NRC TLD Direct Radiation Monitoring Network. Progress report, October--December 1996

Energy Technology Data Exchange (ETDEWEB)

Struckmeyer, R.

1997-03-01

This report presents the results of the NRC Direct Radiation Monitoring Network for the fourth quarter of 1996. It provides the ambient radiation levels measured in the vicinity of 74 sites throughout the United States. In addition, it describes the equipment used, monitoring station selection criteria, characterization of the dosimeter response, calibration procedures, statistical methods, intercomparison, and quality assurance program. 3 figs., 4 tabs.

Establishment of 2000 National Geodetic Control Network of China and It’s Technological Progress

Directory of Open Access Journals (Sweden)

CHEN Junyong

2007-02-01

Full Text Available Objectives: 2000’ National Geodetic Control Network of China is an important fundamental scientific engineering project in China. It consists of three parts which are establishment of 2000 National GPS Geodetic Network, its combination adjustment with national astro-geodetic network and 2000 National Gravity Fundamental network. It provides the high precise coordinate reference and gravity reference for three dimensional geo-center national coordinates system and gravity system, respectively. Additionally, it provides precise unified geometric and physical geodesy information for the economic construction, the national defense and the scientific research. Methods: 1. The larger number of data are processed in triple networks adjustment of 2000 National GPS Geodetic Network, which are chosen from the GPS monitoring stations, such as grade A, B of national GPS network , grade 1st and 2nd of national GPS network, crustal movement observation network of China, and others crustal deformation monitoring stations. Finally, the data of 2666 GPS stations are used in the data processing of 2000 National GPS Geodetic Network, including 124 external stations and 2542 internal stations. In order to the results of triple networks adjustment are corresponding to that of three dimensional geo-center coordinates system, ITRF 97 and epoch 2000.0 are chosen as the coordinate reference frame and epoch reference, respectively. The methods of “strong reference” and “weak reference” are combined used in the control data selection of triple networks adjustment. The scale and rotation scales are adopted for each sub network. The least square adjustment is firstly adopted in each sub network adjustment. The data of obvious abnormal baselines are found and rejected firstly. And the method of double factor robust estimation is adopted in the data processing. 2. The combined adjustment of 2000 National GPS Geodetic Network and national astro-geodetic network is

Clear Purpose...Complete Commitment. A Long-Range Program To Provide Louisianians with Library and Information Services Adequate to Their Needs 1996-2000.

Science.gov (United States)

Jaques, Thomas F.

This document provides the 5-year (1996-2000) library plan for public libraries in Louisiana. It identifies specific inadequacies in public library services, resources, facilities, and personnel. It identifies the people who are to be served, and reveals the geographical, sociological, economic, and educational barriers to the expanded use of…

Perfil epidemiológico do sarampo no Estado de Santa Catarina, Brasil, de 1996 a 2000 Measles epidemiology in the State of Santa Catarina, Brazil, 1996-2000

Directory of Open Access Journals (Sweden)

Maria Cristina de Sousa Santos Faversani

2005-04-01

Full Text Available Este estudo ecológico, baseado nos dados secundários da vigilância epidemiológica e usando município como unidade de análise, mostrou que as coberturas da vacina contra sarampo foram menores de níveis necessários para erradicação (95% e controle (90% em grande parte do Estado de Santa Catarina, Brasil, antes e durante a epidemia de 1997, principalmente da segunda dose da vacina, prevista para 15 meses de idade dentro da vacina triviral. Houve melhora nos anos seguintes, mas continuou faltando a homogeneidade da cobertura. Baixas coberturas vacinais foram associadas com maior incidência de sarampo, mas, no ano epidêmico de 1997, surtos menores de sarampo ocorreram até em alguns municípios com coberturas acima de 95% no primeiro ano de vida, com maior concentração naqueles com baixa cobertura da vacina triviral. Cerca de 80% dos casos de sarampo no período de 1996-2000 ocorreram entre escolares e jovens adultos. A circulação do vírus do sarampo no ano anterior e a densidade populacional aumentaram o risco de sarampo. Dois casos importados em 2004 ilustram bem porque ainda não podemos falar de erradicação e sim de eliminação do sarampo no Estado.This ecological study, based on an analysis of secondary data from epidemiological surveillance and using the municipality (county as the unit of analysis, showed that measles vaccine coverage was lower than necessary for eradication (95% and control (90% in many municipalities in the State of Santa Catarina, Brazil, both before and during the last epidemic in 1997, particularly regarding the second dose of the vaccine, applied as a component of the MMR vaccine, scheduled at 15 months of age. Low vaccine coverage was associated with higher measles incidence. However, during the 1997 epidemic small-scale measles outbreaks were recorded even in municipalities with first-dose coverage of 95% or higher, particularly among those which also had low second-dose coverage for MMR

NDA 2000 -- A modern, networked laboratory

International Nuclear Information System (INIS)

Thompson, K.A.; Ceo, R.N.

1996-01-01

As part of the modernization process, the Nondestructive Analysis (NDA) laboratory at Oak Ridge is undergoing changes to increase reliability, incorporate new analytical techniques, and improve quality assurance. The data system has been decentralized into a network, allowing any instrument to be controlled from any client, even remotely for trouble shooting purposes. By making the computers interchangeable, reliability increases. The software has been redesigned to function on a network, and incorporates several improvements to enhance accuracy and include quality assurance. The emphasis of this paper is directed at the actual hardware and software to integrate NDA 2000. Another paper (Reference 1) by the same authors presented at this symposium gives more details concerning new analytical and QA techniques

Incidence of leukemias in children from El Salvador and Mexico City between 1996 and 2000: Population-based data

OpenAIRE

Mejía-Aranguré, Juan Manuel; Bonilla, Miguel; Lorenzana, Rodolpho; Juárez-Ocaña, Servando; de Reyes, Gladys; Pérez-Saldivar, María Luisa; González-Miranda, Guadalupe; Bernáldez-Ríos, Roberto; Ortiz-Fernández, Antonio; Ortega-Alvarez, Manuel; Martínez-García, María del Carmen; Fajardo-Gutiérrez, Arturo

2005-01-01

Abstract Background There are very few studies that report the incidence of acute leukemias in children in Latin America. This work assesses the incidence of acute leukemias, between 1996 and 2000, in children from 0–14 years old who were attended at the Mexican Social Security Institute in Mexico City and in children from 0–11 years old in El Salvador. Methods Design: Population-based data. Hospitals: In San Salvador, El Salvador, Hospital Nacional de Niños "Benjamín Bloom", the only center ...

Monitoring vegetation change in Abu Dhabi Emirate from 1996 to 2000 and 2004 using Landsat Satellite Imagery

International Nuclear Information System (INIS)

Starbuck, M.J.; Tamayo, J.

2007-01-01

In the fall of 2001, a study was initiated to investigate vegetation changes in the Abu Dhabi Emirates. The vast majority of vegetation present in the region is irrigated and analysis of vegetation change will support groundwater investigations in the region by indicating areas of increased water use. Satellite-based imaging systems provide a good source of data for such an analysis. The recent analysis was completed between February and November 2002 using Landsat 5 Thematic Mapper satellite imagery acquired in 1996 and Landsat 7 Enhanced Thematic Mapper Plus imagery acquired in 2000. These assessments were augmented in 2004with the study of Landsat 7 imagery acquired in early 2004. The total area of vegetation for each of seven study areas was calculated using the Normalized Difference Vegetation Index (NDVI) technique. Multiband image classification was used to differentiate general vegetation types. Change analysis consisted of simple NDVI image differencing and post-classification change matrices. Measurements of total vegetation are for the Abu Dhabi Emirate indicate an increase from 77,200 hectares in 1996 to 162,700 hectares in 2000 (110% increase). Based on comparison with manual interpretation of satellite imagery, the amount of under-reporting of irrigated land is estimated at about 15% of the actual area. From the assessment of 2004 Landset imagery, it was found that the growth of irrigated vegetation in most areas of Emirate had stabilized and had actually slightly decreased in some cases. The decreases are probably due to variability in the measurement technique and not due to actual decreases in area of vegetation. (author)

Efficient JPEG 2000 Image Compression Scheme for Multihop Wireless Networks

Directory of Open Access Journals (Sweden)

Halim Sghaier

2011-08-01

Full Text Available When using wireless sensor networks for real-time data transmission, some critical points should be considered. Restricted computational power, reduced memory, narrow bandwidth and energy supplied present strong limits in sensor nodes. Therefore, maximizing network lifetime and minimizing energy consumption are always optimization goals. To overcome the computation and energy limitation of individual sensor nodes during image transmission, an energy efficient image transport scheme is proposed, taking advantage of JPEG2000 still image compression standard using MATLAB and C from Jasper. JPEG2000 provides a practical set of features, not necessarily available in the previous standards. These features were achieved using techniques: the discrete wavelet transform (DWT, and embedded block coding with optimized truncation (EBCOT. Performance of the proposed image transport scheme is investigated with respect to image quality and energy consumption. Simulation results are presented and show that the proposed scheme optimizes network lifetime and reduces significantly the amount of required memory by analyzing the functional influence of each parameter of this distributed image compression algorithm.

