalence between the Fermi fragmentation model and statistical multifragmentation model used to describe the decay for highly excited fragments for reactions of heavy ions was demonstrated. Due the simplicity of the thermodynamic treatment used in the multifragmentation model, we have adapted it to the calculation of Fermi breakup of light nuclei. The ultimate goal of this study is to calculate the distribution of isotopes produced in proton-induced reactions on light nuclei of biological interest, such as C, O e Ca. Although most of these residual nuclei possess extremely short half-lives and thus represent little long-term danger, they tend to be deficient in neutrons and to decay by positron emission, which allows the monitoring of proton radiotherapy by PET (Positron Emission Tomography). (author)

Cross-Section Measurement of the 169Tm(n,3n)167Tm Reaction and Constraining the Branching Ratio of 167Tm

Science.gov (United States)

Champine, Brian; Gooden, Matthew; Thomas, Keenan; Krishichayan, F.; Norman, Eric; Scielzo, Nick; Tonchev, Anton; Tornow, Werner

2015-10-01

The cross section of the 169Tm(n,3n)167Tm reaction has been measured from 17.5 to 21.5 MeV using activation technique. This energy region was chosen to resolve the two different trends of the previous (n,3n) cross section measurements on 169Tm. In addition, the branching ratio of the 207.8 keV γ-ray line stemming from electron capture of 167Tm was measured to be 0.419(16). The result of these measurements provide more accurate diagnostic estimation of the so called reaction-in-flight neutrons produced via the internal confinement fusion plasma in deuterium-tritium capsules at the National Ignition Facility.

Study of the structure of light neutron rich nucleus with the Tonnerre array; Etude de la structure de noyaux legers riches en neutrons a l'aide du multidetecteur Tonnerre

Energy Technology Data Exchange (ETDEWEB)

Pietri, St

2003-06-01

This work concern the technical development made on the multidetector TONNERRE and the study of the {sup 34}Si nucleus by a complete beta-neutron-gamma spectroscopy. In the first part various tests performed on modules of the detector in the 'Centre d'Etude de Bruyere le Chatel' are presented. A modification of the embassies of the photomultipliers tubes allows to gain more than 50% in the neutron efficiency and to obtain a threshold lower than 300 keV for the neutron energy. A complete C++ simulation of the neutron propagation in the array was carried out. It explains that the slow component of the light output of the scintillator may be responsible of the shape of the time-of-flight spectrum. The second part of these report presents the experiment devoted to the study of the structure of the {sup 34}Si from the beta decay of the {sup 34}Al. It was performed at the GANIL facility using the TONNERRE array and germanium of ENOGAM. The {sup 34}Al was produced by projectile fragmentation of a {sup 36}S beam of 50 MeV/A in a target of {sup 9}Be. A complete beta scheme of the {sup 34}Al is proposed. Eight neutron lines following the {sup 34}Al decay were observed for the first time. Finally we suggest that a monopolar transition could occur in the {sup 34}Si nucleus signing a O{sup +}{sub 2} state at 2133 keV. (author)

Extraction of the 1S0 neutron-neutron scattering length from a kinematically-complete n-d breakup experiment at TUNL

International Nuclear Information System (INIS)

Gonzalez Trotter, D. E.; Tornow, W.; Howell, C. R.; Salinas, F.; Walter, R. L.; Witalea, H.

1999-01-01

The 1 S 0 neutron-neutron (nn) scattering length's currently accepted value (a nn =-18.6±0.3 fm) is derived exclusively from two π - -d capture-reaction experiments, in disagreement with the average -16.7±0.5 fm extracted from kinematically-complete nd breakup experiments. This discrepancy may be due to deficiencies in the analyses of n-d breakup data and/or three-nucleon force (3NF) effects. A kinematically-complete n+d→n 1 +n 2 +p breakup experiment at an incident neutron energy of 13.0 MeV was performed recently at TUNL. The value of a nn was extracted from the direct comparison of experimental and rigorously-calculated theoretical nd breakup differential cross sections at four production angles of the nn pair. Using modern nucleon-nucleon potential models in the three-nucleon cross-section calculations we obtained a nn =-18.7±0.6 fm, in agreement with the π - -d result. We found no significant effect due to 3NFs on our a nn value

Angular distribution of oriented nucleus fission neutrons

International Nuclear Information System (INIS)

Barabanov, A.L.; Grechukhin, D.P.

1982-01-01

Calculations of anisotropy of angular distribution of oriented 235 U nuclei thermal fission neutrons have been carried out. the neutrons were assumed to evaporate isotropically by completely accelerated fragements in the fragment system with only its small part, i. e. fission-producing neutrons, emitted at the moment of neck break. It has been found out that at low energies of neutrons Esub(n)=1-2 MeV the sensitivity of the angular distribution anisotropy to variations of spectrum of neutron evaporation from fragments and the magnitude of a share of fission-producing neutrons reaches approximately 100%, which at high energies, Esub(n) > 5 MeV it does not exceed approximately 20%. Therefore the angular distribution of fast neutrons to a greater degree of confidence may be used for restoring the angular distribution anisotropy of fragments while the angular distribution of low energy neutrons may be used for deriving information on the fission process, but only in case 6f the experiment accuracy is better than approximately 3%

Thermal Bremsstrahlung probing nuclear multifragmentation in nucleus-nucleus collisions around the Fermi energy

International Nuclear Information System (INIS)

D'Enterria, D.G.

2000-05-01

The thermodynamical properties of nuclear matter at moderate temperatures and densities, in the vicinity of the predicted nuclear liquid-gas phase transition, are studied using as experimental probe the hard-photons (E γ > 30 MeV) emitted in nucleus-nucleus collisions. Photon and charged-particle production in four different heavy-ion reactions (Ar 36 + Au 197 , Ag 107 , Ni 58 , C 12 at 60 A*MeV) is measured exclusively and inclusively coupling the TAPS photon spectrometer with two charged-particle and intermediate-mass-fragment detectors covering nearly 4π. We confirm that Bremsstrahlung emission in first-chance (off-equilibrium) proton-neutron collisions (pnγ) is the dominant origin of hard photons. We also firmly establish the existence of a thermal radiation component emitted in second-chance proton-neutron collisions. This thermal Bremsstrahlung emission takes place in semi-central and central nucleus-nucleus reactions involving heavy targets. We exploit this observation i) to demonstrate that thermal equilibrium is reached during the reaction, ii) to establish a new thermometer of nuclear matter based on Bremsstrahlung photons, iii) to derive the thermodynamical properties of the excited nuclear sources and, in particular, to establish a 'caloric curve' (temperature versus excitation energy), and iv) to assess the time-scales of the nuclear break-up process. (author)

Shape coexistence in the neutron-deficient Pt isotopes in the configuration-mixed IBM

International Nuclear Information System (INIS)

Vargas, Carlos E.; Campuzano, Cuauhtemoc; Morales, Irving O.; Frank, Alejandro; Van Isacker, Piet

2008-01-01

The matrix-coherent state approach in the IBM with configuration mixing is used to describe the geometry of neutron-deficient Pt isotopes. Employing a parameter set for all isotopes determined previously, it is found that the lowest minimum goes from spherical to oblate and finally acquires a prolate shape when approaching the mid-shell Pt isotopes

Neutron-nucleus interactions and fission. Chapter 1

International Nuclear Information System (INIS)

1998-01-01

The central problem in nuclear-reactor kinetics is to predict the evolution in time of the neutron population in a multiplying medium. Point kinetics allows study of the global behaviour of the neutron population from the average properties of the medium. Before tackling, in the following chapters, the equations governing the time variation of the reactor power (proportional to the total neutron population), the properties of a neutron-multiplying medium shall be discussed briefly. After recalling a number of definitions, a qualitative description shall be given of the principal nuclear reactions at play in a self-sustaining chain reaction, with emphasis on the source of fission neutrons. Since delayed neutrons play a crucial role in reactor kinetics, their production in a reactor shall be described in greater detail. (author)

Electron-capture delayed fission properties of neutron-deficient einsteinium nuclei

International Nuclear Information System (INIS)

Shaughnessy, Dawn A.

2000-01-01

Electron-capture delayed fission (ECDF) properties of neutron-deficient einsteinium isotopes were investigated using a combination of chemical separations and on-line radiation detection methods. 242 Es was produced via the 233 U( 14 N,5n) 242 Es reaction at a beam energy of 87 MeV (on target) in the lab system, and was found to decay with a half-life of 11 ± 3 seconds. The ECDF of 242 Es showed a highly asymmetric mass distribution with an average pre-neutron emission total kinetic energy (TKE) of 183 ± 18 MeV. The probability of delayed fission (P DF ) was measured to be 0.006 ± 0.002. In conjunction with this experiment, the excitation functions of the 233 U( 14 N,xn) 247-x Es and 233 U( 15 N,xn) 248-x Es reactions were measured for 243 Es, 244 Es and 245 Es at projectile energies between 80 MeV and 100 MeV

Experimental investigation of particle-hole excitations in 91Nb

International Nuclear Information System (INIS)

Singh, Purnima; Palit, R.; Choudhury, D.

2014-01-01

Investigation of high-spin states in nuclei near N = 50 shell closure have attracted considerable attention in recent years. These nuclei provide a suitable laboratory for testing the residual interactions of the spherical shell model. Studies of N = 50, Z ∼ 40 nuclei, revealed that the low-lying states in these nuclei arise from proton excitations within the f 5/2 , p 3/2 , p 1/2 , and g 9/2 orbits. The higher angular momentum states were observed to have dominant contribution of 1p - 1h configurations involving a single g 9/2 neutron excitation across the N = 50 shell gap into the d 5/2 orbit. A comprehensive study of multiparticle-multihole (mp-mh) excitations in these nuclei may provide necessary insight into the evolution of shell structure above N = 50 shell gap. However, till date there is no experimental evidence of states involving two or more neutron excitations across the N = 50 shell gap in N = 50, Z ∼ 40 nuclei. The present work investigates high-spin states in the N = 50 nucleus, 91 Nb, with the purpose to search for states involving 2p - 2h excitations across the N = 50 shell closure

Structure of the unbound nucleus 13Be: One-neutron knockout reaction data from 14Be analyzed in a holistic approach

DEFF Research Database (Denmark)

Aksyutina, Yu; Aumann, T.; Boretzky, K.

2013-01-01

At the ALADIN-LAND setup at GSI the unbound nucleus 13Be has been produced in one-neutron knockout reactions from a 304 MeV/nucleon relativistic beam of 14Be ions impinging on a liquid hydrogen target. An analysis of the data including all available information about 13Be, and in particular recen...

Triaxiality and the wobbling mode In 167Lu

International Nuclear Information System (INIS)

Amro, H.; Ma, W.C.; Winger, J.A.; Li, Y.; Thompson, J.; Hagemann, G.; Herskind, B.; Sletten, G.; Wilson, J.N.; Jensen, D.R.; Fallon, P.; Ward, D.; Diamond, R.M.; Goergen, A.; Machiavelli, A.; Huebel, H.; Domscheit, J.; Wiedenhoewer, I.

2002-01-01

High spin states in 167Lu nucleus were populated through the 123Sb(48Ca,xn) reaction at 203 MeV. Five presumably triaxial superdeformed (TSD) bands have been found. The electromagnetic properties of several connecting transitions between the yrast (TSD1) and the excited (TSD2) bands have been established. Evidence for the assignment of TSD2 band as a wobbling mode built on the yrast TSD band is presented. These bands coexist with bands built on quasiparticle excitations in normal deformed (ND) minimum for which new data are also presented

Laserspectroscopic studies of collective properties of neutron deficient Ba nuclei

International Nuclear Information System (INIS)

Bekk, K.; Andl, A.; Goering, S.; Hanser, A.; Nowicki, G.; Rebel, H.; Schatz, G.

1979-01-01

Isotope shifts and hyperfine structure of the BaI resonance-line (lambda=553.6 nm) have been measured by dye laser induced resonance fluorescence on an atomic beam for sup(135m,129g,129m,126) Ba thus extending previous high resolution measurements of neutron deficient Ba nuclides (N - isomers sup(135m) Ba and sup(135m) Ba show a decreased staggering. Conspicuously the isomer shift of the g 7/2 + isomer sup(129m) Ba proves to be negative. The nuclear structure information is discussed in the context of gamma-spectroscopic studies of transitional nuclei with 50 [de

Further studies of neutron-deficient Sn-isotopes using REX-ISOLDE

CERN Multimedia

Larsen, A; Syed naeemul, H; Siem, S

2007-01-01

Encouraged by the committee to submit the latter part of our latest addendum to experiment IS418 under a new heading this proposal focuses on the second physics case mentioned there. We propose to use Coulomb excitation of odd mass neutron-deficient Sn isotopes to study some dominantly "one quasi-particle" states in these nuclei. Due to spin selection rules these states are difficult to populate following either $\\beta$-decay or in a cascade after a fusion-evaporation reactions, whereas the excitation from the ground-state is of E2 character for some of the most interesting cases.

New neutron-deficient isotopes of barium and rare-earth elements

CERN Document Server

Bogdanov, D D; Karnaukhov, V A; Petrov, L A; Plochocki, A; Subbotin, V G; Voboril, J

1976-01-01

The authors present an investigation of the short-lived neutron- deficient isotopes of barium and rare-earth elements. By using the BEMS-2 isotope separator on a heavy ion beam, 19 new isotopes were produced with mass numbers ranging from 117 to 138. Five of these (/sup 117/Ba, /sup 129,131/Nd and /sup 133,135/Sm) turned out to be delayed proton emitters. The beta -decay probabilities for the new isotopes have been analyzed in terms of the beta -strength function. An analysis of the proton spectrum shape has been performed using the statistical model for delayed proton emission.

Fast neutron radiation induced Glu-B1 deficient lines of an elite bread wheat variety

Science.gov (United States)

Five isogenic wheat lines deficient in high-molecular weight subunit (HMW-GS) proteins encoded by the B-genome were identified from a fast-neutron radiation-mutagenized population of Summit, an elite variety of bread wheat (Triticum aestivum L.). The mutant lines differ from the wild-type progenit...

The unusual high-spin isomer in 182Os and the proton-neutron interaction in high-j orbitals

International Nuclear Information System (INIS)

Tajima, Naoki; Onishi, Naoki

1986-01-01

An intermediate-coupling model of particle-plus-γ-soft-rotor is applied to a qualitative interpretation of the recently observed isomer of 182 Os and the characteristic decay pattern. In the model h 11/2 protons and i 13/2 neutrons are incorporated at the same time. The isomer is realized as the bandhead of a two-proton - two-neutron-aligned band from the present calculation. (orig.)

Collinear laser spectroscopy on radioactive neutron-deficient lead and thallium isotopes

International Nuclear Information System (INIS)

Menges, R.

1989-02-01

The systematic study of the isotope shift in the neighbourhood of the closed shells was extended in this thesis to Z = 82. The elements lead and thallium were measured up to the mass 190 and 188 and the nuclear moments determined together with the change of the mean square charge radius. The accumulating of the recoil nuclei formed by heavy ion reactions in the bunched ion source of the GSI mass separator could be used in order to study the low-spin isomers with I = 2 of the neutron-deficient thallium isotopes up to A = 190. It is a clearly recognizable isomer shift against the I = 7 isomers shown which changes at A = 194 the sign. A phenomenon which also exists in the element mercury, but for which no sufficient explanation exists. The magnetic moments of the thallium isotopes complete the analysis of Ekstroem (1976) and confirm the choice of the sign of the magnetic moments of the I = 2 isomers. The application of the additivity rule to the odd-odd nuclei shows qualitatively good agreement with the experiment and confirms so the assignment of the configuration of the contributing nuclear states. The quadrupole moments show a slight oblate deformation of the 9/2 - intruder states. The moments of the lead isotopes show pronounced one-particle character and by this the nearly spherical shape of nuclei with closed proton shell. The deviation from the linear slope of the mean square radius of the lead isotopes onsetting at A = 194 cannot be explained by the mixing of the 0 1 + ground state with the deformed 0 2 + intruder state. The odd - even staggering and the buckling of the charge radii at the shell closure are very well reproduced by Hartree-Fock calculations which regard the 3- and 4-particle interactions in the nucleus. (orig.) [de

Probing shape coexistence in neutron-deficient $^{72}$Se via low-energy Coulomb excitation

CERN Multimedia

We propose to study the evolution of nuclear structure in neutron-­deficient $^{72}$Se by performing a low-­energy Coulomb excitation measurement. Matrix elements will be determined for low-­lying excited states allowing for a full comparison with theoretical predictions. Furthermore, the intrinsic shape of the ground state, and the second 0$^{+}$ state, will be investigated using the quadrupole sum rules method.

Orientation of nuclei excited by polarized neutrons

International Nuclear Information System (INIS)

Lifshits, E.P.

1986-01-01

Polarization and radiation angular distribution of oriented nuclei in inelastic scattering of polarized neutrons were investigated. Nucleus orientation in the final state was described by polarization density matrix (PDM). If PDM is known, angular distributions, linear and circular polarization of γ-quanta emitted by a nucleus can be determined. Analytical expression for PDM, conditions of its diagonalization in the case of direct nucleus excitation and excitation by the stage of compound nucleus were obtained. Orientation of 12 C nuclei in the excited state 4.439 MeV, 2 + at energy of incident neutrons in the laboratory system from 4.8 MeV (excitation threshold) upt to 9 MeV was calculated as an example. Neutrons in initial state are completely polarized along Z axis. Calculations showed that excitation proceeds mainly by the stage of compound nucleus formation and 12 C nucleus is highly polarized in excited state

Experimental investigation of decay properties of neutron deficient $^{116-118}$Ba isotopes and test of $^{112-115}$Ba beam counts

CERN Multimedia

We propose to study decay of neutron deficient isotopes $^{116-118}$Ba using Double Sided Silicon Strip Detector (DSSSD). To study delayed-proton and $\\alpha$-decay branching ratios of $^{116-118}$Ba are of special interest because of their vicinity to the proton drip line. The nuclear life-times and properties of the proton unstable states of Cs isotopes, populated through decay of $^{116-118}$Ba isotopes will be measured. In addition to that we propose beam development of $^{112-115}$Ba to study exotic decay properties of these neutron deficient nuclei and to search for super-allowed $\\alpha$-decay in future.

Single nucleon emission in relativistic nucleus-nucleus reactions

International Nuclear Information System (INIS)

Anon.

1992-01-01

Significant discrepancies between theory and experiment have previously been noted for nucleon emission via electromagnetic processes in relativistic nucleus-nucleus collisions. The present work investigates the hypothesis that these discrepancies have arisen due to uncertainties about how to deduce the experimental electromagnetic cross section from the total measured cross section. An optical-model calculation of single neutron removal is added to electromagnetic cross sections and compared to the total experimental cross sections. Good agreement is found thereby resolving some of the earlier noted discrepancies. A detailed comparison to the recent work of Benesh, Cook, and Vary is made for both the impact parameter and the nuclear cross section. Good agreement is obtained giving an independent confirmation of the parameterized formulas developed by those authors

Shape transition and coexistence in neutron-deficient rare earth isotopes

CERN Multimedia

We propose to study spectroscopic quadrupole moments of excited states and electromagnetic transition rates between them in the neutron-deficient rare earth nuclei $^{140}$Sm and $^{142}$Gd using projectile Coulomb excitation at energies of 4.7 MeV per nucleon. The rare earth nuclei below the N=82 shell closure form one of the few regions of the nuclear chart where oblate shapes are expected to occur near the ground state. Nuclear shapes are expected to change rapidly in this region, with coexistence of oblate and prolate shapes in some nuclei. The measurement of electromagnetic matrix elements represents therefore a particularly sensitive test of theoretical nuclear structure models.

A neutron beam polarizer for study of parity violation in neutron-nucleus interactions

International Nuclear Information System (INIS)

Penttilae, S.I.; Bowman, J.D.; Frankle, C.M.; Seestrom, S.J.; Yen, Yi-Fen; Delheij, P.P.J.; Haase, D.G.; Postma, H.

1994-01-01

A dynamically-polarized proton target operating at 5 Tesla and 1 K has been built to, neutron beam for studies of parity violation in compound-nuclear resonances. Nearly 0.9 proton polarization was obtained in an electron-beam irradiated ammonia target. This was used to produce a neutron beam polarization of 0.7 at epithermal energies. The combination of the polarized proton target and the LANSCE spallation neutron source produces the most intense pulsed polarized epithermal neutron beam in the world. The neutron-beam polarizer is described and methods to determine neutron beam polarization are presented

Coherent and semi-coherent neutron transfer reactions

International Nuclear Information System (INIS)

Hagelstein, P.L.

1992-01-01

Neutron transfer reactions are proposed to account for anomalies reported in Pons-Fleischmann experiments. The prototypical reaction involves the transfer of a neutron (mediated by low frequency electric or magnetic fields) from a donor nucleus to virtual continuum states, followed by the capture of the virtual neutron by an acceptor nucleus. In this work we summarize basic principles, recent results and the ultimate goals of the theoretical effort

Coherent and semi-coherent neutron transfer reactions

International Nuclear Information System (INIS)

Hagelstein, P.L.

1993-01-01

Neutron transfer reactions are proposed to account for anomalies reported in Pons-Fleischmann experiments. The prototypical reaction involves the transfer of a neutron (mediated by low frequency electric or magnetic fields) from a donor nucleus to virtual continuum states, followed by the capture of the virtual neutron by an acceptor nucleus. In this work we summarize basic principles, recent results and the ultimate goals of the theoretical effort. (author)

Multi-quasiparticle excitation: Extending shape coexistence in A∼190 neutron-deficient nuclei

International Nuclear Information System (INIS)

Shi Yue; Liu, H. L.; Xu, F. R.; Walker, P. M.

2010-01-01

Multi-quasiparticle high-K states in neutron-deficient mercury, lead, and polonium isotopes have been investigated systematically by means of configuration-constrained potential-energy-surface calculations. An abundance of high-K states is predicted with both prolate and oblate shapes, which extends the shape coexistence of the mass region. Well-deformed shapes provide good conditions for the formation of isomers, as exemplified in 188 Pb. Of particular interest is the prediction of low-lying 10 - states in polonium isotopes, which indicate long-lived isomers.

A neutron beam polarizer for study of parity violation in neutron-nucleus interactions

International Nuclear Information System (INIS)

Penttilae, S.I.; Bowman, J.D.; Delheij, P.P.; Frankle, C.M.; Haase, D.G.; Postma, H.; Seestrom, S.J.; Yen, Y.

1995-01-01

A dynamically-polarized proton target operating at 5 Tesla and 1 K has been built to polarize an epithermal neutron beam for studies of parity violation in compound-nuclear resonances. Nearly 0.9 proton polarization was obtained in an electron-beam irradiated ammonia target. This was used to produce a neutron beam polarization of 0.7 at epithermal energies. The combination of the polarized proton target and the LANSCE spallation neutron source produces the most intense pulsed polarized epithermal neutron beam in the world. The neutron-beam polarizer is described and methods to determine neutron beam polarization are presented. copyright 1995 American Institute of Physics

Study of proton and 2 protons emission from light neutron deficient nuclei around A=20

International Nuclear Information System (INIS)

Zerguerras, T.

2001-09-01

Proton and two proton emission from light neutron deficient nuclei around A=20 have been studied. A radioactive beam of 18 Ne, 17 F and 20 Mg, produced at the Grand Accelerateur National d'Ions Lourds by fragmentation of a 24 Mg primary beam at 95 MeV/A, bombarded a 9 Be target to form unbound states. Proton(s) and nuclei from the decay were detected respectively in the MUST array and the SPEG spectrometer. From energy and angle measurements, the invariant mass of the decaying nucleus could be reconstructed. Double coincidence events between a proton and 17 F, 16 O, 15 O, 14 O and 18 Ne were registered to obtain excitation energy spectra of 18 Ne, 17 F, 16 F, 15 F et 19 Na. Generally, the masses measures are in agreement with previous experiments. In the case of 18 Ne, excitation energy and angular distributions agree well with the predictions of a break up model calculation. From 17 Ne proton coincidences, a first experimental measurement of the ground state mass excess of 18 Na has been obtained and yields 24,19(0,15)MeV. Two proton emission from 17 Ne and 18 Ne excited states and the 19 Mg ground state was studied through triple coincidences between two proton and 15 O, 16 O and 17 Ne respectively. In the first case, the proton-proton relative angle distribution in the center of mass has been compared with model calculation. Sequential emission from excited states of 17 Ne, above the proton emission threshold, through 16 F is dominant but a 2 He decay channel could not be excluded. No 2 He emission from the 1.288 MeV 17 Ne state, or from the 6.15 MeV 18 Ne state has been observed. Only one coincidence event between 17 Ne and two proton was registered, the value of the one neutron stripping reaction cross section of 20 Mg being much lower than predicted. (author)

Semi classical model of the neutron resonance compound nucleus

International Nuclear Information System (INIS)

Ohkubo, Makio

1995-01-01

A Semi-classical model of compound nucleus is developed, where time evolution and recurrence for many degrees of freedom (oscillators) excited simultaneously are explicitly considered. The effective number of oscillators plays the role in the compound nucleus, and the nuclear temperatures are derived, which are in good agreement with the traditional values. Time structures of the compound nucleus at resonance are considered, from which equidistant level series with an envelope of strength function of giant resonance nature is obtained. S-matrix formulation for fine structure resonance is derived. (author)

Local magnetic structure determination using polarized neutron holography

International Nuclear Information System (INIS)

Szakál, Alex; Markó, Márton; Cser, László

2015-01-01

A unique and important property of the neutron is that it possesses magnetic moment. This property is widely used for determination of magnetic structure of crystalline samples observing the magnetic components of the diffraction peaks. Investigations of diffraction patterns give information only about the averaged structure of a crystal but for discovering of local spin arrangement around a specific (e.g., impurity) nucleus remains still a challenging problem. Neutron holography is a useful tool to investigate the local structure around a specific nucleus embedded in a crystal lattice. The method has been successfully applied experimentally in several cases using non-magnetic short range interaction of the neutron and the nucleus. A mathematical model of the hologram using interaction between magnetic moment of the atom and the neutron spin for polarized neutron holography is provided. Validity of a polarized neutron holographic experiment is demonstrated by applying the proposed method on model systems

New aspects of the atomic nucleus

International Nuclear Information System (INIS)

Wilkinson, D.H.

1987-01-01

We are at last just beginning to identify convincing evidence for what we have long believed, namely that the nucleus is more than the sum of its neutron-proton parts taken pairwise because, for example, a cluster of three nucleons interacts differently from the sum of the interactions of its three pairs; there is an important collectivism in the life of a nucleus even before we ask what its nucleons are doing. (orig./WL)

Electron-capture delayed fission properties of neutron-deficient einsteinium nuclei

Energy Technology Data Exchange (ETDEWEB)

Shaughnessy, Dawn A. [Univ. of California, Berkeley, CA (United States)

2000-01-01

Electron-capture delayed fission (ECDF) properties of neutron-deficient einsteinium isotopes were investigated using a combination of chemical separations and on-line radiation detection methods. ²⁴²Es was produced via the ²³³U(¹⁴N,5n)²⁴²Es reaction at a beam energy of 87 MeV (on target) in the lab system, and was found to decay with a half-life of 11 ± 3 seconds. The ECDF of ²⁴²Es showed a highly asymmetric mass distribution with an average pre-neutron emission total kinetic energy (TKE) of 183 ± 18 MeV. The probability of delayed fission (P_DF) was measured to be 0.006 ± 0.002. In conjunction with this experiment, the excitation functions of the ²³³U(¹⁴N,xn)^247-xEs and ²³³U^{(15N,xn)248-x}Es reactions were measured for ²⁴³Es, ²⁴⁴Es and ²⁴⁵Es at projectile energies between 80 MeV and 100 MeV.

An effective potential for electron-nucleus scattering in neutrino-pair bremsstrahlung in neutron star crust

International Nuclear Information System (INIS)

Ofengeim, D D; Kaminker, A D; Yakovlev, D G

2015-01-01

We derive an analytic approximation for the emissivity of neutrino-pair bremsstrahlung (NPB) due to scattering of electrons by atomic nuclei in a neutron star (NS) crust of any realistic composition. The emissivity is expressed through generalized Coulomb logarithm by introducing an effective potential of electron-nucleus scattering. In addition, we study the conditions at which NPB in the crust is affected by strong magnetic fields and outline the main effects of the fields on neutrino emission in NSs. The results can be used for modelling of many phenomena in NSs, such as cooling of young isolated NSs, thermal relaxation of accreting NSs with overheated crust in soft X-ray transients and evolution of magnetars. (paper)

Commissioning of a new photon detection system for charge radii measurements of neutron-deficient Ca

Science.gov (United States)

Watkins, J.; Garand, D.; Miller, A. J.; Minamisono, K.; Everett, N.; Powel, R. C.; Maaß, B.; Nörtershäuser, W.; Kalman, C.; Lantis, J.; Kujawa, C.; Mantica, P.

2017-09-01

Calcium is unique for its possession of two stable isotopes of ``doubly magic'' nuclei at proton and neutron numbers (Z , N) = (20 , 20) and (20 , 28) . Recent charge radii measurements of neutron-rich calcium isotopes yielded an upward trend beyond current theoretical predictions. At the BECOLA facility at NSCL/MSU, Ca charge radii measurements will be extended to the neutron-deficient regime using collinear laser spectroscopy. A new photon detection system with an ellipsoidal reflector and a compound parabolic concentrator has been commissioned for the experiment. The system increases the signal-to-noise ratio by reducing background, which is critical for the low production rates of the Ca experiment. Details of the system and results of the characterization tests will be discussed. Work supported in part by NSF Grant PHY-15-65546, U.S. DOE Grant DE-NA0002924 and by the Deutsche Forschungsgemeinschaft Grant SFB 1245.

{sup 91}Nb(p,γ) or there and back again

Energy Technology Data Exchange (ETDEWEB)

Thomas, Benedikt; Glorius, Jan; Reich, Markus; Reifarth, Rene; Sonnabend, Kerstin [Goethe University Frankfurt a.M. (Germany); Blazhev, Andrey; Zell, Karl-Oscar [University of Cologne (Germany); Dressler, Rugard; Schumann, Dorothea [Paul-Scherrer Institute, Villigen (Switzerland); Giesen, Ulrich [Physikalisch-Technische Bundesanstalt, Braunschweig (Germany); Kritcka, Milan [Charles University, Prague (Czech Republic)

2016-07-01

The cross section of the reaction {sup 91}Nb(p,γ){sup 92}Mo is of special interest to answer questions about the production of the most abundant p nucleus {sup 92}Mo. With {sup 91}Nb being a radioactive nucleus the measurement of this reaction in standard kinematics is a big challenge. To produce a sufficient number of {sup 91}Nb isotopes an enriched {sup 92}Mo target was activated by protons at E{sub p} = 19 MeV. Afterwards the produced {sup 91}Nb isotopes are separated chemically and applied onto a tungsten backing. This leads to approximately 10{sup 16} {sup 91}Nb isotopes. The high proton current delivered by the HF-linear-accelerator FRANZ currently built at Goethe University Frankfurt, Germany, enables the execution of measurement with such limited amount of target material. The goal of our investigation is the determination of the cross section of the {sup 91}Nb(p,γ){sup 92}Mo reaction at 2 MeV proton energy and thereby in the astrophysical relevant energy region. We present the current status and the next steps towards the measurement of this cross section.

Experimental Neutron Capture Rate Constraint Far from Stability.

Science.gov (United States)

Liddick, S N; Spyrou, A; Crider, B P; Naqvi, F; Larsen, A C; Guttormsen, M; Mumpower, M; Surman, R; Perdikakis, G; Bleuel, D L; Couture, A; Crespo Campo, L; Dombos, A C; Lewis, R; Mosby, S; Nikas, S; Prokop, C J; Renstrom, T; Rubio, B; Siem, S; Quinn, S J

2016-06-17

Nuclear reactions where an exotic nucleus captures a neutron are critical for a wide variety of applications, from energy production and national security, to astrophysical processes, and nucleosynthesis. Neutron capture rates are well constrained near stable isotopes where experimental data are available; however, moving far from the valley of stability, uncertainties grow by orders of magnitude. This is due to the complete lack of experimental constraints, as the direct measurement of a neutron-capture reaction on a short-lived nucleus is extremely challenging. Here, we report on the first experimental extraction of a neutron capture reaction rate on ^{69}Ni, a nucleus that is five neutrons away from the last stable isotope of Ni. The implications of this measurement on nucleosynthesis around mass 70 are discussed, and the impact of similar future measurements on the understanding of the origin of the heavy elements in the cosmos is presented.

Nuclear physics: Unexpected doubly-magic nucleus

International Nuclear Information System (INIS)

Janssens, R.V.F.

2009-01-01

Nuclei with a 'magic' number of both protons and neutrons, dubbed doubly magic, are particularly stable. The oxygen isotope 24 O has been found to be one such nucleus - yet it lies just at the limit of stability

91Mo and 89Nb high-spin states

International Nuclear Information System (INIS)

Baktybaev, K.; Kojlyk, N.; Ramankulov, K.E.

2003-01-01

In the work the shell-model calculation for 91 Mo and 89 Nb nuclei high-spin states with several valente nucleons is worked out. The nucleons have been arranged in the {2p 1/2 1g 9 / 2 } configurations above the 88 Sr twice magic frame. Using of formalism of generalized quasi-spin with H=H 0 +H pp +H nn +H pn Hamiltonian in which H pp , H nn , H pn the residual nucleon interactions have being written through generalized quasi-spin operators. The obtained scheme well reproduces experimental data for examined nuclei up to 31/2 + , 33/2 - levels with seniority ν=3.5. Similarity of the spectroscopic structures of the nucleus levels with different protons and neutrons numbers above inert frame shows independence of nucleon-nucleon interactions from isotope spins of particles. There are analogous comparison of some negative yrast bands parity levels. The theory well transmits intensity values for electromagnet transitions between states. Besides the observed nuclei's properties does not give any indication on presence of valent nucleons collective motion in the both nuclei

β Decay in the Region of Neutron-deficient {sup 69,70,71}Kr

Energy Technology Data Exchange (ETDEWEB)

Rogers, A.M., E-mail: ARogers@lbl.gov [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Lawrence Berkeley National Laboratory, Berkeley, CA, 94720 (United States); Giovinazzo, J. [Centre d' Etudes Nucléaires de Bordeaux-Gradignan, Université Bordeaux 1, UMR 5797 CNRS/IN2P3, Chemin du Solarium, BP 120, F-33175, Gardignan Cedex (France); Lister, C.J. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Blank, B.; Canchel, G. [Centre d' Etudes Nucléaires de Bordeaux-Gradignan, Université Bordeaux 1, UMR 5797 CNRS/IN2P3, Chemin du Solarium, BP 120, F-33175, Gardignan Cedex (France); Clark, J.A. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); France, G. de; Grévy, S. [GANIL CEA/DSM-CNRS/IN2P3, Boulevard Henri Becquerel, BP55027, 14076 CEAN Cedex 5 (France); Gros, S.; McCutchan, E.A. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Oliveira Santos, F. de [GANIL CEA/DSM-CNRS/IN2P3, Boulevard Henri Becquerel, BP55027, 14076 CEAN Cedex 5 (France); Savard, G.; Seweryniak, D. [Physics Division, Argonne National Laboratory, Argonne, IL 60439 (United States); Stefan, I.; Thomas, J.-C. [GANIL CEA/DSM-CNRS/IN2P3, Boulevard Henri Becquerel, BP55027, 14076 CEAN Cedex 5 (France)

2014-06-15

Decay spectroscopy was performed for neutron-deficient nuclei ranging from zinc to krypton with isospin −3/2 ≤T{sub z}≤0. Measurements of correlated β-delayed protons allowed us to determine the isobaric analog states fed from the decay of {sup 65}Se and {sup 69}Kr, constraining the spin of the {sup 69}Kr ground state. Preliminary results regarding the half lives for the T{sub z}=−1 systems, relevant to the rapid proton capture (rp) process, are discussed.

Structure of neutron-rich nuclei

International Nuclear Information System (INIS)

Nazarewicz, W.

2000-01-01

Complete text of publication follows. The uncharted regions of the (N,Z) plane contain information that can answer many questions of fundamental importance for science: How many protons and neutrons can be clustered together by the strong interaction to form a bound nucleus? What are the proton and neutron magic numbers of the exotic nuclei? What are the properties of very short-lived exotic nuclei with extreme neutron-to-proton ratios? What is the effective nucleon-nucleon interaction in a nucleus that has a very large neutron excess? Nuclear life far from stability is different from that around the stability line; the promised access to completely new combinations of proton and neutron numbers offers prospects for new structural phenomena. The main objective of this talk is to discuss some of the challenges and opportunities of research with exotic nuclei. The covered topics will include: Theoretical challenges; Skins and halos in heavy nuclei; Shape coexistence in exotic nuclei; Beta-decays of neutron-rich nuclei. (author)

Spectroscopy of light neutron deficient nuclei: 31Ar and 27S decays

International Nuclear Information System (INIS)

Borrel, V.

1991-01-01

Light neutron-deficient nuclei exhibit several interesting decay modes. In some cases, beta-delayed alpha emission becomes possible, and beta-delayed three-proton emission can be allowed. The energy spectra of the emitted protons should give informations on the position of the isobaric analog state and on its deexcitation modes. Experimental results obtained at GANIL with the LISE spectrometer on the decay of the isotopes 31 Ar and 27 S are presented. These data are discussed and compared with the predicted isobaric analog state excitation energies and with shell-model calculations. (G.P.) 13 refs.; 7 figs.; 1 tab

O impacto da deficiência nos irmãos: histórias de vida Impact of disability in siblings: life stories

Directory of Open Access Journals (Sweden)

Alcione Aparecida Messa

2010-03-01

Full Text Available Quando uma criança nasce com deficiência, a expectativa da família necessita ser revista, pois se trata de uma situação inesperada, exigindo o ajuste às mudanças de planos. Devido ao significado do relacionamento fraterno, mudanças na saúde e no funcionamento de um irmão irão afetar os outros. As relações com um irmão deficiente dependerão das características da deficiência, além do significado compartilhado na família. O objetivo desta pesquisa foi analisar as repercussões da deficiência para os irmãos, investigando os sentimentos e reações que permeiam as vivências desses indivíduos. Realizouse um grupo de discussão. Os resultados apontaram que cada indivíduo dá significado a vivência com um irmão deficiente segundo seus recursos e história de vida. Os irmãos apresentaram sentimentos negativos como raiva, vergonha e culpa e também ganhos como maturidade, independência e altruísmo. Pode-se concluir que o impacto da deficiência nos irmãos compreende vivências negativas e positivas e que, portanto, deve ser considerado segundo uma rede de influências e peculiaridades intrínsecas das relações familiares. Evidencia-se a necessidade de que esses irmãos sejam assistidos de forma adequada, visando à ampliação dos recursos disponíveis.When a disabled child is born all the family's expectations need to be reviewed because it is an unexpected situation and needs the family system to be adjusted to the new situation. Due to the meaning that sibling relations acquire during lifetime, changes in health and functioning of a sibling will affect the others. Relations with a disabled sibling will depend on features of disability as well as its meaning shared by the family. The aim of this research was to analyze the manifestation of disability for siblings of disabled people, investigating feelings and reactions that pervade their experiences. A discussion group of siblings was created. Results indicated that each

Neutron resonance spectroscopy

International Nuclear Information System (INIS)

Gunsing, F.

2005-06-01

The present document has been written in order to obtain the diploma 'Habilitation a Diriger des Recherches'. Since this diploma is indispensable to supervise thesis students, I had the intention to write a document that can be useful for someone starting in the field of neutron resonance spectroscopy. Although the here described topics are already described elsewhere, and often in more detail, it seemed useful to have most of the relevant information in a single document. A general introduction places the topic of neutron-nucleus interaction in a nuclear physics context. The large variations of several orders of magnitude in neutron-induced reaction cross sections are explained in terms of nuclear level excitations. The random character of the resonances make nuclear model calculation predictions impossible. Then several fields in physics where neutron-induced reactions are important and to which I have contributed in some way or another, are mentioned in a first synthetic chapter. They concern topics like parity nonconservation in certain neutron resonances, stellar nucleosynthesis by neutron capture, and data for nuclear energy applications. The latter item is especially important for the transmutation of nuclear waste and for alternative fuel cycles. Nuclear data libraries are also briefly mentioned. A second chapter details the R-matrix theory. This formalism is the foundation of the description of the neutron-nucleus interaction and is present in all fields of neutron resonance spectroscopy. (author)

Thermal Neutron Capture and Thermal Neutron Burn-up of K isomeric state of 177mLu: a way to the Neutron Super-Elastic Scattering cross section

International Nuclear Information System (INIS)

Roig, O.; Belier, G.; Meot, V.; Daugas, J.-M.; Romain, P.; Aupiais, J.; Jutier, Ch.; Le Petit, G.; Letourneau, A.; Marie, F.; Veyssiere, Ch.

2006-01-01

Thermal neutron radiative capture and burn-up measurements of the K isomeric state in 177Lu form part of an original method to indirectly obtain the neutron super-elastic scattering cross section at thermal energy. Neutron super-elastic scattering, also called neutron inelastic acceleration, occurs during the neutron collisions with an excited nuclear level. In this reaction, the nucleus could partly transfer its excitation energy to the scattered neutron

Measurements of competing structures in neutron-deficient Pb isotopes by employing Coulomb excitation

CERN Multimedia

Bastin, B; Kruecken, R; Larsen, A; Rahkila, P J; Srebrny, J; Clement, E; Wadsworth, R; Syed naeemul, H; Peura, P J; Siem, S; Hadynska-klek, K; Habs, D; Napiorkowski, P J; Diriken, J V J; Iwanicki, J S

Coulomb excitation measurements to study the shape coexistence and quadrupole collectivity of the low-lying levels in neutron-deficient Pb nuclei are proposed. Even-mass $^{188−192}$Pb nuclei will be post-accelerated at REX-ISOLDE in order to measure transition probabilities and quadrupole moments for the first excited states. In combination with results obtained in lifetime measurements, this will allow the sign of the quadrupole deformation parameter to be extracted for the first time for 2$^{+}$ states in the even-mass $^{188−192}$Pb nuclei.

The 93.54 keV level in {sup 91}Sr, and Evidence for 3-neutron States Above N=50

Energy Technology Data Exchange (ETDEWEB)

Malmskog, S G; McDonald, J

1970-01-15

An intense transition of 93.54 keV is seen in the decay of {sup 91}Rb ( T{sub 1/2} = 58.2 sec), and is assigned to a level at this energy in {sup 91}Sr. The level energy is accurately measured with a Ge(Li) detector. The half-life of the level is found by direct timing to be (88 {+-} 3) ns. Measurement of the conversion electron spectrum with a long lens spectrometer has enabled the E2/M1 ratio to be deduced. The nature of the ground and excited states of N 53 nuclei is discussed in terms of configurations of 2d{sub 5/2} neutrons, and compared with the behaviour of the N = 55 and 57 ruthenium nuclei.

Shape coexistence in the N=19 neutron-rich nucleus 31Mg explored by β–γ spectroscopy of spin-polarized 31Na

Directory of Open Access Journals (Sweden)

H. Nishibata

2017-04-01

Full Text Available The structure of excited states in the neutron-rich nucleus 31Mg, which is in the region of the “island of inversion” associated with the neutron magic number N=20, is studied by β–γ spectroscopy of spin-polarized 31Na. Among the 31Mg levels below the one neutron separation energy of 2.3 MeV, the spin values of all five positive-parity levels are unambiguously determined by observing the anisotropic β decay. Two rotational bands with Kπ=1/2+ and 1/2− are proposed based on the spins and energies of the levels. Comparison on a level-by-level basis is performed between the experimental results and theoretical calculations by the antisymmetrized molecular dynamics (AMD plus generator coordinate method (GCM. It is found that various nuclear structures coexist in the low excitation energy region in 31Mg.

AcEST: DK955512 [AcEST

Lifescience Database Archive (English)

Full Text Available AT4 PE=2 SV=1 332 6e-91 sp|P49317|CATA3_NICPL Catalase isozyme 3 OS=Nicotiana plumbagini... 332 6e-91 sp|O24339|CATA_SOLAP...121 GFAVKFYTREGNFDLVGNNFPVFFVRDGMKFPDMVHALKPNPKSHIQ 167 >sp|O24339|CATA_SOLAP Catalase OS=Soldanella alpina

Properties of thermal neutron scattering on the nucleus of hydrogen atom of methane molecule; Osobine rasejanja termalnih neutrona na jezgru vodonikovog atoma molekula metana

Energy Technology Data Exchange (ETDEWEB)

Miloradovic, M M [Tehnicki fakultet, Cacak (Yugoslavia); Markovic, M I [Elektrotehnicki fakultet, Beograd (Yugoslavia)

1987-07-01

On the basis of derived quantum-mechanical expression for the microscopic nucleus scattering the single and collective influences of translational, rotational and intravibrational motions of the methane molecule on the thermal neutron scattering are established. When incident neutron energy is E{sub 0} {<=} 0.1 eV, it is found that only translational and rotational motion of the methane molecule influences the thermal neutron scattering. The influence of these motions for E{sub 0} . 0.1 eV decreases rapidly with the increase of the incident neutron energy and then the significant influence on the thermal neutron scattering exerts inelastic scattering on the combined rotational with single intravibrational phonons of the methane molecule, while the inelastic scattering on single intravibrational phonons is significantly less. In the combination with rotational phonons the biggest influence has threefold degenerated deformed intravibrational phonons, somehow less influence has twofold degenerated deformed intravibrational phonons, and the least influence has valent intravibrational phonons. All the effects of quasielastic and quantum inelastic scattering are clearly expressed with the thermal neutron scattering at small angles, so that for E{sub 0} =1 eV practically there is no scattering backward. (author)

Prompt fission neutron spectra and average prompt neutron multiplicities

International Nuclear Information System (INIS)

Madland, D.G.; Nix, J.R.