Morbilidad por intoxicaciones agudas en el Hospital Pediátrico de Cienfuegos durante el quinquenio 1996-2000 Morbidity from acute poisonings at the Pediatric Hospital of Cienfuegos from 1996 to 2000

Directory of Open Access Journals (Sweden)

Antonio Masot Rangel

2004-09-01

Full Text Available Se realizó un estudio descriptivo, retrospectivo, tipo serie de casos, sobre los pacientes menores de 15 años egresados del Hospital Pediátrico de Cienfuegos, con el diagnóstico de intoxicación aguda, con el objetivo de determinar el comportamiento de algunas variables clínicas y epidemiológicas. El universo de estudio lo conformaron los 609 pacientes egresados con este diagnóstico durante el quinquenio 1996-2000. En todos los casos fueron analizadas las siguientes variables: edad, sexo, origen de la intoxicación, lugar de ocurrencia, agente etiológico, vía de entrada, nivel de atención donde recibió primera asistencia médica y complicaciones; obtenidas de las historias clínicas. El 53 % de las intoxicaciones agudas ocurrió en las edades comprendidas hasta 4 años; en este grupo, el 58,2 % perteneció al sexo masculino, mientras que a partir de los 10 años se observó un franco predominio del sexo femenino (78,3 %. Las intoxicaciones accidentales ocurrieron en el 77,8 % del total de pacientes, pero a partir de los 10 años predominó el origen intencional (67,3 %, resultados que fueron estadísticamente significativos. Se comprobó relación entre la edad de la intoxicación, el sexo y el origen intencional o accidental del evento, en la población estudiada.A descriptive, retrospective and serial study was conducted among patients under 15 discharged from the Pediatric Hospital of Cienfuegos with the diagnosis of acute poisoning aimed at determining the behavior of some clinical and epidemiological variables. The sample was composed of 609 patients discharged with this diagnosis from 1996 to 2000. The following variables were taken from the medical histories and analized in all cases: age, sex, origin of the poisoning, place of occurrence, etiological agent, route, level of medical attention received and complications. 53 % of the acute poisonings took place at ages up to 4 years old. In this group, 58.2 % were males. Among

Voto estructural, racional y mediatizado en las elecciones generales españolas de 1996, 2000 y 2004

Directory of Open Access Journals (Sweden)

González, Juan Jesús

2009-08-01

Full Text Available The article presents three voting models that attempt to explain what is specific about each of the last three general elections held in Spain. Thus, a structural model is proposed for the 1996 elections, a rational-economic model for the elections in 2000, and a mediatized model to explain the mechanisms that intervened in the 2004 elections. The article then presents a voting model that attempts to integrate the main conclusions drawn from each of the previous models. Special emphasis is placed on the communicational mechanisms of the last elections (2004, underlining the influence of the media in attributing responsibility, the issue according to which voters evaluate public policy. Simultaneously, attention is called to the active role of the audiences in selecting the messages that are coherent with their personal experience and their cultural pattern.

El artículo presenta tres modelos de voto que pretenden explicar aquello que cada una de las tres últimas elecciones generales celebradas en España tiene de específico. Así, se propone un modelo estructural para las elecciones de 1996, un modelo racional-económico para las elecciones de 2000 y un modelo mediatizado para explicar los mecanismos que intervinieron en las elecciones de 2004. El artículo presenta por último un modelo de voto que pretende integrar las principales conclusiones extraídas de cada uno de los modelos anteriores. Se hace especial énfasis en los mecanismos comunicativos de las últimas elecciones (2004, subrayando la influencia de los medios sobre la atribución de responsabilidad en virtud de la cual los votantes evalúan las políticas públicas, al tiempo que se llama la atención sobre el papel activo de las audiencias a la hora de seleccionar aquellos mensajes que son coherentes con su experiencia personal y con su patrón cultural.

Landelijk Meetnet Bodemkwaliteit; Resultaten 1996

NARCIS (Netherlands)

Groot MSM; Bronswijk JJB; Leeuwen TC van; LEI-DLO; LBG

2001-01-01

This report contains the results of the National Soil Monitoring Network of the Netherlands in 1996, the fourth year of sampling. The network represents the cooperative effort of the National Institute of Public Health and the Environment (RIVM), the Agriculture Economics Research Institute

Activities of the International Radio Medical Centre (C.I.R.M.) in Rome during the last five years (1996-2000). Centro Internazionale Radio Medico.

Science.gov (United States)

Amenta, F; Dauri, A

2001-01-01

This paper reviews medical activity provided from 1996 to 2000 by the International Radio Medical Centre (Centro Internazionale Radio Medico, C.I.R.M.). C.I.R.M. is a non-profit organization headquartered in Rome and providing freely telemedical advice to ships flying of any flag navigating on all seas of the world, to civil airplanes and to small Italian islands. From 1996 to 2000 C.I.R.M. has assisted 4,982 patients, 4,686 of which (94%) on board ships, 85 on airplanes and 206 on small Italian islands. More than 65% of requests of telemedical advice received by C.I.R.M. were from non-Italian ships. This indicates the really international nature of C.I.R.M.'s activity. The largest number of medical requests come from the Atlantic Ocean, followed by the Mediterranean sea, Indian Ocean and Pacific Ocean. In terms of pathologies assisted, accidents took the first place, followed as main pathologies by gastrointestinal disorders, cardiovascular pathologies, respiratory disorders, infectious and parasitic diseases and nervous system complaints. Analysis of the outcome of C.I.R.M.'s medical activity showed that more than 50% of patients assisted were recovered or improved while assisted by the Centre.

The multi-annual programme TWIN-2 'Use of Wind Energy in the Netherlands, part 2', 1996-2000

International Nuclear Information System (INIS)

Bouwmeester, H.

1997-11-01

The Dutch government would like to achieve a cleaner energy supply in the Netherlands. The target of the government is 10% saving of fossil fuels in 2020. How this can be realized is formulated in the Third White Paper on Energy Policy, published in December 1995. The use of renewable energy sources, including wind energy, plays an important part in this national policy. For the use of wind energy the government aims at a growth of the wind turbine capacity by an average of 100 MW per year, to be realized by installing wind turbines both on land and (in the longer term) offshore. This should result into a fuel saving of 33 PJ in 2007 and 45 PJ in 2020. To stimulate the use of wind energy Novem carried out the Use of Wind Energy in the Netherlands programme (TWIN) from 1991 to 1995. This programme has given a considerable impulse to the growth of wind turbine capacity in the Netherlands. Market parties have been able to complete around 250 MW up to 1996. The programme has unfortunately not resulted in an autonomous market, so the government has ordered the implementation of the TWIN-2 follow-up programme. This follow-up programme runs from 1996 to 2000 and provides a framework for the operations which Novem will be carrying out over this period in the field of wind energy. In this brochure the main elements of the programme are outlined

Dinámica poblacional de los estadios inmaduros del vector del dengue Aedes aegypti (Diptera: Culicidae: un estudio longitudinal (1996-2000

Directory of Open Access Journals (Sweden)

María V Micieli

2006-09-01

Full Text Available Se realizó un estudio de la variación estacional de una población de estadios inmaduros de A. aegypti en La Plata, Argentina, durante cuatro años. Se colocaron 36 recipientes plásticos con 700 ml de agua declorinada y se agregó, en cada uno, una tira de papel de filtro rodeando el perímetro interno como sitio para la ovipostura. Los huevos, larvas y pupas se cuantificaron semanalmente desde septiembre de 1996 hasta agosto de 2000. Tras cuantificar el número de huevos, los papeles fueron sumergidos en cada recipiente para facilitar la eclosión y se agregó un nuevo papel. La presencia de estados inmaduros de A. aegypti fue registrada desde diciembre-enero hasta junio durante los cuatro años de estudio. En 1997 se registraron 13 105 huevos, 7 978 larvas y 1 476 pupas con un 54.7 % de recipientes positivos; en 1998, 8 194 huevos, 668 larvas y 142 pupas y un 28.3 % de recipientes positivos para este mosquito. En 1999 se obtuvieron 13 510 huevos, 3 690 larvas y 743 pupas y un 56.7 % de recipientes con A. aegypti. Para el año 2000 se registraron 16 327 huevos, 4 669 larvas y 715 pupas y un porcentaje de recipientes positivos de 59.3 %. El número de huevos y el porcentaje de eclosión se redujo drásticamente en 1998 donde las temperaturas durante el período diciembre-mayo fueron entre uno y 2.5 ºC más bajas que durante los otros tres años de estudio. Estas temperaturas menores fueron consecuencia del fenómeno climático corriente El Niño.Population dynamics of the immature stages of Aedes aegypti (Diptera: Culicidae, vector of dengue: a longitudinal study (1996-2000. A four year study was conducted on a natural population of immature stages of Aedes aegypti after the re-invasion of Argentina by this vector in 1987. Thirty six plastic containers with 700 ml of dechlorinated water were placed in the La Plata Zoological Garden, La Plata, Argentina. A strip of filter paper around each container was added to facilitate egg counting. Eggs

The Deep Space Network information system in the year 2000

Science.gov (United States)

Markley, R. W.; Beswick, C. A.