1983-01-01

We present a new method for calculating the prompt fission neutron spectrum N(E) and average prompt neutron multiplicity anti nu/sub p/ as functions of the fissioning nucleus and its excitation energy. The method is based on standard nuclear evaporation theory and takes into account (1) the motion of the fission fragments, (2) the distribution of fission-fragment residual nuclear temperature, (3) the energy dependence of the cross section sigma/sub c/ for the inverse process of compound-nucleus formation, and (4) the possibility of multiple-chance fission. We use a triangular distribution in residual nuclear temperature based on the Fermi-gas model. This leads to closed expressions for N(E) and anti nu/sub p/ when sigma/sub c/ is assumed constant and readily computed quadratures when the energy dependence of sigma/sub c/ is determined from an optical model. Neutron spectra and average multiplicities calculated with an energy-dependent cross section agree well with experimental data for the neutron-induced fission of 235 U and the spontaneous fission of 252 Cf. For the latter case, there are some significant inconsistencies between the experimental spectra that need to be resolved. 29 references

Neutron resonance spectroscopy

Energy Technology Data Exchange (ETDEWEB)

Gunsing, F

2005-06-15

The present document has been written in order to obtain the diploma 'Habilitation a Diriger des Recherches'. Since this diploma is indispensable to supervise thesis students, I had the intention to write a document that can be useful for someone starting in the field of neutron resonance spectroscopy. Although the here described topics are already described elsewhere, and often in more detail, it seemed useful to have most of the relevant information in a single document. A general introduction places the topic of neutron-nucleus interaction in a nuclear physics context. The large variations of several orders of magnitude in neutron-induced reaction cross sections are explained in terms of nuclear level excitations. The random character of the resonances make nuclear model calculation predictions impossible. Then several fields in physics where neutron-induced reactions are important and to which I have contributed in some way or another, are mentioned in a first synthetic chapter. They concern topics like parity nonconservation in certain neutron resonances, stellar nucleosynthesis by neutron capture, and data for nuclear energy applications. The latter item is especially important for the transmutation of nuclear waste and for alternative fuel cycles. Nuclear data libraries are also briefly mentioned. A second chapter details the R-matrix theory. This formalism is the foundation of the description of the neutron-nucleus interaction and is present in all fields of neutron resonance spectroscopy. (author)

Spallation production of neutron deficient radioisotopes in North America

International Nuclear Information System (INIS)

Jamriska, D.J.; Peterson, E.J.; Carty, J.

1997-01-01

The US Department of Energy produces a number of neutron deficient radioisotopes by high energy proton induced spallation reactions in accelerators at Los Alamos National Laboratory in New Mexico and Brookhaven National Laboratory in New York. Research isotopes are also recovered from targets irradiated at TRIUMF in British Columbia, Canada. The radioisotopes recovered are distributed for use in nuclear medicine, environmental research, physics research, and industry worldwide. In addition to the main product line of Sr-82 from either Mo or Rb targets, Cu-67 from ZnO targets, and Ge-68 and RbBr targets, these irradiation facilities also produce some unique isotopes in quantities not available from any other source such as Al-26, Mg-28, Si-32, Ti-44, Fe-52, Gd-148, and Hg-194. The authors will describe the accelerator irradiation facilities at the Los Alamos and Brookhaven National Laboratories. The high level radiochemical processing facilities at Los Alamos and brief chemical processes will be described

Laser spectroscopy of neutron deficient gold and platinum isotopes

International Nuclear Information System (INIS)

Savard, G.

1988-03-01

A new method for on-line laser spectroscopy of radioactive atoms based on the resonant ionization spectroscopy of laser-desorbed radioactive samples has been devised. An experimental setup has been installed on-line at the ISOCELE mass separator in Orsay (France) and experiments have been performed on the region of transitional nuclei around Z=79. Isotopic shift measurements on four new isotopes 194 Au, 196 Au, 198 Au, 199 Au have been performed on gold and results on the neutron deficient isotopes down to 186 Au have been obtained confirming the nuclear ground-state shape transition from oblate to prolate between 187 Au and 186 Au. The first isotopic shift measurements on radioactive platinum isotopes have been obtained on 186 Pt, 188 Pt, 189 Pt. Indications of a shape transition have been observed between 186 Pt and 188 Pt. The extracted experimental changes in mean square charge radii δ 2 > A,A' along isotopic chains are compared to self-consistent Hartree-Fock plus BCS calculations

Meningitis neumocócica en niños menores de 15 años: Dieciséis años de vigilancia epidemiológica en Misiones, Argentina

Directory of Open Access Journals (Sweden)

Sandra L Grenón

Full Text Available Se presentan en este trabajo los resultados de 16 años de vigilancia epidemiológica de meningitis neumocócica llevada a cabo en el Hospital Provincial de Pediatría de Misiones (Argentina, antes de la introducción de la vacuna conjugada al calendario nacional. En el período que va de enero de 1994 a diciembre de 2009 se diagnosticaron 167 casos de meningitis por Streptococcus pneumoniae en niños (1 mes-15 años. La tasa de ataque cada 100 000 niños varió entre 19,2 (1997 y 4,3 (2009, con una media de 10,6 y una tendencia en disminución (y = ""0,689x + 16,52. Esto fue a expensas del grupo de niños entre 1 y 11 meses (94/167, 56 %, en el que disminuyó de 146,6 a 34,8 casos cada 100 000 niños. El 30,7 % de los aislamientos (46/150 fueron resistentes a penicilina y el 16,7 % (25/150 no sensibles a cefotaxima. La resistencia a β-lactámicos se incrementó a partir de 1997 y comenzó a disminuir en 2005. Se detectaron 19 serotipos, predominó el 14 (32 %; 40/125. El 84,8 % de los aislamientos quedaron circunscriptos a nueve serotipos: 14, 5, 1, 7F, 18C, 6B, 9N, 9V y 4. La cobertura teórica en los niños 2 años fue de 84,1 % (74/88 y 83,8 % (31/37 con la vacuna 10-valente, y de 89,8 % (79/88 y 83,8 % (31/37 con la vacuna 13-valente, respectivamente. La resistencia a penicilina estuvo circunscripta a 8 serotipos (14, 6B, 6A, 9V, 4, 23B, 1 y 19A, y la no sensibilidad a cefotaxima a 3 serotipos (14, 9V y 1, el más importante fue en ambos casos el serotipo 14. Este estudio permitirá evaluar el impacto de la implementación de las vacunas conjugadas en nuestra zona.

Study of oblate nuclear shapes and shape coexistence in neutron-deficient rare earth isotopes

CERN Multimedia

Guttormsen, M S; Reiter, P; Larsen, A; Korten, W; Clement, E; Siem, S; Renstrom, T; Buerger, A; Jenkins, D G

We propose to investigate nuclear shapes and shape coexistence in neutron-deficient rare earth nuclei below the N=82 shell closure at the ISOLDE facility by employing Coulomb excitation of Nd, Sm, Gd, and Dy beams from the REX accelerator and the Miniball experiment. Nuclear shapes are expected to change rapidly in this region of the nuclear chart. The measurement of electric quadrupole moments of excited states and the transition rates between them serves as a stringent test of theoretical models and effective nucleon-nucleon interactions.

Coulomb Excitation of Neutron Deficient Sn-Isotopes using REX-ISOLDE

CERN Multimedia

Di julio, D D; Kownacki, J M; Marechal, F; Andreoiu, C; Siem, S; Perrot, F; Van duppen, P L E; Napiorkowski, P J; Iwanicki, J S

2002-01-01

It is proposed to study the evolution of the reduced transition probabilities, B(E2; 0$^{+} \\rightarrow$ 2$^{+}$), for neutron deficient Sn isotopes by Coulomb excitation in inverse kinematics using REX-ISOLDE and the MINIBALL detector array. Measurements of the reduced transition matrix element for the transition between the ground state and the first excited 2$^{+}$ state in light even-even Sn isotopes provide a means to study e.g. core polarization effects in the $^{100}$Sn core. Previous attempts to measure this quantity have been carried out using the decay of isomeric states populated in fusion evaporation reactions. We thus propose to utilize the unique opportunity provided by REX-ISOLDE, after the energy upgrade to 3.1 MeV/u, to use the more model-independent approach of Coulomb excitation to measure this quantity in a number of isotopes in this region.

A constrained dispersive optical model for the neutron-nucleus interaction from -80 to +80 MeV for the mass region 27≤A≤32

International Nuclear Information System (INIS)

Al-Ohali, M.A.; Howell, C.R.; Tornow, W.; Walter, R.L.

1995-01-01

A Constrained Dispersive Optical Model (CDOM) analysis was performed for the neutron-nucleus interaction in the energy domain from -80 to 80 MeV for the three nuclei in the center of the 2s-1d shell nuclei. The CDOM incorporates the dispersion relation which connects the real and imaginary parts of the nuclear mean field. Parameters for the model were derived by fitting the neutron differential elastic cross-section, the total cross-section, and the analyzing power data for 27 Al, 28 Si, and 32 S. The parameters were also adjusted slightly to improve overall agreement to single-particle bound-state energies

Symmetry energy of the nucleus in the relativistic Thomas-Fermi approach with density-dependent parameters

Science.gov (United States)

Haddad, S.

2017-11-01

The symmetry energy of a nucleus is determined in a local density approximation and integrating over the entire density distribution of the nucleus, calculated utilizing the relativistic density-dependent Thomas-Fermi approach. The symmetry energy is found to decrease with increasing neutron excess in the nucleus. The isovector coupling channel reduces the symmetry energy, and this effect increases with increased neutron excess. The isovector coupling channel increases the symmetry energy integral in ^{40}Ca and reduces it in ^{48}Ca, and the interplay between the isovector and the isoscalar channels of the nuclear force explains this isotope effect.

Time reversal tests in polarized neutron reactions

International Nuclear Information System (INIS)

Asahi, Koichiro; Bowman, J.D.; Crawford, B.

1998-01-01

This is the final report of a three-year, Laboratory-Directed Research and Development (LDRD) project at the Los Alamos National Laboratory (LANL). In recent years the nuclear weak interaction has been studied in the compound nucleus via parity violation. The observed parity-violating effects are strongly enhanced by nuclear structure. The predictions are that the interaction of polarized neutrons with polarized nuclear targets could be also used to perform sensitive tests of time-reversal-violation because of the nuclear enhancements. The author has designed experiments to search for time-reversal violation in neutron-nucleus interactions. He has also developed techniques to polarize neutrons with laser-polarized 3 He gas targets. Using the polarized 3 He neutron spin filter, he has performed two experiments at LANSCE: an absolute neutron beam polarization measurement with an accuracy of 0.2--0.3% and a neutron spin-rotation measurement on a 139 La sample

Long-lived high-spin isomers in the neutron-deficient 1g sub(9/2)-shell nuclei

International Nuclear Information System (INIS)

Ogawa, K.

1981-09-01

The neutron-deficient 1g sub(9/2)-shell nuclei are studied in the framework of the shell model with active nucleons occuping the 1g sub(9/2) and 2p sub(1/2) shells. The calculated result for 95 Pd shows good agreement with the recent experiment by Nolte and Hick. Many ''spin-gap'' Isomers are predicted in the region of A = 76 -- 84 and A = 95 -- 100. (author)

Neutron spectometers

International Nuclear Information System (INIS)

Poortmans, F.

1977-01-01

Experimental work in the field of low-energy neutron physics can be subdivided into two classes: 1)Study of the decay process of the compound-nucleus state as for example the study of the capture gamma rays and of the neutron induced fission process; 2)Study of the reaction mechanism, mainly by measuring the reaction cross-sections and resonance parameters. These neutron cross-sections and resonance parameters are also important data required for many technological applications especially for reactor development programmes. In general, the second class of experiments impose other requirements on the neutron spectrometer than the first class. In most cases, a better neutron energy resolution and a broader neutron energy range are required for the study of the reaction mechanism than for the study of various aspects of the decay process. (author)

Study of proton and 2 protons emission from light neutron deficient nuclei around A=20; Etude de l'emission proton et de deux protons dans les noyaux legers deficients en neutrons de la region A=20

Energy Technology Data Exchange (ETDEWEB)

Zerguerras, T

2001-09-01

Proton and two proton emission from light neutron deficient nuclei around A=20 have been studied. A radioactive beam of {sup 18}Ne, {sup 17}F and {sup 20}Mg, produced at the Grand Accelerateur National d'Ions Lourds by fragmentation of a {sup 24}Mg primary beam at 95 MeV/A, bombarded a {sup 9}Be target to form unbound states. Proton(s) and nuclei from the decay were detected respectively in the MUST array and the SPEG spectrometer. From energy and angle measurements, the invariant mass of the decaying nucleus could be reconstructed. Double coincidence events between a proton and {sup 17}F, {sup 16}O, {sup 15}O, {sup 14}O and {sup 18}Ne were registered to obtain excitation energy spectra of {sup 18}Ne, {sup 17}F, {sup 16}F, {sup 15}F et {sup 19}Na. Generally, the masses measures are in agreement with previous experiments. In the case of {sup 18}Ne, excitation energy and angular distributions agree well with the predictions of a break up model calculation. From {sup 17}Ne proton coincidences, a first experimental measurement of the ground state mass excess of {sup 18}Na has been obtained and yields 24,19(0,15)MeV. Two proton emission from {sup 17}Ne and {sup 18}Ne excited states and the {sup 19}Mg ground state was studied through triple coincidences between two proton and {sup 15}O, {sup 16}O and {sup 17}Ne respectively. In the first case, the proton-proton relative angle distribution in the center of mass has been compared with model calculation. Sequential emission from excited states of {sup 17}Ne, above the proton emission threshold, through {sup 16}F is dominant but a {sup 2}He decay channel could not be excluded. No {sup 2}He emission from the 1.288 MeV {sup 17}Ne state, or from the 6.15 MeV {sup 18}Ne state has been observed. Only one coincidence event between {sup 17}Ne and two proton was registered, the value of the one neutron stripping reaction cross section of {sup 20}Mg being much lower than predicted. (author)

Projected shell model study of yrast states of neutron-deficient odd-mass Pr nuclei

International Nuclear Information System (INIS)

Ibanez-Sandoval, A.; Ortiz, M. E.; Velazquez, V.; Galindo-Uribarri, A.; Hess, P. O.; Sun, Y.

2011-01-01

A wide variety of modern instruments allow us to study neutron-deficient nuclei in the A=130 mass region. Highly deformed nuclei have been found in this region, providing opportunities to study the deformed rotational bands. The description of the 125,127,129,131,133 Pr isotopes with the projected shell model is presented in this paper. Good agreement between theory and experiment is obtained and some characteristics are discussed, including the dynamic moment of inertia J (2) , kinetic moment of inertia J (1) , the crossing of rotational bands, and backbending effects.

Interaction of neutrons with the matter in the laser field

International Nuclear Information System (INIS)

Zaretskij, D.F.; Lomonosov, V.V.

1980-01-01

The interactions of neutrons with the molecules, atoms and nuclei in the presence of the coherent electromagnetic radiation are considered. There are two effects which are discussed in detail: 1) the ''acceleration'' of thermal neutrons passed through the excited by the resonance laser wave molecular gas; 2) the induced by the laser field the slow neutron capture accompanied by the compound nucleus level excitation. The given effects, if they are experimentally detected, give the possibility to control the neutron flux (spectrum change, polarization, spatial modulation and etc.) and change the interaction cross sections of thermal and resonance neutrons with nuclei due to excitation of p levels of the compound nucleus [ru

Monte Carlo Simulation for Statistical Decay of Compound Nucleus

Directory of Open Access Journals (Sweden)

Chadwick M.B.

2012-02-01

Full Text Available We perform Monte Carlo simulations for neutron and γ-ray emissions from a compound nucleus based on the Hauser-Feshbach statistical theory. This Monte Carlo Hauser-Feshbach (MCHF method calculation, which gives us correlated information between emitted particles and γ-rays. It will be a powerful tool in many applications, as nuclear reactions can be probed in a more microscopic way. We have been developing the MCHF code, CGM, which solves the Hauser-Feshbach theory with the Monte Carlo method. The code includes all the standard models that used in a standard Hauser-Feshbach code, namely the particle transmission generator, the level density module, interface to the discrete level database, and so on. CGM can emit multiple neutrons, as long as the excitation energy of the compound nucleus is larger than the neutron separation energy. The γ-ray competition is always included at each compound decay stage, and the angular momentum and parity are conserved. Some calculations for a fission fragment 140Xe are shown as examples of the MCHF method, and the correlation between the neutron and γ-ray is discussed.

The momentum distribution inside nucleus

International Nuclear Information System (INIS)

Fujita, T.

1985-01-01

Discussions are made on several reactions which can determine the momentum distribution inside nucleus. The first reaction discussed is the high energy heavy ion collision. This reaction involves many nucleons which interact strongly. Therefore, one must be careful for any possible final state interactions. The expression for the single particle momentum distribution is given. And it can be said that the expression is consistent with the description of the energetic neutrons from muon capture by heavy nucleus. The best way to determine the momentum distribution would be the lepton-nucleus scattering since it does not involve the strong interaction in the initial channel. Another reaction discussed is the backward proton production, which is governed by quite complicated reaction processes. Therefore, the determination of the momentum distribution is only indirect. Noverthless, it is found that this reaction presents a very interesting and important information on the momentum distribution. (Aoki, K.)

Proton-neutron interaction at N≅Z. First observation of the Tz = 1 nucleus 4694Pd48 in beam

International Nuclear Information System (INIS)

Gorska, M.; Grzywacz, R.; Rejmund, M.; Foltescu, D.; Roth, H.; Skeppstedt, Oe.; Schubart, R.; Grawe, H.; Heese, J.; Maier, K.H.; Spohr, K.; Fossan, D.B.

1996-01-01

Neutron deficient nuclei close to N ≅ Z are expected to exhibit a new kind of pairing based on the T=0, I=1, I max configuration, which in the (p 1/2 , g 9/2 )shell model space below 100 Sn is governed by the g 2 9/2 proton (π)-neutron(ν) interaction. The experimental data exhibit strongly bound g 2 9/2 , T=0, I=1 + ,9 + . In the experimentally barely studied far from stability upper πg 9/2 shell due to the hole-hole character of the πν interaction spin gap isomers are expected. For this reason the γ decay of isomers produced in the 58 Ni ion beams interaction with 40 Ca target. The 94 Pd isomer has been found as an example of mentioned above spin gap isomers

Study of proton and 2 protons emission from light neutron deficient nuclei around A=20; Etude de l'emission proton et de deux protons dans les noyaux legers deficients en neutrons de la region A=20

Energy Technology Data Exchange (ETDEWEB)

Zerguerras, T

2001-09-01

Proton and two proton emission from light neutron deficient nuclei around A=20 have been studied. A radioactive beam of {sup 18}Ne, {sup 17}F and {sup 20}Mg, produced at the Grand Accelerateur National d'Ions Lourds by fragmentation of a {sup 24}Mg primary beam at 95 MeV/A, bombarded a {sup 9}Be target to form unbound states. Proton(s) and nuclei from the decay were detected respectively in the MUST array and the SPEG spectrometer. From energy and angle measurements, the invariant mass of the decaying nucleus could be reconstructed. Double coincidence events between a proton and {sup 17}F, {sup 16}O, {sup 15}O, {sup 14}O and {sup 18}Ne were registered to obtain excitation energy spectra of {sup 18}Ne, {sup 17}F, {sup 16}F, {sup 15}F et {sup 19}Na. Generally, the masses measures are in agreement with previous experiments. In the case of {sup 18}Ne, excitation energy and angular distributions agree well with the predictions of a break up model calculation. From {sup 17}Ne proton coincidences, a first experimental measurement of the ground state mass excess of {sup 18}Na has been obtained and yields 24,19(0,15)MeV. Two proton emission from {sup 17}Ne and {sup 18}Ne excited states and the {sup 19}Mg ground state was studied through triple coincidences between two proton and {sup 15}O, {sup 16}O and {sup 17}Ne respectively. In the first case, the proton-proton relative angle distribution in the center of mass has been compared with model calculation. Sequential emission from excited states of {sup 17}Ne, above the proton emission threshold, through {sup 16}F is dominant but a {sup 2}He decay channel could not be excluded. No {sup 2}He emission from the 1.288 MeV {sup 17}Ne state, or from the 6.15 MeV {sup 18}Ne state has been observed. Only one coincidence event between {sup 17}Ne and two proton was registered, the value of the one neutron stripping reaction cross section of {sup 20}Mg being much lower than predicted. (author)

Measurement of the energy spectrum of the neutrons inside the neutron flux trap assembled in the center of the reactor core IPEN/MB-01

Energy Technology Data Exchange (ETDEWEB)

Bitelli, Ulysses d' Utra; Mura, Luiz Ernesto Credidio; Santos, Diogo Feliciano dos; Jerez, Rogerio; Mura, Luis Felipe Liamos, E-mail: ubitelli@ipen.br, E-mail: credidiomura@gmail.com [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

2013-07-01

This paper presents the neutron energy spectrum in the central position of a neutron flux trap assembled in the core center of the research nuclear reactor IPEN/MB-01 obtained by an unfolding method. To this end, have been used several different types of activation foils (Au, Sc, Ti, Ni, and plates) which have been irradiated in the central position of the reactor core (setting number 203) at a reactor power level of 64.57 ±2.91 watts . The activation foils were counted by solid-state detector HPGe (gamma spectrometry). The experimental data of nuclear reaction rates (saturated activity per target nucleus) and a neutron spectrum estimated by a reactor physics computer code are the main input data to get the most suitable neutron spectrum in the irradiation position obtained through SANDBP code: a neutron spectra unfolding code that use an iterative adjustment method. The adjustment resulted in 3.85 ± 0.14 10{sup 9} n cm{sup -2} s{sup -1} for the integral neutron flux, 2.41 ± 0.01 10{sup 9} n cm{sup -2} s{sup -1} for the thermal neutron flux, 1.09 ± 0.02 10{sup 9} n cm{sup -2} s{sup -1} for intermediate neutron flux and 3.41± 0.02 10{sup 8} n cm{sup -2} s{sup -1} for the fast neutrons flux. These results can be used to verify and validate the nuclear reactor codes and its associated nuclear data libraries, besides show how much is effective the use of a neutron flux trap in the nuclear reactor core to increase the thermal neutron flux without increase the operation reactor power level. The thermal neutral flux increased 4.04 ± 0.21 times compared with the standard configuration of the reactor core. (author)

Low energy neutron scattering for energy dependent cross sections. General considerations

Energy Technology Data Exchange (ETDEWEB)

Rothenstein, W; Dagan, R [Technion-Israel Inst. of Tech., Haifa (Israel). Dept. of Mechanical Engineering

1996-12-01

We consider in this paper some aspects related to neutron scattering at low energies by nuclei which are subject to thermal agitation. The scattering is determined by a temperature dependent joint scattering kernel, or the corresponding joint probability density, which is a function of two variables, the neutron energy after scattering, and the cosine of the angle of scattering, for a specified energy and direction of motion of the neutron, before the interaction takes place. This joint probability density is easy to calculate, when the nucleus which causes the scattering of the neutron is at rest. It can be expressed by a delta function, since there is a one to one correspondence between the neutron energy change, and the cosine of the scattering angle. If the thermal motion of the target nucleus is taken into account, the calculation is rather more complicated. The delta function relation between the cosine of the angle of scattering and the neutron energy change is now averaged over the spectrum of velocities of the target nucleus, and becomes a joint kernel depending on both these variables. This function has a simple form, if the target nucleus behaves as an ideal gas, which has a scattering cross section independent of energy. An energy dependent scattering cross section complicates the treatment further. An analytic expression is no longer obtained for the ideal gas temperature dependent joint scattering kernel as a function of the neutron energy after the interaction and the cosine of the scattering angle. Instead the kernel is expressed by an inverse Fourier Transform of a complex integrand, which is averaged over the velocity spectrum of the target nucleus. (Abstract Truncated)

Compound nucleus effects in spin-spin cross sections

International Nuclear Information System (INIS)

Thompson, W.J.

1976-01-01

By comparison with recent data, it is shown that spin-spin cross sections for low-energy neutrons may be dominated by a simple compound-elastic level-density effect, independent of spin-spin terms in the nucleon-nucleus optical-model potential. (Auth.)

CT study of infantile cerebral vitamin B1 deficiency (analysis of 22 cases)

International Nuclear Information System (INIS)

Liu Bin; Xi Meifang; Wang Mengding; Wang Chaoxiu

1998-01-01

Purpose: To study the CT features of infantile cerebral vitamin B 1 deficiency. Methods: The authors retrospectively reviewed the clinical manifestations and CT findings of 22 cases of infantile vitamin B 1 deficiency. Results: The main clinical signs were seizure malaise dullness and vomiting. CT scans showed bilateral symmetrical hypodense foci in lenticular nucleus (20/22), head of caudate nucleus (15/22), thalamus (3/22), anterior limb of internal capsule (4/22), external capsule (1/22) and para-ventricle white matter (2/22), and in many cases, signs of cerebral atrophy. 22 cases received thiamine treatment and were fully recovered. Conclusion: The authors concluded that bilateral symmetric hypodense foci in lenticular nucleus thalamus, head of caudate nucleus, anterior limb of internal capsule, external capsule and para-ventricle white matter were important CT signs suggestive of infantile cerebral vitamin B 1 deficiency

Spectroscopy of heavy nuclei by configuration mixing of symmetry restored mean-field states: shape coexistence in neutron-deficient Pb isotopes

International Nuclear Information System (INIS)

Bender, M.; Heenen, P.H.; Bonche, P.; Duguet, T.

2003-01-01

We study shape coexistence and low-energy excitation spectra in neutron-deficient Pb isotopes using configuration mixing of angular-momentum and particle-number projected self-consistent mean-field states. The same Skyrme interaction SLy6 is used everywhere in connection with a density-dependent zero-range pairing force. (orig.)

Nuclear charge radii and nuclear moments of neutron deficient Ba isotopes from high resolution laser spectroscopy

International Nuclear Information System (INIS)

Nowicki, G.; Bekk, K.; Goering, S.; Hanser, A.; Rebel, H.; Schatz, G.

1978-07-01

Isotope shifts and hyperfine structure of the BaI 6s 2 1 S 0 -6s6p 1 P 1 transitions (lambda = 553.6 nm) in neutron deficient Ba nuclides (N 131 Ba, 128 Ba, in addition to remeasurements of all stable Ba nuclides. The extracted values of delta 2 >, the observed odd-even staggering and the nuclear moments are discussed in the light of other theoretical and experimental nuclear structure studies of the region 50 [de

The nucleus

International Nuclear Information System (INIS)

Marano, S.

1998-01-01

In 1911 E.Rutherford discovered the nucleus. Since then the nucleus has been investigated with more and more powerful tools but it remains the main field of study of nuclear physics. As it is impossible to take into account the interaction of all the nucleons, a theory based on the hypothesis that each nucleon undergoes an average interaction force has been set up. 2 representations have emerged: the Skyrme force and the Gogny force. Both representations match experimental results but are unable to describe fission yields or the multi-fragmentation of very hot nuclei. The mean-field theory can predict the shape of the nuclei according to its energy level. An experimental program involving the Vivitron accelerator and the Euroball detector is due to begin to validate it. By bombarding targets with exotic nuclei nuclear physicists detect new structures and test their collision models. About ten years ago nuclear halos were observed with lithium 11 nuclei. In this nucleus 2 neutrons move in a space larger than the nucleus itself. This discovery has triggered the elaboration of new theories based on nuclear clusters. At very high temperatures the mean-field theory predicts that nuclear matter acts as a fluid. Following the nuclei temperature different ways of decay appear: first evaporation then multi-fragmentation and vaporization. This ultimate stage occurs around 100 milliard celsius degree temperature when the nuclei decays in a multitude of light particles. Isomeric states are studied and could be seen as a way of storing energy. In a very pedagogical way this article gives information to understand the challenges that face nuclear physics today and highlights the contributions of Cea in this field. (A.C.)

Delayed neutrons as a probe of nuclear charge distribution in fission of heavy nuclei by neutrons

International Nuclear Information System (INIS)

Isaev, S.G.; Piksaikin, V.M.; Kazakov, L.E.; Roshchenko, V.A.

2002-01-01

A method of the determination of cumulative yields of delayed neutron precursors is developed. This method is based on the iterative least-square procedure applied to delayed neutron decay curves measured after irradiation of 235 U sample by thermal neutrons. Obtained cumulative yields in turns were used for deriving the values of the most probable charge in low-energy fission of the above-mentioned nucleus. (author)

Statistical theory of neutron nuclear reactions

International Nuclear Information System (INIS)

Moldauer, P.A.

1978-02-01

The statistical theory of average neutron nucleus reaction cross sections is reviewed with emphasis on the justification of the Hauser Feshbach formula and its modifications for situations including isolated compound nucleus resonances, overlapping and interfering resonances, the competition of compound and direct reactions, and continuous treatment of residual nuclear states

Statistical theory of neutron nuclear reactions

International Nuclear Information System (INIS)

Moldauer, P.A.

1980-01-01

The statistical theory of average neutron nucleus reaction cross sections is reviewed with emphasis on the justification of the Hauser Feshbach formula and its modifications for situations including isolated compound nucleus resonances, overlapping and interfering resonances, the competition of compound and direct reactions, and continuous treatment of residual nuclear states. (author)

A set-up for measuring neutron cross sections and radiation multiplicity from neutron-nucleus interaction

International Nuclear Information System (INIS)

Georgiev, G.P.; Ermakov, V.A.; Grigor'ev, Yu.V.

1988-01-01

A multiplicity detector of the ''Romashka'' type has been used on the 500 m flight part of the IBR-30 pulsed reactor. The detector consists of 16 independent sections with NaJ(Tl) crystals with a total volume of 36 liters. The geometric efficiency of single-ray detection is ∼ 80%. The gamma-ray to neutron detection efficiency ratio is ≥600 for neutrons with energies below 200 keV. This detector allows one to perform neutron capture and fission cross section measurements and to study gamma-ray multiplicity and resonance selfabsorption effects in the 20 eV-200keV neutron energy range

Statistical theory of neutron nuclear reactions

International Nuclear Information System (INIS)

Moldauer, P.A.

1975-01-01

The statistical theory of average neutron nucleus reaction cross sections is reviewed with emphasis on the justification of the Hauser Feshbach formula and its modifications for situations including isolated compound nucleus resonances, overlapping and interfering resonances, the competition of compound and direct reactions, and continuous treatment of residual nuclear states. 3 figures

Neutron emission spectra and level density of hot rotating 132Sn

International Nuclear Information System (INIS)

Aggarwal, Mamta

2008-01-01

The neutron emission spectrum of the highly excited compound nuclear system 132 Sn is investigated at high spin. The doubly magic nucleus 132 Sn undergoes a shape transition at high angular momentum which affects the nuclear level density and neutron emission probability considerably. The interplay of temperature, shape, deformation and rotational degrees of freedom and their influence on neutron emission is emphasized. We predict an enhancement of nucleonic emission at those spins where the nucleus suffers a transition from a spherical to deformed shape. (author)

167th Airlift Wing > Home

Science.gov (United States)

flight-related information.(Call 911 for emergencies) MID AIR COLLISION AVOIDANCE (MACA) INFO Note: The page on a full 8.5" x 11" sheet. 167 AW MACA Pamphlet - April 2017 167AW MACA Document - April 2017 167AW MACA Poster - Coming Soon featured Links mission Posted 02/09/2017 Freedom of

Delayed neutrons as a probe of nuclear charge distribution in fission of heavy nuclei by neutrons

CERN Document Server

Isaev, S G; Piksaikin, V M; Roshchenko, V A

2001-01-01

A method of the determination of cumulative yields of delayed neutron precursors is developed. This method is based on the iterative least-square procedure applied to delayed neutron decay curves measured after irradiation of sup 2 sup 3 sup 5 U sample by thermal neutrons. Obtained cumulative yields in turns were used for deriving the values of the most probable charge in low-energy fission of the above-mentioned nucleus.

First Measurement of Reaction-in-Flight Neutrons at the National Ignition Facility

Science.gov (United States)

Tonchev, A.; Becker, J.; Bleuel, D.; Bionta, R.; Fortner, D.; Henry, E.; Khater, H.; Shaughnessy, D.; Schnider, D.; Stoeffl, W.; Yeamans, C.; Boswell, M.; Bredeweg, T.; Grim, G.; Jungman, G.; Fowler, M.; Hayes, A.; Obst, A.; Rundberg, R.; Schulz, A.; Wilhelmy, J.; Tornow, W.; Bhike, M.; Howell, C.; Gooden, M.; LLNL/LANL/TUNL Collaboration

2013-10-01

The first measurement of reaction-in-flight (RIF) neutrons, also known as tertiary neutrons, has been performed at the National Ignition Facility (NIF) using an activation technique. Thulium foils positioned at 50 cm from the burning deuterium-tritium (DT) capsule have been exposed to the characteristic DT neutron spectrum. The high-energy part of these neutrons with energies above 15.0 MeV can produce 167Tm via the 169Tm(n,3n) reaction. The 208-keV γ-ray, emitted from the decay of 167Tm with a half-life of 9.2 days, has been measured using two clover detectors. The first preliminary result implies that the ratio of RIF neutrons (En > 15.0 MeV) versus the total neutrons is 1 × 10 -4 +/- 3 × 10 -5. The important implication of these measurements on our knowledge of the charged-particle stopping power in strongly coupled quantum-degenerate plasma will be presented. This work was performed under the auspices of the Lawrence Livermore National Security, LLC, (LLNS) under Contract No. DE-AC52-07NA27344.

The effect of the new nucleon-nucleus elastic scattering data in LAHET trademark Version 2.8 on neutron displacement cross section calculations

International Nuclear Information System (INIS)

Pitcher, E.J.; Ferguson, P.D.; Russell, G.J.; Prael, R.E.; Madland, D.G.; Court, J.D.; Daemen, L.L.; Wechsler, M.S.

1997-01-01

The latest release of the medium-energy Monte Carlo transport code LAHET includes a new nucleon-nucleus elastic scattering treatment based on a global medium-energy phenomenological optical-model potential. Implementation of this new model in LAHET allows nuclear elastic scattering for neutrons with energies greater than 15 MeV and for protons with energies greater than 50 MeV. Previous investigations on the impact of the new elastic scattering data revealed that the addition of the proton elastic scattering channel can lead to a significant increase in the calculated damage energy under certain conditions. The authors report here results on the impact of the new elastic scattering data on calculated displacement cross sections in various elements for neutrons with energies in the range 16 to 3,160 MeV. Calculated displacement cross sections at 20 MeV in low-mass materials are in better agreement with SPECTER-calculated cross sections

MADNIX a code to calculate prompt fission neutron spectra and average prompt neutron multiplicities

International Nuclear Information System (INIS)

Merchant, A.C.

1986-03-01

A code has been written and tested on the CDC Cyber-170 to calculate the prompt fission neutron spectrum, N(E), as a function of both the fissioning nucleus and its excitation energy. In this note a brief description of the underlying physical principles involved and a detailed explanation of the required input data (together with a sample output for the fission of 235 U induced by 14 MeV neutrons) are presented. Weisskopf's standard nuclear evaporation theory provides the basis for the calculation. Two important refinements are that the distribution of fission-fragment residual nuclear temperature and the cooling of the fragments as neutrons are emitted approximately taken into account, and also the energy dependence of the cross section for the inverse process of compound nucleus formation is included. This approach is then used to calculate the average number of prompt neutrons emitted per fission, v-bar p . At high excitation energies, where fission is still possible after neutron emission, the consequences of the competition between first, second and third chance fission on N(E) and v-bar p are calculated. Excellent agreement with all the examples given in the original work of Madland and Nix is obtained. (author) [pt

Saúde da pessoa com deficiência que vive no campo: o que dizem os trabalhadores da Atenção Básica?

Directory of Open Access Journals (Sweden)

Bárbara Lyrio Ursine

2017-06-01

Full Text Available Este estudo objetivou analisar as percepções dos trabalhadores da Estratégia Saúde da Família sobre a saúde da pessoa com deficiência que vive no campo. Trata-se de uma pesquisa de abordagem qualitativa, com o desenho de cunho etnometodológico. Foi realizada observação participante e debates por meio da roda, com registro em diário de campo, e entrevistas semiestruturadas em uma Unidade Básica de Saúde de Grão Mogol, Minas Gerais. Na análise, combinaram-se os dados coletados para triangulação. Os resultados evidenciam que as políticas desenvolvimentistas e a inserção das políticas públicas estão incidindo sobre a saúde das populações do campo. A deficiência está ancorada no modelo biomédico e a dimensão da caridade se ressalta nas ações em saúde. O desenho da Rede de Cuidados à Pessoa com Deficiência deve ser repactuado a fim de enfrentar as barreiras de acesso à saúde.

Nuclear structure studies in highly neutron-deficient (114,116)Xe

Science.gov (United States)

Degraaf, James Hendrick

Lifetimes of nuclear states in 114Xe and 116Xe were measured for the first time; these nuclei represent the most neutron-deficient isotopes of xenon for which lifetimes have now been measured. The fusion-evaporation reactions 58Ni(60Ni, 2p)116Xe at 223 MeV beam energy and 58Ni(58Ni, 2p)114Xe at 215 MeV beam energy were used. Lifetimes were measured using the Recoil Distance Method (RDM) with the 8π gamma-ray spectrometer at Chalk River Laboratories. The new measurements of the B(E2;2+/to 0+) strength in these nuclei, coupled with the recent measurements for heavier xenon isotopes, are well described within the framework of the O(6) symmetry limit of the Interacting Boson Approximation. The octupole nature of the negative parity side-band was also studied, and the lifetime measurements indicate a change from a K/approx 3 structure in heavier xenon isotopes to a K/approx 0,/ 1 structure in 114Xe.

Modeling a neutron rich nuclei source

Energy Technology Data Exchange (ETDEWEB)

Mirea, M.; Bajeat, O.; Clapier, F.; Ibrahim, F.; Mueller, A.C.; Pauwels, N.; Proust, J. [Institut de Physique Nucleaire, IN2P3/CNRS, 91 - Orsay (France); Mirea, M. [Institute of Physics and Nuclear Engineering, Tandem Lab., Bucharest (Romania)

2000-07-01

The deuteron break-up process in a suitable converter gives rise to intense neutron beams. A source of neutron rich nuclei based on the neutron induced fission can be realised using these beams. A theoretical optimization of such a facility as a function of the incident deuteron energy is reported. The model used to determine the fission products takes into account the excitation energy of the target nucleus and the evaporation of prompt neutrons. Results are presented in connection with a converter-target specific geometry. (author000.

Modeling a neutron rich nuclei source

International Nuclear Information System (INIS)

Mirea, M.; Bajeat, O.; Clapier, F.; Ibrahim, F.; Mueller, A.C.; Pauwels, N.; Proust, J.; Mirea, M.

2000-01-01

The deuteron break-up process in a suitable converter gives rise to intense neutron beams. A source of neutron rich nuclei based on the neutron induced fission can be realised using these beams. A theoretical optimization of such a facility as a function of the incident deuteron energy is reported. The model used to determine the fission products takes into account the excitation energy of the target nucleus and the evaporation of prompt neutrons. Results are presented in connection with a converter-target specific geometry. (authors)

Electroweak Measurements of Neutron Densities in CREX and PREX at JLab, USA

Energy Technology Data Exchange (ETDEWEB)

Horowitz, Charles J. [Indiana U.; Kumar, Krishna S. [UMass; Michaels, Robert W. [JLAB

2014-02-01

Measurement of the parity-violating electron scattering asymmetry is an established technique at Jefferson Lab and provides a new opportunity to measure the weak charge distribution and hence pin down the neutron radius in nuclei in a relatively clean and model-independent way. This is because the Z boson of the weak interaction couples primarily to neutrons. We will describe the PREX and CREX experiments on ${}^{208}$Pb and ${}^{48}$Ca respectively; these are both doubly-magic nuclei whose first excited state can be discriminated by the high resolution spectrometers at JLab. The heavier lead nucleus, with a neutron excess, provides an interpretation of the neutron skin thickness in terms of properties of bulk neutron matter. For the lighter ${}^{48}$Ca nucleus, which is also rich in neutrons, microscopic nuclear theory calculations are feasible and are sensitive to poorly constrained 3-neutron forces.

Gamma rays from fast neutron capture in silicon and sulphur

International Nuclear Information System (INIS)

Lindholm, A.; Nilsson, L.; Bergqvist, I.

1975-01-01

Gamma-ray spectra from neutron capture in natural samples of silicon and sulphur have been recorded at eight neutron energies between 4 and 15 MeV. Time-of-flight techniques were used to improve the signal-to-background ratio and the gamma radiation was detected by a large NaI(Tl) scintillator. Cross sections have been determined for transitions to individual (or groups of) levels in the final nucleus. Calculations based on the direct-semidirect model show that this model gives a reasonable description of the shapes of the gamma-ray spectra, but fails to account for observed excitation functions. The inclusion of the compound-nucleus capture process gives a conclusive improvement in the description of the excitation functions, in particular at low neutron energies. The ability of the compound-nucleus model to account for the shapes of the gamma-ray spectra is as good as that of the direct-semidirect model. At higher neutron energies, an improvement is obtained for transitions to the region of weakly bound levels, where the single-particle structure is poorly known. (Auth.)

Study of neutron deficient iridium isotopes by using laser spectroscopy; Etude des noyaux d'iridium deficients en neutrons par spectroscopie laser

Energy Technology Data Exchange (ETDEWEB)

Verney, D

2000-12-19

Resonance ionization spectroscopy was performed on neutron deficient iridium isotopes {sup 182-189}Ir, {sup 186}Ir{sup m} and stable isotopes {sup 191,193}Ir. Hyperfine spectra were recorded from the optical transition at 351,7 nm between the 5d{sup 7}6s{sup 2} {sup 4}F{sub 9/2} ground state and the 5d{sup 7}6s6p {sup 6}F{sub 11/2} excited state. Radioactive iridium isotopes were obtained from {beta}{sup +}/EC decay of radioactive mercury nuclei deposited on a graphite substrate. The radioactive mercury nuclei were produced at the ISOLDE facility at CERN through spallation reactions, by bombarding a molten lead target with the 1 GeV proton beam delivered by the PS-Booster. Magnetic dipole moments and spectroscopic quadrupole moments were extracted from the hyperfine spectra. The mean square charge radius variations, as deduced from the measured isotopic shift, show a sharp change between {sup 187}Ir and {sup 186}Ir{sup g}, accompanied by a sudden increase in deformation: from {beta}2 {approx} 0,16 to {beta}2 > 0, 2. These results were analysed in the framework of an axial rotor plus one or two quasiparticles. The wave functions of the osmium and platinum cores which are used in order to describe the iridium nuclei were calculated from the HF+BCS method with the Skyrme SIII effective interaction. The cores were constrained to take the deformation parameters extracted from the isotopic shift measurements. One shows then that this sudden deformation change corresponds also to a change in the proton state that describes the odd nuclei ground state or that participates in the coupling with the neutron in odd-odd nuclei. This state is identified with the {pi}3/2{sup +}[402] orbital for the smaller deformations nuclei and with the {pi}1/2{sup -}[541] orbital stemming from the h{sub 9/2} subshell for bigger deformations nuclei. (author)

The properties of atomic nuclei at the boundary of proton instability, discussed at the example of very neutron deficient isotopes in the mass range 100-150

International Nuclear Information System (INIS)

Roeckl, E.

1981-10-01

In this paper it shall be tried to strike the balance after the first years of experimenting at the on-line mass separator of the GSI Darmstadt and to present the main results of the study of very neutron deficient isotopes in the mass range 90-150 as well as the resulting questions for further experiments. First some foundations concerning the properties of neutron deficient nuclei and the measuring method are explained. The results and their interpretation are discussed using examples for the alpha decay, the beta decay, the mass-energy-area, and the proton-drip line. Finally the obtained results are summarized, and an outlook to further studies of nuclear properties far from beta stability is given. (orig.) [de

Assessing neutron generator output using neutron activation of silicon

International Nuclear Information System (INIS)

Kehayias, Pauli M.; Kehayias, Joseph J.

2007-01-01

D-T neutron generators are used for elemental composition analysis and medical applications. Often composition is determined by examining elemental ratios in which the knowledge of the neutron flux is unnecessary. However, the absolute value of the neutron flux is required when the generator is used for neutron activation analysis, to study radiation damage to materials, to monitor the operation of the generator, and to measure radiation exposure. We describe a method for absolute neutron output and flux measurements of low output D-T neutron generators using delayed activation of silicon. We irradiated a series of silicon oxide samples with 14.1 MeV neutrons and counted the resulting gamma rays of the 28 Al nucleus with an efficiency-calibrated detector. To minimize the photon self-absorption effects within the samples, we used a zero-thickness extrapolation technique by repeating the measurement with samples of different thicknesses. The neutron flux measured 26 cm away from the tritium target of a Thermo Electron A-325 D-T generator (Thermo Electron Corporation, Colorado Springs, CO) was 6.2 x 10 3 n/s/cm 2 ± 5%, which is consistent with the manufacturer's specifications

Assessing neutron generator output using neutron activation of silicon

Energy Technology Data Exchange (ETDEWEB)

Kehayias, Pauli M. [Body Composition Laboratory, Jean Mayer United States Department of Agriculture Human Nutrition Research Center on Aging, Tufts University, Boston, MA 02111 (United States); Kehayias, Joseph J. [Body Composition Laboratory, Jean Mayer United States Department of Agriculture Human Nutrition Research Center on Aging, Tufts University, Boston, MA 02111 (United States)]. E-mail: joseph.kehayias@tufts.edu

2007-08-15

D-T neutron generators are used for elemental composition analysis and medical applications. Often composition is determined by examining elemental ratios in which the knowledge of the neutron flux is unnecessary. However, the absolute value of the neutron flux is required when the generator is used for neutron activation analysis, to study radiation damage to materials, to monitor the operation of the generator, and to measure radiation exposure. We describe a method for absolute neutron output and flux measurements of low output D-T neutron generators using delayed activation of silicon. We irradiated a series of silicon oxide samples with 14.1 MeV neutrons and counted the resulting gamma rays of the {sup 28}Al nucleus with an efficiency-calibrated detector. To minimize the photon self-absorption effects within the samples, we used a zero-thickness extrapolation technique by repeating the measurement with samples of different thicknesses. The neutron flux measured 26 cm away from the tritium target of a Thermo Electron A-325 D-T generator (Thermo Electron Corporation, Colorado Springs, CO) was 6.2 x 10{sup 3} n/s/cm{sup 2} {+-} 5%, which is consistent with the manufacturer's specifications.