1992-01-01

The Deep Space Network (DSN), the largest, most sensitive scientific communications and radio navigation network in the world, is considered. Focus is made on the telemetry processing, monitor and control, and ground data transport architectures of the DSN ground information system envisioned for the year 2000. The telemetry architecture will be unified from the front-end area to the end user. It will provide highly automated monitor and control of the DSN, automated configuration of support activities, and a vastly improved human interface. Automated decision support systems will be in place for DSN resource management, performance analysis, fault diagnosis, and contingency management.

Sea floor topography and backscatter intensity of the Historic Area Remediation Site (HARS), offshore of New York, based on multibeam surveys conducted in 1996, 1998, and 2000

Science.gov (United States)

Butman, Bradford; Danforth, W.W.; Knowles, S.C.; May, Brian; Serrett, Laurie

2000-01-01

An area offshore of Sandy Hook, New Jersey, has been used extensively for disposal of dredged and other materials, derived from the New York/New Jersey Harbor and surrounding areas, since the late 1800's (Figure 1). Between 1976 and 1995, the New York Bight Dredged Material Disposal Site, also known as the Mud Dump Site (Figure 2), received on average about 6 million cubic yards of material each year from federal and private maintenance dredging and from harbor deepening activities (Massa and others, 1996). In September 1997 the Mud Dump Site (MDS) was closed as an official ocean disposal site by the U.S. Environmental Protection Agency (http://www.epa.gov/), and the MDS and surrounding areas were designated as the Historic Area Remediation Site (HARS). The HARS is subdivided into a Primary Remediation Area (PRA, subdivided into 9 cells), a Buffer Zone, and a No-Discharge Zone (Figure 2). The sea floor of the HARS, approximately 9 square nautical miles in area, is being remediated by placing at least a one-meter cap of Category I (clean) dredged material on top of the existing surface sediments that exhibit varying degrees of degradation. (See http://www.nan.usace.army.mil/business/prjlinks/dmmp/benefic/hars.htm)(Category I sediments have no potential short or long-term impacts and are acceptable for unrestricted ocean disposal (EPA, 1996)). About 1.1 million cubic yards of dredged material for remediation was placed in the HARS in 1999, and 2.5 million cubic yards in 2000. Three multibeam echosounder surveys were carried out to map the topography and surficial geology of the HARS. The surveys were conducted November 23 - December 3, 1996, October 26 - November 11, 1998, and April 6 - 30, 2000. The surveys were carried out as part of a larger survey of the Hudson Shelf Valley and adjacent shelf (Butman and others, 1998, (http://pubs.usgs.gov/openfile/of98-616/). This report presents maps showing topography, shaded relief, and backscatter intensity (a measure of sea

An estimation of global solar p-mode frequencies from IRIS network data: 1989-1996

Science.gov (United States)

Serebryanskiy, A.; Ehgamberdiev, Sh.; Kholikov, Sh.; Fossat, E.; Gelly, B.; Schmider, F. X.; Grec, G.; Cacciani, A.; Palle, P. L.; Lazrek, M.; Hoeksema, J. T.

2001-06-01

The IRIS network has accumulated full disk helioseismological data since July 1989, i.e. a complete 11-year solar cycle. Since the last paper publishing a frequency list [A&A 317 (1997) L71], not only has the network acquired new data, but has also developed new co-operative programs with compatible instruments [Abstr. SOHO 6/GONG 98 Workshop (1998) 51], so that merging IRIS files with these co-operative program data sets has made possible the improvement of the overall duty cycle. This paper presents new estimations of low degree p-mode frequencies obtained from this IRIS++ data bank covering the period 1989-1996, as well as the variation of their main parameters along the total range of magnetic activity, from before the last maximum to the very minimum. A preliminary estimation of the peak profile asymmetries is also included.

Trends in author characteristics and diversity issues in the Journal of Marital and Family Therapy from 1990 to 2000.

Science.gov (United States)

Bailey, C Everett; Pryce, Julia; Walsh, Froma

2002-10-01

In this article, we present an analysis and comparison of published articles in the Journal of Marital and Family Therapy (JMFT) between 1990-1995 and 1996-2000. This study focused on trends in author gender, highest degree, and professional affiliation, and article content on issues of cultural and family diversity (race/ethnicity, class, religion/spirituality, gender, sexual orientation, and varied family forms). Key findings show a significant shift from 69% male first authors in 1990-1995 to equal gender representation in authorship for 1996-2000 articles, with a particular increase in female PhDs. Articles addressing diversity issues doubled from 15.6% of all 1990-1995 articles to 31% in 1996-2000. Of note, women authored 73% of the 1996-2000 articles on the wide range of diversity issues. Implications for the field are discussed.

Criminal liability of physicians and other health care professionals in Hungary (review of case law between 1996-2000).

Science.gov (United States)

Varga, T; Szabó, A; Dósa, A; Bartha, F

2006-12-01

The authors examine the criminal cases involving physicians and other health care workers between January 1996 and December 2000 inclusive. in Hungary. The data are based on the registry of the Criminal Prosecutor's Office. Altogether 94 cases were initiated in this period of time, the accused of the criminal proceeding was a registered nurse in 9 cases, an ambulance paramedic in 5 cases, a pharmacist in 3, and a physician in 77 cases. In cases where registered nurses were involved, the most common act was negligent change of medication or providing inadequate custody of a patient in need, pharmacists were also accused for negligent change of medicinal products. In case of ambulance assistants the most common violation of the professional rules was diagnostic failure or not responding to the call in time. As to physicians, mostly primary care physicians were accused (29%), usually for failing to examine the patient or for diagnostic error, obstetricians-gynecologists (17 %) and traumatologists (12 %) were also frequently accused.

Landelijk Meetnet Regenwatersamenstelling. Meetresultaten 1996

NARCIS (Netherlands)

Boschloo DJ; Stolk AP; LLO

1999-01-01

This report presents the results of the chemical composition measurements of precipitation in the Netherlands in 1996. Measurements were performed on 4-weekly samples obtained from the National Precipitation Chemistry Monitoring Network. Samples from 15 stations were analysed for main components and

The US nuclear reaction data network. Summary of the first meeting, March 13 ampersand 14 1996

International Nuclear Information System (INIS)

1996-03-01

The first meeting of the US Nuclear Reaction Data Network (USNRDN) was held at the Colorado School of Mines, March 13-14, 1996 chaired by F. Edward Cecil. The Agenda of the meeting is attached. The Network, its mission, products and services; related nuclear data and data networks, members, and organization are described in Attachment 1. The following progress reports from the members of the USNRDN were distributed prior to the meeting and are given as Attachment 2. (1) Measurements and Development of Analytic Techniques for Basic Nuclear Physics and Nuclear Applications; (2) Nuclear Reaction Data Activities at the National Nuclear Data Center; (3) Studies of nuclear reactions at very low energies; (4) Nuclear Reaction Data Activities, Nuclear Data Group; (5) Progress in Neutron Physics at Los Alamos - Experiments; (6) Nuclear Reaction Data Activities in Group T2; (7) Progress Report for the US Nuclear Reaction Data Network Meeting; (8) Nuclear Astrophysics Research Group (ORNL); (9) Progress Report from Ohio University; (10) Exciton Model Phenomenology; and (11) Progress Report for Coordination Meeting USNRDN

Evaluation of the sector network for the industry's system of analysis 1996-2002; Evaluering av bransjenettverket for industris analyseordning 1996-2002

Energy Technology Data Exchange (ETDEWEB)

Roenning, Anne; Modahl, Ingunn Saur

2005-07-01

Enova wanted to carry out an evaluation of the sector network for the industry's analysis arrangement 1996-2002. This evaluation considers the arrangement's results in relation to its purposes, and contains an assessment of its effects related to energy consumption and energy efficiency. The data is based on meeting with IFE (Institute for Energy Technology), a survey among the sector network's member companies, interviews with advisors, companies and IFE, a survey among the advisors, and reported data from companies to IFE's database of applications and final reports. The methodology for collection of data on energy saving is based on a direct method instead of an indirect method, originally planned. Based on this evaluation it is concluded that the sector network analysis arrangement or advisory service has been a success. The evaluation has revealed that the industry has gained knowledge about possibilities for a more efficient and environmentally-friendly energy consumption, i.e. an increased competency of action. Additionally, based on the feedback from the companies in the surveys, it was revealed that the companies after the participation in the analysis have carried out energy saving measures equal to 809 GWh. The target figure for the analysis arrangement was energy savings of 350 GWh before 2005 (ml)

Atlanta Centennial Olympic Games and Paralympic Games event study, 1996. Final report, July 1996--August 1996

Energy Technology Data Exchange (ETDEWEB)

Amodei, R.; Bard, E.; Brong, B.; Cahoon, F.; Jasper, K.