Progress report from the Studsvik Neutron Research Laboratory 1990-91

International Nuclear Information System (INIS)

Dahlborg, U.; Ebbsjoe, I.; Holmqvist, B.

1992-01-01

The Studsvik Neutron Research Laboratory (NFL) is the base for the research activities at the Studsvik reactors. It is administrated by the University of Uppsala and is established to facilitate reactor based research. The laboratory is intended to, in co-operation with institutes and department at universities in Sweden, develop, construct and maintain experimental equipment for this kind of research and to make it available for scientists at Swedish universities and, if possible, also to scientists outside the universities. The research at the Studsvik facilities has during 1990 and 1991 been performed by groups form Uppsala University, Royal Institute of Technology, Stockholm, Chalmers Technical University, Gothenburg, and by scientists at NFL. The research programme of the groups is divided into three main areas, scattering of thermal neutrons, nuclear chemistry/nuclear physics, and neutron capture radiography

Isomer spectroscopy of neutron-rich 168 Tb 103

Energy Technology Data Exchange (ETDEWEB)

Gurgi, L. A.; Regan, P. H.; Söderström, P. -A.; Watanabe, H.; Walker, P. M.; Podolyák, Zs.; Nishimura, S.; Berry, T. A.; Doornenbal, P.; Lorusso, G.; Isobe, T.; Baba, H.; Xu, Z. Y.; Sakurai, H.; Sumikama, T.; Catford, W. N.; Bruce, A. M.; Browne, F.; Lane, G. J.; Kondev, F. G.; Odahara, A.; Wu, J.; Liu, H. L.; Xu, F. R.; Korkulu, Z.; Lee, P.; Liu, J. J.; Phong, V. H.; Yag, A.; Zhang, G. X.; Alharbi, T.; Carroll, R. J.; Chae, K. Y.; Dombradi, Zs.; Estrade, A.; Fukuda, N.; Griffin, C.; Ideguchi, E.; Inabe, N.; Kanaoka, H.; Kojouharov, I.; Kubo, T.; Kubono, S.; Kurz, N.; Kuti, I.; Lalkovski, S.; Lee, E. J.; Lee, C. S.; Lotay, G.; Moon, C. -B.; Nishizuka, I.; Nita, C. R.; Patel, Z.; Roberts, O. J.; Schaffner, H.; Shand, C. M.; Suzuki, H.; Takeda, H.; Terashima, S.; Vajta, Zs.; Yoshida, S.; Valiente-Dòbon, J. J.

2017-11-01

In-flight fission of a 345 MeV per nucleon 238U primary beam on a 2 mm thick 9Be target has been used to produce and study the decays of a range of neutron-rich nuclei centred around the doubly mid-shell nucleus 170Dy at the RIBF Facility, RIKEN, Japan. The produced secondary fragments of interest were identified event-by-event using the BigRIPS separator. The fragments were implanted into the WAS3ABI position sensitive silicon active stopper which allowed pixelated correlations between implants and their subsequent β-decay. Discrete γ-ray transitions emitted following decays from either metastable states or excited states populated following beta decay were identified using the 84 coaxial high-purity germanium (HPGe) detectors of the EURICA spectrometer, which was complemented by 18 additional cerium-doped lanthanum bromide (LaBr3) fast-timing scintillation detectors from the FATIMA collaboration. This paper presents the internal decay of a metastable isomeric excited state in the odd-odd nucleus 168Tb, which corresponds to a single proton-neutron hole configuration in the valence maximum nucleus 170Dy. These data represent the first information on excited states in this nucleus, which is the most neutron-rich odd-odd isotope of terbium (Z=65) studied to date. Nilsson configurations associated with an axially symmetric, prolate-deformed nucleus are proposed for the 168Tb ground state the observed isomeric state by comparison with Blocked BCS-Nilsson calculations.

Search for EC-decayed neutron-deficient actinide isotopes using gas-jet coupled JAERI-ISOL

Energy Technology Data Exchange (ETDEWEB)

Tsukada, Kazuaki [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

1997-07-01

To study the nuclear properties of unknown neutron deficient actinide isotopes which decay mainly via orbital electron capture (EC), we have developed a composite system consisting of a gas-jet transport apparatus and a thermal ion-source at the JAERI-ISOL. With this system, search for {sup 236}Am produced in the {sup 235}U({sup 6}Li, 5n) reaction has been performed. Pu KX-rays associated with the EC decay of {sup 236}Am are observed at the mass-236 fraction. The half-life of {sup 236}Am is evaluated to be 4.4min. The outline of the gas-jet coupled JAERI-ISOL system and typical performance are given. (author)

PANDORA, a large volume low-energy neutron detector with real-time neutron-gamma discrimination

Science.gov (United States)

Stuhl, L.; Sasano, M.; Yako, K.; Yasuda, J.; Baba, H.; Ota, S.; Uesaka, T.

2017-09-01

The PANDORA (Particle Analyzer Neutron Detector Of Real-time Acquisition) system, which was developed for use in inverse kinematics experiments with unstable isotope beams, is a neutron detector based on a plastic scintillator coupled to a digital readout. PANDORA can be used for any reaction study involving the emission of low energy neutrons (100 keV-10 MeV) where background suppression and an increased signal-to-noise ratio are crucial. The digital readout system provides an opportunity for pulse shape discrimination (PSD) of the detected particles as well as intelligent triggering based on PSD. The figure of merit results of PANDORA are compared to the data in literature. Using PANDORA, 91 ± 1% of all detected neutrons can be separated, while 91 ± 1% of the detected gamma rays can be excluded, reducing the gamma ray background by one order of magnitude.

Penning-trap mass spectrometry and mean-field study of nuclear shape coexistence in the neutron-deficient lead region

Science.gov (United States)

Manea, V.; Ascher, P.; Atanasov, D.; Barzakh, A. E.; Beck, D.; Blaum, K.; Borgmann, Ch.; Breitenfeldt, M.; Cakirli, R. B.; Cocolios, T. E.; Day Goodacre, T.; Fedorov, D. V.; Fedosseev, V. N.; George, S.; Herfurth, F.; Kowalska, M.; Kreim, S.; Litvinov, Yu. A.; Lunney, D.; Marsh, B.; Neidherr, D.; Rosenbusch, M.; Rossel, R. E.; Rothe, S.; Schweikhard, L.; Wienholtz, F.; Wolf, R. N.; Zuber, K.

2017-05-01

We present a study of nuclear shape coexistence in the region of neutron-deficient lead isotopes. The midshell gold isotopes 180,185,188,190Au (Z =79 ), the two long-lived nuclear states in 197At (Z =85 ), and the neutron-rich nuclide 219At were produced by the ISOLDE facility at CERN and their masses were determined with the high-precision Penning-trap mass spectrometer ISOLTRAP. The studied gold isotopes address the trend of binding energies in a region of the nuclear chart where the nuclear charge radii show pronounced discontinuities. Significant deviations from the atomic-mass evaluation were found for Au,190188. The new trend of two-neutron separation energies is smoother, although it does reveal the onset of deformation. The origin of this effect is interpreted in connection to the odd-even staggering of binding energies, as well as theoretically by Hartree-Fock-Bogoliubov calculations including quasiparticle blocking. The role of blocking for reproducing the large odd-even staggering of charge radii in the mercury isotopic chain is illustrated.

14 MeV neutrons physics and applications

CERN Document Server

Valkovic, Vladivoj

2015-01-01

Despite the often difficult and time-consuming effort of performing experiments with fast (14 MeV) neutrons, these neutrons can offer special insight into nucleus and other materials because of the absence of charge. 14 MeV Neutrons: Physics and Applications explores fast neutrons in basic science and applications to problems in medicine, the environment, and security.Drawing on his more than 50 years of experience working with 14 MeV neutrons, the author focuses on:Sources of 14 MeV neutrons, including laboratory size accelerators, small and sealed tube generators, well logging sealed tube ac

Particle correlations in proton-nucleus and nucleus-nucleus collisions

International Nuclear Information System (INIS)

Nagamiya, Sh.

1981-01-01

Particle correlations in proton-nucleus and nucleus-nucleus collisions at energies of 1-2 GeV/nucleon are investigated. The problems of measurement of the mean free path lambda of protons inside the nucleus and the interaction radius of nucleus-nucleus collisions is considered. The value of lambda has been determined in two-proton coincidence experiment in proton-nucleus interaction at 800 MeV. The observed value of lambda is slightly longer than the expected from free nucleon-nucleon collisions. Some preliminary results on proton emission beyond free nucleon-nucleon kinemaics are given

Influence of LBE long term exposure and simultaneous fast neutron irradiation on the mechanical properties of T91 and 316L

Energy Technology Data Exchange (ETDEWEB)

Stergar, E., E-mail: estergar@sckcen.be [SCK-CEN, Belgian Nuclear Research Centre, Boeretang 200, 2400 Mol (Belgium); Eremin, S.G. [RIAR, Research Institute of Atomic Reactors, Dimitrovgrad (Russian Federation); Gavrilov, S.; Lambrecht, M. [SCK-CEN, Belgian Nuclear Research Centre, Boeretang 200, 2400 Mol (Belgium); Makarov, O.; Iakovlev, V. [RIAR, Research Institute of Atomic Reactors, Dimitrovgrad (Russian Federation)

2016-05-15

The LEXUR–II–LBE irradiation campaign was conducted from 2011 to 2012 and was aimed to investigate the combined influence of irradiation and LBE environment. In this irradiation campaign tensile test samples, pressurized tubes and corrosion samples were irradiated in LBE filled capsules. To separate the effect of exposure to LBE and neutron irradiation a parallel furnace experiment where the samples were exposed to LBE at the irradiation temperature for the corresponding time was conducted. Here we report results of the first extracted capsule which was irradiated about 6 months and dismantled after a cooling phase to decrease activity. The results of SSRT tests for irradiated T91 show that the exposure to LBE at 350 °C for a long time leads to the appearance of liquid metal embrittlement without any pre-treatment which is usually necessary to promote LME. Irradiation increases the effect of LME on the ductility of T91. In contrast to the findings for T91 the gained results also show that tensile tests on irradiated austenitic stainless steel 316L show no influence of LBE environment on the tensile properties.

Identification of new nuclei at and beyond the proton drip-line near the doubly-magic nucleus 100Sn

International Nuclear Information System (INIS)

Anne, R.; Auger, G.; Bazin, D.; Corre, J.M.; Hue, R.; Lewitowicz, M.; Saint-Laurent, M.G.; Rykaczewski, K.; Grzywacz, R.; Pfuetzner, M.; Zylicz, J.; Borrel, V.; Guillemaud-Mueller, D.; Mueller, A.C.; Pougheon, F.; Sorlin, O.; Fomichov, A.; Penionzhkevich, Y.; Lukyanov, S.; Tarasov, O.; Huyse, M.; Szerypo, J.; Wauters, J.

1994-01-01

The new neutron-deficient nuclei 103 Sb, 104 Sb, 98 In, 91 Pd, 89 Rh and 87 Ru have been identified among the quasi-fragmentation products of a 112 Sn beam (63 MeV/nucleon). The fragment identification based on energy-loss, total kinetic energy and time-of-flight measurements has been independently confirmed via observation of γ-radiation following the decay of known short-lived isomers. The region of known isotopes is extended to the predicted proton drip-line for indium and silver, and beyond it for antimony and rhodium. Tentative evidence for the existence of 105 Te, 99 Sn and 93 Ag is also presented. (authors). 28 refs., 2 figs

Measurement of the 209Bi(n ,4 n )206Bi and 169Tm(n ,3 n )167Tm cross sections between 23.5 and 30.5 MeV relevant to reaction-in-flight neutron studies at the National Ignition Facility

Science.gov (United States)

Gooden, M. E.; Bredeweg, T. A.; Champine, B.; Combs, D. C.; Finch, S.; Hayes-Sterbenz, A.; Henry, E.; Krishichayan, Rundberg, R.; Tornow, W.; Wilhelmy, J.; Yeamans, C.

2017-08-01

At the National Ignition Facility, experiments are being performed to measure charged-particle stopping powers in the previously unexplored warm dense plasma regime. These measurements are done using reaction-in-flight (RIF) neutrons from an inertial confinement fusion system. RIF neutrons are produced with a continuum of energies up to 30 MeV. By making activation measurements utilizing threshold reactions for neutrons in the energy range of 15 neutrons can be determined and from this the stopping power of the deuterium and tritium ions that produced the RIF neutrons can be inferred. Currently, the 169Tm(n ,3 n )167Tm reaction has been used. However, in an effort to provide a secondary complimentary measurement, efforts are underway to make use of the 209Bi(n ,4 n )206Bi reaction, with a threshold of 22.5 MeV. The cross sections were measured at the 10 MV tandem Van De Graaff accelerator at the Triangle Universities Nuclear Laboratory with quasimonoenergetic neutrons between 23.5 and 30.5 MeV, where few previous measurements have been made. Cross-section data are compared to calculations and other available measurements.

Prevalence of Vitamin B12 and folic acid deficiency in HIV-positive patients and its association with neuropsychiatric symptoms and immunological response.

Science.gov (United States)

Adhikari, Prabha M R; Chowta, Mukta N; Ramapuram, John T; Rao, Satish; Udupa, Karthik; Acharya, Sahana Devdas

2016-01-01

Deficiency of micronutrients is prevalent even before the development of symptoms of HIV disease and is associated with accelerated HIV disease progression. This study evaluates the prevalence of folate and Vitamin B 12 deficiency in HIV-positive patients with or without tuberculosis (TB) and its association with neuropsychiatric symptoms and immunological response. Cross-sectional, observational study in an outpatient setting. Four groups of HIV-positive patients with TB (Group I), HIV-positive patients with neuropsychiatric symptoms (Group II), HIV-positive patients without neuropsychiatric symptoms or TB (Group III), and HIV-negative controls with neuropsychiatric symptoms (Group IV). Vitamin B 12 and folate estimation was done using carbonyl metallo-immunoassay method. ANOVA, Kruskal-Wallis and Mann-Whitney, Pearson's correlation. The prevalence of folic acid deficiency was 27.1% in the Group I, 31.9% in the Group II, 23.4% in the Group III, and 32% in the Group IV being higher in patients with neuropsychiatric symptoms in both HIV and non-HIV patients. The prevalence of Vitamin B 12 deficiency was 18.8% in Group I, 9.1% in Group II, 4.8% in Group III, and 16.7% in Group IV. The patients with folate deficiency had more severe depression and anxiety. Nearly, 30% of the HIV patients had a folic acid deficiency, and about 10% of the HIV patients had Vitamin B 12 deficiency. The folate deficiency was highest among neuropsychiatric patients with or without HIV infection and Vitamin B 12 deficiency was higher among HIV patients with TB.

(Anti-)deuteron formation and neutron-proton correlation

International Nuclear Information System (INIS)

Mrowczynski, S.

1995-01-01

The neutron-proton correlation, deuteron and antideuteron formation in nuclear collisions are all due to the final state interactions. The neutron-proton correlation function and the (anti-)deuteron formation rate are calculated in parallel. These quantities are expressed through the space-time parameters of the particle source created in nucleus-nucleus collisions. In the case of baryon reach sources, the nucleons are emitted from the whole source volume while the antinucleons dominantly from the surface due to the antinucleon absorption in the baryon environment. Thus, the shape of the antinucleon source is different from the nucleon one, and consequently the antideuteron formation rate is substantially smaller than that one of deuterons. The correlation function satisfies the sum rule, which, in particular, connects the number of correlated neutron-proton pairs with the number of produced deuterons. (author). 18 refs., 4 figs

Photo-nuclear reactions on nuclei in the W-Re-Os region

International Nuclear Information System (INIS)

Shizuma, Toshiyuki; Hayakawa, Takehito; Goko, Shinji; Utsunomiya, Hiroaki; Ohgaki, Hideaki; Mohr, Peter; Lui, Yiu-Wing; Goriely, Stephane

2005-01-01

Photo-disintegration cross sections for 186 W, 187 Re, 188 Os have been measured at energies close to the neutron thresholds using quasi monochromatic γ-ray beams from laser Compton scattering (LCS). The data are used to evaluate the cross sections for the inverse neutron capture reactions within the Hauser-Feshbach statistical model. The influence of the radiative neutron capture on the 9.75 keV first excited state of 187 Os which is substantially populated in stellar plasmas at typical s-process temperatures is examined in connection to the 187 Re- 187 Os cosmochronology. (author)

Geometry Survey of the Time-of-Flight Neutron-Elastic Scattering (Antonella) Experiment

Energy Technology Data Exchange (ETDEWEB)

Oshinowo, Babatunde O. [Fermilab; Izraelevitch, Federico [Buenos Aires U.

2016-10-17

The Antonella experiment is a measurement of the ionization efficiency of nuclear recoils in silicon at low energies [1]. It is a neutron elastic scattering experiment motivated by the search for dark matter particles. In this experiment, a proton beam hits a lithium target and neutrons are produced. The neutron shower passes through a collimator that produces a neutron beam. The beam illuminates a silicon detector. With a certain probability, a neutron interacts with a silicon nucleus of the detector producing elastic scattering. After the interaction, a fraction of the neutron energy is transferred to the silicon nucleus which acquires kinetic energy and recoils. This kinetic energy is then dissipated in the detector producing ionization and thermal energy. The ionization produced is measured with the silicon detector electronics. On the other hand, the neutron is scattered out of the beam. A neutron-detector array (made of scintillator bars) registers the neutron arrival time and the scattering angle to reconstruct the kinematics of the neutron-nucleus interaction with the time-of-flight technique [2]. In the reconstruction equations, the energy of the nuclear recoil is a function of the scattering angle with respect to the beam direction, the time-of-flight of the neutron and the geometric distances between components of the setup (neutron-production target, silicon detector, scintillator bars). This paper summarizes the survey of the different components of the experiment that made possible the off-line analysis of the collected data. Measurements were made with the API Radian Laser Tracker and I-360 Probe Wireless. The survey was completed at the University of Notre Dame, Indiana, USA in February 2015.

19 CFR 122.167 - Aviation smuggling.

Science.gov (United States)

2010-04-01

... 19 Customs Duties 1 2010-04-01 2010-04-01 false Aviation smuggling. 122.167 Section 122.167... TREASURY AIR COMMERCE REGULATIONS Penalties § 122.167 Aviation smuggling. (a) Civil penalties. Any aircraft.... More severe penalties are provided in 19 U.S.C. 1590 if the smuggled merchandise is a controlled...

46 CFR 167.43-1 - Application.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Application. 167.43-1 Section 167.43-1 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Work Vests § 167.43-1 Application. (a) Provisions of this subpart shall apply to all vessels inspected and...

46 CFR 167.20-1 - Construction.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Construction. 167.20-1 Section 167.20-1 Shipping COAST... Requirements, Construction and Arrangement of Nautical School Ships § 167.20-1 Construction. Except as otherwise provided by law or regulations in this subpart, the following standards for construction are...

Structure of Light Neutron-rich Nuclei

International Nuclear Information System (INIS)

Dlouhy, Zdenek

2007-01-01

In this contribution we searched for irregularities in various separation energies in the frame of mass measurement of neutron-rich nuclei at GANIL. On this basis we can summarize that the new doubly magic nuclei are 8 He, 22 O and 24 O. They are characterized by extra stability and, except 24 O, they cannot accept and bind additional neutrons. However, if we add to these nuclei a proton we obtain 9 Li and 25 F which are the core for two-neutron halo nucleus 11 Li and enables that fluorine can bound even 6 more neutrons, respectively. In that aspect the doubly magic nuclei in the neutron-rich region can form the basis either for neutron halo or very neutron-rich nuclei. (Author)

Neutron detection technique

International Nuclear Information System (INIS)

Oblath, N.S.; Poon, A.W.P.

2000-01-01

The Sudbury Neutrino Observatory (SNO) has the ability to measure the total flux of all active flavors of neutrinos using the neutral current reaction, whose signature is a neutron. By comparing the rates of the neutral current reaction to the charged current reaction, which only detects electron neutrinos, one can test the neutrino oscillation hypothesis independent of solar models. It is necessary to understand the neutron detection efficiency of the detector to make use of the neutral current reaction. This report demonstrates a coincidence technique to identify neutrons emitted from the 252 Cf neutron calibration source. The source releases on average four neutrons when a 252 Cf nucleus spontaneously fissions. Each neutron is detected as a separate event when the neutron is captured by a deuteron, releasing a gamma ray of approximately 6.25 MeV. This gamma ray is in turn detected by the photomultiplier tube (PMT) array. By investigating the time and spatial separation between neutron-like events, it is possible to obtain a pure sample of neutrons for calibration study. Preliminary results of the technique applied to two calibration runs are presented

Nucleus-nucleus potential with repulsive core and elastic scattering. Part 1. Nucleus-nucleus interaction potential

International Nuclear Information System (INIS)

Davidovs'ka, O.Yi.; Denisov, V.Yu.; Nesterov, V.O.

2010-01-01

Various approaches for nucleus-nucleus interaction potential evaluation are discussed in details. It is shown that the antisymmetrization of nucleons belonging to different nuclei and the Pauli principle give the essential contribution into the nucleus-nucleus potential at distances, when nuclei are strongly overlapping, and lead to appearance of the repulsive core of nucleus nucleus interaction at small distances between nuclei.

NRC Information No. 91-29: Deficiencies identified during electrical distribution system functional inspections

International Nuclear Information System (INIS)

Rossi, C.E.

1992-01-01

During multidisciplinary inspections, the US Nuclear Regulatory Commission (NRC) has identified many deficiencies related to the electrical distribution system. To address these deficiencies, the NRC has developed an inspection to specifically evaluate the electrical distribution system. During the last year, the NRC completed eight EDSFIs, performing at least one in each of the several common deficiencies in the licensees' programs and in the electrical distribution systems as designed and configured at each plant. These deficiencies included inadequate ac voltages at the 480 Vac and 120 Vac distribution levels, inadequate procedures to test circuit breakers, and inadequate determinations and evaluations of setpoints

Nucleus spectroscopy: extreme masses and deformations

International Nuclear Information System (INIS)

Theisen, Ch.

2009-12-01

The author proposes a synthesis of research activities performed since 1995 in the field of experimental nuclear physics, and more particularly in the investigation of two nucleus extreme states: deformation on the one hand, heavy and very heavy nuclei on the other hand. After a presentation of the context of investigations on deformation, rotation, and heavy nuclei, he gives an overview of developments regarding instruments (gamma spectrometers, detection of fission fragments, and detection at the focal plane of spectrometers or separators) and analysis techniques. Experiments and results are then reported and discussed, concerning super-deformed states with a high angular moment, spectroscopy of neutron-rich nuclei, very heavy nuclei close to nucleus map borders. He finally draws perspectives for middle and long term studies on the heaviest nuclei

Semiclassical model for single-particle transitions in nucleus-nucleus interactions

International Nuclear Information System (INIS)

Milek, B.; Joint Inst. for Nuclear Research, Dubna; Technische Univ., Dresden; Reif, R.; Pham Khan Van; Revai, J.

1990-04-01

A previously elaborated semiclassical one-body model for the dynamics of a single particle, moving in two potentials, in heavy-ion reactions or in fissioning systems has been extended with respect to the inclusion of angular momenta and more realistic separable potentials. The collective relative motion is assumed to proceed along a trajectory which is calculated from classical equations of motion including conservative and phenomenological friction forces. The formalism has been derived involving three-dimensional trajectories for symmetric as well as for asymmetric nucleus-nucleus systems. The model allows for the calculation of correct quantum mechanical transition amplitudes to final bound and continuum states. It has been applied for the investigation of the excitation of a neutron during a fission process, covering also non-statistical differential emission probabilities. From the numerical calculations, using parameters adapted to 252 Cf(sf), one can conclude that in the underlying model without 'sudden' processes the energy spectrum consists of two parts. The low lying component is created in the neck region while a high lying part seems to be governed mainly by the dynamics of the underlying collective motion rather than by the specific initial conditions. (orig.)

3D Protein Dynamics in the Cell Nucleus.

Science.gov (United States)

Singh, Anand P; Galland, Rémi; Finch-Edmondson, Megan L; Grenci, Gianluca; Sibarita, Jean-Baptiste; Studer, Vincent; Viasnoff, Virgile; Saunders, Timothy E

2017-01-10

The three-dimensional (3D) architecture of the cell nucleus plays an important role in protein dynamics and in regulating gene expression. However, protein dynamics within the 3D nucleus are poorly understood. Here, we present, to our knowledge, a novel combination of 1) single-objective based light-sheet microscopy, 2) photoconvertible proteins, and 3) fluorescence correlation microscopy, to quantitatively measure 3D protein dynamics in the nucleus. We are able to acquire >3400 autocorrelation functions at multiple spatial positions within a nucleus, without significant photobleaching, allowing us to make reliable estimates of diffusion dynamics. Using this tool, we demonstrate spatial heterogeneity in Polymerase II dynamics in live U2OS cells. Further, we provide detailed measurements of human-Yes-associated protein diffusion dynamics in a human gastric cancer epithelial cell line. Copyright © 2017 Biophysical Society. Published by Elsevier Inc. All rights reserved.

Dependence of dipole transition gamma ray strength on the type of nucleus

International Nuclear Information System (INIS)

Cojocaru, V.; Stefanescu, Irina; Popescu, I.V.; Badica, T.; Olariu, A.

2000-01-01

The strength of gamma-ray transition is defined as the ratio between the experimental radiative width Γ γ and the theoretical radiative width calculated according to a model (for example Weisskopf single particle model, Γ W ). It is important to know on which parameters this strengths depend. In our previous work we put in evidence the dependence of the dipole transition gamma-ray strengths on the type of the nucleus. In this paper we look for a possible dependence of the quadrupole gamma-ray strengths on the type of nucleus (doubly-even, doubly-odd, with odd proton number and odd neutron number). All the input data are taken from the National Nuclear Data Center, Brookhaven. In order to demonstrate this possible dependence one can use the average of the strongest 10% transitions of given character. As the A dependence is concerned we use the following A-regions: 6-20, 21-44, 45-90, 91-150, 151-200. An average value for these transitions is also plotted both for the E2 and M2 transitions. Generally, all the functions log 10 vs A (S=Γ γ /Γ W ) have the same pattern as 'total' put in evidence by Endt. Moreover, there is a clear difference in the most A regions of the average S 10 values for different types of nuclei. As the RUL (Recommended Upper Limits W.u.) are concerned they have to be established as the highest experimental values of the transition strengths. In this work we suggest new RUL but this time in connection with the type of the nucleus. A table with the RUL depending on the nuclear type, for E2 and M2 transitions, respectively, is given. The number of M2 transitions is quite small. In this case, one might set the recommended upper limits with some precaution. (authors)

New isomers in the neutron-rich A∼190 mass region

International Nuclear Information System (INIS)

Caamano, M.

2002-02-01

Previously unobserved isomeric states in 188 Ta, 190 W, 192 Re, 193 Re, 195 Os, 197 Ir, 198 Ir, 200 Pt, 201 Pt, 202 Pt and 203 Au, with half-lives ranging from 10 ns to 290 μs have been populated and studied using a fragmentation reaction in conjunction with a forward focussing spectrometer. In most cases, this provided the first ever spectroscopic data made available for the nucleus, and 200 Pt presented the first new seniority 4 state, on the basis of γ-γ coincidences, following a fragmentation reaction. Half-lives have been measured and tentative level schemes have been drawn for each isomer, spins and parities being consistent with blocked BCS calculations, hindrance factors, systematics and the relative intensities of γ-rays and X-rays (where possible). Isomeric ratios have been measured, values ranging from 1 % to 64 %. Potential Energy Surface calculations were performed in parallel to the blocked BCS calculations, in order to provide deformation parameters, excitation energies and quasiparticle configurations. Ground state (or lowest level) shape calculations reveal a change from axially symmetric, through triaxial, to spherical shapes across the data set, from 188 Ta to 203 Au, as 208 Pb is approached. Weisskopf hindrance factors provide evidence for the erosion of the goodness of the K-quantum number, compatible with soft or axially symmetric shapes. The prolate-oblate phase transition region, with respect to tungsten, osmium and platinum, shows 195 Os to be the pivotal nucleus in the osmium isotopic chain, with a calculated triaxial ground state. On comparison with the systematics of the region, results obtained for 190 W show evidence for a Z ≤ 74 sub-shell closure, analogous to that at Z = 64. Finally, new isotopes, 167 Tb, 170 Dy and 199 Ir were discovered. (author)

Decay Properties of the Halo Nucleus $^{11}$Li

CERN Multimedia

2002-01-01

During the past years a considerable experimental effort has been devoted to the production and study of nuclei close to the neutron and proton drip-lines. The most spectacular phenomenon encountered is the occurrence of neutron halos in the loosely bound neutron rich nuclei. \\\\ \\\\ Another interesting feature, observed at ISOLDE, which most likely is connected to the halo structure, is the very strong (super-allowed) Gamow-Teller $\\beta$- transitions to highly excited states which are systematically observed for the lightest neutron rich drip-line nuclei. These transitions might be viewed as arising from the quasi-free $\\beta$ -decay of the halo neutrons. It is proposed to make a detailed study of the $\\beta$- strength function for $^{11}$Li, a nuclide having a half-life of 8.2 ms and a Q $\\beta$-value of 20.73~MeV. \\\\ \\\\ So far only a lower limit of the Gamow-Teller transition rate to highly excited states ($\\approx$~18.5~MeV) in the daughter nucleus has been obtained from measurements of $\\beta$-delayed tri...

A possible island of beta-delayed neutron precursors in heavy nucleus region

International Nuclear Information System (INIS)

Zhang Li

1991-01-01

The possible Beta-Delayed neutron precursors in the elements Tl, Hg, and Au were predicted following a systematic research on the known Beta-Delayed neutron precursors. The masses of the unknown nuclei and neutron emission probabilities were calculated

Momentum loss in proton-nucleus and nucleus-nucleus collisions

International Nuclear Information System (INIS)

Khan, F.; Townsend, L.W.

1993-12-01

An optical model description, based on multiple scattering theory, of longitudinal momentum loss in proton-nucleus and nucleus-nucleus collisions is presented. The crucial role of the imaginary component of the nucleon-nucleon transition matrix in accounting for longitudinal momentum transfer is demonstrated. Results obtained with this model are compared with Intranuclear Cascade (INC) calculations, as well as with predictions from Vlasov-Uehling-Uhlenbeck (VUU) and quantum molecular dynamics (QMD) simulations. Comparisons are also made with experimental data where available. These indicate that the present model is adequate to account for longitudinal momentum transfer in both proton-nucleus and nucleus-nucleus collisions over a wide range of energies

Neutron detection using Dy2O3 activation detectors

International Nuclear Information System (INIS)

Gomaa, M.A.; Mohamed, E.J.

1979-01-01

The aim of the present study is to examine the usefulness of Dy 2 O 3 not only as thermal neutron activation detector but also as a fast neutron detector. For thermal neutrons, the half life of 165 Dy is measured to be (141 +- 6) min, its response to thermal neutrons is (2.18 +- 0.01) cpm/ncm -2 s -1 for a 250 mg Dy 2 O 3 pellet. For fast neutrons the Dy 2 O 3 detector is placed within a 20 cm polyethylene sphere and its response is found to be (2.2 +- 0.1) cpm/ncm -2 s -1 for 4 MeV neutrons and (2.10 +- 0.04) cpm/ncm -2 s -1 for 14 MeV neutrons. For neutron dosimetry, its response is found to be (16.7 +- 0.4) cpm per mrem h -1 . (author)

Shape coexistence in the neutron-deficient mercury isotopes studied through Coulomb excitation

CERN Document Server

Bree, Nick

This thesis describes the analysis and results of a series of Coulomb-excitation experiments on even-even neutron-deficient mercury isotopes aimed at obtaining a more detailed description of shape coexistence. Two experimental campaigns have been undertaken in the Summer of 2007 and 2008. Pure beams of 182,184,186,188Hg were produced and accelerated at the REX-ISOLDE radioactive-beam facility, located at CERN (Geneva, Switzerland). The beams were guided to collide with a stable target to induce Coulomb excitation. The scattered particles were registered by a double-sided silicon strip detector, and the emitted gamma rays by the MINIBALL gamma-ray spectrometer. The motivation to study these mercury isotopes, focused around shape coexistence in atomic nuclei, is addressed in chapter 1, as well as an overview of the knowledge in this region of the nuclear chart. A theoretical description of Coulomb excitation is presented in the second chapter, while the third chapter describes the setup employed for the experim...

High resolution neutron spectroscopy for helium isotopes

International Nuclear Information System (INIS)

Abdel-Wahab, M.S.; Klages, H.O.; Schmalz, G.; Haesner, B.H.; Kecskemeti, J.; Schwarz, P.; Wilczynski, J.

1992-01-01

A high resolution fast neutron time-of-flight spectrometer is described, neutron time-of-flight spectra are taken using a specially designed TDC in connection to an on-line computer. The high time-of-flight resolution of 5 ps/m enabled the study of the total cross section of 4 He for neutrons near the 3/2 + resonance in the 5 He nucleus. The resonance parameters were determined by a single level Breit-Winger fit to the data. (orig.)

A study of dissipative phenomena using Orion, a 4 π sectorized neutron detector

International Nuclear Information System (INIS)

Galin, J.; Guerreau, D.; Morjean, M.; Pouthas, J.; Saint-Laurent, F.; Sokolov, A.; Wang, X.M.; Piasecki, E.; Charvet, J.L.; CEA Centre d'Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette

1990-01-01

When studying the behavior of hot nuclei, the challenge is twofold: how are they formed in nucleus-nucleus collisions and how do they decay. For heavy and, thus neutron rich systems a large fraction of the thermalized energy is evacuated by neutron evaporation. Therefore the numbering, event-wise, of neutrons, over 4 π, gives a strong handle on energy dissipation for the different reaction channels. The first neutron measurements of this kind were performed using spherical detectors made of two hemispheres. Since then, a new and larger 4 π detector, ORION, has been designed in order to get information on the spatial distribution of the neutrons. The main characteristics of ORION are described and a few examples are given in order to illustrate the capabilities of such a detector in the study of dissipative collisions

Dicty_cDB: VFH167 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available VF (Link to library) VFH167 (Link to dictyBase) - - - Contig-U16272-1 VFH167P (Link... to Original site) VFH167F 641 VFH167Z 348 VFH167P 989 - - Show VFH167 Library VF (Link to library) Clone ID VFH167 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16272-1 Original site URL http://dict...omology vs DNA Score E Sequences producing significant alignments: (bits) Value N L08391 |L08391.1 Dictyoste...) Homo sapiens cDNA FLJ35376 fis, cl... 320 5e-86 AF401554_1( AF401554 |pid:none) Ictalurus punctatus riboso

Mechanisms of High Energy Hadron-Nucleus and Nucleus-Nucleus Collision Processes

International Nuclear Information System (INIS)

Strugalski, Z.

1994-01-01

Mechanisms of high energy hadron-nucleus and nucleus-nucleus collision processes are depicted qualitatively, as prompted experimentally. In hadron-nucleus collisions the interaction of the incident hadron in intranuclear matter is localized in small cylindrical volume, with the radius as large as the strong interaction range is, centered on the hadron course in the nucleus. The nucleon emission is induced by the hadron in its passing through the nucleus; particles are produced via intermediate objects produced in 2 → 2 endoergic reactions of the hadron and its successors with downstream nucleons. In nucleus-nucleus collisions, the outcome of the reaction appears as the composition of statistically independent hadron-nucleus collision outcomes at various impact parameters. Observable effects supporting such mechanisms are discussed. 51 refs

Hepatitis B virus HBx protein localized to the nucleus restores HBx-deficient virus replication in HepG2 cells and in vivo in hydrodynamically-injected mice

International Nuclear Information System (INIS)

Keasler, Victor V.; Hodgson, Amanda J.; Madden, Charles R.; Slagle, Betty L.

2009-01-01

Identifying the requirements for the regulatory HBx protein in hepatitis B virus (HBV) replication is an important goal. A plasmid-based HBV replication assay was used to evaluate whether HBx subcellular localization influences its ability to promote virus replication, as measured by real time PCR quantitation of viral capsid-associated DNA. HBx targeted to the nucleus by a nuclear localization signal (NLS-HBx) was able to restore HBx-deficient HBV replication, while HBx containing a nuclear export signal (NES-HBx) was not. Both NLS-HBx and NES-HBx were expressed at similar levels (by immunoprecipitation and Western blotting), and proper localization of the signal sequence-tagged proteins was confirmed by deconvolution microscopy using HBx, NLS-HBx, and NES-HBx proteins fused to GFP. Importantly, these findings were confirmed in vivo by hydrodynamic injection into mice. Our results demonstrate that in these HBV replication assays, at least one function of HBx requires its localization to the nucleus.

Test of statistical models of the ν-delayed neutron emission by application of the Monte Carlo method

International Nuclear Information System (INIS)

Ohm, H.

1982-01-01

Using the example of the delayed neutron spectrum of 24 s- 137 I the statistical model is tested in view of its applicability. A computer code was developed which simulates delayed neutron spectra by the Monte Carlo method under the assumption that the transition probabilities of the ν and the neutron decays obey the Porter-Thomas distribution while the distances of the neutron emitting levels are Wigner distribution. Gramow-Teller ν-transitions and simply forbidden ν-transitions from the preceding nucleus to the emitting nucleus were regarded. (orig./HSI) [de

Tangential channel for nuclear gamma-resonance spectroscopy in thermal neutron capture

International Nuclear Information System (INIS)

Belogurov, V.N.; Bondars, H.Ya.; Lapenas, A.A.; Reznikov, R.S.; Senkov, P.E.

1979-01-01

Design of a tangential reactor channel which has been made to replace the radial one in the pulsed research reactor IRT-2000 is described. It allows to use the same hole in biological reactor schielding. Characteristics of neutron and gamma-background spectra at the excit of the channel are given and compared with analogous characteristics of the radial one. The gamma background in the tangential channel is lower than in the radial channel. The gamma spectra in the Gd 155 (n, γ)Gd 156 , Gd 157 (n, γ)Gd 158 , Er 167 (n, γ)Er 168 and Hf 177 (n, γ)Hf 178 reactions show that the application of X-ray detection units BDR with the tangential channel allows to carry out the gamma spectrometry of gamma quanta emitted in the thermal neutron capture by both high and low neutron capture cross section nuclei (e.g., Gdsup(157, 155) and Er 167 , Hf 177 , respectively)

Quantum recurrence and integer ratios in neutron resonances

Energy Technology Data Exchange (ETDEWEB)

Ohkubo, Makio

1998-03-01

Quantum recurrence of the compound nucleus in neutron resonance reactions are described for normal modes which are excited on the compound nucleus simultaneously. In the structure of the recurrence time, integer relations among dominant level spacings are derived. The `base modes` are assumed as stable combinations of the normal modes, preferably excited in many nuclei. (author)

Fission decay properties of ultra neutron-rich uranium isotopes

Indian Academy of Sciences (India)

in the chain of neutron-rich uranium isotopes is examined here. The neutron ... mean field theory, this nucleus is shown to undergo exotic decay mode of thermal neu- .... For 250U with a fission barrier of 4.3 MeV [5], we obtain the value of.

37 CFR 1.167 - Examination.

Science.gov (United States)

2010-07-01

... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Examination. 1.167 Section 1.167 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF... Examination. Applications may be submitted by the Patent and Trademark Office to the Department of Agriculture...

Neutron-deuteron breakup experiment at En=13 MeV: Determination of the 1S0 neutron-neutron scattering length ann

International Nuclear Information System (INIS)

Gonzalez Trotter, D.E.; Meneses, F. Salinas; Tornow, W.; Howell, C.R.; Chen, Q.; Crowell, A.S.; Roper, C.D.; Walter, R.L.; Schmidt, D.; Witala, H.; Gloeckle, W.; Tang, H.; Zhou, Z.; Slaus, I.

2006-01-01

We report on results of a kinematically complete neutron-deuteron breakup experiment performed at Triangle Universities Nuclear Laboratory using an E n =13 MeV incident neutron beam. The 1 S 0 neutron-neutron scattering length a nn has been determined for four production angles of the neutron-neutron final-state interaction configuration. The absolute cross-section data were analyzed with rigorous three-nucleon calculations. Our average value of a nn =-18.7±0.7 fm is in excellent agreement with a nn =-18.6±0.4 fm obtained from capture experiments of negative pions on deuterons. We also performed a shape analysis of the final-state interaction cross-section enhancements by allowing the normalization of the data to float. From these relative data, we obtained an average value of a nn =-18.8±0.5 fm, in agreement with the result obtained from the absolute cross-section measurements. Our result deviates from the world average of a nn =-16.7±0.5 fm determined from previous kinematically complete neutron-deuteron breakup experiments, including the most recent one carried out at Bonn. However, this low value for a nn is at variance with theoretical expectation and other experimental information about the sign of charge-symmetry breaking of the nucleon-nucleon interaction. In agreement with theoretical predictions, no evidence was found of significant three-nucleon force effects on the neutron-neutron final-state interaction cross sections

Antiproton production in nucleon-nucleus and nucleus-nucleus collisions at the CERN-SPS

International Nuclear Information System (INIS)

Kadija, K.; Schmitz, N.; Seyboth, P.

1996-01-01

A model for antiproton production in nucleon-nucleus and nucleus-nucleus collisions at 200 GeV per nucleon, based on the wounded nucleon model is developed. The predictions are compared to published nucleon-nucleus and sulphur-nucleus data. The results suggest the presence of similar antiproton production processes in nucleon-nucleus and nucleus-nucleus collisions near midrapidity. (orig.)

Development of global medium-energy nucleon-nucleus optical model potentials

International Nuclear Information System (INIS)

Madland, D.G.; Sierk, A.J.

1997-01-01

The authors report on the development of new global optical model potentials for nucleon-nucleus scattering at medium energies. Using both Schroedinger and Dirac scattering formalisms, the goal is to construct a physically realistic optical potential describing nucleon-nucleus elastic scattering observables for a projectile energy range of (perhaps) 20 meV to (perhaps) 2 GeV and a target mass range of 16 to 209, excluding regions of strong nuclear deformation. They use a phenomenological approach guided by conclusions from recent microscopic studies. The experimental database consists largely of proton-nucleus elastic differential cross sections, analyzing powers, spin-rotation functions, and total reaction cross sections, and neutron-nucleus total cross sections. They will use this database in a nonlinear least-squares adjustment of optical model parameters in both relativistic equivalent Schroedinger (including relativistic kinematics) and Dirac (second-order reduction) formalisms. Isospin will be introduced through the standard Lane model and a relativistic generalization of that model

Coulomb Excitation of a Neutron-Rich $^{88}$Kr Beam Search for Mixed Symmetry States

CERN Multimedia

Andreoiu, C; Napiorkowski, P J; Iwanicki, J S

2002-01-01

We propose to use the ISOLDE/REX/MINIBALL/CD set-up to perform a Coulomb Excitation experiment with a $^{88}$Kr radioactive beam. The motivation includes a search for $Mixed$ $Symmetry$ states predicted by the IBM-2 model, gathering more spectroscopy data about the $^{88}$Kr nucleus and extending shape coexistence studies (performed previously by the proposers for neutron-deficient Kr isotopes) to the neutron-rich side. The proposed experiment will provide data complementary to the Coulomb Excitation of a relativistic $^{88}$Kr beam proposed by D. Tonev et al. for a RISING experiment. A total of 12 days of beam time is necessary for the experiment, equally divided into two runs. One run with a 2.2 MeV/A beam energy on a $^{48}$Ti target and a second run with the maximum available REX energy of 3.1 MeV/A on a $^{208}$Pb target are requested. Using either a UC$_{x}$ or ThC$_{x}$ fissioning primary target coupled with a plasma source by a cooled transfer line seems to be the best choice for the proposed experime...

Nucleus-nucleus total reaction cross sections

International Nuclear Information System (INIS)

DeVries, R.M.; Peng, J.C.

1980-01-01

We compare sigma/sub R/(E) for nucleus-nucleus systems (obtained from existing direct measurements and derived from elastic scattering data) with nucleon-nucleon and nucleon-nucleus data. The energy dependence of sigma/sub R/(E) for nucleus-nucleus systems is found to be quite rapid; there appears to be no evidence for an energy independent, geometric sigma/sub R/. Simple parameter free microscopic calculations are able to quantitatively reproduce the data and thus, emphasize the dominance of nucleon-nucleon interactions in medium energy nucleus-nucleus collisions

Neutron-rich polonium isotopes studied with in-source laser spectroscopy

CERN Document Server

Dexters, Wim; Cocolios, T E

This work studies the unknown region of neutron rich polonium isotopes. The polonium isotopes, with Z=84, lie above the magic lead nuclei (Z=82). The motivation for this research can mainly be found in these lead nuclei. When looking at the changes in the mean square charge radii beyond the N=126 shell gap, a kink is observed. This kink is also found in the radon (Z=86) and radium (Z=88) isotopes. The observed effect cannot be reproduced with our current models. The polonium isotopes yield more information on the kink and they are also able to link the known charge radii in lead isotopes to those in radon and radium. Additionally, the nuclear moments of the odd-neutron isotope $^{211}$Po are investigated. This nucleus has two protons and one neutron more than the doubly magic nucleus $^{208}$Pb. Nuclear moments of isotopes close to this doubly magic nucleus are good tests for the theoretic models. Besides pushing the models to their limits, the nuclear moments of $^{211}$Po also yield new information on the f...

Nucleus-Nucleus Collision as Superposition of Nucleon-Nucleus Collisions

International Nuclear Information System (INIS)

Orlova, G.I.; Adamovich, M.I.; Aggarwal, M.M.; Alexandrov, Y.A.; Andreeva, N.P.; Badyal, S.K.; Basova, E.S.; Bhalla, K.B.; Bhasin, A.; Bhatia, V.S.; Bradnova, V.; Bubnov, V.I.; Cai, X.; Chasnikov, I.Y.; Chen, G.M.; Chernova, L.P.; Chernyavsky, M.M.; Dhamija, S.; Chenawi, K.El; Felea, D.; Feng, S.Q.; Gaitinov, A.S.; Ganssauge, E.R.; Garpman, S.; Gerassimov, S.G.; Gheata, A.; Gheata, M.; Grote, J.; Gulamov, K.G.; Gupta, S.K.; Gupta, V.K.; Henjes, U.; Jakobsson, B.; Kanygina, E.K.; Karabova, M.; Kharlamov, S.P.; Kovalenko, A.D.; Krasnov, S.A.; Kumar, V.; Larionova, V.G.; Li, Y.X.; Liu, L.S.; Lokanathan, S.; Lord, J.J.; Lukicheva, N.S.; Lu, Y.; Luo, S.B.; Mangotra, L.K.; Manhas, I.; Mittra, I.S.; Musaeva, A.K.; Nasyrov, S.Z.; Navotny, V.S.; Nystrand, J.; Otterlund, I.; Peresadko, N.G.; Qian, W.Y.; Qin, Y.M.; Raniwala, R.; Rao, N.K.; Roeper, M.; Rusakova, V.V.; Saidkhanov, N.; Salmanova, N.A.; Seitimbetov, A.M.; Sethi, R.; Singh, B.; Skelding, D.; Soderstrem, K.; Stenlund, E.; Svechnikova, L.N.; Svensson, T.; Tawfik, A.M.; Tothova, M.; Tretyakova, M.I.; Trofimova, T.P.; Tuleeva, U.I.; Vashisht, Vani; Vokal, S.; Vrlakova, J.; Wang, H.Q.; Wang, X.R.; Weng, Z.Q.; Wilkes, R.J.; Yang, C.B.; Yin, Z.B.; Yu, L.Z.; Zhang, D.H.; Zheng, P.Y.; Zhokhova, S.I.; Zhou, D.C.

1999-01-01

Angular distributions of charged particles produced in 16 O and 32 S collisions with nuclear track emulsion were studied at momenta 4.5 and 200 A GeV/c. Comparison with the angular distributions of charged particles produced in proton-nucleus collisions at the same momentum allows to draw the conclusion, that the angular distributions in nucleus-nucleus collisions can be seen as superposition of the angular distributions in nucleon-nucleus collisions taken at the same impact parameter b NA , that is mean impact parameter between the participating projectile nucleons and the center of the target nucleus

Nucleus-Nucleus Collision as Superposition of Nucleon-Nucleus Collisions

Energy Technology Data Exchange (ETDEWEB)

Orlova, G I; Adamovich, M I; Aggarwal, M M; Alexandrov, Y A; Andreeva, N P; Badyal, S K; Basova, E S; Bhalla, K B; Bhasin, A; Bhatia, V S; Bradnova, V; Bubnov, V I; Cai, X; Chasnikov, I Y; Chen, G M; Chernova, L P; Chernyavsky, M M; Dhamija, S; Chenawi, K El; Felea, D; Feng, S Q; Gaitinov, A S; Ganssauge, E R; Garpman, S; Gerassimov, S G; Gheata, A; Gheata, M; Grote, J; Gulamov, K G; Gupta, S K; Gupta, V K; Henjes, U; Jakobsson, B; Kanygina, E K; Karabova, M; Kharlamov, S P; Kovalenko, A D; Krasnov, S A; Kumar, V; Larionova, V G; Li, Y X; Liu, L S; Lokanathan, S; Lord, J J; Lukicheva, N S; Lu, Y; Luo, S B; Mangotra, L K; Manhas, I; Mittra, I S; Musaeva, A K; Nasyrov, S Z; Navotny, V S; Nystrand, J; Otterlund, I; Peresadko, N G; Qian, W Y; Qin, Y M; Raniwala, R; Rao, N K; Roeper, M; Rusakova, V V; Saidkhanov, N; Salmanova, N A; Seitimbetov, A M; Sethi, R; Singh, B; Skelding, D; Soderstrem, K; Stenlund, E; Svechnikova, L N; Svensson, T; Tawfik, A M; Tothova, M; Tretyakova, M I; Trofimova, T P; Tuleeva, U I; Vashisht, Vani; Vokal, S; Vrlakova, J; Wang, H Q; Wang, X R; Weng, Z Q; Wilkes, R J; Yang, C B; Yin, Z B; Yu, L Z; Zhang, D H; Zheng, P Y; Zhokhova, S I; Zhou, D C

1999-03-01

Angular distributions of charged particles produced in {sup 16}O and {sup 32}S collisions with nuclear track emulsion were studied at momenta 4.5 and 200 A GeV/c. Comparison with the angular distributions of charged particles produced in proton-nucleus collisions at the same momentum allows to draw the conclusion, that the angular distributions in nucleus-nucleus collisions can be seen as superposition of the angular distributions in nucleon-nucleus collisions taken at the same impact parameter b{sub NA}, that is mean impact parameter between the participating projectile nucleons and the center of the target nucleus.

Nucleus-nucleus collision as superposition of nucleon-nucleus collisions

International Nuclear Information System (INIS)

Orlova, G.I.; Adamovich, M.I.; Aggarwal, M.M.

1999-01-01

Angular distributions of charged particles produced in 16 O and 32 S collisions with nuclear track emulsion were studied at momenta 4.5 and 200 A GeV/c. Comparison with the angular distributions of charged particles produced in proton-nucleus collisions at the same momentum allows to draw the conclusion, that the angular distributions in nucleus-nucleus collisions can be seen as superposition of the angular distributions in nucleon-nucleus collisions taken at the same impact parameter b NA , that is mean impact parameter between the participating projectile nucleons and the center of the target nucleus. (orig.)

7 CFR 3015.167 - Replacement of equipment.

Science.gov (United States)

2010-01-01

... 7 Agriculture 15 2010-01-01 2010-01-01 false Replacement of equipment. 3015.167 Section 3015.167..., DEPARTMENT OF AGRICULTURE UNIFORM FEDERAL ASSISTANCE REGULATIONS Property § 3015.167 Replacement of equipment. (a) If needed, equipment may be exchanged for replacement equipment. Replacement of equipment may be...

33 CFR 117.167 - Little Potato Slough.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Little Potato Slough. 117.167 Section 117.167 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.167 Little Potato Slough. The draw of...

Neutrons moderation theory; Theorie du ralentissement des neutrons

Energy Technology Data Exchange (ETDEWEB)

Vigier, J P

1949-07-01

This report gives a summarized presentation of the theory of fast neutrons diffusion and moderation in a given environment as elaborated by M. Langevin, E. Fermi, R. Marshak and others. This statistical theory is based on three assumptions: there is no inelastic diffusion, the elastic diffusion has a spherical symmetry with respect to the center of gravity of the neutron-nucleus system (s-scattering), and the effects of chemical bonds and thermal agitation of nuclei are neglected. The first chapter analyzes the Boltzmann equation of moderation, its first approximate solution (age-velocity equation) and its domain of validity, the extension of the age-velocity theory (general solution) and the boundary conditions, the upper order approximation (spherical harmonics method and Laplace transformation), the asymptotic solutions, and the theory of spatial momenta. The second chapter analyzes the energy distribution of delayed neutrons (stationary and non-stationary cases). (J.S.)

Parity violation in the compound nucleus

International Nuclear Information System (INIS)

Mitchell, G. E.; Crawford, B. E.; Grossmann, C. A.; Lowie, L. Y.; Bowman, J. D.; Knudson, J.; Penttilae, S.; Seestrom, S. J.; Smith, D. A.; Yen, Yi-Fen; Yuan, V. W.; Delheij, P. P. J.; Haseyama, T.; Masaike, A.; Matsuda, Y.; Postma, H.; Roberson, N. R.; Sharapov, E. I.; Stephenson, S. L.

1999-01-01

Measurements have been performed on the helicity dependence of the neutron resonance cross section for many nuclei by our TRIPLE Collaboration. A large number of parity violations are observed. Generic enhancements amplify the signal for symmetry breaking and the stochastic properties of the compound nucleus permit the strength of the symmetry-breaking interaction to be determined without knowledge of the wave functions of individual states. A total of 15 nuclei have been analyzed with this statistical approach. The results are summarized

Study of the neutron-photon competition during fission fragment de-excitation

International Nuclear Information System (INIS)

Min, Dong Pil.

1976-01-01

A program was developed to study in detail the competition between neutron and photon emissions during the different stages of the nucleus de-excitation. The main conclusions of this work are the following: the neutron-photon competition fairly depends of the initial spin of the primary fragment. It has a strong effect on the mean number of emitted neutrons, on the photon energy, and to a lower degree, on the mean energy per neutron. A relation between the mean initial spin of the heavy fragment for the almost symmetrical fission, the mean initial spin of the heavy fragment for a very asymmetric fission and the corresponding values of the mean number of emitted neutrons is given. The mean initial excitation energy must increase of about 9MeV for the nucleus to emit one more neutron. Two reasons are given to explain the fact that the measured neutron multiplicity variance is higher for the heavy fragment than for the light one: either the existence of a covariance between spin and excitation energy distribution, or a dispersion of the values of the mean number of emitted neutrons due to the mass and charge distribution resulting from experimental incertitudes. The mean energy per neutron calculated with the program is in good agreement with measured values [fr

Neutron penetrabilities using an optical model potential (1963); Penetrabilites des neutrons selon le modele du potentiel optique (1963)

Energy Technology Data Exchange (ETDEWEB)

Mani, G S; Melkanoff, M A; Iori, I [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1963-07-01

The neutron penetrabilities and reaction cross-sections are presented in these tables for the case of an optical model potential for the nucleus, for nuclei up to mass 230. (authors) [French] Les penetrabilites et les sections efficaces de reaction pour les neutrons sont donnees dans ces tables en utilisant le modele du potentiel optique, pour les noyaux cibles jusqu'a la masse 230. (auteurs)

Neutron penetrabilities using an optical model potential (1963); Penetrabilites des neutrons selon le modele du potentiel optique (1963)

Energy Technology Data Exchange (ETDEWEB)

Mani, G.S.; Melkanoff, M.A.; Iori, I. [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1963-07-01

The neutron penetrabilities and reaction cross-sections are presented in these tables for the case of an optical model potential for the nucleus, for nuclei up to mass 230. (authors) [French] Les penetrabilites et les sections efficaces de reaction pour les neutrons sont donnees dans ces tables en utilisant le modele du potentiel optique, pour les noyaux cibles jusqu'a la masse 230. (auteurs)

Neutron spectrum for neutron capture therapy in boron; Espectro de neutrones para terapia por captura de neutrones en boro

Energy Technology Data Exchange (ETDEWEB)

Medina C, D.; Soto B, T. G. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Programa de Doctorado en Ciencias Basicas, 98068 Zacatecas, Zac. (Mexico); Baltazar R, A. [Universidad Autonoma de Zacatecas, Unidad Academica de Ingenieria Electrica, Programa de Doctorado en Ingenieria y Tecnologia Aplicada, 98068 Zacatecas, Zac. (Mexico); Vega C, H. R., E-mail: dmedina_c@hotmail.com [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico)

2016-10-15

Glioblastoma multiforme is the most common and aggressive of brain tumors and is difficult to treat by surgery, chemotherapy or conventional radiation therapy. One treatment alternative is the Neutron Capture Therapy in Boron, which requires a beam modulated in neutron energy and a drug with {sup 10}B able to be fixed in the tumor. When the patients head is exposed to the neutron beam, they are captured by the {sup 10}B and produce a nucleus of {sup 7}Li and an alpha particle whose energy is deposited in the cancer cells causing it to be destroyed without damaging the normal tissue. One of the problems associated with this therapy is to have an epithermal neutrons flux of the order of 10{sup 9} n/cm{sup 2}-sec, whereby irradiation channels of a nuclear research reactor are used. In this work using Monte Carlo methods, the neutron spectra obtained in the radial irradiation channel of the TRIGA Mark III reactor are calculated when inserting filters whose position and thickness have been modified. From the arrangements studied, we found that the Fe-Cd-Al-Cd polyethylene filter yielded a ratio between thermal and epithermal neutron fluxes of 0.006 that exceeded the recommended value (<0.05), and the dose due to the capture gamma rays is lower than the dose obtained with the other arrangements studied. (Author)

Identification of new nuclei at and beyond the proton drip-line near the doubly-magic nucleus {sup 100}Sn

Energy Technology Data Exchange (ETDEWEB)

Anne, R; Auger, G; Bazin, D; Corre, J M; Hue, R; Lewitowicz, M; Saint-Laurent, M G [Grand Accelerateur National d` Ions Lourds (GANIL), 14 - Caen (France); Rykaczewski, K; Grzywacz, R [Warsaw Univ. (Poland). Inst. Fizyki Doswiadczalnej; [Grand Accelerateur National d` Ions Lourds (GANIL), 14 - Caen (France); Pfuetzner, M; Zylicz, J [Warsaw Univ. (Poland). Inst. Fizyki Doswiadczalnej; Borcea, C [Institute of Atomic Physics, Bucharest (Romania); Borrel, V; Guillemaud-Mueller, D; Mueller, A C; Pougheon, F; Sorlin, O [Paris-11 Univ., 91 - Orsay (France). Inst. de Physique Nucleaire; Doerfler, T; Schmidt-Ott, W D [Goettingen Univ. (Germany); Fomichov, A; Penionzhkevich, Y [Joint Inst. for Nuclear Research, Dubna (Russian Federation); Lukyanov, S; Tarasov, O [Joint Inst. for Nuclear Research, Dubna (Russian Federation); [Grand Accelerateur National d` Ions Lourds (GANIL), 14 - Caen (France); Huyse, M; Szerypo, J; Wauters, J [Louvain Univ. (Belgium). Inst. for Nuclear- and Radiationphysics; Janas, Z; Keller, H; Schmidt, K [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany)

1994-12-31

The new neutron-deficient nuclei {sup 103}Sb, {sup 104}Sb, {sup 98}In, {sup 91}Pd, {sup 89}Rh and {sup 87}Ru have been identified among the quasi-fragmentation products of a {sup 112}Sn beam (63 MeV/nucleon). The fragment identification based on energy-loss, total kinetic energy and time-of-flight measurements has been independently confirmed via observation of {gamma}-radiation following the decay of known short-lived isomers. The region of known isotopes is extended to the predicted proton drip-line for indium and silver, and beyond it for antimony and rhodium. Tentative evidence for the existence of {sup 105}Te, {sup 99}Sn and {sup 93}Ag is also presented. (authors). 28 refs., 2 figs.

Different surface sensing of the cell body and nucleus in healthy primary cells and in a cancerous cell line on nanogrooves.

Science.gov (United States)

Davidson, Patricia M; Bigerelle, Maxence; Reiter, Günter; Anselme, Karine

2015-10-01

Cancer cells are known to have alterations compared to healthy cells, but can these differences extend to the way cells interact with their environment? Here, the authors focused on the alignment on an array of grooves of nanometer depth using two cell types: healthy osteoprogenitor primary cells (HOP) and a cancerous osteosarcoma (SaOs-2) cell line. Another concern was how this alignment affects the cell's interior, namely, the nucleus. Based on the results, it is proposed that these two cell types respond to different size regimes: SaOs-2 cells are more sensitive to shallow grooves while HOP cells are strongly aligned with deep grooves. As a measure of the impact of cell alignment on the nucleus the orientation and elongation of the nucleus were determined. Compared to HOP cells, the cell nucleus of SaOs-2 cells is more aligned and elongated in response to grooves, suggesting a softer nucleus and/or increased force transmission. These results support the hypothesis that cancer cells have reduced nucleus rigidity compared to healthy ones and further indicate differences in sensing, which may be important during metastasis.

Thermal Bremsstrahlung probing nuclear multifragmentation in nucleus-nucleus collisions around the Fermi energy; Bremsstrahlung thermique comme sonde de la multifragmentation nucleaire dans les collisions noyau-noyau aux energies de Fermi

Energy Technology Data Exchange (ETDEWEB)

D' Enterria, D.G

2000-05-15

The thermodynamical properties of nuclear matter at moderate temperatures and densities, in the vicinity of the predicted nuclear liquid-gas phase transition, are studied using as experimental probe the hard-photons (E{sub {gamma}} > 30 MeV) emitted in nucleus-nucleus collisions. Photon and charged-particle production in four different heavy-ion reactions (Ar{sup 36} + Au{sup 197}, Ag{sup 107}, Ni{sup 58}, C{sup 12} at 60 A*MeV) is measured exclusively and inclusively coupling the TAPS photon spectrometer with two charged-particle and intermediate-mass-fragment detectors covering nearly 4{pi}. We confirm that Bremsstrahlung emission in first-chance (off-equilibrium) proton-neutron collisions (pn{gamma}) is the dominant origin of hard photons. We also firmly establish the existence of a thermal radiation component emitted in second-chance proton-neutron collisions. This thermal Bremsstrahlung emission takes place in semi-central and central nucleus-nucleus reactions involving heavy targets. We exploit this observation i) to demonstrate that thermal equilibrium is reached during the reaction, ii) to establish a new thermometer of nuclear matter based on Bremsstrahlung photons, iii) to derive the thermodynamical properties of the excited nuclear sources and, in particular, to establish a 'caloric curve' (temperature versus excitation energy), and iv) to assess the time-scales of the nuclear break-up process. (author)

26 CFR 1.167(b)-4 - Other methods.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Other methods. 1.167(b)-4 Section 1.167(b)-4...) INCOME TAXES (CONTINUED) Itemized Deductions for Individuals and Corporations § 1.167(b)-4 Other methods. (a) Under section 167(b)(4) a taxpayer may use any consistent method of computing depreciation, such...

Some experimental results of the investigation of hadron-nucleus and nucleus-nucleus interactions

International Nuclear Information System (INIS)

Azimov, S.A.; Gulamov, K.G.; Chernov, G.M.

1978-01-01

Recent experimental data on the hadron-nucleus and nucleus-nucleus inelastic interactions are analyzed. A particular attention is paid to the description of the leading hadron spectra and of the spectra of nucleon recoils in hadron-nucleus interactions. Some of the results of the experimental studies of correlations between secondary particles are discussed. This discussion demonstrates that an analysis of the multiparticle phenomena is very promising regarding the discrimination between the different models for the hadron-nucleus and nucleus-nucleus interactions. It is pointed out that the actual mechanism of the hadron-nucleus and nucleus-nucleus interactions is a rather complex one and can be described comprehensively by none of the existing models

Future possibilities with intermediate-energy neutron beams

International Nuclear Information System (INIS)

Brady, F.P.

1987-01-01

Future possibilities for using neutrons of intermediate energies (50 - 200 MeV) as a probe of the nucleus are discussed. Some of the recent thinking concerning a systematic approach for studying elastic and inelastic scattering of electrons and hadrons and the important role of medium- and intermediate-energy neutrons in such a programme is reviewed. The advantages of neutrons in this energy range over neutrons with lower energies and over intermediate-energy pions for determining nuclear-transition and ground state densities, and for distinguishing proton from neutron density (isovector sensitivity), are noted. The important role of (n,p) charge exchange reactions in nuclear excitation studies is also reviewed. Experimental methods for utilizing neutrons as probes in elastic, inelastic, and charge exchange studies at these energies are discussed

The Re/Os Clock Revisited

CERN Multimedia

Leal, L C; Kitis, G; Guber, K H; Quaranta, A; Koehler, P E

2002-01-01

The purpose of the proposed project of an accurate measurement of the relevant neutron cross sections of $^{186}$Os and $^{187}$Os is to remove the principal nuclear physics uncertainties in the analysis of the Re/Os cosmochronometer. The necessary cross section information will be obtained in complementary experiments at the nTOF facility at CERN and at the Karlsruhe Van de Graaff accelerator. Transformation of these results into significantly improved stellar reaction rates will allow to evaluate the age of the elements in the framework of galactic chemical evolution models.

Integral high energy nuclon-nucleus cross sections for mathematical experiments with electronuclear facilities

International Nuclear Information System (INIS)

Barashenkov, V.S.; Gudowski, W.; Polanski, A.

1999-01-01

A parametrization of the integral cross sections σ nonel , σ tl , σ tot for the elastic nonelastic and total proton- and neutron-nucleus interactions is considered at medium and high energies. On the basis of this parametrization a code is created for the interpolational calculations of the integral cross sections for arbitrary target nuclei at proton energies E=1 MeV - 1 TeV and neutron energies E=12.5 MeV - 1 TeV

Study of the odd-${A}$, high-spin isomers in neutron-deficient trans-lead nuclei with ISOLTRAP

CERN Multimedia

Herfurth, F; Blaum, K; Beck, D; Kowalska, M; Schwarz, S; Stanja, J; Huyse, M L; Wienholtz, F

We propose to measure the excitation energy of the $\\frac{13^{+}}{2}$ isomers in the neutron-deficient isotopes $^{193,195,197}$Po with the ISOLTRAP mass spectrometer. The assignment of the low- and high-spin isomers will be made by measuring the energy of the $\\alpha$- particles emitted in the decay of purified beams implanted in a windmill system. Using $\\alpha$-decay information, it is then also possible to determine the excitation energy of the similar isomers in the $\\alpha$-daughter nuclei $^{189,191,193}$Pb, $\\alpha$-parent nuclei $^{197,199,201}$Rn, and $\\alpha$-grand-parent nuclei $^{201,203,205}$Ra. The polonium beams are produced with a UC$_{\\textrm{x}}$ target and using the RILIS.

46 CFR 167.45-80 - Fire axes.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Fire axes. 167.45-80 Section 167.45-80 Shipping COAST... Firefighting and Fire Prevention Requirements § 167.45-80 Fire axes. (a) All nautical school ships shall be provided with fire axes, as follows: Number of axes Gross tons of nautical school ships: All not over 50...

Measurement of Neutron Energy Spectrum Emitted by Cf-252 Source Using Time-of-Flight Method

Energy Technology Data Exchange (ETDEWEB)

Lee, Cheol Ho; Son, Jaebum; Kim, Tae Hoon; Lee, Sangmin; Kim, Yong-Kyun [Hanyang University, Seoul (Korea, Republic of)

2016-10-15

The techniques proposed to detect the neutrons usually require the detection of a secondary recoiling nucleus in a scintillator (or other type of detector) to indicate the rare collision of a neutron with a nucleus. This is the same basic technique, in this case detection of a recoil proton that was used by Chadwick in the 1930 s to discover and identify the neutron and determine its mass. It is primary technique still used today for detection of fast neutron, which typically involves the use of a hydrogen based organic plastic or liquid scintillator coupled to a photo-multiplier tube. The light output from such scintillators is a function of the cross section and nuclear kinematics of the n + nucleus collision. With the exception of deuterated scintillators, the scintillator signal does not necessarily produce a distinct peak in the scintillator spectrum directly related to the incident neutron energy. Instead neutron time-of-flight (TOF) often must be utilized to determine the neutron energy, which requires generation of a prompt start signal from the nuclear source emitting the neutrons. This method takes advantage of the high number of prompt gamma rays. The Time-of-Flight method was used to measure neutron energy spectrum emitted by the Cf-252 neutron source. Plastic scintillator that has a superior discrimination ability of neutron and gamma-ray was used as a stop signal detector and liquid scintillator was used as a stat signal detector. In experiment, neutron and gamma-ray spectrum was firstly measured and discriminated using the TOF method. Secondly, neutron energy spectrum was obtained through spectrum analysis. Equation of neutron energy spectrum that was emitted by Cf-252 source using the Gaussian fitting was obtained.

Spontaneous-fission decay properties and production cross-sections for the neutron-deficient nobelium isotopes formed in the sup 4 sup 4 sup , sup 4 sup 8 Ca+ sup 2 sup 0 sup 4 sup , sup 2 sup 0 sup 6 sup , sup 2 sup 0 sup 8 Pb reactions

CERN Document Server

Belozerov, A V; Chepigin, V I; Drobina, T P; Gorshkov, V A; Kabachenko, A P; Malyshev, O N; Merkin, I M; Oganessian, Yu T; Popeko, A G; Sagaidak, R N; Svirikhin, A I; Yeremin, A V; Berek, G; Brida, I; Sáro, S

2003-01-01

Heavy-ion fusion reactions sup 4 sup 8 Ca+ sup 2 sup 0 sup 4 Pb and sup 4 sup 4 Ca+ sup 2 sup 0 sup 8 Pb leading to the same compound nucleus sup 2 sup 5 sup 2 No sup * were run in attempts to produce new neutron-deficient spontaneous-fission isotopes of sup 2 sup 4 sup 9 sup , sup 2 sup 5 sup 0 No using the electrostatic separator VASSILISSA. Production cross-sections for the spontaneous-fission activities with the half-lives 5.6 and 54 mu s observed in these reactions are compared with the measured ones for the well-known isotopes of sup 2 sup 5 sup 1 sup - sup 2 sup 5 sup 5 No formed in the heavy-ion fusion reactions sup 4 sup 8 Ca+ sup 2 sup 0 sup 6 Pb and sup 4 sup 8 Ca+ sup 2 sup 0 sup 8 Pb. The obtained excitation functions for the reaction products formed after the evaporation of 1-4 neutrons from the corresponding compound No nuclei have been compared with similar data obtained earlier and results of statistical model calculations. (orig.)

Energy dependence of relative abundances and periods of delayed neutron separate groups from neutron induced fission of 239Pu in the virgin neutron energy range 0.37-4.97 MeV

International Nuclear Information System (INIS)

Piksajkin, V.M.; Kazakov, L.E.; Isaev, S.T.; Korolev, G.G.; Roshchenko, V.A.; Tertychnyj, R.G.

2002-01-01

Relative yield and group period of delayed neutrons induced by the 239 Pu fission in the 0.37-4.97 MeV range were measured. Comparative analysis of experimental data was conducted in terms of middle period of half-life of delayed neutron nuclei-precursors. Character and scale of changing values of delayed neutron group parameters as changing excitation energy of fission compound-nucleus have been demonstrated for the first time. Considerable energy dependence of group parameters under the neutron induced 239 Pu fission that was expressed by the decreasing middle period of half-life of nuclei-precursors by 10 % in the 2.85 eV - 5 MeV range of virgin neutrons was detected [ru

Study on the cause of iron-deficiency anemia in adolescent athletes by INAA with enriched stable isotopes

International Nuclear Information System (INIS)

Qian, Q.F.; Wu, S.Q.; Tian, J.B.; Huo, Z.P.; Chen, J.D.; Li, K.J.

1991-01-01

Iron deficiency anemia is still one of the most common nutritional deficiency diseases throughout the world. The incidence of iron deficiency is high especially in children, adolescent, and endurance athletes. The authors studied the iron absorption rate and iron balance in six child football players during training and non-training periods. The neutron activation method with enriched stable isotope 58Fe has been adopted. The results show that the rate of iron absorption in athletes during the training period (9.1 + 2.9%) was significantly lower than that during the non-training period (11.9 + 4.7%); the iron balance was negative and the sweat iron loss increased during training. Hair is one of the metabolism excretory organs. The physiological changes of body would influence the trace element contents in hair. The hairs collected from four athletes were measured by Synchrotron-induced X-ray Fluorescence analysis, so as to get the trace element contents. Preliminary results show that the changes of iron content in the hairs are in accordance with the athlete's physical activity. There are no perceptible changes for Zn and Ca. It is verified that exercise is one of the causes of iron deficiency in athletes. It is necessary to increase iron supply in an athletes' nutritional intake to ensure optimal performance ability

Observation for really cold fragmentation of heavy nucleus

International Nuclear Information System (INIS)

Goverdovskij, A.A.; Ketlerov, V.V.; Mitrofanov, V.F.; Ostapenko, Yu.B.; Khryachkov, V.A.

1998-01-01

The results of the detailed study on mass-energy charged correlations of the thorium-232 fission fragments, produced by the 5 MeV neutrons are presented. The event of the thorium nucleus really cold fragmentation into tellurium-134 and strontium-99 at the basic quantum states is identified. It is shown that the whole reaction energy is exhausted by the motion kinetic energy of the fragments in the mutual field

Neutron spectrum for neutron capture therapy in boron

International Nuclear Information System (INIS)

Medina C, D.; Soto B, T. G.; Baltazar R, A.; Vega C, H. R.

2016-10-01

Glioblastoma multiforme is the most common and aggressive of brain tumors and is difficult to treat by surgery, chemotherapy or conventional radiation therapy. One treatment alternative is the Neutron Capture Therapy in Boron, which requires a beam modulated in neutron energy and a drug with 10 B able to be fixed in the tumor. When the patients head is exposed to the neutron beam, they are captured by the 10 B and produce a nucleus of 7 Li and an alpha particle whose energy is deposited in the cancer cells causing it to be destroyed without damaging the normal tissue. One of the problems associated with this therapy is to have an epithermal neutrons flux of the order of 10 9 n/cm 2 -sec, whereby irradiation channels of a nuclear research reactor are used. In this work using Monte Carlo methods, the neutron spectra obtained in the radial irradiation channel of the TRIGA Mark III reactor are calculated when inserting filters whose position and thickness have been modified. From the arrangements studied, we found that the Fe-Cd-Al-Cd polyethylene filter yielded a ratio between thermal and epithermal neutron fluxes of 0.006 that exceeded the recommended value (<0.05), and the dose due to the capture gamma rays is lower than the dose obtained with the other arrangements studied. (Author)

Examining the possibility to observe neutron dark decay in nuclei

Science.gov (United States)

Pfützner, M.; Riisager, K.

2018-04-01

As proposed recently by Fornal and Grinstein, neutrons can undergo a dark matter decay mode which has not yet been observed. Such a decay could explain the existing discrepancy between two different methods of neutron lifetime measurements. If such neutron decay is possible, then it should occur also in nuclei with sufficiently low neutron binding energy. We examine a few nuclear candidates for the dark neutron decay and we consider the possibilities of their experimental identification. In more detail we discuss the case of 11Be which appears as the most promising nucleus for the observation of neutron dark decay.

Examining the possibility to observe neutron dark decay in nuclei

DEFF Research Database (Denmark)

Pfutzner, M.; Riisager, K.

2018-01-01

also in nuclei with sufficiently low neutron binding energy. We examine a few nuclear candidates for the dark neutron decay and we consider the possibilities of their experimental identification. In more detail we discuss the case of Be-11 which appears as the most promising nucleus for the observation......As proposed recently by Fornal and Grinstein, neutrons can undergo a dark matter decay mode which has not yet been observed. Such a decay could explain the existing discrepancy between two different methods of neutron lifetime measurements. If such neutron decay is possible, then it should occur...... of neutron dark decay....

High energy nucleus-nucleus scattering and matter radius of unstable nucleus

International Nuclear Information System (INIS)

Sato, H.; Okuhara, Y.

1985-07-01

The interaction cross sections of high energy nucleus-nucleus scattering have been studied with the Glauber Model and Hartree-Fock like variational calculation for the nuclear structure. It is found that the experimental interaction cross sections of the light unstable nucleus-stable nucleus scatterings measured by INS-LBL collaboration are well reproduceable. (author)

The nucleon-nucleus scattering at intermediate energies

International Nuclear Information System (INIS)

Auger, J.-P.

1976-01-01

The Glauber model has the merit to connect directly the nucleon-nucleus elastic differential cross section with the nucleon-nucleon amplitude and nuclear densities. The general agreement between the 1 GeV proton elastic scattering differential cross sections calculated without adjustable parameter and the experimental data (from He 4 to Pb 208 ) is rather satisfactory up to 2. - 2.5 fm -1 momentum transfer. Although the 1 GeV proton elastic scattering experiments constitute at present one of the best method in determining neutron densities, it seems that self-consistent calculations bring the best knowledge of these densities. The model independent analysis performed with electron and proton scattering experiments show that the difference between neutron and proton r.m.s. radius cannot be determined better than 25-30% for Pb 208 [fr

Distrofia muscular congênita e deficiência de merosina Congenital muscular dystrophy and merosin deficiency

Directory of Open Access Journals (Sweden)

Lineu Cesar Werneck

1997-01-01

Full Text Available Uma proporção variável de pacientes com distrofia muscular congênita (DMC da forma clássica ou ocidental apresenta deficiência da cadeia α2 da merosina, uma proteína da matriz extracelular. Foi realizado estudo das características clínicas, laboratoriais e histopatológicas de 18 pacientes com DMC, relacionadas com o padrão de merosina encontrado na biópsia muscular. Estudo imuno-histoquímico demonstrou que 11 pacientes eram merosina-deficiente (MD e sete pacientes eram merosina-positiva (MP. Nenhum dos nove pacientes MD com idade suficiente para serem avaliados alcançaram a capacidade de deambulação, enquanto quatro dos sete pacientes MP atingiram deambulação sem auxílio. Os níveis de creatinoquinase estavam mais aumentados nos pacientes MD, mas a diferença entre os dois grupos não foi estatisticamente significativa. Estudo da condução nervosa motora foi realizado em 12 pacientes. Todos os quatro pacientes MP apresentaram exames normais, enquanto dois de oito pacientes MD apresentaram diminuição da velocidade de condução nervosa motora. Entre 69 parâmetros de biópsia muscular avaliados, não foi encontrada diferença estatisticamente significativa entre os grupos MP e MD. Esses resultados sugerem que a diferenciação entre os casos MP e MD serve para fins de prognóstico, pois os pacientes MP chegam a deambular. Além disso, este estudo indica que não existe relação entre a ausência de merosina e as alterações histológicas encontradas na biópsia muscular.Merosin α2 chain, an extracellular matrix protein, is deficient in a proportion of patients with classical congenital muscular dystrophy (CMD. A study of clinical, laboratory and histopathological features of 18 patients with CMD was performed in relation to the merosin expression in muscle biopsy. Immunohistochemistry study showed that merosin was deficient in 11 patients and present in 7. None of the 9 merosin-deficient patient: evaluated achieved

Neutron physics entering the 21st century

International Nuclear Information System (INIS)

Aksenov, V.L.

2000-01-01

The objectives of present-day neutron physics are neutron-aided investigations of fundamental interactions and symmetries, high excited states of nuclei, crystalline and magnetic structures, dynamic excitations in solids and liquids over a wide range of energies. The state-of-art and perspectives of the solution of most topical and principle problems of neutron physics are analyzed. The main conclusion is that neutron physics provides rich information for nuclear particle physics, physics of nucleus, condensed matter physics, chemistry, biology, materials science, and earth sciences. In the next century, however, new higher flux neutron sources must be created. By the year 2010 the number of nuclear reactors used for physical research will reduce to 10-15 reactors over the world. Trends in the development of neutron sources are analyzed. The possibilities of leading neutron research centers in the world are considered and most promising projects of neutron sources are discussed. (author)

Tests of time reversal in neutron-nucleus scattering

International Nuclear Information System (INIS)

Bowman, J.D.

1988-01-01

Experiments to test time-reversal invariance are discussed. The experiments are based on observables constructed from the momentum and spin vectors of epithermal neutrons and from the spin of an aligned or polarized target. It is shown that the proposed tests are detailed balance tests of time-reversal invariance. The status of the experiments is briefly reviewed. 14 refs., 5 figs

High energy nucleus-nucleus collisions

International Nuclear Information System (INIS)

Bhalla, K.B.

1980-01-01

An attempt is made to explain nucleus-nucleus collisions based on nuclear emulsion experiments. Peripheral and central collisions are described in detail. Assuming the fireball model, the concepts of geometry, kinematics and thermodynamics in this model are discussed. Projectile and target fragmentations are studied. The advantages of using nuclear emulsions as detectors, are mentioned. Proton-nucleus collisions and nucleus-nucleus collisions are compared. Interactions, of projectiles such as Ca, B and C on targets such as Pb, Ag, Br etc. at very high energies (approximately 300 to 1700 Gev) are listed. A comparison of the near multiplicities in these interactions is given. A generalized explanation is given on the processes involved in these interactions. (A.K.)

From the nucleus discovery to DWBA

International Nuclear Information System (INIS)

Fernandez, B.

2007-01-01

The author presents a brief review of the main events in the field of nuclear reactions that are acknowledged as milestones because of their importance due to either experimental setting or physical interpretation. It is shown that the pace of discoveries has been strongly dependent on the technical progress in detection means at the beginning of nuclear physics and now is linked to the development of simulation means. The discovery of the neutron, the development of the Geiger counter, the theory of the compound nucleus or the first direct reactions are among these milestones

WIMP-nucleus scattering in chiral effective theory

Science.gov (United States)

Cirigliano, Vincenzo; Graesser, Michael L.; Ovanesyan, Grigory

2012-10-01

We discuss long-distance QCD corrections to the WIMP-nucleon(s) interactions in the framework of chiral effective theory. For scalar-mediated WIMP-quark interactions, we calculate all the next-to-leading-order corrections to the WIMP-nucleus elastic cross-section, including two-nucleon amplitudes and recoil-energy dependent shifts to the single-nucleon scalar form factors. As a consequence, the scalar-mediated WIMP-nucleus cross-section cannot be parameterized in terms of just two quantities, namely the neutron and proton scalar form factors at zero momentum transfer, but additional parameters appear, depending on the short-distance WIMP-quark interaction. Moreover, multiplicative factorization of the cross-section into particle, nuclear and astro-particle parts is violated. In practice, while the new effects are of the natural size expected by chiral power counting, they become very important in those regions of parameter space where the leading order WIMP-nucleus amplitude is suppressed, including the so-called "isospin-violating dark matter" regime. In these regions of parameter space we find order-of-magnitude corrections to the total scattering rates and qualitative changes to the shape of recoil spectra.

Rotation-aligned coupling and axial asymmetry in the neutron deficient lanthanum nuclei. Progress report, May 15, 1975--May 14, 1976

International Nuclear Information System (INIS)

Zganjar, E.F.

1976-01-01

The work on the neutron deficient nuclei in the Au region was brought nearer to completion, and systems necessary to extend the investigation to the La nuclei were developed. Twelve reports, including five journals articles, were generated during the reporting period, and the principal investigator received invitations to two international conferences. The LSU nuclear spectroscopy group was given a good deal of support and added strength (by the Department of Physics and Astronomy) through the addition of a nuclear structure theorist and a departmentally sponsored postdoctoral position

Spin assignments of nuclear levels above the neutron binding energy in $^{88}$Sr

CERN Multimedia

Neutron resonances reveal nuclear levels in the highly excited region of the nucleus around the neutron binding energy. Nuclear level density models are therefore usually calibrated to the number of observed levels in neutron-induced reactions. The gamma-ray cascade from the decay of the highly excited compound nucleus state to the ground state show dierences dependent on the initial spin. This results in a dierence in the multiplicity distribution which can be exploited. We propose to use the 4${\\pi}$ total absorption calorimeter (TAC) at the n TOF facility to determine the spins of resonances formed by neutrons incident on a metallic $^{87}$Sr sample by measuring the gamma multiplicity distributions for the resolved resonances. In addition we would like to use the available enriched $^{87}$Sr target for cross section measurements with the C$\\scriptscriptstyle{6}$D$\\scriptscriptstyle{6}$ detector setup.

The shell structure effects in neutron cross section calculation by a ...

African Journals Online (AJOL)

The role of the shell structure properties of the nucleus in the calculation of neutron-induced reaction cross-section data based on nuclear reaction theory has been investigated. In this investigation, measured, evaluated and calculated (n.p) reaction cross-section data on la spherical nucleus (i.e. 112Sn) and a deformed ...

Neutron emission study after muon capture by nuclei

International Nuclear Information System (INIS)

Bouyssy, Alain.

1974-01-01

Muon capture by nuclei, used in the beginning for checking the weak interaction, is now a method of investigation of nuclear structure. Study of spectrum, asymmetry and polarization of emitted neutrons after polarized muon capture has been done in three directions: weak coupling constants, final state interaction, nuclear wave functions. The neutron intensity and helicity are very dependent of the neutron - residual nucleus interaction, while the asymmetry is sensitive to the wave functions used for the proton. Moreover if the induced tensor coupling constant is different from zero the asymmetry is increased. Longitudinal polarization experiments, with those for neutron intensity, would be of great interest to give informations on neutron asymmetry [fr

ISINN-2. Neutron spectroscopy, nuclear structure and related topics

International Nuclear Information System (INIS)

1994-01-01

The proceedings contain the materials presented at the Second International Seminar on Neutron-Nucleus Interactions (ISINN-2) dealing with the problems of neutron spectroscopy, nuclear structure and related topics. The Seminar took place in Dubna on April 26-28, 1994. Over 120 scientists from Belgium, Bulgaria, Czech Republic, Germany, Holland, Italy, Japan, Latvia, Mexico, Poland, Slovakia, Slovenia, Ukraine, US and about 10 Russian research institutes took part in the Seminar. The main problems discussed are the following: P-odd and P-even angular correlation and T-reversal invariance in neutron reactions, nuclear structure investigations by neutron capture, the mechanism of neutron reactions, nuclear fission processes, as well as neutron data for nuclear astrophysics

Contribution to the study of the inelastic scattering of neutrons from a to 5 MeV (1961); Contribution a l'etude de la diffusion inelastique des neutrons de 1 a 5 MeV (1961)

Energy Technology Data Exchange (ETDEWEB)

Abramson - Szteinsznaider, D [Commissariat a l' Energie Atomique, Saclay (France). Centre d' Etudes Nucleaires

1961-07-01

- The aim of this work is to see if this reaction occurs only by compound nucleus formation or involves some contribution of direct interaction. In the first case, the angular distribution of inelastic neutrons is symmetric about 90 degree. In the second case, this distribution must be asymmetric and must change slowly with energy of incident neutrons. The neutrons corresponding at the excitation of a given level of the residual nucleus are selected by their coincidence with the {gamma} rays of deexcitation of this level. From the results of our measurements on iron, iodine and bismuth and of other laboratories on different elements, we can conclude that generally, the inelastic scattering of neutrons of some MeV occurs only by compound nucleus. (author) [French] - Le but de ce travail est de determiner si cette reaction s'effectue uniquement par passage par un noyau compose ou fait intervenir un processus d'interaction directe. Dans le premier cas, la distribution angulaire des neutrons inelastiques est symetrique par rapport a 90 degree. Dans le deuxieme cas, cette distribution doit etre asymetrique et doit varier lentement avec l'energie des neutrons incidents. Les neutrons correspondant a l'excitation d'un niveau determine du residuel sont selectionnes par leur cofncidence avec les rayonnements {gamma} de desexcitation de ce niveau. D'apres les resultats de nos mesures sur le fer, l'iode et le bismuth et de celles des autres laboratoires sur differents elements, nous pouvons conclure que, en general, la diffusion inelastique des neutrons de quelques MeV s'effectue uniquement par noyau compose. (auteur)

Multiparticle excitations in the 149 Gd superdeformed nucleus. Signature of new C4 nucleus symmetry

International Nuclear Information System (INIS)

Theisen, C.

1995-01-01

The use of 8 π and EUROGAM phase I multi-detectors for the study of high spin states of 149 Gd nucleus has revealed unexpected new phenomenons about the superdeformation in this nucleus. The new excited bands confirm the omnipresence of twin bands phenomenon. A new multi-particle excitation (two protons and one neutron) has been discovered. Thanks to the second generation EUROGAM detector, unexpected discoveries such as C 4 symmetry, level interactions, complete backbending were obtained for the second potential well. The knowledge of interacting levels gives informations about the nucleon-nucleon residual interaction and could allow the determination of SD bands excitation energy. The complex processing and analysis of high multiplicity events has led to the development of new computing tools. An automatic band research program has been written for the discovery of new excited bands, and an exact method for the elimination of uncorrected events has been developed. The improvements of multi-detector performances should allow the discovery of more exceptional phenomenons and new anomalies in the SD bands. (J.S.). 222 refs., 86 figs., 38 tabs

Interacting gluon model for hadron-nucleus and nucleus-nucleus collisions in the central rapidity region

International Nuclear Information System (INIS)

Fowler, G.N.; Navarra, F.S.; Plumer, M.; Lawrence Berkeley Laboratory, Nuclear Science Division, Berkeley, California 94720); Vourdas, A.; Weiner, R.M.

1989-01-01

The interacting gluon model developed to describe the inelasticity distribution in hadron-nucleon collisions has been generalized and applied to hadron-nucleus and nucleus-nucleus interactions. Leading particle spectra and energy distributions in hadron-nucleus and nucleus-nucleus collisions are calculated

Neutron cross section measurements using the ORELA: 40Ar(n,x), 40Ca(n,x), 22Ne(n,γ) 187Os(n,n'), 186187Os(n,nn'γ), the stable tellurium isotopes (n,γ) and 205Tl(n,nγ). Progress report, September 1, 1981-August 31, 1982

International Nuclear Information System (INIS)

Winters, R.R.

1982-08-01

The research reported is in two major areas, nuclear physics and astrophysics. In nuclear, studies in the use of an optical model nuclear potential to describe the experimentally determined scattering matrix, and reduced neutron widths for s/sub 1/2/ resonances in 32 S. In astrophysics, total and capture cross sections for 186 Os, 187 Os, and 188 Os, 22 Ne(n,γ) resonances, and capture cross sections for 148 Sm, 149 Sm, and 150 Sm, were measured

Electro neutrons around a 12 MV Linac

International Nuclear Information System (INIS)

Vega C, H. R.; Perez L, L. H.

2012-10-01

Neutron contamination around Linacs for radiotherapy is a source of undesirable doses for the patient. The main source of these neutrons is the photonuclear reactions occurring in the Linac head and the patient body. Electrons also produce neutrons through (e, en) reactions. This reaction is known as electro disintegration and is carried out by the electron scattering that produce a virtual photon that is absorbed by the scattering nucleus producing the reaction e + A → (A-1) + n + e'. In this work the electron-neutron spectrum to 100 cm from the isocenter of a 12 MV Linac has been measured using a passive Bonner spheres spectrometer in a novel procedure named Planetary mode. (Author)

46 CFR 167.05-35 - Public nautical school.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Public nautical school. 167.05-35 Section 167.05-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Definitions § 167.05-35 Public nautical school. The term public nautical school means any school...

Neutron capture experiments with 4π DANCE Calorimeter

Directory of Open Access Journals (Sweden)

Krtička M.

2012-02-01

Full Text Available In recent years we have performed a series of neutron capture experiments with the DANCE detector array located at the Los Alamos Neutron Science Center. The radiative decay spectrum from the compound nucleus contains important information about nuclear structure and the reaction mechanism. The primary goals of the measurements are to obtain improved capture cross sections, to determine properties of the photon strength function, to improve neutron level densities and strength functions by determining the spin and parity of the capturing states. We shall present examples of our recent results.