1998-11-01

The Atlanta metropolitan region was the location of one of the most ambitious Intelligent Transportation Systems (ITS) deployments in the United States. This deployment included several individual projects--a Central Transportation Management Center (TMC), six Traffic Control Centers (TCCs), one Transit Information Center (TIC), The Travel Information Showcase (TIS), and the extension of the Metropolitan Atlanta Rapid Transit Authority (MARTA) Rail network and the new high-occupancy vehicle (HOV) lanes on I-85 and I-75. The 1996 Atlanta Centennial Olympic Games and Paralympic Games created a focus for these projects. All of these systems were to be brought on-line in time for the Olympic Games. This report presents the findings of the 1996 Olympic and Paralympic Games Events Study--a compilation of findings of system performance, the benefits realized, and the lessons learned during their operations over the event period. The study assessed the performance of the various Travel Demand Management (TDM) plans employed for Olympic Games traffic management.

Outline of the safety research results, in the power reactor field, fiscal year 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-11-01

The Power Reactor and Nuclear Fuel Development Corporation (PNC) has promoted the safety research in fiscal year of 1996 according to the Fundamental Research on Safety Research (fiscal year 1996 to 2000) prepared on March, 1996. Here is described on the research results in fiscal year 1996, the first year of the 5 years programme, and whole outline of the fundamental research on safety research, on the power reactor field (whole problems on the new nuclear converter and the fast breeder reactor field and problems relating to the power reactor in the safety for earthquake and probability theoretical safety evaluation field). (G.K.)

Selection and network effects - Migration flows into OECD countries 1990-2000

DEFF Research Database (Denmark)

Pedersen, Peder J.; Pytlikova, Mariola; Smith, Nina

2008-01-01

This paper presents empirical evidence on immigration flows into the OECD countries during the period 1990-2000. Our results indicate that network effects are strong, but vary between different groups of welfare states and between countries according to the type of immigration policy being applie...... a major influence on the observed migration patterns until now. This may partly be explained by restrictive migration policies which may have dampened the potential selection effects....

The Persistence of Structural Inequality?: A Network Analysis of International Trade, 1965-2000

Science.gov (United States)

Mahutga, Matthew C.

2006-01-01

This article reports results from a network analysis of international trade from 1965 through 2000. It addresses the impact of changes associated with globalization and the "new international division of labor" (NIDL) on structural inequality in the world economy. To assess this impact, I ask three specific questions. (1) Do patterns of…

FY 2000 report on the results of the research study of environmental information network; 2000 nendo kankyo joho network ni kansuru chosa kenkyu hokokusho

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-03-01

Described herein are the FY 2000 results of the research study on environmental information network formation. The Internet is experiencing an explosive increase in volume of information distributed therethrough. This is accompanied by increased problems related to information searches, information exchange security and information-reliability guarantees. First in demand are excellent portal sites, and second are sites that can be relied on to responsibly provide information. Cooperation with the real world off the Net is of particular importance, because the operating organizations, e.g., sites, will lose their raison deter, unless they clarify their unique abilities and characteristics under the tendencies towards broadened bands and ubiquity. The public sector, on the other hand, is highly reliable, accumulates a large volume of information, and has high network capacity. It has various functions, e.g., supporting the activities pertaining to ISO standards, and promoting the activities, e.g., those for educational programs, interdisciplinary exchanges by researchers, and matching of various organizations. The international cooperation for environmental information needs construction and operation of the networks, and construction of the infrastructures in the developing countries. If information becomes more ubiquitous, a chaotic sea of information will result. NEDO is strongly obliged to serve as the beacon, because it has established a huge volume of environment-related technologies, information, and networks. (NEDO)

Year 2000 problem impact on nuclear power plants

International Nuclear Information System (INIS)

Mauck, J.L.

1998-01-01

US Nuclear Regulatory commission began consideration of Year 2000 problem in nuclear power plants in 1996. It was found that no Year 2000 problem exists in safety related (reactor protection) instrumentation and control systems. Other important but not safety related systems needed for safe operation are impacted, namely security, emergency response data collection, radiation monitoring and control, surveillance tracking, control of feedwater, control rods, turbine as well as externals (communication, parts supply)

Use of wind energy in the Netherlands, part 2. The multi-annual programme for wind energy 1996-2000 TWIN-2

International Nuclear Information System (INIS)

Bouwmeester, H.; De Jong, I.

1996-08-01

The Dutch government would like to achieve a cleaner energy supply in the Netherlands. The target of the government is 10% saving of fossil fuels in 2020. How this can be realized is formulated in the Third White Paper on Energy Policy, published in December 1995. The use of renewable energy sources, including wind energy, plays an important part in this national policy. For the use of wind energy the government aims at a growth of the wind turbine capacity by an average of 100 MW per year, to be realized by installing wind turbines both on land and (in the longer term) offshore. This should result into a fuel saving of 33 PJ in 2007 and 45 PJ in 2020. To stimulate the use of wind energy Novem carried out the Use of Wind Energy in the Netherlands programme (TWIN) from 1991 to 1995. This programme has given a considerable impulse to the growth of wind turbine capacity in the Netherlands. Market parties have been able to complete around 250 MW up to 1996. The programme has unfortunately not resulted in an autonomous market, so the government has ordered the implementation of the TWIN-2 follow-up programme. This follow-up programme runs from 1996 to 2000 and provides a framework for the operations which Novem will be carrying out over this period in the field of wind energy. In this brochure the main elements of the programme are outlined. Also a state-of-the-art is given since the end of 1995, as well as an overview of developments in the wind energy market, and the mission, aim and targets of the TWIN-2 programme. 12 refs

Birth interval and stunting in children under five years of age in Peru (1996-2014).

Science.gov (United States)

Sobrino, M; Gutiérrez, C; Alarcón, J; Dávila, M; Cunha, A J

2017-01-01

Examine the evolution of stunting in birth interval (BI), and associated factors from 1996 to 2014. Data were extracted from the National Demographic and Health Survey of Peru (DHS) for the years 1996, 2000, 2005, 2010 and 2014 on children birth (≤24 months vs. >24 months) and others sociodemographic variables. Crude and adjusted odds ratios with 95% confidence intervals were estimated in logistic regression for the effect of BI and other variables on stunting by each survey year. Between 1996 and 2014, stunting declined in both BI groups: ≤24 months: 35.8% to 21.8%; >24 months: 29.5% to 14.3%. BI was associated with stunting after adjustment for other variables in each survey except 2005. Of the other factors, sex, birth order (fourth child or more), maternal education and poverty were independently associated with stunting in all survey years. Residence in rural areas and in Amazon forest and highland regions was associated with stunting 1996 and 2000. Maternal age was not independently associated with stunting. While stunting showed a decreasing trend from 1996 to 2014, birth interval exceeding 24 months exerted a protective effect on stunting across the years surveyed. Poverty, low maternal education and high birth order were associated with stunting in all survey years. © 2016 John Wiley & Sons Ltd.

New Brunswick air quality monitoring results for the year 2000

International Nuclear Information System (INIS)

Hughes, R.

2002-01-01

Monitoring data for air quality in New Brunswick in 2000 is presented in this document. Designed for the general public, it summarizes the air quality results for 2000 and focuses on air quality assessment as it relates to existing air quality standards and objectives. The report also contains the long term trend data for representative sites. The New Brunswick Air Quality Regulation of the Clean Air Act specifies the air quality standards applicable for carbon monoxide, sulphur dioxide, hydrogen sulphide, nitrogen dioxide and total suspended particulate. The monitoring was conducted at 58 sites in 8 regional monitoring networks throughout the province. Thirteen additional sites were selected for the measurement of acid rain. Despite the fact that no standards were in effect in 2000 in New Brunswick for several substances, including inhalable particulate matter, ground-level ozone, volatile organic compounds, selected semi-volatile organic compounds, trace elements in particulate matter and mercury in air and precipitation, their levels were measured at some locations. The results indicate that emissions trends, variations in industrial output, changing process or emission control technologies, and weather conditions throughout the year explain most of the variations in results between regions. As a rule, compliance with standards is good. Acid rain continued to impact, especially in the southwestern districts of the province. Since 1996, the levels of mercury in precipitation has slightly declined. 39 refs., 43 figs

Perfil da mortalidade materna em maternidade pública de Teresina - PI, no Período de 1996 a 2000: uma Contribuição da Enfermagem Perfil de la Mortalidad Materna en la Maternidad Pública de Teresina - PI (Brasil, en el Periodo de 1996 a 2000: una Contribución de la Enfermería Maternal profile Mortality in a Public Maternity of Teresina - PI (Brazil, in the Period between 1996 and 2000: a Nursing Contribution

Directory of Open Access Journals (Sweden)