Application of Van Hove theory to fast neutron inelastic scattering

International Nuclear Information System (INIS)

Stanicicj, V.

1974-11-01

The Vane Hove general theory of the double differential scattering cross section has been used to derive the particular expressions of the inelastic fast neutrons scattering kernel and scattering cross section. Since the considered energies of incoming neutrons being less than 10 MeV, it enables to use the Fermi gas model of nucleons. In this case it was easy to derive an analytical expression for the time-dependent correlation function of the nucleus. Further, by using an impulse approximation and a short-collision time approach, it was possible to derive the analytical expression of the scattering kernel and scattering cross section for the fast neutron inelastic scattering. The obtained expressions have been used for Fe nucleus. It has been shown a surprising agreement with the experiments. The main advantage of this theory is in its simplicity for some practical calculations and for some theoretical investigations of nuclear processes

46 CFR 167.65-25 - Steering gear tests.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Steering gear tests. 167.65-25 Section 167.65-25... SHIPS Special Operating Requirements § 167.65-25 Steering gear tests. On all nautical school ships making voyages of more than 48 hours' duration, the entire steering gear, the whistle, the means of...

Yields of the rare-earth neutron-deficient isotopes in the reactions of Mo isotopes with 40Ca ions

International Nuclear Information System (INIS)

Adam, J.; Chaloun, P.; Gangrskij, Yu.P.

1999-01-01

The results of the joint Russian-Chinese experiment on the measurements of the reaction cross sections of the rare-earth neutron-deficient isotopes production and the study of their decay scheme are presented. The studied nuclides were obtained in the reactions 92 Mo + 40 Ca and 97 Mo + 40 Ca on the 4-meter cyclotron of the Flerov Laboratory of Nuclear Reactions, JINR. The recoil nuclei were stopped in the inert gas and transported by the gas flow to the detectors. The single and coincidence spectra of γ-, x-rays and delayed protons were measured. The enhanced yield of the reactions with the charge particle evaporation was observed

Mass measurement of cooled neutron-deficient bismuth projectile fragments with time-resolved Schottky mass spectrometry at the FRS-ESR facility

Energy Technology Data Exchange (ETDEWEB)

Litvinov, Yu.A.; Geissel, H. [Giessen Univ. (Germany); Radon, T. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (DE)] [and others

2005-06-01

Masses of 582 neutron-deficient nuclides (30{<=}Z{<=}85) were measured with time-resolved Schottky mass spectrometry at the FRS-ESR facility at GSI, 117 were used for calibration. The masses of 71 nuclides were obtained for the first time. A typical mass accuracy of 30 {mu}u was achieved. These data have entered the latest atomic mass evaluation. The mass determination of about 140 additional nuclides was possible via known energies (Q-values) of {alpha}-, {beta}-, or proton decays. The obtained results are compared with the results of other measurements. (orig.)

Modes of transference and rupture of the nucleus with neutron halos 6 He on 209 Bi near of the Coulomb barrier

International Nuclear Information System (INIS)

Lizcano C, D.

2003-01-01

In recent experiments, the fusion of the exotic radioactive nucleus 6 He with 209 Bi has been studied for the first time at energies above and below the Coulomb barrier. A considerable enhancement in the fusion was observed, which implies a reduction of about 25% in the nominal fusion barrier. Some previous theoretical works suggest that this striking effect may be caused by the coupling to neutron transfer channels with a positive Q-value which would lead to a neutron flow and the consequent formation of a neck between the projectile and the target. Later, in the current work, we ran two new experiments on the same reaction using the FN Tandem Van de Graaff (10 MV) accelerator and the dual superconducting TwinSol system, both of them belonging to the University of Notre Dame, USA. This time, the purpose was to study one- and two-neutron transfer and the 6 He projectile breakup at laboratory energies of 14.7, 16.2, 17.9, 19.0 and 22.5 MeV. A strong group of 4 He was observed (with an effective Q-value about .5 MeV) whose integrated cross section results exceptionally high, exceeding the fusion cross section both above and below the barrier. The simultaneously measured elastic scattering angular distribution required high total cross sections so that this yield is confirmed. Preliminary coupled channels calculations sing the computer program called Fresco developed at the University of Surrey (England) suggested that the reaction mechanisms may be better described as a direct nuclear breakup and two-neutron transfer to unbound states in 211 Bi. These calculations predicted also an enhancement in the fusion cross section below the barrier due to the transfer and breakup channel coupling, which strongly suggests that this channel is the 'doorway state' that explains the fusion barrier reduction observed in previous experiments. It was found that the 4 He group fully dominates the total reaction cross section at the measured energies and we show evidence that a new

Study of the isomeric states of 66As

International Nuclear Information System (INIS)

Czajkowski, S.; Blank, B.; Andriamonje, S.; Attallah, F.; Boue, F.; Davi, F.; Del Moral, R.; Fleury, A.; Musquere, A.; Pravikoff, M.S.; Dufour, J-P; Grzywacz, R.; Janas, Z.; Karny, M.; Pfuetzner, M.; Donzaud, C.; Grewe, A.; Heinz, A.; Junghans, A.; Lewitowicz, M.; Sauvestre, J-E.

1997-01-01

The most neutron-deficient isotopes in the N = Z region are an important source of information on the neutron-proton interaction far off stability. The isotopes in this region are characterized by an extreme sensitivity of the deformation to the isospin variations. Here the structure of deformed shells are favoring the high spin states the lifetime of which being sufficient long to be observed after flight time of the order of the microsecond. The study of the decay of this isomeric states permits to approach the structure of the first excited levels of this isotopes. Recent experiments at GANIL with the SISSI - LISE 3 spectrometer were performed to study the neutron deficient nucleus 66 As. This nucleus was produced in the fragmentation of 70 MeV/u 78 Kr primary beam in a nickel target. Two new isomeric states have been observed. From the observed γ transitions a decay scheme is proposed

46 CFR 167.05-25 - Nautical school ship.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Nautical school ship. 167.05-25 Section 167.05-25 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Definitions § 167.05-25 Nautical school ship. The term nautical school ship means a vessel operated by or in connection with a nautical school...

21 CFR 516.167 - Removal from the index.

Science.gov (United States)

2010-04-01

... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Removal from the index. 516.167 Section 516.167... DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index of Legally Marketed Unapproved New Animal Drugs for Minor Species § 516.167 Removal from the index. (a) After due...

Diffractive ''semioptical'' model for nucleus-nucleus collisions

International Nuclear Information System (INIS)

Barashenkov, V.S.; Musulmanbekov, Zh.Zh.

1979-01-01

Diffraction Glauber theory for nucleus-nucleus collisions is considered in approximation when the initial nucleus interacts as a whole with nucleons of the target nucleus. Such an approach, being intermediate between precise Glauber theory and its optical limit, essentially simplifies numerical calculations and gives a good agreement with experiments as well. (author)

Studies with radioactive beams - properties of neutron halo

International Nuclear Information System (INIS)

Tanihata, I.

1992-01-01

Interaction cross sections σ I and 9 Li transverse momentum distributions of 11 Li reactions were measured using p, d, Be and C targets at 800 A and 400 A MeV. The density distribution of 11 Li nucleus has been determined, for the first time, combining the interaction cross sections with various targets and energies. It was confirmed that only the distribution with long tail describe the observed data. The momentum correlation of two neutrons in the neutron halo is extracted from the P T distribution of 9 Li and that of neutron. It is found that the two neutrons are moving in the same direction in average and thus strongly suggests a formation of di-neutron in 11 Li

Neutron absorbing article

International Nuclear Information System (INIS)

Naum, R.G.; Owens, D.P.; Dooker, G.I.

1981-01-01

A neutron-absorbing article suitable for use in spent fuel racks is described. It comprises boron carbide particles, diluent particles, and a phenolic polymer cured to a continuous matrix. The diluent may be silicon carbide, graphite, amorphous carbon, alumina, or silica. The combined boron carbide-diluent phase contains no more than 2 percent B 2 O 3 , and the neutron-absorbing article contains from 20 to 40 percent phenol resin. The ratio of boron carbide to diluent particles is in the range 1:9 to 9:1

An excitatory paraventricular nucleus to AgRP neuron circuit that drives hunger.

Science.gov (United States)

Krashes, Michael J; Shah, Bhavik P; Madara, Joseph C; Olson, David P; Strochlic, David E; Garfield, Alastair S; Vong, Linh; Pei, Hongjuan; Watabe-Uchida, Mitsuko; Uchida, Naoshige; Liberles, Stephen D; Lowell, Bradford B

2014-03-13

Hunger is a hard-wired motivational state essential for survival. Agouti-related peptide (AgRP)-expressing neurons in the arcuate nucleus (ARC) at the base of the hypothalamus are crucial to the control of hunger. They are activated by caloric deficiency and, when naturally or artificially stimulated, they potently induce intense hunger and subsequent food intake. Consistent with their obligatory role in regulating appetite, genetic ablation or chemogenetic inhibition of AgRP neurons decreases feeding. Excitatory input to AgRP neurons is important in caloric-deficiency-induced activation, and is notable for its remarkable degree of caloric-state-dependent synaptic plasticity. Despite the important role of excitatory input, its source(s) has been unknown. Here, through the use of Cre-recombinase-enabled, cell-specific neuron mapping techniques in mice, we have discovered strong excitatory drive that, unexpectedly, emanates from the hypothalamic paraventricular nucleus, specifically from subsets of neurons expressing thyrotropin-releasing hormone (TRH) and pituitary adenylate cyclase-activating polypeptide (PACAP, also known as ADCYAP1). Chemogenetic stimulation of these afferent neurons in sated mice markedly activates AgRP neurons and induces intense feeding. Conversely, acute inhibition in mice with caloric-deficiency-induced hunger decreases feeding. Discovery of these afferent neurons capable of triggering hunger advances understanding of how this intense motivational state is regulated.

Neutron moderation theory with thermal motion of the moderator nuclei

Energy Technology Data Exchange (ETDEWEB)

Rusov, V.D.; Tarasov, V.A.; Chernezhenko, S.A.; Kakaev, A.A.; Smolyar, V.P. [Odessa National Polytechnic University, Department of Theoretical and Experimental Nuclear Physics, Odessa (Ukraine)

2017-09-15

In this paper we present the analytical expression for the neutron scattering law for an isotropic source of neutrons, obtained within the framework of the gas model with the temperature of the moderating medium as a parameter. The obtained scattering law is based on the solution of the general kinematic problem of elastic scattering of neutrons on nuclei in the L-system. Both the neutron and the nucleus possess arbitrary velocities in the L-system. For the new scattering law we obtain the flux densities and neutron moderation spectra as functions of temperature for the reactor fissile medium. The expressions for the moderating neutrons spectra allow reinterpreting the physical nature of the underlying processes in the thermal region. (orig.)

Production of neutron-rich nuclides in the vicinity of N = 126 shell closure in multinucleon transfer reactions

Directory of Open Access Journals (Sweden)

Karpov Alexander

2017-01-01

Full Text Available Multinucleon transfer in low-energy nucleus-nucleus collisions is widely discussed as a method of production of yet-unknown neutron-rich nuclei hardly accessible (or inaccessible by other methods. Modeling of complicated dynamics of nuclear reactions induced by heavy ions is done within a multidimensional dynamical model of nucleus-nucleus collisions based on the Langevin equations. The model gives a continuous description of the system evolution starting from the well-separated target and projectile in the entrance channel of the reaction up to the formation of final reaction products. In this paper, rather recent sets of experimental data for the 136Xe+198Pt,208Pb reactions are analyzed together with the production cross sections for neutron-rich nuclei in the vicinity of the N = 126 magic shell.

Heavy neutron-deficient radioactive beams: fission studies and fragment distributions

Energy Technology Data Exchange (ETDEWEB)

Schmidt, K.H.; Benlliure, J.; Heinz, A.; Voss, B. [Gesellschaft fuer Schwerionenforschung mbH, Darmstadt (Germany); Boeckstiegel, C.; Grewe, A.; Steinhaeuser, S.; Clerc, H.G.; Jong, M. de; Junghans, A.R.; Mueller, J. [Technische Hochschule Darmstadt (Germany). Inst. fuer Kernphysik; Pfuetzner, M. [Warsaw Univ. (Poland). Inst. of Experimental Physics

1998-02-01

The secondary-beam facility of GSI Darmstadt was used to study the fission process of short-lived radioactive nuclei. Relativistic secondary projectiles were produced by fragmentation of a 1 A GeV {sup 238}U primary beam and identified in nuclear charge and mass number. Their production cross sections were determined, and the fission competition in the statistical deexcitation was deduced for long isotopical chains. New results on the enhancement of the nuclear level density in spherical and deformed nuclei due to collective rotational and vibrational excitations were obtained. Using these reaction products as secondary beams, the dipole giant resonance was excited by electromagnetic interactions in a secondary lead target, and fission from excitation energies around 11 MeV was induced. The fission fragments were identified in nuclear charge, and their velocity vectors were determined. Elemental yields and total kinetic energies have been determined for a number of neutron-deficient actinides and preactinides which were not accessible with conventional techniques. The characteristics of multimodal fission of nuclei around {sup 226}Th were systematically investigated and related to the influence of shell effects on the potential energy and on the level density between fission barrier and scission. A systematic view on the large number of elemental yields measured gave rise to a new interpretation of the enhanced production of even elements in nuclear fission and allowed for a new understanding of pair breaking in large-scale collective motion. (orig.)

T-odd angular correlations in the emission of prompt gamma rays and neutrons in nuclear fission induced by polarized neutrons

International Nuclear Information System (INIS)

Danilyan, G. V.; Klenke, J.; Krakhotin, V. A.; Kopach, Yu. N.; Novitsky, V. V.; Pavlov, V. S.; Shatalov, P. B.

2011-01-01

Study of the T-odd three-vector correlation in the emission of prompt neutrons from 235 U fission by polarized cold neutrons has been continued at the facility MEPHISTO of the FRM II reactor (Technical University of Munich). The sought correlation was not found within experimental error of 2.3 × 10 −5 . The upper limit for the asymmetry coefficient has been set to vertical bar D n vertical bar −5 at 99% confidence level, whereas for ternary fission correlation coefficient D α = (170±20) × 10 −5 . This limit casts doubt on a model that explains the three-vector correlation in ternary fission by the Coriolis mechanism. At the same time, five-vector correlation in the emission of prompt fission neutrons has been measured, which describes the rotation of the fissioning nucleus at the moment it breaks (ROT effect). At the angle 22.5° to the fission axis, the correlation coefficient was found to be (1.57 ± 0.20) × 10 −4 , while at the angle of 67.5° it is zero within the experimental uncertainty. The existence of ROT effect in the emission of prompt fission neutrons can be explained by the anisotropy of neutron emission in the rest frame of the fragment (fission fragments are aligned with respect to the axis of deformation of the fissioning nucleus), similar to the mechanism of ROT effect in the emission of prompt γ-rays.

The investigation of the decay of the deformed 167Yb, 164Tm, 225Ac, 221Fr nuclei. Beta-spectrograph with positional-sensitive detector

International Nuclear Information System (INIS)

Butabaev, Yu.S.

1994-01-01

The decay of the deformed 167 Yb, 164 Tm, 225 Ac, 221 Fr nuclei is investigated in this work. For 167 Yb and 164 Tm decays the specters of the conversion electrons were measured. 32 γ-transitions were found for 167 Yb decay, 6 of which were found for the first time. The multipolarities for 9 γ-transitions were found. For 164 Tm decay 23 new γ-transitions were found. The theoretical investigations of the collective states in the nucleus were carried out. Octupole-rotatory line with k=1 - was found in the measurement of conversion electrons specters of the short-life nuclei. Device' nonlinearity was 0,04%. Resolution was Δβρ/βρ 0,11%. Effective light yield was 1-2 %. The decay of 225 Ac and 221 Fr nuclei were investigated. The investigations of α-γ -coincidence, α-γ - rays were carried out. 24 new γ -transitions for 225 Ac and 13 ones for 221 Fr were found. The new levels and their intensities were defined more precisely. Intensity balance calculations were carried out and the full populations of the nuclear levels were calculated. (author). 3 tabs.; 10 figs

Affinity of 167Tm-citrate for tumor and liver tissue

International Nuclear Information System (INIS)

Ando, A.; Ando, I.; Hiraki, T.

1983-01-01

Strong affinity of 167 Tm-citrate for tumor tissue was reconfirmed by using Ehrlich tumor. Excellent tumor imaging was obtained with 167 Tm-citrate because of its strong tumor affinity and because of the suitable physical characteristics of 167 Tm. A large amount of 167 Tm had accumulated in the connective tissue which contained inflammatory tissue, quite large amounts were found in areas containing viable and necrotic tumor tissue, and small amounts were present in viable tumor tissue. 167 Tm was not seen in necrotic tumor tissue. It was concluded that lysosomes did not play a major role in the tumor concentration of 167 Tm, but played an important role in the liver concentration of this nuclide. In the case of hepatoma AH109A, it was presumed that lysosomes played a considerably important role in the tumor concentration of 167 Tm, hepatoma AH109A possessing some residual features of the liver. 167 Tm was bound to acid mucopolysaccharides and transposed by the acid mucopolysaccharides in the tumor tissues and liver. The acid mucopolysaccharides to which 167 Tm were bound in tumor and liver, were heparan sulfate, chondroitin sulfate (or keratosulfate) and heparin (or keratosulfate). (orig.)

Resolution of the crystal structure of the deficient perovskite LaNiO2.5 from neutron powder diffraction data

International Nuclear Information System (INIS)

Alonso, J.A.; Martinez-Lope, M.J.

1996-01-01

The oxygen-deficient perovskite LaNiO 2.5 has been prepared by controlled reduction of LaNiO 3 with Zr metal. The XRD pattern could be indexed in a monoclinic unit-cell with dimensions a 0 xa 0 xa 0 (a 0 : lattice parameter of the ideal cubic perovskite). The indexing of the neutron powder diffraction pattern needed a doubled cell to account for the superstructure reflections originated by the oxygen vacancy ordering and the tilting of the Ni coordination polyhedra. The structure was solved and refined from the neutron powder data. The oxygen vacancies are ordered in such a way that square planar NiO 4 and NiO 6 octahedra alternate in the ab plane along the [110] direction. Both kinds of Ni polyhedra are fairly distorted and tilted in order to optimize the La-O distances, giving rise to a highly strained structure of metastable character. In fact, the compound readily takes oxygen, above 175 C in air, to give the much more stable LaNiO 3 perovskite. (orig.)

Passageiros com deficiência no transporte aéreo brasileiro: diferentes atores, perspectivas semelhantes

Directory of Open Access Journals (Sweden)

Talita Naiara Rossi da Silva

Full Text Available Resumo As mudanças em relação ao entendimento da deficiência no mundo buscam a efetivação da inclusão social e a maior participação das pessoas com deficiência em todos os contextos e atividades. Entretanto, no transporte aéreo há inúmeras barreiras que podem dificultar a viagem dessas pessoas. Assim, este estudo busca compreender as experiências de passageiros com deficiência no transporte aéreo brasileiro, a partir das perspectivas de diferentes atores sociais, incluindo profissionais que atuam em associações, centros de referência em reabilitação, órgãos públicos e passageiros com deficiência usuários do transporte aéreo. Para desenvolvimento do estudo foram realizadas 20 entrevistas semiestruturadas entre 2012 e 2013. Os resultados indicaram que os passageiros com deficiência encontram inúmeras dificuldades no transporte aéreo ao longo de todo o processo de viagem, inclusive fatores associados aos aeroportos, às aeronaves e aos serviços e procedimentos das companhias aéreas. Sugere-se que projetos envolvendo os usuários sejam desenvolvidos, para que seja possível compreender as reais necessidades desses passageiros e desenvolver soluções que assegurem sua independência e segurança no uso do transporte.

Nuclear studies at TUNL using polarized neutron beams

International Nuclear Information System (INIS)

Walter, R.L.; Howell, C.R.; Tornow, W.

1992-01-01

Experimental data obtained using polarized neutron beams has proven to be essential for determining the nucleon-nucleon and the nucleon-nucleus interaction. The present paper reviews the experimental methods and some results of the Triangle Universities Nuclear Laboratory for a variety of polarization experiments involving neutron elastic scattering. A brief introduction to the nucleon-nucleon problem and its relation to the three-nucleon problem is presented; data for n-p and n-d analyzing powers are highlighted. Measurements involving heavier targets ( 93 Nb and 208 Pb) and their connection to the development of conventional and dispersive optical models are shown. The importance of the dispersive model for 27 Al in relation to conclusions about the nucleon-nucleus spin-spin potential is presented. Comparisons of microscopic models to data for 10 B and 28 Si are described

Particle physics with cold neutrons

International Nuclear Information System (INIS)

Dubbers, D.

1991-01-01

Slow neutrons are used in a large number of experiments to study the physics of particles and their fundamental interactions. Some of these experiments search for manifestations of ''new physics'' like baryon- or lepton-number nonconservation, time reversal nonconservation, new particles, right-handed currents, nonzero neutron charge, nonlinear terms in the Schrodinger equation, exotic e + e - states, and others. Other slow neutron experiments test the present Standard Model. The parity nonconserving weak neutron-nucleon interaction is studied in a variety of experiments. Free neutron beta decay gives precise values for the weak vector and axialvector coupling constants, which allow precise tests of basic symmetries like the conservation of the weak vector current, the unitarity of the weak quark mixing matrix, SU(3) flavour symmetry, and right-handed currents. Neutron beta decay data are further needed to calculate weak cross-sections, for applications, in big bang cosmology, in astrophysics, in solar physics and the solar neutrino problem, and in such mundane things as neutrino detection efficiencies in neutrino oscillation or proton decay experiments. Neutron-nucleon, neutron-nucleus and neutron-electron scattering lengths are determined in high precision experiments, which use methods like neutron interferometry or neutron gravity spectrometry. The experiments give information on quantities like the neutron charge radius or the neutron electric polarizability. Precision measurements of other fundamental constants lead to a better, model-independent value of the fine structure constant. Finally, the fundamental experiments on quantum mechanics, like spinor 4π -rotation, Berry's phase, dressed neutrons, Aharanov - Casher effect, or gravitational effects on the neutron's phase will be briefly discussed. (author)

Comparison of neutron scattering cross sections with the JLM microscopic optical model

International Nuclear Information System (INIS)

Kailas, S.; Gupta, S.K.

Recently Jeukenne et al have determined microscopically the nucleon-nucleus optical potential from Reid's nucleon-nucleon interaction. Microscopic neutron-nucleus optical potentials are constructed using accurate matter densities. Reasonable success has been obtained in describing the total and elastic cross section and angular distributions at Esub(n)=8.05 MeV without modifying the microscopically calculated potentials. (auth.)

Statistical theory for calculating energy spectra of β-delayed neutrons

International Nuclear Information System (INIS)

Kawano, Toshihiko; Moeller, Peter; Wilson, William B.

2008-01-01

Theoretical β-delayed neutron spectra are calculated based on the Quasi-particle Random Phase Approximation (QRPA) and the Hauser-Feshbach statistical model. Neutron emissions from an excited daughter nucleus after β-decay to the granddaughter residual are more accurately calculated than previous evaluations, including all the microscopic nuclear structure information, such as a Gamow-Teller strength distribution and discrete states in the granddaughter. The calculated delayed-neutron spectra reasonably agree with those evaluations in the ENDF decay library, which are based on experimental data. The model was adopted to generate the delayed-neutron spectra for all 271 precursors. (authors)

ISINN-5. 5. International seminar on interaction of neutrons with nuclei. Neutron spectroscopy, nuclear structure, related topics

International Nuclear Information System (INIS)

1997-01-01

The materials submitted at the fifth in a series of annual international seminar on interaction of neutrons with nuclei Neutron Spectroscopy, Nuclear Structure, Related Topics (ISINN-5) are given. The Seminar is organized by the Frank Laboratory of Neutron Physics of the Joint Institute for Nuclear Research and took place in Dubna on May 14-17, 1997. About 130 specialists from Belgium, China, Germany, France, Japan, Korea, Latvia, Netherlands, Ukraine, 7 Russian research institutes and a number of JINR laboratories took part in the Seminar. The scope of the problems discussed is traditionally wide. It includes the problems of violation of fundamental symmetries in the interaction of neutrons with nuclei, the properties of the neutron as the fundamental particle, nonstatistical aspects of the radiation capture of neutrons by nuclei, topical problems of the theory of nucleus, and the fission mechanism of heavy nuclei. The latest results obtained with ultracold neutrons (UCN), in particular, different approaches to understanding of the cause of UCN anomalous leakage through the walls of the trap are considered as well. The wide spectrum of methodological aspects of neutron-aided experiments is also discussed in details

Neutron emission in fission of highly excited californium nuclei (E*=76 MeV)

International Nuclear Information System (INIS)

Blinov, M.V.; Bordyug, V.M.; Kozulin, Eh.M.; Mozhaev, A.N.; Levitovich, M.; Muzychka, Yu.A.; Penionzhkevich, Yu.Eh.; Pustyl'nik, B.I.

1990-01-01

The differential cross sections for neutron production in the fission of highly excited californium nuclei formed in the 238 U+ 12 C (105 MeV) reaction have been measured. From the analysis of the experimental data is follows that the number of pre-fission neutrons substantially exceeds the value obtained in the framework of the standard statistical model. The saddle-to-scission time of the excited nucleus is estimated on the basis of the neutron multiplicity. The dependences of the neutron number and neutron average energies upon the fragment mass are determined

Nominal effective radiation doses delivered during clinical trials of boron neutron capture therapy

International Nuclear Information System (INIS)

Capala, J.; Diaz, A.Z.; Chanana, A.D.

1997-01-01

Boron neutron capture therapy (BNCT) is a binary system that, in theory, should selectively deliver lethal, high linear energy transfer (LET) radiation to tumor cells dispersed within normal tissues. It is based on the nuclear reaction 10-B(n, α)7-Li, which occurs when the stable nucleus of boron-10 captures a thermal neutron. Due to the relatively high cross-section of the 10-B nucleus for thermal neutron capture and short ranges of the products of this reaction, tumor cells in the volume exposed to thermal neutrons and containing sufficiently high concentration of 10-B would receive a much higher radiation dose than the normal cells contained within the exposed volume. Nevertheless, radiation dose deposited in normal tissue by gamma and fast neutron contamination of the neutron beam, as well as neutron capture in nitrogen, 14-N(n,p)14-C, hydrogen, 1-H(n,γ)2-H, and in boron present in blood and normal cells, limits the dose that can be delivered to tumor cells. It is, therefore, imperative for the success of the BNCT the dosed delivered to normal tissues be accurately determined in order to optimize the irradiation geometry and to limit the volume of normal tissue exposed to thermal neutrons. These are the major objectives of BNCT treatment planning

Photoproduction of lepton pairs in proton-nucleus and nucleus-nucleus collisions at RHIC and LHC energies

Energy Technology Data Exchange (ETDEWEB)

Moreira, B. D.; Goncalves, V. P.; De Santana Amaral, J. T. [Universidade Federal de Pelotas, Instituto de Fisica e Matematica (Brazil)

2013-03-25

In this contribution we study coherent interactions as a probe of the nonlinear effects in the Quantum Electrodynamics (QED). In particular, we study the multiphoton effects in the production of leptons pairs for proton-nucleus and nucleus-nucleus collisions for heavy nuclei. In the proton-nucleus we assume the ultrarelativistic proton as a source of photons and estimate the photoproduction of lepton pairs on nuclei at RHIC and LHC energies considering the multiphoton effects associated to multiple rescattering of the projectile photon on the proton of the nucleus. In nucleus - nucleus colllisions we consider the two nuclei as a source of photons. As each scattering contributes with a factor {alpha}Z to the cross section, this contribution must be taken into account for heavy nuclei. We consider the Coulomb corrections to calculate themultiple scatterings and estimate the total cross section for muon and tau pair production in proton-nucleus and nucleus-nucleus collisions at RHIC and LHC energies.

Hot nuclei studies with a 4 π-Neutron detector

International Nuclear Information System (INIS)

Galin, J.; Crema, E.; Doubre, H.; Guerreau, D.; Jiang, D.X.; Morjean, M.; Piasecki, E.; Pouthas, J.; Saint-Laurent, F.; Sokolov, A.; Wang, X.D.; Charvet, J.L.; Frehaut, J.; Lott, B.; Magnago, C.; Patin, Y.; Gatty, B.; Jacquet, D.; Lott, B.

1989-01-01

When studying the behavior of hot nuclei, the challenge is twofold: how are they formed in nucleus-nucleus collisions and how do they decay Systematic studies have been undertaken at GANIL by bombarding heavy targets (Au, Th) with intermediate energy projectiles (27, 35, 44 and 77 MeV/u Ar and 32 MeV/u Kr). For such neutron rich systems the thermalized energy can be roughly evaluated simply by measuring the multiplicity of evaporated neutrons using a 4 π Gd loaded, liquid scintillator detector. The influence of the bombarding energy and projectile mass on the energy dissipation has been investigated for different exit channels and special emphasis has been put in the study of the most dissipative collisions. The thermal energy, derived by summing the energy removed by both evaporated neutrons and light charged particles is shown to saturate at E * ≅ 650 MeV in the Ar induced reactions between 27 and 77 MeV/u, in good consistency with the predictions of semi-classical Landau-Vlasov calculations

Analyzer of neutron flux in real time

International Nuclear Information System (INIS)

Rojas S, A.S.; Carrillo M, R.A.; Balderas, E.G.

1999-01-01

With base in the study of the real signals of neutron flux of instability events occurred in the Laguna Verde nuclear power plant where the nucleus oscillation phenomena of the reactor are in the 0 to 2.5 Hz range, it has been seen the possibility about the development a surveillance and diagnostic equipment capable to analyze in real time the behavior of nucleus in this frequencies range. An important method for surveillance the stability of the reactor nucleus is the use of the Power spectral density which allows to determine the frequencies and amplitudes contained in the signals. It is used an instrument carried out by LabVIEW graphic programming with a data acquisition card of 16 channels which works at Windows 95/98 environment. (Author)

Model for nucleus-nucleus, hadron-nucleus and hadron-proton multiplicity distributions

International Nuclear Information System (INIS)

Singh, C.P.; Shyam, M.; Tuli, S.K.

1986-07-01

A model relating hadron-proton, hadron-nucleus and nucleus-nucleus multiplicity distributions is proposed and some interesting consequences are derived. The values of the parameters are the same for all the processes and are given by the QCD hypothesis of ''universal'' hadronic multiplicities which are found to be asymptotically independent of target and beam in hadronic and current induced reactions in particle physics. (author)

Differences Between a Single- and a Double-Folding Nucleus-9Be Optical Potential

International Nuclear Information System (INIS)

Bonaccorso, A.; Carstoiu, F.; Charity, R. J.; Kumar, R.; Salvioni, G.

2016-01-01

We have recently constructed two very successful n- 9 Be optical potentials (Bonaccorso and Charity in Phys Rev C89:024619, 2014). One by the Dispersive Optical Model (DOM) method and the other (AB) fully phenomenological. The two potentials have strong surface terms in common for both the real and the imaginary parts. This feature makes them particularly suitable to build a single-folded (light-) nucleus- 9 Be optical potential by using ab-initio projectile densities such as those obtained with the VMC method. On the other hand, a VMC density together with experimental nucleon–nucleon cross-sections can be used also to obtain a neutron and/or proton- 9 Be imaginary folding potential. We will use here an ab-initio VMC density to obtain both a n- 9 Be single-folded potential and a nucleus-nucleus double-folded potential. In this work we report on the cases of 8 B, 8 Li and 8 C projectiles. Our approach could be the basis for a systematic study of optical potentials for light exotic nuclei scattering on such light targets. Some of the projectiles studied are cores of other exotic nuclei for which neutron knockout has been used to extract spectroscopic information. For those cases, our study will serve to make a quantitative assessment of the core-target part of the reaction description, in particular its localization. (author)

ISINN-3. Neutron spectroscopy, nuclear structure, related topics

International Nuclear Information System (INIS)

1995-01-01

The proceedings contain the materials presented at the Third International Seminar on Neutron-Nucleus Interactions (ISINN-3) dealing with the problems of neutron spectroscopy, nuclear structure and related topics. The Seminar took place in Dubna on April 26-28, 1995. Over 100 scientists from Belgium, Bulgaria, Czech Republic, Germany, Japan, Latvia, Mexico, Poland, Slovakia, Ukraine, USA and from more than 10 Russian research institutes took part in the Seminar. The Seminar is dedicated to the memory of the founder of the Neutron Physics Laboratory of JINR, the famous soviet scientist Professor Fedor L. Shapiro, whose 80th anniversary is being observed. The main problems discussed are the following: fundamental interactions and symmetries in neutron-induced reactions, fundamental properties of the neutron, properties of excited nuclei after neutron capture and some other ones. Special emphasis is laid upon γ decay and neutron induced nuclear fission as well as upon the methodical aspects of new experiments

Higgs-boson production in nucleus-nucleus collisions

International Nuclear Information System (INIS)

Anon.

1992-01-01

Cross section calculations are presented for the production of intermediate-mass Higgs bosons produced in ultrarelativistic nucleus-nucleus collisions via two photon fusion. The calculations are performed in position space using Baur's method for folding together the Weizsacker-Williams virtual-photon spectra of the two colliding nuclei. It is found that two photon fusion in nucleus-nucleus collisions is a plausible way of finding intermediate-mass Higgs bosons at the Superconducting Super Collider or the CERN Large Hadron Collider

Higgs-Boson Production in Nucleus-Nucleus Collisions

Science.gov (United States)

Norbury, John W.

1992-01-01

Cross section calculations are presented for the production of intermediate-mass Higgs bosons produced in ultrarelativistic nucleus-nucleus collisions via two photon fusion. The calculations are performed in position space using Baur's method for folding together the Weizsacker-Williams virtual-photon spectra of the two colliding nuclei. It is found that two photon fusion in nucleus-nucleus collisions is a plausible way of finding intermediate-mass Higgs bosons at the Superconducting Super Collider or the CERN Large Hadron Collider.

Consequences of Relativistic Neutron Outflow beyond the Accretion Disks of Active Galaxies

Science.gov (United States)

Ekejiuba, I. E.; Okeke, P. N.

1993-05-01

Three channels of relativistic electron injection in the jets of extragalactic radio sources (EGRSs) are discussed. With the assumption that an active galactic nucleus (AGN) is powered by a spinning supermassive black hole of mass ~ 10(8) M_⊙ which sits at the center of the nucleus and ingests matter and energy through an accretion disk, a model for extracting relativistic neutrons from the AGN is forged. In this model, the inelastic proton--proton and proton--photon interactions within the accretion disk, of relativistic protons with background thermal protons and photons, respectively, produce copious amounts of relativistic neutrons. These neutrons travel ballistically for ~ 10(3gamma_n ) seconds and escape from the disk before they decay. The secondary particles produced from the neutron decays then interact with the ambient magnetic field and/or other particles to produce the radio emissions observed in the jets of EGRSs. IEE acknowledges the support of the World Bank and the Federal University of Technology, Yola, Nigeria as well as the hospitality of Georgia State University.

25 CFR 167.14 - Movement of livestock.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Movement of livestock. 167.14 Section 167.14 Indians... Movement of livestock. Annually, prior to the normal lamb buying season, the Central Grazing Committee... and the procedures and methods to be used in moving livestock to market. All movements of livestock...

46 CFR 167.65-35 - Use of auto pilot.

Science.gov (United States)

2010-10-01

... 46 Shipping 7 2010-10-01 2010-10-01 false Use of auto pilot. 167.65-35 Section 167.65-35 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Special Operating Requirements § 167.65-35 Use of auto pilot. Except as provided in 33 CFR 164.15, when...

Angular momentum and incident-energy dependence of nucleus-nucleus interaction

International Nuclear Information System (INIS)

Yamaguchi, S.

1991-01-01

The purpose of this paper is to understand intuitively the origin of the angular momentum and incident-energy dependence of the nucleus-nucleus interaction on the basis of the totally- antisymmetrized many-body theory. With the aim of understanding the structure of the nucleus-nucleus interaction, we show first that the nucleus-nucleus interaction can be written by the use of the density-distribution function and the phase-space distribution function instead of using the many-body wave function itself. And we show that the structure change of the density-distribution function with the increase of the angular momentum causes the angular momentum dependence of the nucleus-nucleus interaction and that the incident-energy dependence of the nucleus-nucleus interaction originates from the structure change of the phase-space distribution function

Study on the characteristics of sup(163,165,167)Tm excited states

International Nuclear Information System (INIS)

Adam, I.; Alikov, B.A.; Badalov, Kh.N.

1985-01-01

On the basis of analysis of transition intensities, de-excitation nature and systematics of sup(163,1965, 167)Tm nucleus level energy the interpretation of some excited states of studied isotopes is suggested. Results of calculations within the framework of an independent quasiparticle model and quasiparticle-phonon model confirm the suggested interpretation and show that taking account of quasiparticle-phonon interaction improves agreement of theoretical energy values with experimental as compared with the independent quasiparticle model. The calculation of energy of rotational states within the framework of a non adi batic rotational model shows that it is possible to obtain rather good agreement with experiment. It is noted that taking account of correctly the difference in deformations of one-particle states can result in the improvement of agreement of theory and experiment. When calculating rotational spectra for the description of high-lying states it is desirable to consider dependence of collective parameters, for example, inertia momentum, on spin

Description of nuclear structure and cross sections for nucleon-nucleus scattering on the basis of effective Skyrme forces

International Nuclear Information System (INIS)

Kuprikov, V. I.; Pilipenko, V. V.; Soznik, A. P.; Tarasov, V. N.; Shlyakhov, N. A.

2009-01-01

The possibility of constructing such new versions of effective nucleon-nucleon forces that would make it possible to describe simultaneously the cross sections for nucleon-nucleus scattering and quantities characterizing nuclear matter and the structure of finite even-even nuclei is investigated on the basis of a microscopic nucleon-nucleus optical potential that is calculated by using effective Skyrme interaction. A procedure for optimizing the parameters of Skyrme forces by employing fits to specific angular distributions for neutron-nucleus scattering and by simultaneously testing the features of nuclear matter, the binding energy of the target nucleus, and its proton root-mean-square radius is proposed. A number of versions of modified Skyrme forces that ensure a reasonable description of both nucleon-nucleus scattering and the properties of nuclear structure are found on the basis of this procedure.

New results on nuclear multifragmentation in nucleon-nucleus and nucleus-nucleus collisions at relativistic energies

International Nuclear Information System (INIS)

Besliu, Calin; Jipa, Alexandru; Iliescu, Bogdan; Felea, Daniel

2002-01-01

Some new aspects on the multifragmentation processes in nucleus-nucleus and nucleon-nucleus collisions at high energies are discussed in this work. Experimental data obtained in international collaborations (for example, MULTI Collaboration with KEK Tsukuba (Japan) and SKM 200 Collaboration with JINR Dubna (Russia)) are used to discuss new mechanisms in the target nucleus fragmentation. Correlations with stopping power, participant region size and energy density are included. Comparisons of the experimental results with the predictions of a phenomenological geometric model of intermediate mass fragment multiplicity, caloric curves and angular distributions are also presented. These results are used for global description of the multifragmentation processes in nucleon-nucleus and nucleus-nucleus collisions at relativistic energies. The size of the participant region and the average intermediate mass fragments multiplicity are taken into consideration using the free space probability. A few correlations between the deposited energy in the participant region and stability state of the intermediate mass fragments are presented in this work. The importance of the collision geometry in the multifragmentation processes is stressed. The results suggest different time moments for the incident nucleus fragmentation and for the target nucleus fragmentation. The associated entropies are distinct. (authors)

Low energy E0 transitions in odd-mass nuclei of the neutron deficient 180 < A < 200 region

International Nuclear Information System (INIS)

Zganjar, E.F.; Kortelahti, M.O.; Wood, J.L.; Papanicolopulos, C.D.

1987-01-01

The region of neutron-deficient nuclei near Z = 82 and N = 104 provides the most extensive example of low-energy shape coexistence anywhere on the mass surface. It is shown that E0 and E0 admixed transitions may be used as a fingerprint to identify shape coexistence in odd-mass nuclei. It is also shown that all the known cases of low energy E0 and E0 admixed transitions in odd-mass nuclei occur where equally low-lying O + states occur in neighboring even-even nuclei. A discussion of these and other relevant data as well as suggestions for new studies which may help to clarify and, more importantly, quantify the connection between E0 transitions and shape coexistence are presented. 60 refs., 7 figs., 4 tabs

Study of the Neutron Deficient Pb and Bi Isotopes by Simultaneous Atomic- and Nuclear-Spectroscopy

CERN Multimedia

Kessler, T

2002-01-01

We propose to study systematically nuclear properties of the neutron deficient lead $^{183-189}$Pb, $^{191g}$Pb, $^{193g}$Pb and bismuth isotopes $^{188-200}$Bi by atomic spectroscopy with the ISOLDE resonance ionisation laser ion source (RILIS) combined with simultaneous nuclear spectroscopy at the detection set-up. The main focus is the determination of the mean square charge radii of $^{183-190}$Pb and $^{188-193}$Bi from which the influence of low-lying intruder states should become obvious. Also the nuclear spin and magnetic moments of ground-states and long-lived isomers will be determined unambiguously through evaluation of the hyperfine structure, and new isomers could be discovered. The decay properties of these nuclei can be measured by $\\alpha$-$\\gamma$ and $\\beta$-$\\gamma$ spectroscopy. With this data at hand, possible shape transitions around mid-shell at N$\\sim$104 will be studied. This data is crucial for the direct test of nuclear theory in the context of intruder state influence (e.g. energy ...

Os caminhos percorridos pelo processo inclusivo de alunos com deficiência na escola: uma reflexão dos direitos construídos historicamente

Directory of Open Access Journals (Sweden)

Edison Duarte

2011-10-01

Full Text Available Normal 0 21 false false false PT-BR X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabela normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin:0cm; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;}  O movimento de inclusão defende a educação de qualidade para alunos com deficiência no sistema regular de ensino e as escolas devem fornecer as condições necessárias para que este aluno aprenda. Este texto tem como objetivo trazer uma leitura crítica sobre o processo histórico de inclusão de alunos com deficiência no sistema educacional, com base na análise da legislação oficial publicada sobre o tema. Essa análise permite reflexões a respeito das evoluções conquistadas, bem como os possíveis equívocos ainda presentes. O referido texto se deteve apenas ao período histórico referente à fase de inclusão, com início na década de 1990. A legislação vigente estabelece a adequação do sistema educacional às necessidades e limitações apresentadas pelos alunos com deficiência, transtornos globais de desenvolvimento ou com altas habilidades/superdotação. Os recursos educacionais especiais são limitados apenas aos alunos com essas condições físicas ou psicológicas, legitimadas por laudo médico.Palavras-chave: Inclusão. Pessoa com deficiência. Educação. 

Thermodynamic properties of OsB under high temperature and high pressure

Science.gov (United States)

Chen, Hai-Hua; Li, Zuo; Cheng, Yan; Bi, Yan; Cai, Ling-Cang

2011-09-01

The energy-volume curves of OsB have been obtained using the first-principles plane-wave ultrasoft-pseudopotential density functional theory (DFT) within the generalized gradient approximation (GGA) and local density approximation (LDA). Using the quasi-harmonic Debye model we first analyze the specific heat, the coefficients of thermal expansion as well as the thermodynamic Grüneisen parameter of OsB in a wide temperature range at high pressure. At temperature 300 K, the coefficients of thermal expansion αV by LDA and GGA calculations are 1.67×10 -5 1/K and 2.01×10 -5 1/K, respectively. The specific heat of OsB at constant pressure (volume) is also calculated. Meanwhile, we find that the Debye temperature of OsB increases monotonically with increasing pressure. The present study leads to a better understanding of how the OsB materials respond to pressure and temperature.

Direct capture of low-energy neutrons by {sup 16}O

Energy Technology Data Exchange (ETDEWEB)

Kitazawa, Hideo [Tokyo Inst. of Tech., Nagatsuta, Yokohama (Japan). Interdisciplinary Graduate School of Science; Igashira, Masayuki

1998-03-01

A dispersive optical potential for the interaction between low-energy neutrons and {sup 16}O-nuclei is derived from a dispersion relation based on the Feshbach generalized optical model. This potential is applied to direct-capture model calculations in explaining the observed off-resonance capture transitions to the ground (5/2{sup +}) and 871 keV(1/2{sup +}) levels in {sup 17}O at neutron energies of 20-70 keV. The model calculations take account of the spatial nonlocality of the neutron-nucleus interaction potential. (author)

Coulomb excitation of the two proton-hole nucleus $^{206}$Hg

CERN Multimedia

We propose to use Coulomb excitation of the single magic two-proton-hole nucleus $^{206}$Hg. In a single-step excitation both the first 2$^{+}$ and the highly collective octupole 3$^{-}$ states will be populated. Thus, information on both quadrupole and octupole collectivity will be gained in this neutron-rich nucleus. Due to the high beam intensity, we will be able to observe multi-step Coulomb excitation as well, providing further test on theoretical calculations. The results will be used to improve the predictive power of the shell model for more exotic nuclei as we move to lighter N=126 nuclei. The experiment will use the new HIE-ISOLDE facility and the MINIBALL array, and will take advantage of the recently developed $^{206}$Hg beam from the molten lead target.

Theory of neutron emission in fission

International Nuclear Information System (INIS)

Madland, D.G.

1989-01-01

Following a summary of the observables in neutron emission in fission, a brief history is given of theoretical representations of the prompt fission neutron spectrum N(E) and average prompt neutron multiplicity /bar /nu///sub p/. This is followed by descriptions, together with examples, of modern approaches to the calculation of these quantities including recent advancements. Emphasis will be placed upon the predictability and accuracy of the modern approaches. In particular, the dependence of N(E) and /bar /nu///sub p/ on the fissioning nucleus and its excitation energy will be discussed, as will the effects of and competition between first-, second- and third-chance fission in circumstances of high excitation energy. Finally, properties of neutron-rich (fission-fragment) nuclei are discussed that must be better known to calculate N(E) and /bar /nu///sub p/ with higher accuracy than is currently possible. 17 refs., 11 figs

Fusion reaction around the Coulomb barrier with neutron-rich nuclei

Energy Technology Data Exchange (ETDEWEB)

Yoshida, Atsushi [Institute of Physical and Chemical Research, Wako, Saitama (Japan)

1997-07-01

Two fusion reactions with neutron-rich nuclei are reported in this work. On the first reaction: {sup 9,10,11}Be+{sup 209}Bi, the fusion cross sections around the coulomb barrier were measured by determing {alpha} disintegration from compound nucleus Fr. In the field of 10-100 mb, the same total fusion cross sections were obtained. The phenomenon {sup 11}Be(neutron halo nucleus) alone increased and decreased was not observed. The fusion cross sections of {sup 27,29,31}Al+{sup 197}Au system were determined by using 130 kcps and 30 kcps of beam strength of {sup 29,31}Al, respectively. The value of {sup 27}Al was reproduced by calculation, but that of {sup 29}Al increased around barrier which could not be explained by CCDEF calculation. (S.Y.)

Cochlear nucleus neuron analysis in individuals with presbycusis.

Science.gov (United States)

Hinojosa, Raul; Nelson, Erik G

2011-12-01

The aim of this study was to analyze the cochlear nucleus neuron population in individuals with normal hearing and presbycusis. Retrospective study of archival human temporal bone and brain stem tissues. Using strict inclusion criteria, the temporal bones and cochlear nuclei from six normal hearing individuals and four individuals with presbycusis were selected for analysis. The spiral ganglion cell population, the cochlear nucleus neuron population, and the cell body size of the neurons were quantified in these cases. A relationship was not observed between age and the spiral ganglion cell population in the normal hearing group. Presbycusis subjects exhibited a reduced spiral ganglion cell population. The mean cochlear nucleus neuron population was observed to be significantly higher in the presbycusis group (mean ± standard deviation: 114,170 ± 10,570) compared to the normal hearing group (91,470 ± 9,510) (P = .019). This difference was predominantly the result of greater multipolar and granule cell neuron populations. Only the fusiform neuron type exhibited a significantly different mean cell body cross-sectional area between the normal hearing group (242 ± 27) and the presbycusis group (300 ± 37) (P = .033). This investigation is the first time, to our knowledge, that the populations of the eight neuron types in the cochlear nucleus have been quantified in both normal hearing individuals and individuals with presbycusis. The data support the concept that presbycusis is not an effect of aging alone but instead may be a condition that predisposes one to hearing loss with advancing age and is characterized by a congenitally elevated cochlear nucleus neuron population. Copyright © 2011 The American Laryngological, Rhinological, and Otological Society, Inc.

A Simple Correlation for Neutron Capture Rates from Nuclear Masses

Energy Technology Data Exchange (ETDEWEB)

Couture, Aaron Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2018-01-30

Recent studies of neutron capture performed at LANL have revealed a previously unrecognized connection between nuclear masses and the average neutron capture cross section. A team of three scientists from Los Alamos (P-27), Yale Univ., and Istanbul Univ. (Turkey) recently discovered this connection and have published their results as a Rapid Communication in Physical Review C. Neutron capture is a reaction in which a free neutron is absorbed by the nucleus, keeping the element unchanged, but changing isotopes. This reaction is typically exothermic. As a result, the reaction can proceed even when many other reaction channels are closed. In an astrophysical environment, this means that neutron capture is the primary mechanism by which all of the elements with atomic number greater than nickel are produced is neutron capture.

Fast neutron scattering on actinide nuclei

International Nuclear Information System (INIS)

1982-01-01

More and more sophisticated neutron experiments have been carried out with better samples in several laboratories and it was necessary to intercompare them. In this respect, let us quote for example (n,n'e) and (n,n'#betta#) measurements. Moreover, high precision (p,p), (p,p') and (p,n) measurements have been made, thus supplementing neutron experiments in the determination of the parameters of the optical model, still widely used to describe the neutron-nucleus interaction. The optical model plays a major role and it is therefore essential to know it well. The spherical optical model is still very useful, especially because of its simplicity and of the relatively short calculation times, but is obviously insufficient to treat deformed nuclei such as actinides. For accurate calculations about these nuclei, it is necessary to use a deformed potential well and solve a set of coupled equations, hence long computational times. The importance of compound nucleus formation at low energy requires also a good knowledge of the statistical model together with that of all the reaction mechanisms which are involved, including fission for which an accurate barrier is necessary and, of course, well-adjusted level densities. The considerations form the background of the Scientific Programme set up by a Programme Committee whose composition is given further on in this book

The spin-spin effect in the total neutron cross section of polarized neutrons on polarized 165Ho

International Nuclear Information System (INIS)

Fasoli, U.; Galeazzi, G.; Pavan, P.; Toniolo, D.; Zago, G.; Zannoni, R.

1978-01-01

The spin-spin effect in the total neutron cross section of polarized neutrons on polarized 165 Ho has been measured in the energy interval 0.4 to 2.5 MeV, in perpendicular geometry. The results are consistent with zero effect. The spin-spin cross section sigmasub(ss) has been theoretically evaluated by a non-adiabatic coupled-channel calculation. From the comparison between the experimental and theoretical results a value Vsub(ss) = 9+-77 keV for the strength of the spin-spin potential has been obtained. Compound-nucleus effects do not seem to be relevant. (Auth.)

Dual-sided microstructured semiconductor neutron detectors (DSMSNDs)

International Nuclear Information System (INIS)

Fronk, Ryan G.; Bellinger, Steven L.; Henson, Luke C.; Ochs, Taylor R.; Smith, Colten T.; Kenneth Shultis, J.; McGregor, Douglas S.

2015-01-01

Microstructured semiconductor neutron detectors (MSNDs) have in recent years received much interest as high-efficiency replacements for thin-film-coated thermal neutron detectors. The basic device structure of the MSND involves micro-sized trenches that are etched into a vertically-oriented pvn-junction diode that are backfilled with a neutron converting material. Neutrons absorbed within the converting material induce fission of the parent nucleus, producing a pair of energetic charged-particle reaction products that can be counted by the diode. The MSND deep-etched microstructures produce good neutron-absorption and reaction-product counting efficiencies, offering a 10× improvement in intrinsic thermal neutron detection efficiency over thin-film-coated devices. Performance of present-day MSNDs are nearing theoretical limits; streaming paths between the conversion-material backfilled trenches, allow a considerable fraction of neutrons to pass undetected through the device. Dual-sided microstructured semiconductor neutron detectors (DSMSNDs) have been developed that utilize a complementary second set of trenches on the back-side of the device to count streaming neutrons. DSMSND devices are theoretically capable of greater than 80% intrinsic thermal neutron detection efficiency for a 1-mm thick device. The first such prototype DSMSNDs, presented here, have achieved 29.48±0.29% nearly 2× better than MSNDs with similar microstructure dimensions.

Shape evolution in neutron-rich A ~ 140 nuclei beyond the doubly-magic nucleus 132Sn

Science.gov (United States)

Odahara, Atsuko; Eurica Collaboration

2014-09-01

Study for the shape evolution enables us to disentangle competition between spherical (single-particle like) shape and deformed (collective-like) shape as a function of neutron number. Neutron-rich nuclei in the northeast region of the doubly-magic 132Sn locates in one of the best mass region where a variety of collective modes, not only prolate deformation but also octupole collectivity, are expected to appear. These neutron-rich A ~140 nuclei were produced by using in-flight fission reaction of the 345 MeV/u 238U86+ beam at RIKEN RI Beam Factory. This experiment was performed in the framework of the EURICA (EUroball RIken Cluster Array) project based on the highly-efficient β- and isomer-decay spectroscopy methods. Around 20 extremely neutron-rich nuclei with Z=51--55 have been studied in this work. New isomers with half lives of longer than hundreds ns were found in some nuclei, such as the neutron-rich Cs isotopes. Also, preliminary results for the β decay of neutron-rich I and Xe isotopes have been obtained. Systematic change of the shape evolution for these neutron-rich isotopes will be discussed.

Characterization of Monoenergetic Low Energy Neutron Fields with the {mu}TPC Detector

Energy Technology Data Exchange (ETDEWEB)

Golabek, C.; Lebreton, L.; Petit, M. [Laboratoire de Metrologie et de Dosimetrie des Neutrons, IRSN Cadarache, 13115 Saint-Paul-Lez-Durance (France); Billard, J.; Grignon, C.; Bosson, G.; Bourrion, O.; Guillaudin, O.; Mayet, F.; Richer, J.-P.; Santos, D. [Laboratoire de Physique Subatomique et de Cosmologie, Universite Joseph (France)

2011-12-13

The AMANDE facility produces monoenergetic neutron fields from 2 keV to 20 MeV for metrological purposes. To be considered as a reference facility, fluence and energy distributions of neutron fields have to be determined by primary measurement standards. For this purpose, a micro Time Projection Chamber is being developed to be dedicated to measure neutron fields with energy ranging from 2 keV up to 1 MeV. We present simulations showing that such a detector, which allows the measurement of the ionization energy and the 3D reconstruction of the recoil nucleus, provides the determination of neutron energy and fluence of such low energy neutron fields.

A {mu}TPC detector for the characterization of low energy neutron fields

Energy Technology Data Exchange (ETDEWEB)

Golabek, C., E-mail: cedric.golabek@irsn.fr [Laboratoire de Metrologie et de Dosimetrie des Neutrons, IRSN Cadarache, 13115 Saint-Paul-Lez-Durance (France); Billard, J. [Laboratoire de Physique Subatomique et de Cosmologie, Universite Joseph Fourier Grenoble 1, CNRS/IN2P3, Institut Polytechnique de Grenoble, 53 rue des Martyrs, 38026 Grenoble (France); Allaoua, A. [Laboratoire de Metrologie et de Dosimetrie des Neutrons, IRSN Cadarache, 13115 Saint-Paul-Lez-Durance (France); Bosson, G.; Bourrion, O.; Grignon, C.; Guillaudin, O. [Laboratoire de Physique Subatomique et de Cosmologie, Universite Joseph Fourier Grenoble 1, CNRS/IN2P3, Institut Polytechnique de Grenoble, 53 rue des Martyrs, 38026 Grenoble (France); Lebreton, L., E-mail: lena.lebreton@irsn.fr [Laboratoire de Metrologie et de Dosimetrie des Neutrons, IRSN Cadarache, 13115 Saint-Paul-Lez-Durance (France); Mayet, F. [Laboratoire de Physique Subatomique et de Cosmologie, Universite Joseph Fourier Grenoble 1, CNRS/IN2P3, Institut Polytechnique de Grenoble, 53 rue des Martyrs, 38026 Grenoble (France); Petit, M. [Laboratoire de Metrologie et de Dosimetrie des Neutrons, IRSN Cadarache, 13115 Saint-Paul-Lez-Durance (France); Richer, J.-P.; Santos, D. [Laboratoire de Physique Subatomique et de Cosmologie, Universite Joseph Fourier Grenoble 1, CNRS/IN2P3, Institut Polytechnique de Grenoble, 53 rue des Martyrs, 38026 Grenoble (France)

2012-06-21

The AMANDE facility produces monoenergetic neutron fields from 2 keV to 20 MeV for metrological purposes. To be considered as a reference facility, fluence and energy distributions of neutron fields have to be determined by primary measurement standards. For this purpose, a micro Time Projection Chamber is being developed to be dedicated to measure neutron fields with energy ranging from 8 keV up to 1 MeV. In this work we present simulations showing that such a detector, which allows the measurement of the ionization energy and the 3D reconstruction of the recoil nucleus, provides the determination of neutron energy and fluence of these neutron fields.

Ações e estratégias pedagógicas descritas a partir da prática docente voltada a alunos com deficiência que caracterizam os critérios de mediação de Reuven Feuerstein

Directory of Open Access Journals (Sweden)

Patricia Moralis Caramori

2012-10-01

Full Text Available O estudo aborda a temática da educação de pessoas com deficiência intelectual severa. Tem por objetivo descrever e analisar a implementação do processo educacional desses alunos, enfocando as estratégias pedagógicas utilizadas por professoras de Educação Especial na cidade de Araraquara. Abarca uma população pouco investigada, e une dois eixos de discussão de forma inovadora: a Teoria da Modificabilidade Cognitiva Estrutural (MCE de Reuven Feuerstein e a educação de alunos com deficiência intelectual severa. De acordo com a MCE e a idéia de Experiência de Aprendizagem Mediada, o professor atua como mediador, interpondo-se entre os estímulos do ambiente e o aluno, selecionando-os, filtrandoos e modelando-os. O método deu-se pelo estabelecimento do perfil do professor, seu mapeamento e localização. A coleta de dados ocorreu por meio de três instrumentos: entrevista com as professoras participantes, protocolo de observação e diário de campo para registro. Os dados foram analisados qualitativamente, extraindo-se o máximo de detalhes possível do cotidiano investigado. Os resultados descrevem o trabalho das quatro professoras e arrola as suas estratégias pedagógicas que permitem a relação com os três principais critérios de medicação: Intencionalidade e Reciprocidade, Significado e Transcendência. Como conclusão o estudo mostra ser possível a associação entre a Experiência de Aprendizagem Mediada de Feuerstein e as práticas pedagógicas voltadas a alunos com deficiência intelectual severa, já que determinados procedimentos empregados trazem em seu cerne preceitos essenciais à mediação.

Projectile fragmentation of a weakly-bound 11Be nucleus at 0.8 GeV/nucleon

International Nuclear Information System (INIS)

Kobayashi, T.

1990-01-01

The projectile fragmentation of a weakly-bound 11 Be projectile has been measured on a carbon target at 0.8 GeV/nucleon. The transverse momentum distribution of 10 Be fragments showed a two-Gaussian structure: a narrow component with σ ∼ 25 MeV/c on top of a wide component with σ ∼ 110 MeV/c. As in the case of 11 Li fragmentation, the narrow momentum distribution indicates a long tail in the neutron density distribution which is consistent with the large nuclear matter radius of the 11 Be nucleus. Neutrons were also measured in coincidence with 10 Be fragments. In contrast to 10 Be fragments, no narrow momentum distribution was observed for coincident neutrons

Benchmark of neutron production cross sections with Monte Carlo codes

Science.gov (United States)

Tsai, Pi-En; Lai, Bo-Lun; Heilbronn, Lawrence H.; Sheu, Rong-Jiun

2018-02-01

Aiming to provide critical information in the fields of heavy ion therapy, radiation shielding in space, and facility design for heavy-ion research accelerators, the physics models in three Monte Carlo simulation codes - PHITS, FLUKA, and MCNP6, were systematically benchmarked with comparisons to fifteen sets of experimental data for neutron production cross sections, which include various combinations of 12C, 20Ne, 40Ar, 84Kr and 132Xe projectiles and natLi, natC, natAl, natCu, and natPb target nuclides at incident energies between 135 MeV/nucleon and 600 MeV/nucleon. For neutron energies above 60% of the specific projectile energy per nucleon, the LAQGMS03.03 in MCNP6, the JQMD/JQMD-2.0 in PHITS, and the RQMD-2.4 in FLUKA all show a better agreement with data in heavy-projectile systems than with light-projectile systems, suggesting that the collective properties of projectile nuclei and nucleon interactions in the nucleus should be considered for light projectiles. For intermediate-energy neutrons whose energies are below the 60% projectile energy per nucleon and above 20 MeV, FLUKA is likely to overestimate the secondary neutron production, while MCNP6 tends towards underestimation. PHITS with JQMD shows a mild tendency for underestimation, but the JQMD-2.0 model with a modified physics description for central collisions generally improves the agreement between data and calculations. For low-energy neutrons (below 20 MeV), which are dominated by the evaporation mechanism, PHITS (which uses GEM linked with JQMD and JQMD-2.0) and FLUKA both tend to overestimate the production cross section, whereas MCNP6 tends to underestimate more systems than to overestimate. For total neutron production cross sections, the trends of the benchmark results over the entire energy range are similar to the trends seen in the dominate energy region. Also, the comparison of GEM coupled with either JQMD or JQMD-2.0 in the PHITS code indicates that the model used to describe the first

Nuclear physics and fundamental physics explored with neutrons

International Nuclear Information System (INIS)

Masuda, Yasuhiro

1995-08-01

This Japan Hadron Project workshop was held on May 19 and 20, 1995, at Institute for Nuclear Study, University of Tokyo. The Neutron Arena planned in JHP is the facility that uses the spallation neutrons generated by high energy protons, and its utilization is planned in wide research fields. On the other hand, in the neutron scattering facility in the booster utilization facility of National Laboratory for High Energy Physics, the researches of verifying parity nonconservation and time reversal break have been carried out so far. It is necessary to accurately measure the reaction cross section of neutrons in low energy region. This workshop was planned for examining the Neutron Arena by the researchers related to elementary particles and atomic nuclei. In the workshop, lectures were given on the break of the reversal symmetry of time and space in neutron-atomic nucleus reaction, neutrino physics, neutron capture and celestial nuclear physics, neutron-induced nucleosynthesis, development and utilization of very cold neutron interferometer using multi-layer film mirror, research on gravity using neutron interferometer, electric polarizability of neutrons, β decay of neutrons, possibility of research on basic symmetry problem at E-arena, β decay in storage ring, neutron electric dipole moment using ultracold neutrons, magnetic confinement and control of ultracold neutrons, and outline of JHP neutron source. (K.I.)

Neutron emission in fission of highly excited californium nuclei (E* = 76 MeV)

International Nuclear Information System (INIS)

Blinov, M.V.; Bordyug, V.M.; Kozulin, E.M.; Levitovich, M.; Mozhaev, A.N.; Muzychka, Yu.A.; Penionzhkevich, Yu.E.; Pustyl'nik, B.I.

1990-01-01

Differential cross sections for neutron production have been measured in fission of excited californium nuclei produced in the reaction 238 U + 12 C (105 MeV). It follows from analysis of the experimental results that the number of neutrons emitted before fission considerably exceeds the number obtained in the framework of the standard statistical model. On the basis of the multiplicity of neutrons they authors have estimated the time of fission of the excited nucleus. The dependence of the number of neutrons and their average energies on the mass of the fragments is determined

Development of Cold Neutron Depth Profiling System at HANARO

International Nuclear Information System (INIS)

Park, B. G.; Choi, H. D.; Sun, G. M.

2012-01-01

The depth profiles of intentional or intrinsic constituents of a sample provide valuable information for the characterization of materials. A number of analytical techniques for depth profiling have been developed. Neutron Depth Profiling (NDP) system which was developed by Ziegler et al. is one of the leading analytical techniques. In NDP, a thermal or cold neutron beam passes through a material and interacts with certain isotopes that are known to emit monoenergetic-charged particle remaining a recoil nucleus after neutron absorption. The depth is obtained from the energy loss of those charged particles escaping surface of substrate material. For various applications of NDP technique, the Cold Neutron Depth Profiling System (CN-NDP) was developed at a neutron guide CG1 installed at the HANARO cold neutron source. In this study the design features of the cold neutron beam and target chamber for the CN-NDP system are given. Also, some experiments for the performance tests of the CN-NDP system are described

Aspectos das lesões esportivas em atletas com deficiência visual

Directory of Open Access Journals (Sweden)

Marília Passos Magno e Silva

2011-10-01

Full Text Available Estudos na área de lesões esportivas em atletas com deficiência apresentam, em sua maioria, um desenho de pesquisa que agrega dados de diferentes deficiências (físicas e sensoriais e modalidades esportivas, criando dificuldades na interpretação dos resultados. Este estudo teve como objetivo principal analisar a frequência das lesões esportivas em atletas com deficiência visual, além de identificar as áreas corporais mais lesionadas, o mecanismo das lesões esportivas, as principais lesões esportivas que acometem os atletas com deficiência visual e verificar se o grau de deficiência visual apresenta relação com a incidência de lesões esportivas. Fizeram parte do estudo atletas com deficiência visual, de ambos os sexos, integrantes da seleção brasileira nas modalidades de atletismo, futebol de 5, goalball, judô e natação, em competições internacionais, entre os anos de 2004 e 2008. Os dados foram coletados através de uma ficha médica e fisioterápica utilizada pela Confederação Brasileira de Desporto para Cegos e pelo Comitê Paraolímpico Brasileiro. Participaram do estudo 131 atletas, sendo 42 do sexo feminino e 89 do sexo masculino, 61 com classe visual B1, 46 com classe B2 e 24 com classe B3. Deste total, 102 atletas apresentaram 288 lesões resultando em uma média de 2,82 lesões por atleta. Atletas do sexo feminino lesionam mais que atletas do sexo masculino; porém, essa diferença não é estatisticamente significante. Com relação à classificação visual, atletas B1 lesionam mais que B2 e esses mais que B3; porém, só foi encontrada diferença significativa entre os atletas B1 e B3. Foi encontrado valor próximo entre lesões por acidente esportivo e sobrecarga. A respeito dos segmentos corporais, os membros inferiores foram mais acometidos, seguido por membros superiores, coluna, cabeça e tronco. Foram encontrados 21 diagnósticos diferentes, sendo mais frequentes as tendinopatias, contraturas e

Coulomb Excitation of the N = 50 nucleus 80Zn

International Nuclear Information System (INIS)

Van de Walle, J.; Cocolios, T. E.; Huyse, M.; Ivanov, O.; Mayet, P.; Raabe, R.; Sawicka, M.; Stefanescu, I.; Duppen, P. van; Aksouh, F.; Ames, F.; Habs, D.; Lutter, R.; Behrens, T.; Gernhauser, R.; Kroell, T.; Kruecken, R.; Bildstein, V.; Blazhev, A.; Eberth, J.

2008-01-01

Neutron rich Zinc isotopes, including the N = 50 nucleus 80 Zn, were produced and post-accelerated at the Radioactive Ion Beam (RIB) facility REX-ISOLDE (CERN). Low-energy Coulomb excitation was induced on these isotopes after post-acceleration, yielding B(E2) strengths to the first excited 2 + states. For the first time, an excited state in 80 Zn was observed and the 2 1 + state in 78 Zn was established. The measured B(E2,2 1 + →0 1 + ) values are compared to two sets of large scale shell model calculations. Both calculations reproduce the observed B(E2) systematics for the full Zinc isotopic chain. The results for N = 50 isotones indicate a good N = 50 shell closure and a strong Z = 28 proton core polarization. The new results serve as benchmarks to establish theoretical models, predicting the nuclear properties of the doubly magic nucleus 78 Ni

FENDL/E-2.0. Evaluated nuclear data library of neutron-nucleus interaction cross sections and photon production cross sections and photon-atom interaction cross sections for fusion applications. Version 1, March 1997. Summary documentation

International Nuclear Information System (INIS)

Pashchenko, A.B.; Wienke, H.

1998-01-01

This document presents the description of a physical tape containing the basic evaluated nuclear data library of neutron-nucleus interaction cross sections, photon production cross sections and photon-atom interaction cross sections for fusion applications. It is part of the evaluated nuclear data library for fusion applications FENDL-2. The data are available cost-free from the Nuclear Data Section upon request. The data can also be retrieved by the user via online access through international computer networks. (author)

Implicações políticas da institucionalização da deficiência The political implications of the institutionalization of deficiency

Directory of Open Access Journals (Sweden)

Carlos Alberto Marques

1998-04-01

Full Text Available O investimento social no corpo põe em evidência valores estéticos e de produtividade, determinantes dos padrões de normalidade vigentes. Um corpo deficiente está fora dos padrões estabelecidos, gerando uma prática preconceituosa e segregacionista. A instituição assistencialista constitui um dos mais eficientes mecanismos de defesa da sociedade em relação aos portadores de deficiência, identificando-os e mantendo-os isolados do convívio social. Escondida atrás de um discurso de proteção e de preparação dos deficientes para uma possível reintegração no contexto social, a institucionalização da deficiência protege mais a sociedade do que seus portadores.The social emphasis on the body exposes esthetical and productivity values, that establish the dominant normality patterns. A deficienty body is out of the established models, implying on a preconceptious and segregationist praxis. The assistentialist institution is one of the most efficient society mechanisms relating to the deficient individuals by identifying and keeping them isolated from the social acquaintanceship. Hidden by a discourse on the deficient protection and preparation to a possible social reintegration, the deficiency instituonalization protects more the society than its deficients.

Unexpected role of the steroid-deficiency protein ecdysoneless in pre-mRNA splicing

Czech Academy of Sciences Publication Activity Database

Claudius, A.-K.; Romani, P.; Lamkemeyer, T.; Jindra, Marek; Uhlířová, M.

2014-01-01

Roč. 10, č. 4 (2014), e1004287 ISSN 1553-7404 Grant - others:Marie Curie Fellowship Award(CZ) GA 276569 Institutional support: RVO:60077344 Keywords : steroid-deficiency protein Subject RIV: ED - Physiology Impact factor: 8.167, year: 2013 http://www.plosgenetics.org/article/info%3Adoi%2F10.1371%2Fjournal.pgen.1004287

Affinity of /sup 167/Tm-citrate for tumor and liver tissue

Energy Technology Data Exchange (ETDEWEB)

Ando, A; Ando, I; Hiraki, T; Sakamoto, K; Hisada, K; Takeshita, M

1983-10-07

Strong affinity of /sup 167/Tm-citrate for tumor tissue was reconfirmed by using Ehrlich tumor. Excellent tumor imaging was obtained with /sup 167/Tm-citrate because of its strong tumor affinity and because of the suitable physical characteristics of /sup 167/Tm. A large amount of /sup 167/Tm had accumulated in the connective tissue which contained inflammatory tissue, quite large amounts were found in areas containing viable and necrotic tumor tissue, and small amounts were present in viable tumor tissue. /sup 167/Tm was not seen in necrotic tumor tissue. It was concluded that lysosomes did not play a major role in the tumor concentration of /sup 167/Tm, but played an important role in the liver concentration of this nuclide. In the case of hepatoma AH109A, it was presumed that lysosomes played a considerably important role in the tumor concentration of /sup 167/Tm, hepatoma AH109A possessing some residual features of the liver. /sup 167/Tm was bound to acid mucopolysaccharides and transposed by the acid mucopolysaccharides in the tumor tissues and liver. The acid mucopolysaccharides to which /sup 167/Tm were bound in tumor and liver, were heparan sulfate, chondroitin sulfate (or keratosulfate) and heparin (or keratosulfate).

Measuring planetary neutron albedo fluxes by remote gamma-ray sensing

International Nuclear Information System (INIS)

Haines, E.L.; Metzger, A.E.

1984-01-01

A remote-sensing γ-ray spectrometer (GRS) is capable of measuring planetary surface composition through the detection of characteristic gamma rays. In addition, the planetary neutron leakage flux may be detected by means of a thin neutron absorber surrounding the γ-ray detector which converts the neutron flux into a γ-ray flux having a unique energy signature. The γ rays representing the neutron flux are observed against interference consisting of cosmic γ rays, planetary continuum and line emission, and a variety of gamma rays arising from cosmic-ray particle interactions with the γ-ray spectrometer and spacecraft (SC). In this paper the amplitudes of planetary and non-planetary neutron fluxes are assessed and their impact on the sensitivity of measurement is calculated for a lunar orbiter mission and a comet nucleus rendezvous mission. For a 100 h observation period from an altitude of 100 km, a GRS on a lunar orbiter can detect a thermal neutron albedo flux as low as 0.002 cm -2 s -1 and measure the expected flux of approx.=0.6 cm -2 s -1 with an uncertainty of 0.001 cm -2 s -1 . A GRS rendezvousing with a comet at a distance equal to the radius of the comet's nucleus, again for a 100 h observation time, should detect a thermal neutron albedo flux at a level of 0.006 cm -2 s -1 and measure the expected flux of approx.=0.4 cm -2 s -1 with an uncertainty of 0.004 cm -2 s -1 . Mapping the planetary neutron flux jointly with the direct detection of H will not only provide a more accurate model for translating observed γ-ray fluxes into concentrations but will also extend the effective sampling depth and should provide a capability for simple stratigraphic modeling of hydrogen. (orig.)

Differences Between a Single- and a Double-Folding Nucleus-^{9}Be Optical Potential

Science.gov (United States)

Bonaccorso, A.; Carstoiu, F.; Charity, R. J.; Kumar, R.; Salvioni, G.

2016-05-01

We have recently constructed two very successful n-^9Be optical potentials (Bonaccorso and Charity in Phys Rev C89:024619, 2014). One by the Dispersive Optical Model (DOM) method and the other (AB) fully phenomenological. The two potentials have strong surface terms in common for both the real and the imaginary parts. This feature makes them particularly suitable to build a single-folded (light-) nucleus-^9Be optical potential by using ab-initio projectile densities such as those obtained with the VMC method (Wiringa http://www.phy.anl.gov/theory/research/density/). On the other hand, a VMC density together with experimental nucleon-nucleon cross-sections can be used also to obtain a neutron and/or proton-^9Be imaginary folding potential. We will use here an ab-initio VMC density (Wiringa http://www.phy.anl.gov/theory/research/density/) to obtain both a n-^9Be single-folded potential and a nucleus-nucleus double-folded potential. In this work we report on the cases of ^8B, ^8Li and ^8C projectiles. Our approach could be the basis for a systematic study of optical potentials for light exotic nuclei scattering on such light targets. Some of the projectiles studied are cores of other exotic nuclei for which neutron knockout has been used to extract spectroscopic information. For those cases, our study will serve to make a quantitative assessment of the core-target part of the reaction description, in particular its localization.

33 CFR 167.1701 - In Prince William Sound: Precautionary areas.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false In Prince William Sound: Precautionary areas. 167.1701 Section 167.1701 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF... Traffic Separation Schemes and Precautionary Areas Pacific West Coast § 167.1701 In Prince William Sound...

Deconfinement of quarks and gluons in nucleus-nucleus collisions

International Nuclear Information System (INIS)

Gorenstein, M.I.

2011-01-01

The energy dependence of hadron production in relativistic nucleus-nucleus collisions reveals the anomalies. They were predicted as the signals of the deconfinement phase transition and observed by NA49 collaboration in Pb+Pb collisions at the CERN SPS. This indicates the onset of the deconfinement in central nucleus-nucleus collisions at about 30 AGeV.

Neutron-to-proton ratios in pA and π+-A interactions

International Nuclear Information System (INIS)

Bayukov, Yu.D.; Degtyarenko, P.V.; Druzhinin, B.L.

1983-01-01

Measurements of neutron and proton yields at 120 deg have been carried out in 7.5 GeV/c pA and in 1.4 GeV/c and 5.0 GeV/c π +- A interactions. The ratios of secondary neutrons to protons are considered in detail. The ratios depend on kinetic energy of secondary nucleons and this dependence is more pronounced for heavy nuclei. Dependence of this ratios on the incident particle charge and the asymmetry resulting from a different number of protons and neutrons in the nucleus are discussed

The total kinetic energy release in the fast neutron-induced fission of {sup 232}Th

Energy Technology Data Exchange (ETDEWEB)

King, Jonathan; Yanez, Ricardo; Loveland, Walter; Barrett, J. Spencer; Oscar, Breland [Oregon State University, Dept. of Chemistry, Corvallis, OR (United States); Fotiades, Nikolaos; Tovesson, Fredrik; Young Lee, Hye [Los Alamos National Laboratory, Physics Division, Los Alamos, NM (United States)

2017-12-15

The post-emission total kinetic energy release (TKE) in the neutron-induced fission of {sup 232}Th was measured (using white spectrum neutrons from LANSCE) for neutron energies from E{sub n} = 3 to 91 MeV. In this energy range the average post-neutron total kinetic energy release decreases from 162.3 ± 0.3 at E{sub n} = 3 MeV to 154.9 ± 0.3 MeV at E{sub n} = 91 MeV. Analysis of the fission mass distributions indicates that the decrease in TKE with increasing neutron energy is a combination of increasing yields of symmetric fission (which has a lower associated TKE) and a decrease in the TKE release in asymmetric fission. (orig.)

Towards complete spectroscopy of 193Os

International Nuclear Information System (INIS)

Eisermann, Y.; Graw, G.; Metz, A.; Hertenberger, R.; Wirth, H.-F.

2002-01-01

Strong evidence for the existence of supersymmetry in atomic nuclei has been found in the quartet of nuclei 194,195 Pt, 195,196 Au. Our attention is now focused a second quartet of nuclei, that is 193,194 Ir, 192,193 Os where the model is applicable. We investigate the heaviest osmium isotope which is accessible in a single neutron transfer reaction: 193 Os. Excitation energies are known from (d,p) and (n,γ) measurements, but there is limited information about quantum numbers, To measure absolute cross-sections and asymmetries of the 192 Os(d(tilde),p) 193 Os reaction we used our facilities at the Munich tandem accelerator. The 22 MeV beam of vector-polarised deuterons was produced by our new Stern-Gerlach-Source. Outgoing protons were analysed by the Q3D magnetic spectrograph and detected with a strip-detector. The target consisted of a metallic foil of 146 μg/cm 2 highly enriched 192 Os (99%). (author)

26 CFR 1.167(b)-0 - Methods of computing depreciation.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Methods of computing depreciation. 1.167(b)-0....167(b)-0 Methods of computing depreciation. (a) In general. Any reasonable and consistently applied method of computing depreciation may be used or continued in use under section 167. Regardless of the...

Two-proton knockout on neutron-rich nuclei

International Nuclear Information System (INIS)

Bazin, D.; Brown, B.A.; Campbell, C.M.; Church, J.A.; Dinca, D.C.; Enders, J.; Gade, A.; Glasmacher, T.; Hansen, P.G.; Mueller, W.F.; Olliver, H.; Perry, B.C.; Sherrill, B.M.; Terry, J.R.; Tostevin, J.A.

2004-01-01

Two-proton knockout reactions on neutron-rich nuclei [Phys. Rev. Lett. 91 (2003) 012501] have been studied in inverse kinematics at intermediate energy. Strong evidence that the two-proton removal from a neutron-rich system proceeds as a direct reaction is presented, together with a preliminary theoretical discussion of the partial cross sections based on eikonal reaction theory and the many-body shell model. They show that this reaction can be used to characterize the wave functions of the projectiles and holds great promise for the study of neutron-rich nuclei

Neutron halo in 14B studied via reaction cross sections

International Nuclear Information System (INIS)

Fukuda, M.; Tanaka, M.; Iwamoto, K.; Wakabayashi, S.; Yaguchi, M.; Ohno, J.; Morita, Y.; Kamisho, Y.; Mihara, M.; Matsuta, K.; Nishimura, D.; Suzuki, S.; Nagashima, M.; Ohtsubo, T.; Ogura, T.; Abe, K.; Kikukawa, N.; Sakai, T.; Sera, D.; Takechi, M.; Izumikawa, T.; Suzuki, T.; Yamaguchi, T.; Sato, K.; Furuki, H.; Miyazawa, S.; Ichihashi, N.; Kohno, J.; Yamaki, S.; Kitagawa, A.; Sato, S.; Fukuda, S.

2014-01-01

Reaction cross sections (σ R ) for the neutron-rich nucleus 14 B on Be, C, and Al targets have been measured at several energies in the intermediate energy range of 45-120 MeV/nucleon. The present experimental σ R show a significant enhancement relative to the systematics of stable nuclei. The nucleon density distribution was deduced through the fitting procedure with the modified Glauber calculation. The necessity of a long tail in the density distribution was found, which is consistent with the valence neutron in 2s 1/2 orbital with the small empirical one-neutron separation energy in 14 B. (authors)

Whole-body retention studies of /sup 167/Tm--citrate. Estimation of radiation dose to humans from /sup 167/Tm--citrate

Energy Technology Data Exchange (ETDEWEB)

Hiraki, T; Ando, A [Kanazawa Univ. (Japan). School of Paramedicine; Mori, H; Ando, I; Sakamoto, K

1978-02-01

For the purpose of calculating absorbed dose to humans from /sup 167/Tm-citrate, the whole-body retention studies using 5 rats were carried out. Up to 40 days following intravenous injection of /sup 167/Tm-citrate, the whole-body counts were monitored with an animal counter. The whole-body retention curve was obtained with three exponential components. Namely, the 26% of the injected /sup 167/Tm-citrate had a biological half-time of 3.4 hours, 12.5% had a biological half-time of 99 hours and 61.5% had a biological half-time of 106 days. These results indicate, that three components consist of the rapid clearance from the kidneys, the retention in the liver and other soft tissues with relatively long half-time and the retention in the bones with long half-time. Based on these biological data and the MIRD Committee method, the average dose estimates to the bone and whole-body from intravenous administration of 1 mCi /sup 167/Tm-citrate were 7.08 rads and 1.28 rads, respectively.

Study of the proton-neutron interaction around $^{68}$Ni : Vibrational structure of $^{72,74}$Zn

CERN Multimedia

Hass, M; Blazhev, A A; Kruecken, R; Muecher, D; Kumar, V; Srebrny, J; Albers, M; Gernhaeuser, R A; Hadynska-klek, K; Eberth, J H; Lo bianco, G; Napiorkowski, P J; Bettermann, L; Das gupta, S; Kroell, T; Leske, J; Iwanicki, J S

We propose to study the $^{72}$Zn nucleus, 2 protons and 2 neutrons away from the possible double-magic $^{68}$Ni nucleus, by means of Coulomb Excitation in inverse kinematics. Current data suggest almost degenerated 2$^{+}$ states of 2-phonon and mixed-symmetric character, respectively. The identification of the 2$^+_{ms}$ state in $^{72}$Zn will be a direct measure of the interaction between valence protons and neutrons, which is the key to understand the nature of $^{68}$Ni. We furthermore propose to study the unusual behavior of the first excited 0$^{+}$ state in this region using the t($^{72}$Zn,p)$\\,^{74}$Zn reaction.

Studies of neutron dissociation at Fermilab energies

International Nuclear Information System (INIS)

Ferbel, T.

1975-01-01

The latest results obtained in a continuing investigation of neutron dissociation in (pπ - ) systems in neutron--nucleus collisions between 50 and 300 GeV/c are summarized. The nuclear coherent dissociation data are discussed first; then new measurements of total cross sections of neutrons on nuclei in the Fermilab momentum range are presented; finally, neutron dissociation using a hydrogen target is considered, and the hydrogen data are compared with expectations from simple Deck models. A substantial correlation was observed between the mass and the t of the system produced. The spin structure of the pπ - amplitudes at low mass was described surprisingly well by the simple Deck mechanism. The t-channel helicity amplitudes contained comparable contributions from flip and nonflip terms, and the states produced were not restricted to those expected on the basis of the Morrison rule. (19 figures, 2 tables) (U.S.)

New fission-neutron-spectrum representation for ENDF

International Nuclear Information System (INIS)

Madland, D.G.

1982-04-01

A new representation of the prompt fission neutron spectrum is proposed for use in the Evaluated Nuclear Data File (ENDF). The proposal is made because a new theory exists by which the spectrum can be accurately predicted as a function of the fissioning nucleus and its excitation energy. Thus, prompt fission neutron spectra can be calculated for cases where no measurements exist or where measurements are not possible. The mathematical formalism necessary for application of the new theory within ENDF is presented and discussed for neutron-induced fission and spontaneous fission. In the case of neutron-induced fission, expressions are given for the first-chance, second-chance, third-chance, and fourth-chance fission components of the spectrum together with that for the total spectrum. An ENDF format is proposed for the new fission spectrum representation, and an example of the use of the format is given

Additional evaluation of alpha induced neutron production nuclear data. 9Be, 27Al, 28,29,30Si

International Nuclear Information System (INIS)

Murata, Toru; Shibata, Keiichi

2005-01-01

Alpha particle induced neutron production cross sections, emitted neutron energy spectrum and angular distributions were evaluated for the target nucleus 9 Be, 27 Al and Si isotopes; 28 Si, 29 Si and 30 Si in the incident energy region below 15 MeV. (author)

Trabalhador com deficiência física: fragilidades e agravos autorreferidos

Directory of Open Access Journals (Sweden)

Débora Ribas Leal

2013-02-01

Full Text Available Este estudo teve como objetivo investigar fragilidades e agravos vivenciados por trabalhadores com deficiência física no seu ambiente de trabalho. Trata-se de um estudo de caso, de caráter descritivo, de abordagem qualitativa. Os dados foram coletados junto a oito trabalhadores com deficiência física e analisados mediante análise temática. A maioria dos sujeitos pesquisados refere ter encontrado dificuldades na busca do emprego e mencionam o preconceito e a acessibilidade como obstáculos. A maioria não identifica riscos para adoecimento no ambiente de trabalho. As pessoas com deficiência física devem ter conhecimentos acerca de seus direitos e sobre os riscos ocupacionais a que estão expostos, a fim de facilitar meios para a consolidação de uma sociedade cada vez mais inclusiva e promotora de ambiências saudáveis. Os profissionais de saúde devem fazer uma profunda reflexão a fim de que sejam colaboradores para a inclusão saudável de pessoas com deficiência em seus ambientes de trabalho.

Absolute on-line in-pile measurement of neutron fluxes using self-powered neutron detectors: Monte Carlo sensitivity calculations

Energy Technology Data Exchange (ETDEWEB)

Vermeeren, L. [SCK/CEN, B-2400 Mol (Belgium)

2001-07-01

Self-powered neutron detectors (SPND) are well suited to monitor continuously the neutronic operating conditions of driver fuel of research reactors and to follow its burnup evolution. This is of particular importance when advanced or new MTR fuel designs need to be qualified. We have developed a detailed MCNP-4B based Monte Carlo approach for the calculation of neutron sensitivities of SPNDs. Results for the neutron sensitivity of a Rh SPND are in excellent agreement with experimental data recently obtained at the BR2 research reactor. A critical comparison of the Monte Carlo results with results from standard analytical methods reveals an important deficiency of the analytical methods in the description of the electron transport efficiency. Our calculation method allows a reliable on-line determination of the absolute in-pile neutron flux. (author)

Absolute on-line in-pile measurement of neutron fluxes using self-powered neutron detectors: Monte Carlo sensitivity calculations

International Nuclear Information System (INIS)

Vermeeren, L.

2001-01-01

Self-powered neutron detectors (SPND) are well suited to monitor continuously the neutronic operating conditions of driver fuel of research reactors and to follow its burnup evolution. This is of particular importance when advanced or new MTR fuel designs need to be qualified. We have developed a detailed MCNP-4B based Monte Carlo approach for the calculation of neutron sensitivities of SPNDs. Results for the neutron sensitivity of a Rh SPND are in excellent agreement with experimental data recently obtained at the BR2 research reactor. A critical comparison of the Monte Carlo results with results from standard analytical methods reveals an important deficiency of the analytical methods in the description of the electron transport efficiency. Our calculation method allows a reliable on-line determination of the absolute in-pile neutron flux. (author)

Molecular dissection of the response of the rice Systemic Acquired Resistance Deficient 1 (SARD1) gene to different types of ionizing radiation.

Science.gov (United States)

Jung, In Jung; Hwang, Jung Eun; Han, Sung Min; Kim, Dong Sub; Ahn, Joon-Woo; Choi, Hong-Il; Kwon, Soon-Jae; Kang, Si-Yong; Kim, Jin-Baek

2017-07-01

Exposure to ionizing radiation induces plant defenses by regulating the expression of response genes. The systemic acquired resistance deficient 1 (SARD1) is a key gene in plant defense response. In this study, the function of Oryza sativa SARD1 (OsSARD1) was investigated after exposure of seeds/plants to ionizing radiation, jasmonic acid (JA) or salicylic acid (SA). Rice seeds exposed to two types of ionizing radiations (gamma ray [GR] and ion beam [IB]) were analyzed by quantitative reverse transcription PCR (qRT-PCR) to identify the genes that are altered in response to ionizing radiation. Then, OsSARD1-overexpressing homozygous Arabidopsis plants were generated to assess the effects of OsSARD1 in the response to irradiation. The phenotypes of these transgenic plants, as well as control plants, were monitored after GR irradiation at doses of 200 and 300 Gray (Gy). The OsSARD1 transcript was strongly downregulated after exposure to GR and IB irradiation. Previous phylogenetic analysis showed that the Arabidopsis SARD1 (AtSARD1) protein is closely related to Arabidopsis calmodulin-binding protein 60g (AtCBP60g), which is known to be required for activation of SA biosynthesis. In this study, phylogenetic analysis showed that OsSARD1 was grouped with AtSARD1. The OsSARD1 gene was induced after exposure to SA and JA. The biological phenotype of OsSARD1-overexpressing Arabidopsis plants was examined. OsSARD1-overexpressing plants displayed resistance to GR; in comparison with wild-type plants, the height and weight of OsSARD1-overexpressing plants were significantly greater after GR irradiation. In addition, OsSARD1 protein was abundantly accumulated in the nucleus. The results indicate that OsSARD1 plays an important role in the regulation of the defense responses to GR and IB irradiation and exhibits phytohormone induced expression.

Lethal Effect of Thermal Neutrons on Hypoxic Elirlich Ascites Tumour Cells in vitro

OpenAIRE

MITSUHIKO, AKABOSHI; KENICHI, KAWAI; HIROTOSHI, MAKI; Research Reactor Institute, Kyoto University; Research Reactor Institute, Kyoto University; Research Reactor Institute, Kyoto University

1985-01-01

Ehrlich ascites tumour cells were irradiated in vitro with thermal neutrons under aerobic and hypoxic conditions, and the survival of their reproductive capacity was assayed in vivo. Only a slight hypoxic protection was observed for thermal neutron irradiation with an oxygen enhancement ratio (OER) of 1.2, as compared with OER of 3.3 for ^Co-γ-rays. Absorbed dose of thermal neutrons was calculated by assuming that the energies of recoiled nuclei were completely absorbed within a cell nucleus....

Shape coexistence in neutron-deficient Hg isotopes studied via lifetime measurements in $^{184,186}$Hg and two-state mixing calculations

CERN Document Server

Gaffney, L P; Page, R.D.; Grahn, T.; Scheck, M.; Butler, P.A.; Bertone, P.F.; Bree, N.; Carroll, R.J.; Carpenter, M.P.; Chiara, C.J.; Dewald, A.; Filmer, F.; Fransen, C.; Huyse, M.; Janssens, R.V.F.; Joss, D.T.; Julin, R.; Kondev, F.G.; Nieminen, P.; Pakarinen, J.; Rigby, S.V.; Rother, W.; Van Duppen, P.; Watkins, H.V.; Wrzosek-Lipska, K.; Zhu, S.