Francisca Maria do Nascimento

2007-09-01

Full Text Available Estudo quantitativo retrospectivo com objetivo de caracterizar o perfil da mortalidade materna em uma maternidade pública de Teresina-PI, no período de 1996 a 2000. O universo constou de 107 óbitos maternos, cujos instrumentos foram: prontuários, declarações dos óbitos, livro de registros e relatórios da enfermagem, coletados em setembro a dezembro de 2004 em formulário estruturado. Os dados relativos aos aspectos socioeconômicos e pessoais revelaram como procedência os Estados: Piauí (73, 33 da capital e 40 de outras cidades; Maranhão (33; e Pará (1. A maioria das mulheres era casada, tinha idade entre 20 e 30 anos, um a três filhos, ensino fundamental incompleto e era do lar. Os dados obstétricos na maioria revelaram a não-realização de seis consultas pré-natais, era a primeira gravidez, parto cesariano e admissão em estado grave. Destacaram-se como causas dos óbitos: infecções, hipertensão e hemorragias. Conclui-se que a mortalidade materna é problema grave, necessitando melhoria assistencial nos serviços de saúde.Estudio cuantitativo y retrospectivo, que objetivó caracterizar el perfil de la mortalidad materna de una maternidad pública en Teresina PI (Brasil, en el periodo de 1996 hasta 2000. El universo fue compuesto por 107 muertes maternas, cuyos instrumentos fueron: prontuarios, declaración de muertes, libros de registros y relatos de la enfermería, colectados en septiembre y diciembre de 2004 en formulario estructurado. Los datos relativos a los aspectos socioeconómico y personales revelaran como origen los Estados: Pará (01, Maranhão (33 y Piauí (73 de estos 33 de Teresina y 40 del interior. La mayoría de las mujeres era casada, tenía edad entre 20 y 30 años, de uno a tres niños, la educación básica incompleta, trabajadoras del hogar. Los datos de la obstetricia habían demostrado que la mayoría no realizaron seis consultas prenatales, estaban en el primer embarazo, parto cesariano y admitido

Pneumonia mortality trends in all Brazilian geographical regions between 1996 and 2012

Directory of Open Access Journals (Sweden)

Rosemeire de Olanda Ferraz

Full Text Available ABSTRACT Objective: To analyze the temporal trends in pneumonia mortality rates (standardized by age, using the 2010 population of Brazil as the standard in all Brazilian geographical regions between 1996 and 2012. Methods: This was an ecological time-series study examining secondary data from the Mortality Database maintained by the Information Technology Department of the Brazilian Unified Health Care System. Polynomial and joinpoint regression models, and corresponding 95% CIs, were used for trend analysis. Results: The pneumonia mortality rates in the South, Southeast, and Central-West showed a decreasing behavior until 2000, followed by increases, whereas, in the North and Northeast, they showed increasing trends virtually throughout the period studied. There was variation in annual percent change in pneumonia mortality rates in all regions except the North. The Central-West had the greatest decrease in annual percent change between 1996 and 2000, followed by an increase of the same magnitude until 2005. The 80 years and over age group was the one most influencing the trend behavior of pneumonia mortality rates in all regions. Conclusions: In general, pneumonia mortality trends reversed, with an important increase occurring in the years after 2000.

Web Technology Conferences Exhibition LEPFest 2000

CERN Multimedia

2000-01-01

1994 CERN,Geneva - First, VRML1994 NCSA,Chicago - Browsers, Mosaic1995 Fraunhofer Gesellschaft,Darmstadt - Java 1995 MIT,Boston - Security1996 INRIA Paris - SMEs;European Union1997 SLAC/Stanford University,California - Acces 1998 Southern Cross University, Australia - Internationalisation1999 University of Toronto,Toronto - XML, e-commerce2000 CWI,Amsterdam - Multimedia,SMIL2001 Universities of Hong Kong,Hong Kong2002 University of Hawaii,Hawaii

Revisão de 26 casos clínicos de duodeno-jejunite proximal em eqüinos (1996-2000

Directory of Open Access Journals (Sweden)

Fernandes Wilson Roberto

2003-01-01

Full Text Available Os dados de 26 eqüinos com duodeno-jejunite proximal (DJP, examinados no HOVET-FMVZ-USP entre dezembro de 1996 e novembro de 2000, foram revisados. Durante esse período, foram atendidos 1555 animais, dos quais 205 apresentavam distúrbios gastrintestinais (13,2%. Os casos de DJP representaram 1,7% do total de eqüinos atendidos. A idade, os achados clínico-laboratoriais e a evolução clínica foram comparados entre eqüinos sobreviventes (grupo 1 e eqüinos não sobreviventes (grupo 2. Vinte eqüinos (76,9% sobreviveram. Todos os animais foram submetidos exclusivamente a tratamento médico. A análise dos resultados foi feita através de comparação entre médias pelo teste t de Student com significância de 5%. Houve diferença significativa entre os dois grupos em relação aos seguintes parâmetros analisados: contagem total de leucócitos no sangue, creatinina sérica e freqüência cardíaca. A principal complicação nos animais recuperados foi laminite (30,8%.

The Challenges in New Tourist Destination Development within the Area of Ecological Network Natura 2000

Directory of Open Access Journals (Sweden)

Pavlović Duško

2016-12-01

Full Text Available Natura 2000 is often equated with protected areas where human activities are significantly limited or even excluded in order to preserve biodiversity. However, Natura 2000 is based on other settings. Most of the activities and projects in the Natura area can be carried out with the mitigation of possible negative impacts. Sometimes they need only minor adjustments. Proposals of major development projects or changes in land use should undergo the evaluation of acceptability for the ecological network. If the assessment is positive, the procedure will be allowed if it is in the Natura area. As such, the Natura 2000 can provide new opportunities for rural areas, for example through eco-tourism and recreation. The paper will provide a SWOT analysis of micro location of building a new transport route, which is aimed at the development of new tourist destinations in the protected area.

The main results of fulfilment in 1996 of the scientific part of the State programme of the Republic of Belarus for minimization and overcoming of the Chernobyl NPP accident consequences (1996-2000)

International Nuclear Information System (INIS)

Konoplya, E.F.

1997-01-01

In the publication are summarized the basic results of the researches executed in 1996 in the framework of the 'Scientific maintenance of the decision of problems of the Chernobyl NPP accident consequences' of the State program of Republic of Belarus for minimization and overcoming of the Chernobyl NPP accident consequences on 1996-2000 on the following directions: dose monitoring of the population, estimation and forecast of both collective irradiation dozes and risks of radiation induced diseases; development and optimization of a complex of measures for effective land use and decrease of radioactive contamination of agricultural production in order to reduce irradiation dozes of the population; development of complex technologies and means of decontamination, processing and burial of radioactive wastes; development of the measures for increase of radiation protection of the population of Belarus during of the reducing period after the Chernobyl accident; development of complex system of an estimation and decision-making on problems of radiation protection of the population living on contaminated territories; study of influence of radiological consequences of the Chernobyl accident on health of people, development of methods and means of diagnostics, treatment and preventive maintenance of diseases for various categories of the victims; development of effective methods of preventive maintenance and treatment of diseases of both mother and child in conditions of influence of the Chernobyl NPP accident consequences; study of genetic consequences caused by the Chernobyl accident and development of effectual measures of their prevention; creation of the effective both prophylactic means and food additives for treatment and rehabilitation of the persons having suffered after the Chernobyl accident; study of the radioisotopes behaviour dynamics in environment (air, water, ground), ecosystems and populated areas; optimization of the system of radiation ecological

The 1996 CFM results. Record natural gas sales figure in 1996

International Nuclear Information System (INIS)

Anon.

1997-01-01

The French Methane Company (CFM) provides about 20% of the French natural gas market with its pipes network. Its sales wined a new record in 1996 with 86 billions of kWh which corresponds to a 20% increase in two years. This growth reached 12% in the domestic sector with respect to 1995 and is explained by colder climatic conditions and to the efficient promotional policy of Gaz de France. In the industrial sector, a 10% growth is recorded due to the start up a new cogeneration installations in which CFM is considerably involved (short note). (J.S.)

THE PORTION OF AUTOLOGOUS BLOOD IN ORTHOPEDIC DEPARTMENT OF GENERAL HOSPITAL NOVA GORICA IN FIVE YEARS PERIOD (1996–2000

Directory of Open Access Journals (Sweden)

Janka Černe-Zavadlav

2002-04-01

Full Text Available Background. The presentation of autologous blood donation with analysis of used blood and the percentage of autologous blood on Orthopedic Department in the years 1996–2000.Methods. From card-index of autologous blood donors we analysed 363 preoperative autologous blood donations.We followed the number of doses in one patient and type of operating procedure.We analysed the usage of blood from transfusion issue protocols and the usage of postoperative autotransfusion from patient protocols.Results. 91% of all preoperative blood donations in our hospital in five years period were from Orthopedic Department. There were 280 operating procedures (hip and knee arthroplasty that needed blood transfusion. 196 of these (70% were included in preoperative blood donation programme. We collected 330 doses: 1 dose in 61 cases, 2 doses in 100, 3 doses in 34 and 4 doses in 1 case or 1.68 doses per patient. The relationship between used autologous and allogenic blood were 46 : 54 (doses or 38 : 62 (mL. Autologous blood represented 38% of all used blood on Orthopedic Department, only 11% of autologous blood were discarded.Conclusions. The program of preoperative blood donation is well organized on The Orthopedic Department of our Hospital. To our experience we make the most of profit of autotransfusion (to avoid risks of allogenic blood, optimal patient colaboration, low percentage of discarded blood with two predonated doses in combination with postoperative autotransfusion. Regard to The Law of Blood supply (may 2000 we are going to introduce this protocol of preoperative blood donation for all programed operating procedures in our Hospital, which need blood transfusion.