2014-01-01

The neutron-deficient mercury isotopes, $^{184,186}$Hg, were studied with the Recoil Distance Doppler Shift (RDDS) method using the Gammasphere array and the K\\"oln Plunger device. The Differential Decay Curve Method (DDCM) was employed to determine the lifetimes of the yrast states in $^{184,186}$Hg. An improvement on previously measured values of yrast states up to $8^{+}$ is presented as well as first values for the $9_{3}$ state in $^{184}$Hg and $10^{+}$ state in $^{186}$Hg. $B(E2)$ values are calculated and compared to a two-state mixing model which utilizes the variable moment of inertia (VMI) model, allowing for extraction of spin-dependent mixing strengths and amplitudes.

Mobilidade urbana para pessoas com deficiência no Brasil: um estudo em blogs

Directory of Open Access Journals (Sweden)

Adriana Silva Barbosa

2016-01-01

Full Text Available A mobilidade urbana considera as condições de deslocamento das pessoas e bens pela cidade. O objetivo deste estudo é analisar como os blogs com a temática deficiência retratam a mobilidade urbana para pessoas com deficiência no Brasil. Para tanto, foi realizada uma pesquisa qualitativa e exploratória, na qual foram analisadas postagens de 15 blogs de pessoas com deficiência com o emprego da Grounded Theory. Reconhecer a mobilidade urbana como condição estratégica para a inclusão de pessoas com deficiência foi identificada como categoria central deste estudo, à qual se subordinam dezesseis subcategorias, organizadas em cinco eixos: necessidade de mudanças, sentimentos, efetivação da mudança, investimentos financeiros e consequências. Estes resultados mostram que a mobilidade urbana é considerada pelas pessoas com deficiência como estratégica para sua inclusão social e que os blogs evidenciam suas necessidades, reivindicações, reflexões, discussões e apontam soluções para os problemas que enfrentam em seu cotidiano.

Scattering of Neutrons on Fluctuations of the Density of the Thin Films

Directory of Open Access Journals (Sweden)

S. G. ABDULVAHABOVA

2016-11-01

Full Text Available Abstract. The cross section for scattering neutron  on the density of  fluctuations of the  thin films is obtained in the framework of the quantum theory of multiple scattering  in the quasielastic approximation. Inhomogeneity can be caused by dynamic density fluctuations, and be statistical in nature. Fluctuations in the density of the scattering material cause neutron scattering wave. The probability of a collision between a neutron and an atomic nucleus depends on the number of neutrons and on their velocity. The formulas have been obtained under the assumption that the imaginary part of the optical potential is a local operator. It was determined that the scattering in density fluctuations does not contribute to the attenuation of the coherent neutron wave. In the approximation of a thin target the solution of the equation for the total scattering amplitude is identical to the expression obtained in the usual eikonal approximation and differs significantly, at least functionally, from the solution for the case of a thick target. There have been detailed investigations of the reflection and refraction of neutron waves in matter, and the details of their dispersion law have been studied. The results are  hown  also, that  the total cross section for scattering by the complete target becomes universal and does not depend on cross section for scattering by one nucleus.Keywords: 25.40-Ep

Investigations of fast neutron production by 190 GeV/c muon interactions on graphite target

CERN Document Server

Chazal, V; Cook, B; Henrikson, H; Jonkmans, G; Paic, A; Mascarenhas, N; Vogel, P; Vuilleumier, J L

2002-01-01

The production of fast neutrons (1 MeV - 1 GeV) in high energy muon-nucleus interactions is poorly understood, yet it is fundamental to the understanding of the background in many underground experiments. The aim of the present experiment (CERN NA55) was to measure spallation neutrons produced by 190 GeV/c muons scattering on carbon target. We have investigated the energy spectrum and angular distribution of spallation neutrons, and we report the result of our measurement of the neutron production differential cross section.

Sintomas visuais de deficiências nutricionais em pinhão-manso Visual symptoms of nutrient deficiency in physic nut

Directory of Open Access Journals (Sweden)

Enilson de Barros Silva

2009-04-01

Full Text Available O objetivo deste trabalho foi avaliar o crescimento e caracterizar os sintomas de deficiências de macro e micronutrientes em mudas de pinhão-manso (Jatropha curcas. As mudas foram cultivadas em solução nutritiva completa e, também, em soluções com omissão de N, P, K, Ca, Mg, S, B, Cu, Fe, Mn ou Zn, pelo uso da técnica do elemento faltante. Foram avaliados os sintomas visuais de deficiência de nutrientes e a massa de matéria seca da parte aérea e das raízes, respectivamente aos 90 e 120 dias após a aplicação dos tratamentos. As omissões de macro e micronutrientes provocaram sintomas visuais de deficiência nutricional comuns a outras espécies. As deficiências limitaram a produção de massa de matéria seca na seguinte ordem: Ca>Mg>K>N>P>S, para macronutrientes; e Fe>Cu>Zn>Mn>B, para micronutrientes.The objectives of this work were to evaluate the growth of physic nut (Jatropha curcas and to characterize visual symptoms of macro and micronutrient deficiencies in seedlings. The seedlings were cultivated in nutritive solution containing all required macro and micronutrients and in solutions with omission of N, P, K, Ca, Mg, S, B, Cu, Fe, Mn or Zn, using the missing element technique. Visual deficiency symptoms and seedlings dry weight were evaluated at 90 and 120 days after treatments, respectively. The absences of macro and micronutrients in physic nut caused in nutritional deficiency visual symptoms known to other species. The deficiencies restricted the dry matter production according to the following order: Ca>Mg>K>N>P>S, for macronutrients, and Fe>Cu>Zn>Mn>B, for micronutrients.

Pharmacological evidences for DFK167-sensitive presenilin-independent gamma-secretase-like activity.

Science.gov (United States)

Sevalle, Jean; Ayral, Erwan; Hernandez, Jean-François; Martinez, Jean; Checler, Frédéric

2009-07-01

Amyloid-beta (Abeta) peptides production is thought to be a key event in the neurodegenerative process ultimately leading to Alzheimer's disease (AD) pathology. A bulk of studies concur to propose that the C-terminal moiety of Abeta is released from its precursor beta-amyloid precursor protein by a high molecular weight enzymatic complex referred to as gamma-secretase, that is composed of at least, nicastrin (NCT), Aph-1, Pen-2, and presenilins (PS) 1 or 2. They are thought to harbor the gamma-secretase catalytic activity. However, several lines of evidence suggest that additional gamma-secretase-like activities could potentially contribute to Abeta production. By means of a quenched fluorimetric substrate (JMV2660) mimicking the beta-amyloid precursor protein sequence targeted by gamma-secretase, we first show that as expected, this probe allows monitoring of an activity detectable in several cell systems including the neuronal cell line telencephalon specific murine neurons (TSM1). This activity is reduced by DFK167, N-[N-(3,5-difluorophenacetyl)-L-alanyl]-S-phenylglycine t-butyl ester (DAPT), and LY68458, three inhibitors known to functionally interact with PS. Interestingly, JMV2660 but not the unrelated peptide JMV2692, inhibits Abeta production in an in vitrogamma-secretase assay as expected from a putative substrate competitor. This activity is enhanced by PS1 and PS2 mutations known to be responsible for familial forms of AD and reduced by aspartyl mutations inactivating PS or in cells devoid of PS or NCT. However, we clearly establish that residual JMV2660-hydrolysing activity could be recovered in PS- and NCT-deficient fibroblasts and that this activity remained inhibited by DFK167. Overall, our study describes the presence of a proteolytic activity displaying gamma-secretase-like properties but independent of PS and still blocked by DFK167, suggesting that the PS-dependent complex could not be the unique gamma-secretase activity responsible for Abeta

Failure of the statistical hypothesis for compound nucleus decay

International Nuclear Information System (INIS)

Chrien, R.E.

1976-01-01

In the past five years, conclusive evidence has accumulated that channel correlations are important in resonance reactions. Experiments showing the failure of the statistical hypothesis for compound nucleus decay are described. The emphasis is on the radiative neutron capture reaction, where much detailed work has been done. A short summary of the theory of the (n,γ) reaction is presented; it is demonstrated that this reaction is a sensitive probe of the wave functions for highly excited nuclear states. Various experimental techniques using reactor and accelerator-based neutron sources are presented. The experiments have shown that both resonant and non-resonant reactions can show single particle effects where the external part of configuration space is dominant. In the non-resonant case, hard sphere capture is important; on resonances, valence particle motion and the contributions of 1 and 3 quasi-particle doorway states make up a significant fraction of the radiative width

Neutron detection using a planar array of superheated superconductors

International Nuclear Information System (INIS)

Meagher, G.

1996-01-01

A new thermal neutron detector consisting of an indium/mylar PASS array with a filler of boron powder has been tested successfully. A boron nucleus captures a neutron and the α-particle emitted in this reaction nucleates the transition to the normal state in a neighbouring grain. A PASS with grain radius r=12 μm showed very low response to irradiation by 835 keV γ-rays. The same PASS responded to α-particles with high efficiency, and thermal neutrons were detected with good efficiency and very low background. Thermal neutrons were also counted with an R=25 μm PASS. The use of large granules will allow spatial resolution to a single grain to be obtained and a read-out based on conventional inductive coupling and fast electronics to be utilized. (orig.)

Discrete spectroscopy in {sup 180}Os at high spins

Energy Technology Data Exchange (ETDEWEB)

Marti, G; Venkova, Ts; Morek, T; Schnare, H; Gast, W; Georgiev, A; Spohr, K M; Lieder, R M [Institut fuer Kernphysik, KFA-Juelich (Germany); Maier, K H [Hahn-Meitner-Institut Berlin GmbH (Germany); Zell, K O [Institut fuer Kernphysik, Universitaet Koeln (Germany)

1992-08-01

New information on rotational bands in {sup 180}Os was obtained from a discrete spectroscopy experiment in which the final nucleus was populated through the {sup 150}Nd({sup 36}S,6n) reaction at 177 MeV. A new strongly-coupled rotational band starting at a relatively high excitation energy was found. The observation and placement of the 185.6 keV in the level scheme gives strong support to a hypothetical 2-quasineutron configuration assigned to the 7{sup -} isomeric bands in {sup 180}Os and the isotone {sup 178}W. Band mixing between the (-,1){sub 1} and (-,1){sub 3} bands of same parity and signature was observed, and the interaction strength was estimated from experimental branching ratios. The authors` results confirm a previous assignment for the yrast and yrare sequences in this nucleus. With the identification of new transitions above the states with I {approx_equal} 24, previously assigned bands had to be revised, with the result that the second band crossing vanishes. 23 refs., 3 figs.

Recent results in the development of a global medium-energy nucleon-nucleus optical-model potential

International Nuclear Information System (INIS)

Madland, D.G.

1988-02-01

Initial results are presented for the determination of a global medium-energy nucleon-nucleus phenomenological optical-model potential using a relativistic Schroedinger representation. The starting point for this work is the global phenomenological optical-model potential of Schwandt /ital et al./, which is based on measured elastic scattering cross sections and analyzing power for polarized protons ranging from 80 to 180 MeV. This potential is optimally modified to reproduce experimental proton reaction cross sections as a function of energy, while allowing only minimal deterioration in the fits to the elastic cross sections and analyzing powers. Further modifications in the absorptive potential were found necessary to extrapolate the modified potential to higher energies. The final potential is converted to a neutron-nucleus potential by use of standard Lane model assumptions and by accounting approximately for the Coulomb correction. Comparisons of measured and calculated proton reaction and neutron total cross sections are presented for 27 Al, 56 Fe, and 208 Pb. Medium-energy optical-model potentials for complex projectiles are briefly discussed in an appendix. 7 refs., 20 figs

On the problem of bound states of pions and neutrons

International Nuclear Information System (INIS)

Gudima, K.K.; Karnaukhov, V.A.

1992-01-01

The problem of existence of the bound states of negative pions and neutrons has been widely discussed for the last years. It is considered possibilities of the experimental observation of pion-neutron clusters, if they do exist, in nucleus-nucleus collisions. The yields of exotic fragments π -Z n A in the interactions of 12 C and 56 Fe with 208 Pb at the energies from 0.3 to 3.7 GeV per nucleon are calculated. For 40 Ar+ 238 U and 139 La+ 238 U collisions the calculations were performed at the energied of 1.8 GeV and 1.3 GeV per nucleon, respectively. These calculations were performed in the framework of the coalescence mechanism with the differential cross sections for pion and neutron production generated by firestreak model. The differential cross sections for production of π -1 n -2 , π -2 N 2 , π - n 4 , π -4 n 6 , and π -12 n 6 were calculated. It is shown that the use of very heavy projectiles like 56 Fe and 139 La has a great advantage in the experimental search for the exotic clusters. 20 refs.; 8 figs

Study of 193Os beta- decay

International Nuclear Information System (INIS)

Zahn, Guilherme Soares

2006-01-01

In this work, the excited levels of 193 Ir populated by the beta - decay of 193 Os (T 1/2 ∼ 30h) were investigated. For that purpose, ∼ 5 mg samples of 99%-enriched 192 Os were irradiated under a thermal neutron flux of ∼ 10 12 s -1 and then analysed both using single gamma spectroscopy and a 4-detector multi parametric acquisition facility, which provided data for both a gamma gamma coincidence analysis and a directional angular correlation gamma gamma (θ ) study. From these data, 28 transitions were added to this decay scheme, 11 of which were previously known from nuclear reactions and 17 observed for the first time. Eight excited levels were also added to the decay scheme, 3 of which were known from nuclear reaction studies - the remaining 5 are suggested for the first time. Moreover, it was possible to confirm suspicions found in reference that the levels at 848.93 keV and 849.093 keV are indeed the same; it was also possible to confirm the existence of an excited level at 806.9 keV, which had been inferred, but not experimentally confirmed in beta decay studies to date. The angular correlation analysis allowed for the definition of the spin of the excited level at 874 keV as 5/2 +; moreover, the results showed a 79% probability that the spin of the 1078 keV level is 5/2/'-, and also restricted the spin possibilities for the new excited level at 960 keV to two values (1/2 or 3/2). It was also possible to measure the multipolarity mixing ratio (δ Ln+1 /L n ) for 43 transitions - 19 of them for the first time and most of the others with a better precision than previously known. Finally, an attempt was made to understand the low-lying levels structure for this nucleus using a theoretical model, which reproduced the ground state and the two lowest-lying excited levels in 193 Ir. (author)

Neutron-induced cross sections of actinides via the surrogate-reaction method

Directory of Open Access Journals (Sweden)

Ducasse Q.

2013-12-01

Full Text Available The surrogate-reaction method is an indirect way of determining cross sections for reactions that proceed through a compound nucleus. This technique may enable neutron-induced cross sections to be extracted for short-lived nuclei that otherwise cannot be measured. However, the validity of the surrogate method has to be investigated. In particular, the absence of a compound nucleus formation and the Jπ dependence of the decay probabilities may question the method. In this work we study the reactions 238U(d,p239U, 238U(3He,t238Np, 238U(3He,4He237U as surrogates for neutron-induced reactions on 238U, 237Np and 236U, respectively, for which good quality data exist. The experimental set-up enabled the measurement of fission and gamma-decay probabilities. The first results are hereby presented.

Study of Hadron Production in Hadron-Nucleus and Nucleus-Nucleus Collisions at the CERN SPS

CERN Multimedia

Klochkov, V; Herve, A E; Kowalski, S; Kaptur, E A; Kowalik, K L; Dominik, W M; Matulewicz, T N; Krasnoperov, A; Feofilov, G; Vinogradov, L; Kovalenko, V; Johnson, S R; Planeta, R J; Rubbia, A; Marton, K; Messerly, B A; Puzovic, J; Bogomilov, M V; Bravar, A; Renfordt, R A E; Deveaux, M; Engel, R R; Grzeszczuk, A; Davis, N; Kuich, M; Lyubushkin, V; Kondratev, V; Kadija, K; Diakonos, F; Slodkowski, M A; Rauch, W H; Pistillo, C; Laszlo, A; Nakadaira, T; Hasegawa, T; Sadovskiy, A; Morozov, S; Petukhov, O; Mathes, H; Roehrich, D; Marcinek, A J; Marino, A D; Grebieszkow, K; Di luise, S; Wlodarczyk, Z; Rybczynski, M A; Wojtaszek-szwarc, A; Nirkko, M C; Sakashita, K; Golubeva, M; Kurepin, A; Manic, D; Kolev, D I; Kisiel, J E; Koziel, M E; Rondio, E; Larsen, D T; Czopowicz, T R; Seyboth, P; Turko, L; Guber, F; Marin, V; Busygina, O; Strikhanov, M; Taranenko, A; Cirkovic, M; Roth, M A; Pulawski, S M; Aduszkiewicz, A M; Bunyatov, S; Vechernin, V; Nagai, Y; Anticic, T; Dynowski, K M; Mackowiak-pawlowska, M K; Stefanek, G; Pavin, M; Fodor, Z P; Nishikawa, K; Tada, M; Blondel, A P P; Stroebele, H W; Posiadala, M Z; Kolesnikov, V; Andronov, E; Zimmerman, E D; Antoniou, N; Majka, Z; Dumarchez, J; Naskret, M; Ivashkin, A; Tsenov, R V; Koziel, M G; Schmidt, K J; Melkumov, G; Popov, B; Panagiotou, A; Richter-was, E M; Morgala, S J; Paolone, V; Damyanova, A; Gazdzicki, M; Unger, M T; Wilczek, A G; Stepaniak, J M; Seryakov, A; Susa, T; Staszel, P P; Brzychczyk, J; Maksiak, B; Tefelski, D B

2007-01-01

The NA61/SHINE (SHINE = SPS Heavy Ion and Neutrino Experiment) experiment is a large acceptance hadron spectrometer at the CERN SPS for the study of the hadronic final states produced in interactions of various beam particles (pions, protons, C, S and In) with a variety of fixed targets at the SPS energies. The main components of the current detector were constructed and used by the NA49 experiment. The physics program of NA61/SHINE consists of three main subjects. In the first stage of data taking (2007-2009) measurements of hadron production in hadron-nucleus interactions needed for neutrino (T2K) and cosmic-ray (Pierre Auger and KASCADE) experiments will be performed. In the second stage (2009-2011) hadron production in proton-proton and proton-nucleus interactions needed as reference data for a better understanding of nucleus-nucleus reactions will be studied. In the third stage (2009-2013) energy dependence of hadron production properties will be measured in nucleus-nucleus collisions as well as in p+p a...

Lev Landau and the concept of neutron stars

International Nuclear Information System (INIS)

Yakovlev, Dmitrii G; Haensel, Pawel; Baym, Gordon; Pethick, Christopher

2013-01-01

We review Lev Landau's role in the history of neutron star physics in the 1930s. According to the recollections of Rosenfeld (Proc. 16th Solvay Conference on Physics, 1974, p. 174), Landau improvised the concept of neutron stars in a discussion with Bohr and Rosenfeld just after the news of the discovery of the neutron reached Copenhagen in February 1932. We present arguments that the discussion must have taken place in March 1931, before the discovery of the neutron, and that they, in fact, discussed the paper written by Landau in Zurich in February 1931 but not published until February 1932 (Phys. Z. Sowjetunion 1, 285). In this paper, Landau mentioned the possible existence of dense stars that look like one giant nucleus; this could be regarded as an early theoretical prediction or anticipation of neutron stars, albeit prior to the discovery of the neutron. The coincidence of the dates of the neutron discovery and the publication of the paper has led to an erroneous association of Landau's paper with the discovery of the neutron. In passing, we outline Landau's contribution to the theory of white dwarfs and to the hypothesis of stars with neutron cores. (from the history of physics)

Pion production in nucleus--nucleus collisions

International Nuclear Information System (INIS)

Schroeder, L.S.

1975-06-01

Current work on pion production in high-energy nucleus-nucleus collisions is reviewed. The majority of existing data are of the inclusive variety in which a single final state pion is detected. Experimental data are compared and their possible contributions to obtaining new information on nuclear structure is discussed. Various models which attempt to explain the observed single-inclusive-pion spectra either on the basis of a nucleon-nucleus interaction in which Fermi motion is included or on some type of cooperative model are examined. Other areas of interest involving pion production include tests of charge symmetry and pion multiplicities. (9 figures, 1 table) (U.S.)

Fluctuations of radiative widths and the relaxation time of neutron resonances

International Nuclear Information System (INIS)

Kal'chenko, A.I.; Prokopets, G.A.

1989-01-01

The process of equilibrium state formation is discussed as the first step to be compound nucleus after slow neutron capture. Analysis of 78 nuclei with mass numbers A=27-238 is carried out. 20 refs.; 6 figs.; 2 tabs

Investigations of fast neutron production by 190 GeV/c muon interactions on different targets

International Nuclear Information System (INIS)

Chazal, V.; Boehm, F.; Cook, B.; Henrikson, H.; Jonkmans, G.; Paic, A.; Mascarenhas, N.; Vogel, P.; Vuilleumier, J.-L.

2002-01-01

The production of fast neutrons (1 MeV-1 GeV) in high-energy muon-nucleus interactions is poorly understood, yet it is fundamental to the understanding of the background in many underground experiments. The aim of the present experiment (CERN NA55) was to measure spallation neutrons produced by 190 GeV/c muons scattering on carbon, copper and lead targets. We have investigated the energy spectrum and angular distribution of spallation neutrons, and we report the result of our measurement of the neutron production differential cross-section

Parity violation in the compound nucleus

International Nuclear Information System (INIS)

Bowman, J.D.; Frankle, C.M.; Green, A.A.

1994-01-01

The status of parity violation in the compound nucleus is reviewed. The results of previous experimental results obtained by scattering polarized epithermal neutrons from heavy nuclei in the 3-p and 4-p p-wave strength function peaks are presented. Experimental techniques are presented. The extraction of the mean squared matrix element of the parity-violating interaction, M 2 , between compound-nuclear levels and the relationship of M 2 to the coupling strengths in the meson exchange weak nucleon-nucleon potential are discussed. The tendency of measured asymmetries to have a common sign and theoretical implications are discussed. New experimental results are presented that show that the common sign phenomenon is not universal, as theoretical models developed up to now would predict

Neutron and proton optical potentials

International Nuclear Information System (INIS)

Hansen, L.F.

1985-11-01

The neutron and proton optical model potentials (OMP) are discussed in terms of microscopic (MOMP) and phenomenological (POMP) models. For the MOMP, two approaches are discussed, the nucleus matter approach [Jeukenne-Lejeune-Mahaux (JLM) and Brieva-Rook-von Geramb (BRVG), potentials] and the finite nuclei approach (Osterfeld and Madsen). For the POMP, the Lane charge-exchange potential and its validity over a wide mass range is reviewed. In addition to the Lane symmetry term, the Coulomb correction to both the real and imaginary parts of the OMP is discussed for the above models. The use of the OMP to calculate collective inelastic scattering and observed differences between the neutron- and proton-deformation parameters is also illustrated. 25 refs., 3 figs

Secondary Neutron Production from Space Radiation Interactions: Advances in Model and Experimental Data Base Development

Science.gov (United States)

Heilbronn, Lawrence H.; Townsend, Lawrence W.; Braley, G. Scott; Iwata, Yoshiyuki; Iwase, Hiroshi; Nakamura, Takashi; Ronningen, Reginald M.; Cucinotta, Francis A.

2003-01-01

For humans engaged in long-duration missions in deep space or near-Earth orbit, the risk from exposure to galactic and solar cosmic rays is an important factor in the design of spacecraft, spacesuits, and planetary bases. As cosmic rays are transported through shielding materials and human tissue components, a secondary radiation field is produced. Neutrons are an important component of that secondary field, especially in thickly-shielded environments. Calculations predict that 50% of the dose-equivalent in a lunar or Martian base comes from neutrons, and a recent workshop held at the Johnson Space Center concluded that as much as 30% of the dose in the International Space Station may come from secondary neutrons. Accelerator facilities provide a means for measuring the effectiveness of various materials in their ability to limit neutron production, using beams and energies that are present in cosmic radiation. The nearly limitless range of beams, energies, and target materials that are present in space, however, means that accelerator-based experiments will not provide a complete database of cross sections and thick-target yields that are necessary to plan and design long-duration missions. As such, accurate nuclear models of neutron production are needed, as well as data sets that can be used to compare with, and verify, the predictions from such models. Improvements in a model of secondary neutron production from heavy-ion interactions are presented here, along with the results from recent accelerator-based measurements of neutron-production cross sections. An analytical knockout-ablation model capable of predicting neutron production from high-energy hadron-hadron interactions (both nucleon-nucleus and nucleus-nucleus collisions) has been previously developed. In the knockout stage, the collision between two nuclei result in the emission of one or more nucleons from the projectile and/or target. The resulting projectile and target remnants, referred to as

Study of the mechanism of the reaction 58Ni+40Ca and high spin states of the evaporation residual nuclei by application of γ-spectroscopy

International Nuclear Information System (INIS)

Komninos, P.

1983-01-01

γ-spectroscopic methods were applied to determine absolute cross sections for different evaporation channels of the reaction 40 Ca-> 58 Ni. In the incident-energy range Esub(lab)=135 to 158 MeV excitation functions were measured for the channels 2p+np, 3p+n2p, 4p, 5p, n4p, α, 2pα, and 3pα. Besides the cross section for the n2p and the n3p channel at Esub(lab)=135 MeV was determined. In the course of this thesis by means of 40 Ca-induced compound-nucleus reactions on Ni and Fe targets high spin states of neutron-deficient nuclei in the N 93 Ru a (17/2 - ) state and a (21/2) + isomeric state was identified the half-life of which was determined to (2.6+-0.2)μs. The earlier unknown level scheme of 91 Tc was established. Thereby states with spins up to 37/2 + (6398.0 keV) and 42/2 - (7715.1 keV) were observed. Both level schemes were compared with shell model calculations, and a good agreement resulted. Finally a partial β + /EC decay scheme for the identified new isotope 91 Ru(9+-1 s) was established. (orig./HSI) [de

Temperature measurement with neutrons

International Nuclear Information System (INIS)

Bizard, G.; Durand, D.; Lecolley, J.F.; Lefebvres, F.; Marques, M.; Peter, J.; Tamain, B.

1998-01-01

The results presented in this report were obtained from the information provided by charged products. Another alternative consists in detecting the neutrons abundantly emitted particularly by heavy nuclei. The residue channel was studied in the 40 Ar + 197 Au at 60 MeV/nucleon by means of the neutron multidetector DEMON. The evolution of the multiplicity of neutrons emitted backwards in the framework of the heavy nucleus forwardly detected as a function of the residue velocity by a silicon detector, placed at 8 degrees and at 24.5 cm from target, agrees with the expected results i.e. an increase with the residue velocity hence with the collision violence. For the same detector the first measurements show similarly a linear increase of the apparent temperature of 4.0 to around 6.5 MeV for residue velocities varying from 0.5 to 1.3 cm/ns and masses ranging from 140 to 160 uma. This first results of the analysis show therefore a good behaviour of the assembly and especially of the couple DeMoN-SyReP

Mechanisms of fission neutron emission

International Nuclear Information System (INIS)

Maerten, H.

1991-01-01

The time evolution in fission is the starting point for discussing not only the main mechanism of fission neutron emission, the evaporation from fully accelerated fragments, but also possible secondary ones connected with dynamical features of nuclear fission. ''Asymptotic'' conditions as relevant for describing the particle release from highly excited, rapidly moving fragments are defined. Corresponding statistical model approaches to fission neutron emission, based on the adequate consideration of the intricate fragment occurrence probability, reproduce most of the experimental data. The remarkable influence of fission modes on neutron observables is analyzed in the framework of a macroscopic-microscopic scission point model consistent with energy conservation. Finally, chances and deficiencies for solving the mechanism puzzle are summarized. (author). 87 refs, 21 figs

Perspective of ultrarelativistic nucleus-nucleus collisions

International Nuclear Information System (INIS)

Specht, H.J.

1985-01-01

The paper concerns the lectures given at the International School of nuclear physics, Erice, 1985, which survey the expectations for the field of ultrarelativistic nucleus-nucleus collisions. The primary motivation for the field, the organization of the lectures, and a description of the NA 34 experiment, are all briefly given. (U.K.)

Deformation and shape transitions in hot rotating neutron deficient Te isotopes

International Nuclear Information System (INIS)

Aggarwal, Mamta; Mazumdar, I.

2009-01-01

Evolution of the nuclear shapes and deformations under the influence of temperature and rotation is investigated in Te isotopes with neutron number ranging from the proton drip line to the stability valley. Spin dependent critical temperatures for the shape transitions in Te nuclei are computed. Shape transitions from prolate at low temperature and spin to oblate via triaxiality are seen with increasing neutron number and spin.

Energy distribution of neutrons from the (n,2n) reaction in 238U

International Nuclear Information System (INIS)

Misulovin, A.

1978-12-01

Energy distribution of the first and second neutrons from (n,2n) scattering event in 238 U was evaluated according to the consistent compound nucleus model recently proposed by Segev. The law for deriving the energy distribution of secondary neutrons from a (n,2n) scattering event, depends on whether the reaction is considered as a simultaneous emission of two neutrons from one compound nucleus, or a successive emission of neutrons from different compound nuclei. Segev has presented a means of calculating the energy distribution assuming the latter model. The laws presented in the ENDF/B data files suggest the former model. The evaluation was based on inelastic level excitation and evaporation data for 238 U and 237 U. Data was retrieved from ENDF/B files. The evaporation data for 237 U was based on (γ,n) reaction 238 U. The inelastic level excitation data for 237 U was evaluated at the Soreq Nuclear Research Centre. It is concluded from the application of Segev's model to 238 U, that the energetic spectrum of secondary neutrons, is harder in the high range of energy than the one predicted by the use of the distribution law presented in ENDF/B data files. The spectrum of secondary (n,2n) neutrons, resulting from the interaction of 14 MeV neutrons in 238 U calculated with Segev's model, is compared with the corresponding spectrum of the LLL library, ENDF/B library and the recent evaluation of BNWL. It is found that the spectrum evaluated by LLL and BNWL is harder than that evaluated with Segev's model

Uptakes of trace elements in Zn-deficient mice

International Nuclear Information System (INIS)

Ohyama, T.; Yanaga, M.; Yoshida, T.; Maetsu, H.; Suganuma, H.; Omori, T.

2002-01-01

A multitracer technique was used to obtain uptake rates of essential trace elements in various organs and tissues in Zn-deficient mice. A multitracer solution, containing more than 20 radioisotopes, was injected intraperitoneally into Zn-deficient state mice and control ones. Uptake rates of the radioisotopes were compared with concentrations of trace elements determined by instrumental neutron activation analysis (INAA) in order to study a specific metabolism of Zn and other essential trace elements, such as Mn, Co, Se, Rb, and Sr. The result suggests that Zn is supplied from bone to other organs and tissues and an increase in Co concentration in all organs and tissues depends on its chemical form, under the Z-deficient state. (author)

$^{11}$Be($\\beta$p), a quasi-free neutron decay?

CERN Document Server

Riisager, K.; Borge, M.J.G.; Briz, J.A.; Carmona-Gallardo, M.; Fraile, L.M.; Fynbo, H.O.U.; Giles, T.; Gottberg, A.; Heinz, A.; Johansen, J.G.; Jonson, B.; Kurcewicz, J.; Lund, M.V.; Nilsson, T.; Nyman, G.; Rapisarda, E.; Steier, P.; Tengblad, O.; Thies, R.; Winkler, S.R.

2014-01-01

We have observed $\\beta$-delayed proton emission from the neutron-rich nucleus $^{11}$Be by analysing a sample collected at the ISOLDE facility at CERN with accelerator mass spectrometry (AMS). With a branching ratio of (8.4 $\\pm$ 0.6)$\\times$ 10$^{-6}$ the strength of this decay mode, as measured by the B$_\\mathrm{GT}$-value, is unexpectedly high. The result is discussed within a simple single-particle model and could be interpreted as a quasi-free decay of the $^{11}$Be halo neutron into a single-proton state.

Some applications of the multiple scattering theory to the study of the hadron-nucleus interactions at intermediate energies

International Nuclear Information System (INIS)

Dedonder, J.-P.

1979-01-01

This work is devoted to the study of elastic hadron nucleus scattering. At first, an asymptotic evaluation leads to a closed, analytic expression of the eikonal amplitude. This approximate expression displays the role and the influence of the nuclear paremeters in, e.g., p-nucleus scattering around 1 GeV. Pion-nucleus scattering around the 3-3 resonance is then studied. A 3 body model calculation (pion, bound nucleon and residual nucleus represented by a potential) allows to study the importance of binding effects in this problem dominated by the strong energy dependence of the elementary amplitude. The last part is devoted to the construction in momentum space of a realistic optical potential and its comparison with experimental data. The scalling of π + and π - on neighbouring isotopes should allow the measure of the differences between the proton and neutron distributions in nuclei [fr

Study of 19C by One-Neutron Knockout

Directory of Open Access Journals (Sweden)

Hwang Jongwon

2016-01-01

Full Text Available The spectroscopic structure of 19C, a prominent one-neutron halo nucleus, has been studied with a 20C secondary beam at 290 MeV/nucleon and a carbon target. Neutron-unbound states populated by the one-neutron knockout reaction were investigated by means of the invariant mass method. The preliminary relative energy spectrum and parallel momentum distribution of the knockout residue, 19C*, were reconstructed from the measured four momenta of the 18C fragment, neutron, and beam. Three resonances were observed in the spectrum, which correspond to the states at Ex = 0.62(9, 1.42(10, and 2.89(10 MeV. The parallel momentum distributions for the 0.62-MeV and 2.89-MeV states suggest spin-parity assignments of 5/2+ and 1/2−, respectively. The 1.42-MeV state is in line with the reported 5/22+ state.

Global features of nucleus-nucleus collisions in ultrarelativistic domain

International Nuclear Information System (INIS)

Savina, M.V.; Shmatov, S.V.; Slavin, N.V.; Zarubin, P.I.

1998-01-01

HIJING generator simulation of nucleus-nucleus collisions at ultrarelativistic energies is presented. It is shown that the global characteristics of nucleus-nucleus collisions, such as distribution of a charged multiplicity, total and electromagnetic transverse energy over pseudorapidity are rather sensitive to some predictions of models of high-exited nuclear medium formation, namely parton energy losses in dense nuclear matter. These losses result in appearance of a broad maximum in global variable distributions over pseudorapidity. The most profound of this effect occurs at central heavy ion collisions at LHC energy

Incident energy and target dependence of interaction cross sections and density distribution of neutron drip-line nuclei

International Nuclear Information System (INIS)

Shimoura, S.

1992-01-01

The relation between nuclear density distribution and interaction cross section is discussed in terms of Glauber model. Based on the model, density distribution of neutron drip-line nucleus 11 Be and 11 Li is determined experimentally from incident energy dependence of interaction cross sections of 11 Be and 11 Li on light targets. The obtained distributions have long tails corresponding to neutron halos of loosely bound neutrons. (Author)

Scaling phenomenon in relativistic nucleus-nucleus collisions

International Nuclear Information System (INIS)

Wong, C.Y.; Blankenbecler, R.

1980-01-01

New scaling variables for proton and pion production in relativistic nucleus-nucleus collisions are introduced which are the generalizations of the Feynmann scaling variable. They allow a simple description of the cross sections at forward and backward angles. 2 figures

Nucleus--nucleus potential

International Nuclear Information System (INIS)

Jaqaman, H.R.

1977-01-01

The nucleus--nucleus interaction is studied within the framework of the generator coordinate method that permits an easy incorporation of the full effects of antisymmetrization. It is found that the interaction, as far as the elastic scattering problem is concerned, can be described by a simple effective potential that is equivalent to the original many-body (and hence non-local) problem. The potential is obtained by dividing the wavefunction into a long-range part and a short-range part and requiring the former to satisfy a Schroedinger equation. This enables avoiding dealing with the troublesome short-range part of the wavefunction and provides a direct link with the optical model so that the potential obtained here is equivalent to the real part of the optical potential (the imaginary part is not investigated). The effective potential is found to consist of three parts: an interaction term between the nucleons belonging to different nuclei, a kinetic energy term due to the change in the intrinsic kinetic energy of the system as a result of the antisymmetrization, and finally an l-dependent part. The kinetic energy term is found to be very repulsive and effectively gives a hard core, and is calculated for the α--α and 16 O-- 16 O cases. The full potential is calculated for the α--α case for the S, D, and G partial waves and then used to calculate the corresponding phase shifts that are then compared with experimental results and other microscopic calculations. Finally, some recent results and analyses of fusion and deep inelastic reactions are reviewed that seem to indicate the presence of a hard core in the nucleus--nucleus potential. Such a hard core is present in the potential obtained in the sudden approximation

Low energy states of {sub 31}{sup 81}Ga{sub 50}: Elements on the doubly-magic nature of {sup 78}Ni

Energy Technology Data Exchange (ETDEWEB)

Verney, D. [Institut de Physique Nucleaire CNRS-IN2P3/Univ. Paris Sud-XI, F-91406 Orsay Cedex (France)]|[GANIL, BP 55027, F-14076 Caen Cedex 5 (France); Ibrahim, F.; Bourgeois, C. [Institut de Physique Nucleaire CNRS-IN2P3/Univ. Paris Sud-XI, F-91406 Orsay Cedex (France)] (and others)

2007-01-15

Excited levels were attributed to {sub 31}{sup 81}Ga{sub 50} for the first time which were fed in the {beta} decay of its mother nucleus {sup 81}Zn produced in the fission of {sup nat}U using the ISOL technique. We show that the structure of this nucleus is consistent with that of the less exotic proton-deficient N 50 isotones within the assumption of strong proton Z 28 and neutron N = 50 effective shell effects. (authors)

Shell model study of high spin states in the N=50 nucleus 93Tc

International Nuclear Information System (INIS)

Ghugre, S.S.; Patel, S.B.; Bhowmik, R.K.

1994-01-01

High spin states in the N=50 nucleus 93 Tc were reinvestigated by using the reaction 64 Zn ( 35 Cl, 4p 2n) at a beam energy of 140 MeV. This was done particularly with a view to observe any γ rays upto 2.7 MeV which may have been missed in our earlier study where the experimental conditions were set to observe γ rays upto 2 MeV. We found four new γ rays of energy: 2484, 2164, 2130 and 69 keV. We have placed these γ rays in the level scheme and it now gets extended to 49/2 - . Though there is no substantial change in the level scheme, placing the γ rays in the level scheme has resulted into two important conclusions: (1) We have performed shell model calculations for 93 Tc nucleus within a model space which encompasses an enlarged proton configuration and allows for the excitation of the neutron across the N=50 core. The excitation of a single neutron across the N=50 core satisfactorily explains the new level scheme. (2) The energy of the 17/2 - isomeric state is now unambiguously placed at 2185 keV. (orig.)

Hadron-nucleus collisions

International Nuclear Information System (INIS)

Strugalski, Z.

1981-01-01

Qualitative picture of high energy hadron-nucleus collision process, emerging from the analysis of experimental data, is presented. Appropriate description procedure giving a possibility of reproducing various characteristics of this process in terms of the data on elementary hadron-nucleon interaction is proposed. Formula reproducing hadron-nucleus collision cross sections is derived. Inelastic collision cross sections for pion-nucleus and proton-nucleus reactions at wide energy interval are calculated for Pb, Ag, and Al targets. A-dependence of cross sections for pion-nucleus and proton-nucleus collisions at nearly 50 GeV/c momentum were calculated and compared with existing experimental data. Energy dependence of cross sections for hadron-nucleus collisions is determined simply by energy dependence of corresponding cross sections for hadron-nucleon collisions; A-dependence is determined simply by nuclear sizes and nucleon density distributions in nuclei

A spin-transport system for a longitudinally polarized epithermal neutron beam

International Nuclear Information System (INIS)

Crawford, B.E.; Bowman, J.D.; Penttilae, S.I.; Roberson, N.R.

2001-01-01

The TRIPLE (Time Reversal and Parity at Low Energies) collaboration uses a polarized epithermal neutron beam and a capture γ-ray detector to study parity violation in neutron-nucleus reactions. In order to preserve the spin polarization of the neutrons as they travel the 60-m path to the target, the beam pipes are wrapped with wire to produce a solenoidal magnetic field of about 10 G along the beam direction. The flanges and bellows between sections of the beam pipe cause gaps in the windings which in turn produce radial fields that can depolarize the neutron spins. A computer code has been developed that numerically evaluates the effect of these gaps on the polarization. A measurement of the neutron depolarization for neutrons in the actual spin-transport system agrees with a calculation of the neutron depolarization for the TRIPLE system. Features that will aid in designing similar spin-transport systems are discussed

The neutron therapy facility at the University of Pennsylvania-Fox Chase Cancer Center

International Nuclear Information System (INIS)

Bloch, P.; Chu, J.; Larsen, R.

1983-01-01

The fusion of deuterium and tritium nuclei results in the formation of a helium-4 nucleus and a 14 MEV neutron. This reaction readily takes place when deuterium and tritium ions are accelerated to potentials between 150-200 kV. These energy ions can be obtained in a moderate size accelerator. A DT neutron facility has been installed in the radiation therapy department of the University of Pennsylvania Hospital-Fox Chase Cancer Center. The system is being commissioned in a hospital setting to test the efficacy of fast neutron radiotherapy

Performance of the multiple target He/PbI sub 2 aerosol jet system for mass separation of neutron-deficient actinide isotopes

CERN Document Server

Ichikawa, S; Asai, M; Haba, H; Sakama, M; Kojima, Y; Shibata, M; Nagame, Y; Oura, Y; Kawade, K

2002-01-01

A multiple target He/PbI sub 2 aerosol jet system coupled with a thermal ion source was installed in the isotope separator on line (JAERI-ISOL) at the JAERI tandem accelerator facility. The neutron-deficient americium and curium isotopes produced in the sup 2 sup 3 sup 3 sup , sup 2 sup 3 sup 5 U( sup 6 Li, xn) and sup 2 sup 3 sup 7 Np( sup 6 Li, xn) reactions were successfully mass-separated and the overall efficiency including the ionization of Am atoms was evaluated to be 0.3-0.4%. The identification of a new isotope sup 2 sup 3 sup 7 Cm with the present system is reported.

Effects of split fast neutron doses on the liver cells of albino Swiss mice

International Nuclear Information System (INIS)

Abdelmeguid, N.; Ramadan, A.A.; El-Khatib, A.M.

1990-01-01

The effect of neutron doses from a compact D-T neutron generator on the liver cells of adult male and female albino Swiss mice was investigated. Fast neutrons (14.5 MeV) were delivered to the whole body in a single dose or in two, four, six or eight equal doses separated by 3-day intervals. The lowest dose, 100 rem, was given over an exposure time of 6 hours and was then steadily raised to 912 rem over an exposure time of 48 hours. During exposure the neutron flux was controlled by the activation foil technique. The animals were killed for testing after each irradiation. Histological examination of the hepatocytes with a light microscope showed marked degenerative changes only after the longer irradiation periods (24, 36 and 48 h). Electron microscopy showed cytological (cytoplasmic and nuclear) changes in the hepatocytes after only 12 hours' irradiation. Densitometric scans of electron micrographs of control and 12 h-irradiated livers indicated that the control hepatocyte interphase nucleus contains approximately 72% heterochromatin, while the irradiated nucleus contains only 64% heterochromatin. (author). 13 figs., 1 tab., 18 refs

Progress report on neutron science. April 1, 2004 - March 31, 2005

International Nuclear Information System (INIS)

Kurihara, Kazuo; Moriai, Atsushi; Matsuda, Masaaki

2005-09-01

This issue summarizes research progress in neutron science at Japan Atomic Energy Research Institute (JAERI) by utilizing the research reactor JRR-3 during the period between April 1, 2004 and March 31, 2005. This report contains highlights in research by 13 neutron research groups at JAERI and 91 summary articles. (author)

Primary vs. secondary antibody deficiency: clinical features and infection outcomes of immunoglobulin replacement.

Directory of Open Access Journals (Sweden)

Sai S Duraisingham

Full Text Available Secondary antibody deficiency can occur as a result of haematological malignancies or certain medications, but not much is known about the clinical and immunological features of this group of patients as a whole. Here we describe a cohort of 167 patients with primary or secondary antibody deficiencies on immunoglobulin (Ig-replacement treatment. The demographics, causes of immunodeficiency, diagnostic delay, clinical and laboratory features, and infection frequency were analysed retrospectively. Chemotherapy for B cell lymphoma and the use of Rituximab, corticosteroids or immunosuppressive medications were the most common causes of secondary antibody deficiency in this cohort. There was no difference in diagnostic delay or bronchiectasis between primary and secondary antibody deficiency patients, and both groups experienced disorders associated with immune dysregulation. Secondary antibody deficiency patients had similar baseline levels of serum IgG, but higher IgM and IgA, and a higher frequency of switched memory B cells than primary antibody deficiency patients. Serious and non-serious infections before and after Ig-replacement were also compared in both groups. Although secondary antibody deficiency patients had more serious infections before initiation of Ig-replacement, treatment resulted in a significant reduction of serious and non-serious infections in both primary and secondary antibody deficiency patients. Patients with secondary antibody deficiency experience similar delays in diagnosis as primary antibody deficiency patients and can also benefit from immunoglobulin-replacement treatment.

Primary vs. Secondary Antibody Deficiency: Clinical Features and Infection Outcomes of Immunoglobulin Replacement

Science.gov (United States)

Duraisingham, Sai S.; Buckland, Matthew; Dempster, John; Lorenzo, Lorena; Grigoriadou, Sofia; Longhurst, Hilary J.

2014-01-01

Secondary antibody deficiency can occur as a result of haematological malignancies or certain medications, but not much is known about the clinical and immunological features of this group of patients as a whole. Here we describe a cohort of 167 patients with primary or secondary antibody deficiencies on immunoglobulin (Ig)-replacement treatment. The demographics, causes of immunodeficiency, diagnostic delay, clinical and laboratory features, and infection frequency were analysed retrospectively. Chemotherapy for B cell lymphoma and the use of Rituximab, corticosteroids or immunosuppressive medications were the most common causes of secondary antibody deficiency in this cohort. There was no difference in diagnostic delay or bronchiectasis between primary and secondary antibody deficiency patients, and both groups experienced disorders associated with immune dysregulation. Secondary antibody deficiency patients had similar baseline levels of serum IgG, but higher IgM and IgA, and a higher frequency of switched memory B cells than primary antibody deficiency patients. Serious and non-serious infections before and after Ig-replacement were also compared in both groups. Although secondary antibody deficiency patients had more serious infections before initiation of Ig-replacement, treatment resulted in a significant reduction of serious and non-serious infections in both primary and secondary antibody deficiency patients. Patients with secondary antibody deficiency experience similar delays in diagnosis as primary antibody deficiency patients and can also benefit from immunoglobulin-replacement treatment. PMID:24971644

Test of parity and time reversal invariance with low energy polarized neutrons

International Nuclear Information System (INIS)

Masaike, Akira

1996-01-01

Measurements of helicity asymmetries in slow neutron reactions on nuclei have been performed by transmission and capture γ-ray detection. Large enhancements of parity-violation effects have been observed on p-wave resonances of various medium and heavy nuclei. The weak matrix elements in hadron reactions have been deduced from these experimental results. Neutron spin precession near the p-wave resonance has been measured. In recent years violation of time reversal invariance is being searched for in the neutron reactions in which large enhancements of the parity violation effects have been observed. The measurement of the term σ n ·(k n x I) in a neutron reaction using polarized neutrons and a polarized target is an example of the test of T-violation. Polarizations of the neutron and lanthanum nucleus for these experiments are also presented. (author)

High-energy neutron yields in interactions of carbon ions with 114Sn and 124Sn nuclei

International Nuclear Information System (INIS)

Blinov, M.B.; Gavrilov, B.P.; Kovalenko, S.S.; Kozulin, Eh.M.; Mozhaev, A.N.; Oganesyan, Yu.Ts.; Penionzhkevich, Yu.Eh.

1984-01-01

The measurements of the yields of neutrons (energy more than 5 MeV) emitted in the interactions of carbon-12 ions (9 MeV/nucl.) with nuclei of two tin isotopes are conducted. The results obtained prove the effect of nucleon composition of a nucleus on the process of formation of high-energy neutrons. To clarify the concrete interaction mechanism it is necessary to perform systematic research for a number of isotopes differing in the relation of the number of neutrons and protons and binding energies of the last neutron

. Estimating soil contamination from oil spill using neutron backscattering technique

International Nuclear Information System (INIS)

Okunade, I.O.; Jonah, S.A.; Abdulsalam, M.O.

2009-01-01

An analytical facility which is based on neutron backscattering technique has been adapted for monitoring oil spill. The facility which consists of 1 Ci Am-Be isotopic source and 3 He neutron detector is based on the principle of slowing down of neutrons in a given medium which is dominated by the elastic process with the hydrogen nucleus. Based on this principle, the neutron reflection parameter in the presence of hydrogenous materials such as coal, crude oil and other hydrocarbon materials depends strongly on the number of hydrogen nuclei present. Consequently, the facility has been adapted for quantification of crude oil in soil contaminated in this work. The description of the facility and analytical procedures for quantification of oil spill in soil contaminated with different amount of crude oil are provided

Neutron-proton bremsstrahlung experiments

Energy Technology Data Exchange (ETDEWEB)

Koster, J.E. (Los Alamos National Lab., NM (United States)); Nelson, R.O. (Los Alamos National Lab., NM (United States)); Schillaci, M.E. (Los Alamos National Lab., NM (United States)); Wender, S.A. (Los Alamos National Lab., NM (United States)); Mayo, D. (Univ. of California at Davis, CA (United States)); Brady, F.P. (Univ. of California at Davis, CA (United States)); Romero, J. (Univ. of California at Davis, CA (United States)); Krofcheck, D. (Lawrence Livermore National Lab., CA (United States)); Blann, M. (Lawrence Livermore National Lab., CA (United States)); Anthony, P. (Lawrence Livermore National Lab., CA (United States)); Brown, V.R. (Lawrence Livermore National Lab., CA (United States)); Hansen, L. (Lawrence Livermore National Lab., CA (United States)); Pohl, B. (Lawrence Livermore National Lab., CA (United States)); Sangster, T.C. (Lawrence Livermore National Lab., CA (United States)); Nifenecker, H. (Inst. des Sciences Nucleaires, Grenoble (France)); Pinston,

1993-06-01

It is well known that charged particles emit bremsstrahlung radiation when they are accelerated. Classical electron bremsstrahlung occurs when a proton is emitted by an electron accelerated in the field of a nucleus. The bremsstrahlung process also occurs in the scattering of nucleons, for which it is the lowest energy inelastic process that can occur. Like electron bremsstrahlung, nucleon-nucleon bremsstrahlung also requires the exchange of a virtual particle to conserve energy and momentum. In electron bremsstrahlung a virtual photon is exchanged but with two nucleons a meson can be exchanged. Unlike electron bremsstrahlung, in nucleon-nucleon bremsstrahlung the photon can originate from the exchanged meson. This exchange contribution has been shown in calculations to be a significant fraction of bremsstrahlung events. Thus bremsstrahlung serves as a probe of exchange currents in the nucleon-nucleon interaction. Because of a lack of a free neutron target or an intense neutron beam, few measurements of neutron-proton bremsstrahlung exist, each having poor statistical accuracy and poor energy resolution. The white neutron source at the Weapons Neutron Research (WNR) target area at the Los Alamos Meson Physics Facility (LAMPF) produces neutrons with energies from below 50 to above 400 MeV. Using time-of-flight techniques and a liquid hydrogen target, we are measuring the outgoing photons of energies up to 250 MeV at gamma ray angles of around 90 relative to the incident beam. Protons scattered at very forward angles are also detected in coincidence with the gamma rays. (orig.)

Determination of thermal neutrons diffusion length in graphite; Determinacion de la Longitud de Difusion de los Neutrones Termicos en Grafito

Energy Technology Data Exchange (ETDEWEB)

Garcia Fite, J

1959-07-01

The diffusion length of thermal neutrons in graphite using the less possible quantity of material has been determined. The proceeding used was the measurement in a graphite pile which has a punctual source of rapid neutrons inside surrounded by a reflector medium (paraffin or water). The measurement was done in the following conditions: a) introducing an aluminium plate between both materials. b) Introducing a cadmium plate between both materials. (Author) 91 refs.

Cold fusion produces more tritium than neutrons

International Nuclear Information System (INIS)

Rajagopalan, S.R.

1989-01-01

The results of the major cold fusion experiments performed in various laboratories of the world and attempts to explain them are reviewed in brief. Particular reference is made to the experiments carried out in the Bhabha Atomic Research Centre (BARC), Bombay. In BARC experiments, it is found that tritium is the primary product of cold fusion. Author has put forward two hypothetical pictures of D-D fusion. (1) When a metal like Pd or Ti is loaded with D 2 , a crack forms. Propogation of such a crack accelerates deuterons which bombard Pd D 2 /D held by Pd or Ti leading to neutron capture or tritium formation with the release of protons and energy. The released protons might transfer its energy to some other deuteron and a chain reaction is started. This chain reaction terminates when a substantial portion of D in the crack tip is transmuted. This picture explains fusion reaction bursts and the random distribution of reaction sites, but does not explain neutron emission. (2) The deuterons accelerated by a propogating crack may hit a Pd/Ti nucleus instead of a deuterium nucleus and may transmute Pd/Ti. (M.G.B.). 18 refs

Analysis of a neutron scattering integral experiment on iron for neutron energies from 1 to 15 MeV

International Nuclear Information System (INIS)

Cramer, S.N.; Oblow, E.M.

1976-11-01

Monte Carlo calculations were made to analyze the results of an integral experiment with an iron sample to determine the adequacy of neutron scattering cross section data for iron. The experimental results analyzed included energy-dependent NE-213 detector count rates at a scattering angle of 90 deg and pulse-height spectra for scattered neutrons produced in an iron ring pulsed with a 1- to 20-MeV neutron source. The pulse-height data were unfolded to generate secondary neutron spectra at 90 deg as a function of incident neutron energy. Multigroup Monte Carlo calculations using the MORSE code and ENDF/B-IV cross sections were made to analyze all reported results. Discrepancies between calculated and measured responses were found for inelastic scattering reactions in the range from 1 to 4 MeV. These results were related to deficiencies in ENDF/B-IV iron cross section data

46 CFR 167.45-50 - Foam smothering system requirements.

Science.gov (United States)

2010-10-01

... 167.45-50 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) NAUTICAL SCHOOLS PUBLIC NAUTICAL SCHOOL SHIPS Special Firefighting and Fire Prevention Requirements § 167.45-50 Foam smothering... deep in not more than 3 minutes. The arrangement of piping shall be such as to give a uniform...

14 CFR 135.167 - Emergency equipment: Extended overwater operations.

Science.gov (United States)

2010-01-01

... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Emergency equipment: Extended overwater operations. 135.167 Section 135.167 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF...) One CO2 bottle for emergency inflation; (x) One inflation pump; (xi) Two oars; (xii) One 75-foot...

Gravity Defied From Potato Asteroids to Magnetised Neutron Stars

Indian Academy of Sciences (India)

Gravity Defied. From Potato Asteroids to Magnetised Neutron Stars. 2. ... objects that just missed being stars in this particular install- ment. 1. .... However, the total energy that can be made .... trial metals in which the electrons form a degenerate Fermi gas. ... In deuterium fusion, a deuterium nucleus and a proton combine to.

Astrophysical neutron capture rates in s- and r-process nucleosynthesis

International Nuclear Information System (INIS)

Beer, H.; Mohr, P.; Oberhummer, H.; Rauscher, T.; Mutti, P.; Corvi, F.; Sedyshev, P.V.; Popov, Yu.P.

1997-01-01

The astrophysical neutron capture rates of light and heavy nuclei are measured and calculated. The measurements are realized using the activation technique at the 3.75 MV Karlsruhe Van de Graaff accelerator and by means of the time-of-flight method at the Geel electron linear accelerator (GELINA). The setup for the fast cyclic activation measurements made on 26 Mg and 48 Ca, as well as on Pt isotopes is described. The time-of-flight method is used for neutron capture measurements of the bottleneck isotopes 138 Ba and 208 Pb. The calculations are made using direct and compound nuclear capture models. The s-process nucleosynthesis path in the Os and Pt mass region is discussed in details. It is shown that for 19 '1 Os, 192 Ir and 193 Pt there is a competition between β-decay and neutron capture. The β-decay half-lives are dependent on temperature and electron density of the s-process environment. The abundance of s-only 192 Pt originates from the branching at 191 Os and 192 Ir. The isotopes 190 Pt and 198 Pt are not on the s-process path, therefore the seed abundance vanish during nucleosynthesis. Calculations are carried out using parametrized models in order to reproduce the s-process abundance in the mass region from Os up to Pt. The neutron density is adjusted to reproduce the solar abundance of the s-only isotope 9 2 Pt in the analysis of the present branching especially

Decay studies of new neutron deficient isotopes in the range of elements between gadolinium and lead

CERN Document Server

Hofmann, S; Faust, W; Guttner, K; Hessberger, F P; Münzenberg, G; Reisdorf, W; Schneider, J H R; Thuma, B

1981-01-01

Very neutron deficient isotopes below lead are produced with beams of /sup 58/Ni, /sup 92/Mo, and /sup 107/Ag accelerated by the linear accelerator UNILAC. After separation from the projectile beam by the velocity filter SHIP, the fusion products are implanted with their full recoil energy into an array of position-sensitive detectors. With a newly developed position and time correlation technique, parent daughter relationships, half lives and alpha branching ratios of a large number of isotopes are determined. Two new alpha emitting isomeric states are identified in /sup 155/Lu and /sup 156/Hf. The energies of the excited states are (1798+or-12) keV in /sup 155/Lu and (1977+18) keV in /sup 156/Hf, the half-lives are (2.60+or-0.07) ms and (444+or-17) mu s, respectively. Compared to the ground state transitions, a hindrance of 10/sup 5/ can be deduced for both transitions, possibly indicating orbital angular momenta of the order of 10 h(cross) for the alpha emitting states. The isomers are proposed to belong t...

SU(3) symmetries in exotic neutron-rich nuclei

International Nuclear Information System (INIS)

Hayes, A.C.

1991-01-01

We examine the structure of the exotic neutron-rich nucleus 11 Li with an emphasis on understanding the origin of the soft E1 resonance and the neuron halo. The similarities and differences between shell model and di-neutron cluster model descriptions of the system are displayed using the Hecht expansion techniques. We find that the ground state 11 Li as described in large shell model calculations is well approximated by the di-neutron cluster state. In contrast to the ground state, the soft E1 model of 11 Li appears to have a more complicated structure and the E1 strength of this resonance is very sensitive to cancellations between p→s and p→d contributions to the dipole matrix elements. 12 refs., 6 figs., 3 tabs

The imaginary part of the nucleus - nucleus optical potential

International Nuclear Information System (INIS)

Phatak, S.C.; Sinha, B.

1978-01-01

The contribution to the imaginary nucleus - nucleus optical potential has been estimated by evaluating the energy - conserving seocond-order term in the perturbation series. The incoming nuclear field is supposed to excite nucleons in a nucleus in this calculation and the nuclear excitations are approximated by particle-hole excitations in a Fermi gas. The resulting imaginary potential compares favourably with phenomenological potentials. (author)

New Beta-delayed Neutron Measurements in the Light-mass Fission Group

Energy Technology Data Exchange (ETDEWEB)

Agramunt, J. [Instituto de Física Corpuscular, CSIC-Univ. Valencia, Apdo. Correos 22085, E-46071 Valencia (Spain); García, A.R. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas, E-28040 Madrid (Spain); Algora, A. [Instituto de Física Corpuscular, CSIC-Univ. Valencia, Apdo. Correos 22085, E-46071 Valencia (Spain); Äystö, J. [University of Jyväskylä, FI-40014 Jyväskyä (Finland); Caballero-Folch, R.; Calviño, F. [Secció d' Enginyeria Nuclear, Universitat Politécnica de Catalunya, E-08028 Barcelona (Spain); Cano-Ott, D. [Centro de Investigaciones Energéticas, Medioambientales y Tecnológicas, E-28040 Madrid (Spain); Cortés, G. [Secció d' Enginyeria Nuclear, Universitat Politécnica de Catalunya, E-08028 Barcelona (Spain); Domingo-Pardo, C. [Instituto de Física Corpuscular, CSIC-Univ. Valencia, Apdo. Correos 22085, E-46071 Valencia (Spain); Eronen, T. [University of Jyväskylä, FI-40014 Jyväskyä (Finland); Gelletly, W. [Department of Physics, University of Surrey, Guildford GU2 7XH (United Kingdom); Gómez-Hornillos, M.B. [Secció d' Enginyeria Nuclear, Universitat Politécnica de Catalunya, E-08028 Barcelona (Spain); and others

2014-06-15

A new accurate determination of beta-delayed neutron emission probabilities from nuclei in the low mass region of the light fission group has been performed. The measurements were carried out using the BELEN 4π neutron counter at the IGISOL-JYFL mass separator in combination with a Penning trap. The new results significantly improve the uncertainties of neutron emission probabilities for {sup 91}Br, {sup 86}As, {sup 85}As, and {sup 85}Ge nuclei.

Search for a new X(16.7) boson and dark photons in the NA64 experiment at CERN

CERN Document Server

Banerjee, D.; Chumakov, A.G.; Cooke, D.; Crivelli, P.; Depero, E.; Dermenev, A.V.; Donskov, S.V.; Dusaev, R.R.; Enik, T.; Charitonidis, N.; Feshchenko, A.; Frolov, V.N.; Gardikiotis, A.; Gerassimov, S.G.; Gninenko, SN; Hösgen, M.; Jeckel, M.; Karneyeu, A.E.; Kekelidze, G.; Ketzer, B.; Kirpichnikov, D.V.; Kirsanov, M.M.; Konorov, I.V.; Kovalenko, S.G.; Kramarenko, V.A.; Kravchuk, L.V.; Krasnikov, N.V.; Kuleshov, S.V.; Lyubovitskij, V.E.; Lysan, V.; Matveev, V.A.; Mikhailov, Yu.V.; Peshekhonov, D.V.; Polyakov, V.A.; Radics, B.; Rojas, R.; Rubbia, A.; Samoylenko, V.D.; Tikhomirov, V.O.; Tlisov, D.A.; Toropin, A.N.; Trifonov, A.Yu.; Vasilishin, B.I.; Vasquez Arenas, G.; Volkov, P.V.; Volkov, V.; Ulloa, P.

2018-06-09

We report the first results on a direct search for a new 16.7 MeV boson (X) which could explain the anomalous excess of e+e- pairs observed in the excited 8Be* nucleus decays. Due to its coupling to electrons, the X could be produced in the bremsstrahlung reaction e-Z -> e-ZX by a 100 GeV e- beam incident on an active target in the NA64 experiment at the CERN SPS and observed through the subsequent decay into a e+e- pair. With 5.4x10^10 electrons on target no evidence for such decays was found, allowing to set first limits on the X-e- coupling in the range 1.3x10^-4 e+e- of the bremsstrahlung A' with a mass < 23 MeV.

General analysis for experimental studies of time-reversal-violating effects in slow neutron propagation through polarized matter

International Nuclear Information System (INIS)

Lamoreaux, S.K.; Golub, R.

1994-01-01

A general technique is developed for the analysis of proposed experimental studies of possible P,T-violating effects in the neutron-nucleus interaction based on low-energy neutron transmission through polarized matter. The analysis is applied to proposed experimental schemes and we determine the levels at which the absolute neutron polarization, magnetic fields, and target polarization must be controlled in order for these experiments to obtain a given sensitivity to P,T-violating effects

Jasmonate signaling is activated in the very early stages of iron deficiency responses in rice roots.

Science.gov (United States)

Kobayashi, Takanori; Itai, Reiko Nakanishi; Senoura, Takeshi; Oikawa, Takaya; Ishimaru, Yasuhiro; Ueda, Minoru; Nakanishi, Hiromi; Nishizawa, Naoko K

2016-07-01

Under low iron availability, plants induce the expression of various genes involved in iron uptake and translocation at the transcriptional level. This iron deficiency response is affected by various plant hormones, but the roles of jasmonates in this response are not well-known. We investigated the involvement of jasmonates in rice iron deficiency responses. High rates of jasmonate-inducible genes were induced during the very early stages of iron deficiency treatment in rice roots. Many jasmonate-inducible genes were also negatively regulated by the ubiquitin ligases OsHRZ1 and OsHRZ2 and positively regulated by the transcription factor IDEF1. Ten out of 35 genes involved in jasmonate biosynthesis and signaling were rapidly induced at 3 h of iron deficiency treatment, and this induction preceded that of known iron deficiency-inducible genes involved in iron uptake and translocation. Twelve genes involved in jasmonate biosynthesis and signaling were also upregulated in HRZ-knockdown roots. Endogenous concentrations of jasmonic acid and jasmonoyl isoleucine tended to be rapidly increased in roots in response to iron deficiency treatment, whereas these concentrations were higher in HRZ-knockdown roots under iron-sufficient conditions. Analysis of the jasmonate-deficient cpm2 mutant revealed that jasmonates repress the expression of many iron deficiency-inducible genes involved in iron uptake and translocation under iron sufficiency, but this repression is partly canceled under an early stage of iron deficiency. These results indicate that jasmonate signaling is activated during the very early stages of iron deficiency, which is partly regulated by IDEF1 and OsHRZs.

Deficiência de boro na cultura do abacaxi 'Pérola' Boron deficiency in pineapple 'Pérola'

Directory of Open Access Journals (Sweden)

Susana Cristine Siebeneichler

2008-12-01

Full Text Available Vinte plantas de abacaxi "Pérola" foram cultivadas em vasos de plástico de 10 L, em casa de vegetação, com o objetivo de caracterizar os sintomas visuais de deficiência de B nas plantas e nos frutos. Os vasos continham areia de rio lavada cinco vezes com água comum e depois duas vezes com água desionizada. Dez plantas foram irrigadas com solução completa e, de outras dez, o B foi suprimido da solução cinco meses após o plantio. As plantas apresentaram crescimento vegetativo normal e formaram frutos normais. Após a colheita dos frutos, acompanhou-se a formação das mudas do tipo rebento e rebentão basal, onde se observou que as plantas cultivadas sem B formaram mais mudas do tipo rebento do que as plantas cultivadas com B. Na formação das mudas do tipo rebentão basal, não se observou o efeito da supressão do B. No cultivo da planta-soca e em rebentões basais, cultivados em solução nutritiva sem B, observaram-se sintomas de deficiência de B somente no período reprodutivo. Os sintomas de deficiência de B se caracterizaram por: frutos deformados e menores, com formação de excrescência cortiçosa ou secreção de goma entre os frutilhos, rachaduras entre estes preenchidas com excrescência cortiçosa. As mudas tipo filhote formadas nas plantas-soca apresentaram folhas com falhas na borda e pontas secas.Twenty pineapple "Pérola" plants were cultivated in 10L plastic pots in a greenhouse, with the objective of characterizing the visual symptoms of boron deficiency in the pineapple leaves and fruit. The pots contained river sand that was washed five times with common water and two times with deionized water. Ten plants were irrigated five months after planting with a complete nutrient solution and the other ten, without B in the solution. The plants presented regular vegetative growth and fruit formation. After the harvest of the fruit, the formation of shoot and suckers seedling types were accompanied, where it was

Statistical distribution of resonance parameters for inelastic scattering of fast neutrons

International Nuclear Information System (INIS)

Radunovic, J.

1973-01-01

This paper deals with the application of statistical method for the analysis of nuclear reactions related to complex nuclei. It is shown that inelastic neutron scattering which occurs by creation of a complex nucleus in the higher energy range can be treated by statistical approach

Low-lying intruder state of the unbound nucleus {sup 13}Be

Energy Technology Data Exchange (ETDEWEB)

Kondo, Y., E-mail: kondo@phys.titech.ac.j [Department of Physics, Tokyo Institute of Technology, 2-12-1 Oh-Okayama, Meguro, Tokyo 152-8551 (Japan); Nakamura, T.; Satou, Y. [Department of Physics, Tokyo Institute of Technology, 2-12-1 Oh-Okayama, Meguro, Tokyo 152-8551 (Japan); Matsumoto, T.; Aoi, N. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Endo, N. [Department of Physics, Tohoku University, 2-1-1 Katahira, Aoba, Sendai, Miyagi 980-8577 (Japan); Fukuda, N.; Gomi, T. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Hashimoto, Y. [Department of Physics, Tokyo Institute of Technology, 2-12-1 Oh-Okayama, Meguro, Tokyo 152-8551 (Japan); Ishihara, M. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Kawai, S. [Department of Physics, Rikkyo University, 3-34-1 Nishi-Ikebukuro, Toshima, Tokyo 171-8501 (Japan); Kitayama, M.; Kobayashi, T.; Matsuda, Y. [Department of Physics, Tohoku University, 2-1-1 Katahira, Aoba, Sendai, Miyagi 980-8577 (Japan); Matsui, N. [Department of Physics, Tokyo Institute of Technology, 2-12-1 Oh-Okayama, Meguro, Tokyo 152-8551 (Japan); Motobayashi, T. [RIKEN Nishina Center, 2-1 Hirosawa, Wako, Saitama 351-0198 (Japan); Nakabayashi, T.; Okumura, T. [Department of Physics, Tokyo Institute of Technology, 2-12-1 Oh-Okayama, Meguro, Tokyo 152-8551 (Japan); Ong, H.J.; Onishi, T.K. [Department of Physics, University of Tokyo, 7-3-1 Hongo, Bunkyo, Tokyo 113-0033 (Japan)

2010-06-21

An experimental study for the unbound nucleus {sup 13}Be has been performed by means of the invariant mass method via the one-neutron removal reaction {sup 1}H({sup 14}Be,{sup 12}Be+n). A resonance has been observed at 0.51(1) MeV in the relative energy (E{sub rel}) spectrum of the {sup 12}Be+n system. The transverse momentum distribution of the {sup 12}Be+n system as well as the resonance width of 0.45(3) MeV gives evidence for the p-wave nature of the resonance. A d-wave resonance has also been observed at 2.39(5) MeV in the E{sub rel} spectrum. The observation of the low-lying p-wave resonance indicates the disappearance of the N=8 magicity in the vicinity of the neutron drip line region.

Determination of thermal neutrons diffusion length in graphite

International Nuclear Information System (INIS)

Garcia Fite, J.

1959-01-01

The diffusion length of thermal neutrons in graphite using the less possible quantity of material has been determined. The proceeding used was the measurement in a graphite pile which has a punctual source of rapid neutrons inside surrounded by a reflector medium (paraffin or water). The measurement was done in the following conditions: a) introducing an aluminium plate between both materials. b) Introducing a cadmium plate between both materials. (Author) 91 refs

Characterization of Rice Homeobox Genes, OsHOX22 and OsHOX24, and Over-expression of OsHOX24 in Transgenic Arabidopsis Suggest their Role in Abiotic Stress Response

Directory of Open Access Journals (Sweden)

Annapurna eBhattacharjee

2016-05-01

Full Text Available Homeobox transcription factors are well known regulators of plant growth and development. In this study, we carried out functional analysis of two candidate stress-responsive HD-ZIP I class homeobox genes from rice, OsHOX22 and OsHOX24. These genes were highly upregulated under various abiotic stress conditions at different stages of rice development, including seedling, mature and reproductive stages. The transcript levels of these genes were enhanced significantly in the presence of plant hormones, including abscisic acid (ABA, auxin, salicylic acid and gibberellic acid. The recombinant full-length and truncated homeobox proteins were found to be localized in the nucleus. Electrophoretic mobility shift assay established the binding of these homeobox proteins with specific DNA sequences, AH1 (CAAT(A/TATTG and AH2 (CAAT(C/GATTG. Transactivation assays in yeast revealed the transcriptional activation potential of full-length OsHOX22 and OsHOX24 proteins. Homo- and hetero-dimerization capabilities of these proteins have also been demonstrated. Further, we identified putative novel interacting proteins of OsHOX22 and OsHOX24 via yeast-two hybrid analysis. Over-expression of OsHOX24 imparted higher sensitivity to stress hormone, ABA, and abiotic stresses in the transgenic Arabidopsis plants as revealed by various physiological and phenotypic assays. Microarray analysis revealed differential expression of several stress-responsive genes in transgenic lines as compared to wild-type. Many of these genes were found to be involved in transcriptional regulation and various metabolic pathways. Altogether, our results suggest the possible role of OsHOX22/OsHOX24 homeobox proteins as negative regulators in abiotic stress responses.

Quasi-elastic shadowing in nucleus-nucleus elastic scattering

Energy Technology Data Exchange (ETDEWEB)

Dymarz, R; Malecki, A [Institute of Nuclear Physics, Krakow (Poland); Gluski, K [Institute of Nuclear Research, Warsaw (Poland); Picchi, P [Turin Univ. (Italy). Ist. di Fisica; Consiglio Nazionale delle Ricerche, Turin (Italy). Lab. di Cosmo-Geofisica)

1979-01-06

The complete evaluation of the Glauber multiple-scattering series for nucleus-nucleus collisions is a very difficult task and that is why various approximate formulae were proposed. In this work some of these approximations are discussed.

26 CFR 1.167(a)-1 - Depreciation in general.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Depreciation in general. 1.167(a)-1 Section 1... Depreciation in general. (a) Reasonable allowance. Section 167(a) provides that a reasonable allowance for the... the taxpayer for the production of income shall be allowed as a depreciation deduction. The allowance...

Induced mutation breeding by fast neutron

International Nuclear Information System (INIS)

Chen Zhengba; You Risheng

1988-09-01

The high-yield and long-grain new variety 'Zhongtie 31' was developed through five generations after irradiation of the rice variety 'Tieqiu 15' dried seeds by 14 MeV fast neutrons with a fluence of (1.33 ∼ 3.33) x 10 11 neutrons cm -2 . It matured earlier 3 to 5 days, the plant is higher 10 cm, bigger ear, more grain than its original variety 'tieqiu 15', and the yield increased by 19.2% to 30.7%. The source of new variety 'Zhongtie 31' was proved by the isoenzyme genetics. In field test, it increased by 7% to 10% as compared with high-yield variety 'Guichao No.2' and the hybrid rive 'Shanyou No.2', and is more palatable. The new variety was initiated by irradiation mutagensis routine rice, its well-grown and bumper-yield performances may be compared favourably with hybrid rice variety. In July 1986, the new variety 'Zhongtie 31' was obtained by inducing mutation with fast neutron. The same year, the planted area of 'Zhongtie 31' has achieved upto 250 thousand mu (1.67 x 10 8 cm 2 )

High density QCD and nucleus-nucleus scattering deeply in the saturation region

International Nuclear Information System (INIS)

Kormilitzin, Andrey; Levin, Eugene; Miller, Jeremy S.

2011-01-01

In this paper we solve the equations that describe nucleus-nucleus scattering, in high density QCD, in the framework of the BFKL Pomeron Calculus. We found that (i) the contribution of short distances to the opacity for nucleus-nucleus scattering dies at high energies, (ii) the opacity tends to unity at high energy, and (iii) the main contribution that survives comes from soft (long distance) processes for large values of the impact parameter. The corrections to the opacity Ω(Y,b)=1 were calculated and it turns out that they have a completely different form, namely (1-Ω→exp(-Const√(Y))) than the opacity that stems from the Balitsky-Kovchegov equation, which is (1-Ω→exp(-ConstY 2 )). We reproduce the formula for the nucleus-nucleus cross section that is commonly used in the description of nucleus-nucleus scattering, and there is no reason why it should be correct in the Glauber-Gribov approach.

Magnetic dipole moment of the doubly closed-shell plus one proton nucleus $^{49}$Sc

CERN Multimedia

Gaulard, C V; Walters, W; Nishimura, K; Muto, S; Bingham, C R

It is proposed to measure the magnetic moment of $^{49}$Sc by the Nuclear Magnetic Resonance on Oriented Nuclei (NMR-ON) method using the NICOLE on-line nuclear orientation facility. $^{49}$Sc is the neutron rich, doubly closed-shell, nucleus $^{48}$Ca plus one proton. Results will be used to deduce the effective g-factors in the $^{48}$Ca region with reference to nuclear structure and meson exchange current effects.

Neutron-induced cross sections of short-lived nuclei via the surrogate reaction method

Directory of Open Access Journals (Sweden)

Morel P.

2011-10-01

Full Text Available The measurement of neutron-induced cross sections of short-lived nuclei is extremely difficult due to the radioactivity of the samples. The surrogate reaction method is an indirect way of determining cross sections for nuclear reactions that proceed through a compound nucleus. This method presents the advantage that the target material can be stable or less radioactive than the material required for a neutron-induced measurement. We have successfully used the surrogate reaction method to extract neutron-induced fission cross sections of various short-lived actinides. In this work, we investigate whether this technique can be used to determine neutron-induced capture cross sections in the rare-earth region.

Neutron-induced cross sections of short-lived nuclei via the surrogate reaction method

Directory of Open Access Journals (Sweden)

Tassan-Got L.

2012-02-01

Full Text Available The measurement of neutron-induced cross sections of short-lived nuclei is extremely difficult due to the radioactivity of the samples. The surrogate reaction method is an indirect way of determining cross sections for nuclear reactions that proceed through a compound nucleus. This method presents the advantage that the target material can be stable or less radioactive than the material required for a neutron-induced measurement. We have successfully used the surrogate reaction method to extract neutron-induced fission cross sections of various short-lived actinides. In this work, we investigate whether this technique can be used to determine neutron-induced capture cross sections in the rare-earth region.

Research on amplification multiple of source neutron number for ADS

International Nuclear Information System (INIS)

Liu Guisheng; Zhao Zhixiang; Zhang Baocheng; Shen Qingbiao; Ding Dazhao

1998-01-01

NJOY-91.91 and MILER code systems was applied to process and generate 44 group cross sections in AMPX master library format from CENDL-2 and ENDF/B-6. It is important an ADS (Accelerator-Driven System) assembly spectrum is used as the weighting spectrum for generating multi-group constants. Amplification multiples of source neutron number for several fast assemblies were calculated

Energy spectra of neutrons accompanying the emission fission of 238U

International Nuclear Information System (INIS)

Smirenkin, G.N.; Lovchikova, G.N.; Trufanov, A.M.; Svirin, M.I.; Polyakov, A.V.; Vinogradov, V.A.; Dmitriev, V.D.; Boykov, G.S.

1996-01-01

The spectra of fission neutrons emitted from 238U are measured for the first time by the time-of-flight method at incident-neutron energies of 16.0 and 17.7 MeV. Analysis of the neutron spectra shows that experimental results at incident-neutron energies of 14.7, 16.0, and 17.7 MeV (above the threshold of chance fission) differ significantly from those obtained at a neutron energy of 2.9 MeV (below the threshold of chance fission). Owing to the prefission emission of neutrons, the observed spectra of neutrons from emission fission exhibit a characteristic growth of the neutron yield in both hard and soft sections of the spectrum of secondary neutrons. This growth manifests itself as a step in the first case and as a rise in the second case, where it results in a noticeable excess of neutrons over the statistical-model predictions for E<2 MeV. The first feature in the spectra of neutrons from emission fission can be associated with the nonequilibrium decay of an excited fissile nucleus. On the contrary, the origin of the second feature has yet to be clarified. Additional measurements of angular distributions of secondary neutrons may prove helpful in this respect

Approximation by rational functions as processing method, analysis and transformation of neutron data

International Nuclear Information System (INIS)

Gaj, E.V.; Badikov, S.A.; Gusejnov, M.A.; Rabotnov, N.S.

1988-01-01

Possible applications of rational functions in the analysis of neutron cross sections, angular distributions and neutron constants generation are described. Results of investigations made in this direction, which have been obtained after the preceding conference in Kiev, are presented: the method of simultaneous treatment of several cross sections for one compound nucleus in the resonance range; the use of the Pade approximation for elastically scattered neutron angular distribution approximation; obtaining of subgroup constants on the basis of rational approximation of cross section functional dependence on dilution cross section; the first experience in function approximation by two variables

Proton energy dependence of slow neutron intensity

International Nuclear Information System (INIS)

Teshigawara, Makoto; Harada, Masahide; Watanabe, Noboru; Kai, Tetsuya; Sakata, Hideaki; Ikeda, Yujiro

2001-01-01

The choice of the proton energy is an important issue for the design of an intense-pulsed-spallation source. The optimal proton beam energy is rather unique from a viewpoint of the leakage neutron intensity but no yet clear from the slow-neutron intensity view point. It also depends on an accelerator type. Since it is also important to know the proton energy dependence of slow-neutrons from the moderators in a realistic target-moderator-reflector assembly (TMRA). We studied on the TMRA proposed for Japan Spallation Neutron Source. The slow-neutron intensities from the moderators per unit proton beam power (MW) exhibit the maximum at about 1-2 GeV. At higher proton energies the intensity per MW goes down; at 3 and 50 GeV about 0.91 and 0.47 times as low as that at 1 GeV. The proton energy dependence of slow-neutron intensities was found to be almost the same as that of total neutron yield (leakage neutrons) from the same bare target. It was also found that proton energy dependence was almost the same for the coupled and decoupled moderators, regardless the different moderator type, geometry and coupling scheme. (author)

Theoretical descriptions of neutron emission in fission

International Nuclear Information System (INIS)

Madland, D.G.

1991-01-01

Brief descriptions are given of the observables in neutron emission in fission together with early theoretical representations of two of these observables, namely, the prompt fission neutron spectrum N(E) and the average prompt neutron multiplicity ν-bar p . This is followed by summaries, together with examples, of modern approaches to the calculation of these two quantities. Here, emphasis is placed upon the predictability and accuracy of the new approaches. In particular, the dependencies of N(E) and ν-bar p upon the fissioning nucleus and its excitation energy are discussed. Then, recent work in multiple-chance fission and other recent work involving new measurements are presented and discussed. Following this, some properties of fission fragments are mentioned that must be better known and better understood in order to calculate N(E) and ν-bar p with higher accuracy than is currently possible. In conclusion, some measurements are recommended for the purpose of benchmarking simultaneous calculations of neutron emission and gamma emission in fission. (author). 32 refs, 26 figs

Evaluation of neutron cross-sections of {sup 127}I important for radiation transport calculations in large NaI detectors

Energy Technology Data Exchange (ETDEWEB)

Pronayaev, V G [Institute of Physics and Power Engineering, Obninsk (Russian Federation)

1997-06-01

Evaluations were made of neutron inelastic scattering cross-sections with excitation of discrete levels of the residual nucleus, the (n,2n) reaction, secondary neutron emission spectra and secondary photons for reactions which contribute substantially to production of photons for {sup 127}I with the use of the theoretical model for neutrons with an initial energy of 60 keV-20 MeV. (author). 10 refs, 3 figs.

Neutron data evaluation of {sup 238}U

Energy Technology Data Exchange (ETDEWEB)

Maslov, V.M.; Porodzinskij, Y.V.; Hasegawa, Akira; Shibata, Keiichi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment

1998-08-01

Cross sections for neutron-induced reactions on {sup 238}U are calculated by using the Hauser-Feshbach-Moldauer theory, the coupled channel model and the double-humped fission barrier model. The direct excitation of ground state band levels is calculated with a rigid-rotator model. The direct excitation of vibrational octupole and K = 2{sup +} quadrupole bands is included using a soft (deformable) rotator model. The competition of inelastic scattering to fission reaction is shown to be sensitive to the target nucleus level density at excitations above the pairing gap. As for fission, (n,2n), (n,3n), and (n,4n) reactions, secondary neutron spectra data are consistently reproduced. Pre-equilibrium emission of first neutron is included. Shell effects in the level densities are shown to be important for estimation of energy dependence of non-emissive fission cross section. (author). 105 refs.

26 CFR 1.167(b)-1 - Straight line method.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Straight line method. 1.167(b)-1 Section 1.167(b... Straight line method. (a) In general. Under the straight line method the cost or other basis of the... may be reduced to a percentage or fraction. The straight line method may be used in determining a...

26 CFR 1.167(g)-1 - Basis for depreciation.

Science.gov (United States)

2010-04-01

... 26 Internal Revenue 2 2010-04-01 2010-04-01 false Basis for depreciation. 1.167(g)-1 Section 1.167... for depreciation. The basis upon which the allowance for depreciation is to be computed with respect... property at that time, is the basis for computing depreciation. [T.D. 6500, 25 FR 11402, Nov. 26, 1960...

25 CFR 167.15 - Control of livestock disease and introduction of livestock.

Science.gov (United States)

2010-04-01

... 25 Indians 1 2010-04-01 2010-04-01 false Control of livestock disease and introduction of livestock. 167.15 Section 167.15 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF THE INTERIOR LAND AND WATER NAVAJO GRAZING REGULATIONS § 167.15 Control of livestock disease and introduction of livestock. (a) The...

Alpha decay of 114Ba

International Nuclear Information System (INIS)

Mazzocchi, C.; Janas, Z.; Batist, L.; Belleguic, V.; Doering, J.; Kapica, M.; Kirchner, R.; Roeckl, E.; Gierlik, M.; Zylicz, J.; Mahmud, H.; Schmidt, K.; Woods, P.J.

2003-01-01

The neutron-deficient isotope 114 Ba was produced in a fusion evaporation reaction at the GSI On-Line Mass Separator. We measured the α-particle energy of 114 Ba, the half-life of its daughter nucleus 110 Xe, and the α-decay branching ratios for 114 Ba, 110 Xe and 106 Te. (orig.)

Scientific Design of the New Neutron Radiography Facility (SANRAD) at SAFARI-1 for South Africa

Science.gov (United States)

de Beer, F. C.; Gruenauer, F.; Radebe, J. M.; Modise, T.; Schillinger, B.

The final scientific design for an upgraded neutron radiography/tomography facility at beam port no.2 of the SAFARI-1 nuclear research reactor has been performed through expert advice from Physics Consulting, FRMII in Germany and IPEN, Brazil. A need to upgrade the facility became apparent due to the identification of various deficiencies of the current SANRAD facility during an IAEA-sponsored expert mission of international scientists to Necsa, South Africa. A lack of adequate shielding that results in high neutron background on the beam port floor, a mismatch in the collimator aperture to the core that results in a high gradient in neutron flux on the imaging plane and due to a relative low L/D the quality of the radiographs are poor, are a number of deficiencies to name a few.The new design, based on results of Monte Carlo (MCNP-X) simulations of neutron- and gamma transport from the reactor core and through the new facility, is being outlined. The scientific design philosophy, neutron optics and imaging capabilities that include the utilization of fission neutrons, thermal neutrons, and gamma-rays emerging from the core of SAFARI-1 are discussed.

High-power electron beam tests of a liquid-lithium target and characterization study of (7)Li(p,n) near-threshold neutrons for accelerator-based boron neutron capture therapy.

Science.gov (United States)

Halfon, S; Paul, M; Arenshtam, A; Berkovits, D; Cohen, D; Eliyahu, I; Kijel, D; Mardor, I; Silverman, I

2014-06-01

A compact Liquid-Lithium Target (LiLiT) was built and tested with a high-power electron gun at Soreq Nuclear Research Center (SNRC). The target is intended to demonstrate liquid-lithium target capabilities to constitute an accelerator-based intense neutron source for Boron Neutron Capture Therapy (BNCT) in hospitals. The lithium target will produce neutrons through the (7)Li(p,n)(7)Be reaction and it will overcome the major problem of removing the thermal power >5kW generated by high-intensity proton beams, necessary for sufficient therapeutic neutron flux. In preliminary experiments liquid lithium was flown through the target loop and generated a stable jet on the concave supporting wall. Electron beam irradiation demonstrated that the liquid-lithium target can dissipate electron power densities of more than 4kW/cm(2) and volumetric power density around 2MW/cm(3) at a lithium flow of ~4m/s, while maintaining stable temperature and vacuum conditions. These power densities correspond to a narrow (σ=~2mm) 1.91MeV, 3mA proton beam. A high-intensity proton beam irradiation (1.91-2.5MeV, 2mA) is being commissioned at the SARAF (Soreq Applied Research Accelerator Facility) superconducting linear accelerator. In order to determine the conditions of LiLiT proton irradiation for BNCT and to tailor the neutron energy spectrum, a characterization of near threshold (~1.91MeV) (7)Li(p,n) neutrons is in progress based on Monte-Carlo (MCNP and Geant4) simulation and on low-intensity experiments with solid LiF targets. In-phantom dosimetry measurements are performed using special designed dosimeters based on CR-39 track detectors. © 2013 Elsevier Ltd. All rights reserved.

Investigation for the Fossil Embryo using Neutron Tomography at HANARO, KAERI

International Nuclear Information System (INIS)

Kim, Tae Joo; Sim, Cheul Muu; Kim, Dong Hee; Grellet-Tinner, Gerald

2012-01-01

Neutron imaging technique is one of non-destructive method. It is similar to X-ray and g-ray methods in using the different attenuation characteristics depending on materials. However, there is great difference between them. The mass attenuation coefficients of X-ray and g- ray monotonically increase with the atomic number since they interact with electrons. Thus X-ray image method does not supply sufficient contrast between similar atomic numbers. On the other hand, that of thermal neutrons depends much on the nucleus not electrons. Especially thermal neutrons easily penetrate most of metals, while they are attenuated well by such materials as hydrogen, water, boron, gadolinium and cadmium. Because of these unique characteristics of neutron, neutron imaging technique has been utilized for NDT or researches for next power sources (fuel cell or Li-Ion battery). Recently, dinosaur egg was found at the Aptian. Albian Algui Ulaan Tsav site, Mongolia. In this study, we applied the neutron imaging technique to investigate dinosaur embryo at Neutron Radiography Facility of HANARO, KAERI

Investigation for the Fossil Embryo using Neutron Tomography at HANARO, KAERI

Energy Technology Data Exchange (ETDEWEB)

Kim, Tae Joo; Sim, Cheul Muu [Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); Kim, Dong Hee [National Science Museum, Daejeon (Korea, Republic of); Grellet-Tinner, Gerald [The Field Museum, Chicago (United States)

2012-05-15

Neutron imaging technique is one of non-destructive method. It is similar to X-ray and g-ray methods in using the different attenuation characteristics depending on materials. However, there is great difference between them. The mass attenuation coefficients of X-ray and g- ray monotonically increase with the atomic number since they interact with electrons. Thus X-ray image method does not supply sufficient contrast between similar atomic numbers. On the other hand, that of thermal neutrons depends much on the nucleus not electrons. Especially thermal neutrons easily penetrate most of metals, while they are attenuated well by such materials as hydrogen, water, boron, gadolinium and cadmium. Because of these unique characteristics of neutron, neutron imaging technique has been utilized for NDT or researches for next power sources (fuel cell or Li-Ion battery). Recently, dinosaur egg was found at the Aptian. Albian Algui Ulaan Tsav site, Mongolia. In this study, we applied the neutron imaging technique to investigate dinosaur embryo at Neutron Radiography Facility of HANARO, KAERI

Neutron Tomography Application for Aircraft-parts and Root of Ginseng

Energy Technology Data Exchange (ETDEWEB)

Kim, Yi Kyung; Lee, Seung Wook; Sim, Chul Mu; Jeon, Jin Su; Kim, Tae Ju [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)

2005-07-01

The neutron computerized tomography is considered to be a complementary tool to X-ray tomography in the sense that neutron interacts with atomic nucleus, otherwise X-ray interacts with an orbital electron of atom. The neutron tomography compared with X-ray tomography has a relatively short history. It is employed in stationary, as neutron sources are produced by the nuclear reactor. The full potential of the neutron tomography has yet to be investigated. Since, HANARO NRF was installed in 1995, the neutron radiography research group of KAERI has been developed the non-destructive testing methods by the computer tomography served for aerospace industry and agricultural industry. Concerning to NDT for aerospace, research was cooperated with Korean Air force. At the first stage, research was focused to find the micro-cracks based on internal passages inside aircraft parts and residual core of turbine blade. Concerning to NDT for agriculture, research was cooperated with the Agricultural Development and Technology Center. Research was focused to find the alive roots of Korean ginseng.

A realistic solvable model for the Coulomb dissociation of neutron halo nuclei