Energy storage systems program report for FY1996

Energy Technology Data Exchange (ETDEWEB)

Butler, P.C.

1997-05-01

Sandia National Laboratories, New Mexico, conducts the Energy Storage Systems Program, which is sponsored by the US Department of Energy`s Office of Utility Technologies. The goal of this program is to assist industry in developing cost-effective energy storage systems as a resource option by 2000. Sandia is responsible for the engineering analyses, contracted development, and testing of energy storage systems for stationary applications. This report details the technical achievements realized during fiscal year 1996.

ENFERMEDAD INVASORA POR HAEMOPHILUS INFLUENZAE ANTES Y DESPUÉS DE LA CAMPAÑA DE VACUNACIÓN EN LA POBLACIÓN INFANTIL DE LA COMUNIDAD VALENCIANA (1996-2000

Directory of Open Access Journals (Sweden)

Mercedes Goicoechea Sáez

2002-01-01

Full Text Available Fundamento: La introducción de la vacuna conjugada anti Haemophilus influenzae tipo b (Hib en niños ha provocado un llamativo descenso de la incidencia de la enfermedad por H. influenzae. El objetivo de este estudio es analizar las características más relevantes de la enfermedad invasora por H. influenzae en cuanto a la epidemiología, clínica, evolución y estado de vacunación de la población infantil de la Comunidad Valenciana en el periodo 1996-2000. Método: Los datos se recogen de las historias clínicas de los niños menores de 15 años que hayan presentado síntomas y signos clínicos sugestivos de enfermedad invasora con aislamiento de Haemophilus influenzae y/o que cumple con los criterios de definición de caso establecidos, atendidos en todos los hospitales públicos de la Comunidad Valenciana entre 1996 y 2000. La evolución de la incidencia se valoró mediante tasas de incidencia. La clínica y su evolución (secuelas y letalidad mediante la frecuencia y distribución por edad. Resultados: Se registraron un total de 36 casos de enfermedad invasora por Haemophilus influenzae. La tasa de incidencia en niños menores de 15 años pasó de 3,56/105 en 1996 a 1,07/105 en 1997 (coincidiendo con la campaña de vacunación y la posterior inclusión de la vacuna conjugada anti Hib en el Calendario de Vacunaciones Sistemáticas de la Comunidad Valenciana y 0,30/105 en 1998, situación que se sigue manteniendo en los años posteriores. El 53% de los casos se dan en menores de 18 meses. Tanto las secuelas como los fallecimientos se producen en la época anterior a la aplicación rutinaria de la vacuna conjugada. Ningún niño vacunado correctamente falleció. Se registraron 2 casos de H. influenzae tipo no b en niños vacunados. Conclusiones: La incidencia de la infección por Haemophilus influenzae tipo b disminuyó drásticamente desde el inicio de la vacunación sistemática de la población infantil.

Estimation of methane and nitrous oxide emission from animal production sector in Taiwan during 1990-2000

International Nuclear Information System (INIS)

Shangshyng Yang; Chungming Liu; Yenlan Liu

2003-01-01

To investigate the greenhouse gases emissions from the feeding and waste management of livestock and poultry, methane and nitrous oxide emissions were estimated from the local measurement and IPCC guidelines during 1990-2000 in Taiwan. Hog is the major livestock and is followed by goat and cattle, while chicken is the major poultry and is followed by duck and geese. Methane emission from enteric fermentation of livestock was 30.9 Gg in 1990, increased to 39.3 Gg in 1996, and then decreased gradually to 34.9 Gg in 2000. Methane emission from the waste management was 48.5 Gg in 1990, reached the peak value of 60.7 Gg in 1996, and then declined to 43.3 Gg in 2000. In the case of poultry, annual methane emission from enteric fermentation and waste management was 30.6-44.1 ton, and 8.7-13.2 Gg, respectively. Nitrous oxide emission from waste management of livestock was 0.78 ton in 1990, increased to 0.86 ton in 1996, and then decreased to 0.65 ton in 2000. Nitrous oxide emission from waste management of poultry was higher than that of livestock with 1.11 ton in 1990, 1.68 ton in 1999, and 1.65 ton in 2000. There is an urgent need to reduce methane emission from enteric fermentation and recover methane from anaerobic waste treatment for energy in livestock and poultry feeding in Taiwan. (Author)

Quarterly coal report, April 1996--June 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-11-01

This report provides information about U.S. coal production, distribution; exports, imports, prices, consumption, and stocks. Data on coke production is also provided. This report presents data for April 1996 thru June 1996.

Optimal JPWL Forward Error Correction Rate Allocation for Robust JPEG 2000 Images and Video Streaming over Mobile Ad Hoc Networks

Directory of Open Access Journals (Sweden)

Benoit Macq

2008-07-01

Full Text Available Based on the analysis of real mobile ad hoc network (MANET traces, we derive in this paper an optimal wireless JPEG 2000 compliant forward error correction (FEC rate allocation scheme for a robust streaming of images and videos over MANET. The packet-based proposed scheme has a low complexity and is compliant to JPWL, the 11th part of the JPEG 2000 standard. The effectiveness of the proposed method is evaluated using a wireless Motion JPEG 2000 client/server application; and the ability of the optimal scheme to guarantee quality of service (QoS to wireless clients is demonstrated.

Glacio-meteorological investigations on Vatnajökull, Iceland, summer 1996: an overview

NARCIS (Netherlands)

Oerlemans, J.; Björnsson, H.; Kuhn, M.; Obleitner, F.; Palsson, F.; Smeets, C.J.P.P.; Vugts, H.F.; Wolde, J. de

1999-01-01

We give an overview of a glacio-meteorological experiment carried out in the summer (melt season) of 1996 on the largest European ice cap, Vatnajökull, Iceland (area 8000 km2; altitude range: from sea level to about 2000 m). The main goal was to understand how the energy used in the melting of snow

Microsoft Windows 2000 Router Configuration Guide

National Research Council Canada - National Science Library

Richburg, Florence

2001-01-01

The purpose of this guide is to provide technical guidance to network administrators of small to medium size networks in the configuration and integration of Microsoft Windows 2000 Server Router features...

Infections after liver transplantation in adults: data from a university hospital in southern Brazil (1996-2000 Infecções em pacientes transplantados hepáticos adultos no Hospital de Clínicas de Porto Alegre, Rio Grande do Sul, Brasil, no período de 1996-2000

Directory of Open Access Journals (Sweden)

Mônica Vinhas de Souza

2007-06-01

Full Text Available BACKGROUND: Infections after liver transplantations are the most important cause of morbi-mortality. In this study, we assessed the main characteristics of these infections in a southern Brazilian university hospital. METHODS: We conducted a retrospective cohort with 55 patients who underwent orthotopic liver transplantation between 1996 and 2000 in the "Hospital de Clínicas de Porto Alegre", Porto Alegre, RS, Brazil, to characterize the infections that occurred in the group. RESULTS: One or more infections (average 2.10 were diagnosed in 47 patients, especially during the first month after transplantation. The most common were bacteremia, intra-abdominal infections and pneumonia, predominantly with bacteria, especially Staphylococcus sp (and particularly S. aureus and E. coli. The mortality rate attributed to infections was high: 17 cases of all deaths (total 27 deaths. Significant risk factors for infections included reoperation, diabetes, biliary stenosis and higher Child-Pugh scores. CONCLUSION: Infections remain a severe threat in liver transplant patients, and special efforts should be made to prevent and manage them correctly.RACIONAL: Infecções são a causa principal de morbimortalidade em pacientes submetidos a transplantes hepáticos. OBJETIVO: Avaliar as principais características destas infecções em pacientes de um hospital universitário do sul do Brasil. MÉTODO: Uma coorte retrospectiva foi conduzida com os 55 pacientes transplantados hepáticos adultos cuja cirurgia foi realizada entre 1996 e 2000 no Hospital de Clínicas de Porto Alegre, RS, todos aos eventos infecciosos que ocorreram nesta população foram registrados. RESULTADOS: Uma ou mais infecções (média 2,1 episódios foram diagnosticadas em 47 pacientes, o período de maior ocorrência destas foi o primeiro mês após a cirurgia. As infecções mais comuns foram: bacteremias, infecções intra-abdominais e pneumonias, a etiologia mais freqüente foi bacteriana

Overview of IAEA year 2000 activities in the Department of Safeguards

International Nuclear Information System (INIS)

Chitumbo, K.

1999-01-01

The IAEA Department of Safeguards established a project in 1996 for the year 2000 (Y2K) conversion activities. This project covered assessment, conversion and testing of the software applications, instrument evaluation software, embedded systems and Personal Computer (PC) hardware attached to various equipment. Significant progress has been made in converting the applications and instruments to be year 2000 compliant. At the same time Member states have made an effort as well in converting the systems used jointly at the facilities

The Fermilab Farms in 1996

International Nuclear Information System (INIS)

1997-05-01

The farms in 1996 began a period of transition. The old farms continue to be used but do not provide sufficient CPU power, memory, or network bandwidth for all of the tasks which are required. Therefore we have purchased and installed a substantial increment of new farms and are working on adding another increment during 1997. The purpose of all this activity is to provide computing for the fixed target run and for the other large computing users who cannot be accommodated on the other systems that are available at Fermilab

The monitoring network for radioactivity in air in Norway. Annual report 2000; Nettverket for overvaaking av radioaktivitet i luft i Norge

Energy Technology Data Exchange (ETDEWEB)

Berg, Thor Chr.

2002-06-01

On the instruction of the Radiation Monitoring Authority (SSV), NILU has assumed responsibility for the operation of a monitoring network for radioactivity. This report describes this network. None of the 29 stations of the network detected radiation in 2000 that cannot be attributed to the natural variation of the radiation levels or to normal technical irregularities. However, much of the equipment was acquired in the years following the Chernobyl accident of 1986 and is in need of replacement.

Annual suspended sediment and trace element fluxes in the Mississippi, Columbia, Colorado, and Rio Grande drainage basins

Science.gov (United States)

Horowitz, A.J.; Elrick, K.A.; Smith, J.J.

2001-01-01

Suspended sediment, sediment-associated, total trace element, phosphorus (P), and total organic carbon (TOC) fluxes were determined for the Mississippi, Columbia, Rio Grande, and Colorado Basins for the study period (the 1996, 1997, and 1998 water years) as part of the US Geological Survey's redesigned National Stream Quality Accounting Network (NASQAN) programme. The majority (??? 70%) of Cu, Zn, Cr, Ni, Ba, P, As, Fe, Mn, and Al are transported in association with suspended sediment; Sr transport seems dominated by the dissolved phase, whereas the transport of Li and TOC seems to be divided equally between both phases. Average dissolved trace element levels are markedly lower than reported during the original NASQAN programme; this seems due to the use of 'clean' sampling, processing, and analytical techniques rather than to improvements in water quality. Partitioning between sediment and water for Ag, Pb, Cd, Cr, Co, V, Be, As, Sb, Hg, and Ti could not be estimated due to a lack of detectable dissolved concentrations in most samples. Elevated suspended sediment-associated Zn levels were detected in the Ohio River Basin and elevated Hg levels were detected in the Tennessee River, the former may affect the mainstem Mississippi River, whereas the latter probably do not. Sediment-associated concentrations of Ag, Cu, Pb, Zn, Cd, Cr, Co, Ba, Mo, Sb, Hg, and Fe are markedly elevated in the upper Columbia Basin, and appear to be detectable (Zn, Cd) as far downstream as the middle of the basin. These elevated concentrations seem to result from mining and/or mining-related activities. Consistently detectable concentrations of dissolved Se were found only in the Colorado River Basin. Calculated average annual suspended sediment fluxes at the mouths of the Mississippi and Rio Grande Basins were below, whereas those for the Columbia and Colorado Basins were above previously published annual values. Downstream suspended sediment-associated and total trace element fluxes

Comparison of 1972 and 1996 water levels in the Goleta central ground-water subbasin, Santa Barbara County, California

Science.gov (United States)

Kaehler, Charles A.; Pratt, David A.; Paybins, Katherine S.

1997-01-01

Ground-water levels for 1996 were compared with 1972 water levels to determine if a "drought buffer" currently exists. The drought buffer was defined previously, in a litigated settlement involving the Goleta Water District, as the 1972 water level in the Central ground-water subbasin. To make this deter mination, a network of 15 well sites was selected, water levels were measured monthly from April through December 1996, and the 1996 water-level data were compared with1972 data. The study was done in cooperation with the Goleta Water District. The 1972-1996 water-level-altitude changes for corresponding months of the comparison years were averaged for each network well. These averaged changes ranged from a rise of 9.4 ft for well 2N2 to a decline of 45.0 ft for well 8K8. The results of the comparison indicate a rise in water level at 1 site (well 2N2) and a decline at 14 sites. The mean of the 14 negative average values was a decline of 24.0 ft. The altitude of the bottom of well 2N2 was higher than the bottom altitudes at the other network sites, and this well is located a few feet from a fault that acts as a hydrologic barrier. The results of the water-level comparison for the Central subbasin were influenced to some unknown degree by the areal distribution of the set of wells selected for the network and the vertical dis tribution of the perforated intervals of the wells. For this reason, the mean water-level change--a decline of 21.8 ft--calculated from the averages of the month-to-month changes for the 15 network sites, should be used with caution. In addition, the number of usable individual monthly comparison measurements available for an individual site ranged from one to nine, and averaged six. Therefore, a weighted mean of the monthly averages was calculated on the basis of the number of comparison measurements available for each site. The weighted mean is a decline of 20.9 ft. All Central subbasin wells that were idle (that is, were not being pumped

The implementing evaluation of the Law on the air and the rational use of the energy of the 30 december 1996; L'evaluation de la mise en oeuvre de la loi sur l'air et l'utilisation rationnelle de l'energie du 30 decembre 1996

Energy Technology Data Exchange (ETDEWEB)

Bernard, J F [Conseil national de l' air, 75 - Paris (France)

2001-12-01

This documents aims to evaluate the environmental policy implemented since 1996, by the definition of the Law of the 30 december 1996. The first chapter presents the atmospheric pollution effects on the health, the ecosystems and the buildings, and the installations of the air pollution monitoring to show the necessity of a regulatory action, detailed in chapter two. The third chapter takes stock on the air pollution in France since 1996 to 2000 to propose in chapter four actions for the olfactive nuisances, the rational energy use and the renewable energies and the other pollutant sources than the transport. (A.L.B.)

Bioenergy research programme. Yearbook 1996. Utilization of bioenergy and biomass conversion; Bioenergian tutkimusohjelma. Vuosikirja 1996. Bioenergian kaeyttoe ja biomassan jalostus

Energy Technology Data Exchange (ETDEWEB)

Nikku, P [ed.

1997-12-01

The aim of the programme is to increase the use of economically profitable and environmentally sound bioenergy by improving the competitiveness of present peat and wood fuels. Research and development projects will also develop new economically competitive biofuels, new equipment and methods for production, handling and utilisation of biofuels. The total funding for 1996 was 27.3 million FIM and the number of projects 63. The number of projects concerning bioenergy use was 10 and biomass conversion 6. Results of the projects carried out in 1996 are presented in this publication. The aim of the bioenergy use is to develop and demonstrate at least 3-4 new equipment or methods for handling and use of biofuels. The equipment and/or methods should provide economically competitive and environmentally sound energy production. The second aim is to demonstrate 2-3 large-scale biofuel end-use technologies. Each of these should have a potential of 0.2- 0.3 million toe/a till the year 2000. The aims have been achieved in the field of fuel handling technologies and small-scale combustion concepts, but large-scale demonstration projects before the year 2000 seems to be a very challenging aim. The aim of the biomass conversion is to produce basic information on biomass conversion, to evaluate the quality of products, their usability, environmental effects of use as well as the total economy of the production. The objective of biomass conversion is to develop 2-3 new methods, which could be demonstrated, for the production and utilisation of liquefied, gasified and other converted biofuels. The production target is 0.2-0.3 million toe/a by the year 2000 at a competitive price level. The studies focused on the development of flash pyrolysis technology for biomass, and on the study of storage stability of imported wood oils and of their suitability for use in oil-fired boilers and diesel power plants

A Network Analysis of Social Balance in Conflict in the Maghreb

Science.gov (United States)

2013-03-01

relationships from Table 6 shown in graph form. Graph by author using Pajek ( Batagelj & Mrvar , 1996 ...author using Pajek ( Batagelj & Mrvar , 1996 )................................................................................................ 4-17 Figure...negative and black is positive. By author using Pajek ( Batagelj & Mrvar , 1996 ). ..... 4-21 Figure 23: Network Graph of 10 Actor Network (Post-French

International network non-energy use and CO2 emissions (NEU-CO2). An activity within the European Commission's ENRICH programme, DG RTD, 'Environment and Climate'. Final report of the first phase of the network (January 1999 - June 2000)

International Nuclear Information System (INIS)

Patel, M.; Gielen, D.; Kilde, N.; Simmons, T.

2000-07-01

This report concludes the first phase of the NEU-CO 2 network, covering the period from January 1999 to June 2000. Within this period, two workshops were held, one in Paris in September 1999 and the other in Brussels in April 2000. The results of these workshops represent the basis of this report. The workshop papers have also been compiled in workshop proceedings which are publicly available. Due to the success of the NEU-CO 2 network, the partners decided to apply for the continuation of this activity which was recently accepted by the European Commission. The second phase of the of the NEU-CO 2 network will start in Fall 2000 and will continue for 18 months. This will allow the NEU-CO 2 network to improve the methods applied, to close data gaps, to check the preliminary conclusions given in this report and to provide consolidated results and recommendations by mid 2002. The ultimate goal of the NEU-CO 2 network is to contribute to an improvement of the IPCC guidelines in the area of non-energy use and to provide inventorists with tools and methods to estimate more accurately non-energy CO 2 emissions. (orig.)

Evaluation 2000 and regulation and method. Release monitoring and environmental surveillance around Cea centers; Bilan 2000 et reglementation et methode. Controle des rejets et surveillance de l'environnement des centres CEA

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-06-01

This publication counts for the year 2000 for the evaluation of liquid and gaseous radioactive effluents releases and the radioactivity levels measured in the vicinity of Cea centers, through the air, water, vegetation and milk surveillance. An analysis of the results from 1996 to 2000 allows to follow their evolution. A second booklet develops the sampling and measurement methods made on effluents in environment. It present besides the regulation applied to effluents monitoring. (N.C.)

Evaluation 2000 and regulation and method. Release monitoring and environmental surveillance around Cea centers

International Nuclear Information System (INIS)

2001-06-01

This publication counts for the year 2000 for the evaluation of liquid and gaseous radioactive effluents releases and the radioactivity levels measured in the vicinity of Cea centers, through the air, water, vegetation and milk surveillance. An analysis of the results from 1996 to 2000 allows to follow their evolution. A second booklet develops the sampling and measurement methods made on effluents in environment. It present besides the regulation applied to effluents monitoring. (N.C.)

Chlamydia positivity in New Orleans public high schools, 1996-2005: implications for clinical and public health practices.

Science.gov (United States)

Nsuami, M Jacques; Nsa, Musheni; Brennan, Christine; Cammarata, Catherine L; Martin, David H; Taylor, Stephanie N

2013-01-01

To describe the trends in chlamydia positivity among New Orleans high school students tested in a schoolwide screening between 1996 and 2005, and to determine factors associated with chlamydia positivity among students during the 10-year period. Between school years 1995-1996 and 2004-2005, students in New Orleans public high schools were tested for chlamydia using nucleic acid amplification tests (NAAT) in urine specimens (LCx assay until 1999-2000; BD assay from 2000-2001 to 2004-2005). For each year, we calculated chlamydia positivity by dividing the number of students testing positive by the total number of students tested. Data were analyzed separately by gender. Logistic regressions were performed to determine independent predictors of chlamydia positivity during the 10-year period. Between 1996 and 2005, the average chlamydia positivity was 7.0% (95% confidence interval 6.6-7.4) in boys and 13.1% (95% confidence interval 12.6-13.7) in girls (P New Orleans school-age adolescent population. Any benefit of screening on individuals tested was likely to be mitigated by participants' uninterrupted social interactions with the dynamic forces that sustain the sexual transmission of chlamydia in the population. Copyright © 2013 Academic Pediatric Association. Published by Elsevier Inc. All rights reserved.

The implementing evaluation of the Law on the air and the rational use of the energy of the 30 december 1996; L'evaluation de la mise en oeuvre de la loi sur l'air et l'utilisation rationnelle de l'energie du 30 decembre 1996

Energy Technology Data Exchange (ETDEWEB)

Bernard, J.F. [Conseil national de l' air, 75 - Paris (France)

2001-12-01

This documents aims to evaluate the environmental policy implemented since 1996, by the definition of the Law of the 30 december 1996. The first chapter presents the atmospheric pollution effects on the health, the ecosystems and the buildings, and the installations of the air pollution monitoring to show the necessity of a regulatory action, detailed in chapter two. The third chapter takes stock on the air pollution in France since 1996 to 2000 to propose in chapter four actions for the olfactive nuisances, the rational energy use and the renewable energies and the other pollutant sources than the transport. (A.L.B.)

Enfermedad invasora por Haemophilus Influenzae antes y después de la campaña de vacunación en la población infantil de la Comunidad Valenciana (1996-2000

Directory of Open Access Journals (Sweden)

Goicoechea Sáez Mercedes

2002-01-01

Full Text Available Fundamento: La introducción de la vacuna conjugada anti Haemophilus influenzae tipo b (Hib en niños ha provocado un llamativo descenso de la incidencia de la enfermedad por H. influenzae. El objetivo de este estudio es analizar las características más relevantes de la enfermedad invasora por H. influenzae en cuanto a la epidemiología, clínica, evolución y estado de vacunación de la población infantil de la Comunidad Valenciana en el periodo 1996-2000. Método: Los datos se recogen de las historias clínicas de los niños menores de 15 años que hayan presentado síntomas y signos clínicos sugestivos de enfermedad invasora con aislamiento de Haemophilus influenzae y/o que cumple con los criterios de definición de caso establecidos, atendidos en todos los hospitales públicos de la Comunidad Valenciana entre 1996 y 2000. La evolución de la incidencia se valoró mediante tasas de incidencia. La clínica y su evolución (secuelas y letalidad mediante la frecuencia y distribución por edad. Resultados: Se registraron un total de 36 casos de enfermedad invasora por Haemophilus influenzae. La tasa de incidencia en niños menores de 15 años pasó de 3,56/10(5 en 1996 a 1,07/10(5 en 1997 (coincidiendo con la campaña de vacunación y la posterior inclusión de la vacuna conjugada anti Hib en el Calendario de Vacunaciones Sistemáticas de la Comunidad Valenciana y 0,30/10(5 en 1998, situación que se sigue manteniendo en los años posteriores. El 53% de los casos se dan en menores de 18 meses. Tanto las secuelas como los fallecimientos se producen en la época anterior a la aplicación rutinaria de la vacuna conjugada. Ningún niño vacunado correctamente falleció. Se registraron 2 casos de H. influenzae tipo no b en niños vacunados. Conclusiones: La incidencia de la infección por Haemophilus influenzae tipo b disminuyó drásticamente desde el inicio de la vacunación sistemática de la población infantil.

Scientific authorship and collaboration network analysis on malaria research in Benin: papers indexed in the web of science (1996-2016).

Science.gov (United States)

Azondekon, Roseric; Harper, Zachary James; Agossa, Fiacre Rodrigue; Welzig, Charles Michael; McRoy, Susan

2018-01-01

To sustain the critical progress made, prioritization and a multidisciplinary approach to malaria research remain important to the national malaria control program in Benin. To document the structure of the malaria collaborative research in Benin, we analyze authorship of the scientific documents published on malaria from Benin. We collected bibliographic data from the Web Of Science on malaria research in Benin from January 1996 to December 2016. From the collected data, a mulitigraph co-authorship network with authors representing vertices was generated. An edge was drawn between two authors when they co-author a paper. We computed vertex degree, betweenness, closeness, and eigenvectors among others to identify prolific authors. We further assess the weak points and how information flow in the network. Finally, we perform a hierarchical clustering analysis, and Monte-Carlo simulations. Overall, 427 publications were included in this study. The generated network contained 1792 authors and 116,388 parallel edges which converted in a weighted graph of 1792 vertices and 95,787 edges. Our results suggested that prolific authors with higher degrees tend to collaborate more. The hierarchical clustering revealed 23 clusters, seven of which form a giant component containing 94% of all the vertices in the network. This giant component has all the characteristics of a small-world network with a small shortest path distance between pairs of three, a diameter of 10 and a high clustering coefficient of 0.964. However, Monte-Carlo simulations suggested our observed network is an unusual type of small-world network. Sixteen vertices were identified as weak articulation points within the network. The malaria research collaboration network in Benin is a complex network that seems to display the characteristics of a small-world network. This research reveals the presence of closed research groups where collaborative research likely happens only between members. Interdisciplinary

Outline of results of safety research (in nuclear fuel cycle field in fiscal year 1996)

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-01

The safety research in Power Reactor and Nuclear Fuel Development Corporation in fiscal year 1996 has been carried out based on the basic plan of safety research (from fiscal year 1996 to 2000) which was decided in March, 1996. In this report, on nuclear fuel cycle field, namely all the subjects in the fields of nuclear fuel facilities, environmental radioactivity and waste disposal, and the subjects related to nuclear fuel facilities among the fields of aseismatic and probabilistic safety assessments, the results of research in fiscal year 1996, the first year of the 5-year project, are summarized together with the outline of the basic plan of safety research. The basic policy, objective and system for promotion of the safety research are described. The objectives of the safety research are the advancement of safety technology, the safety of facilities, stable operation techniques, the safety design and the evaluation techniques of next generation facilities, and the support of transferring nuclear fuel cycle to private businesses. The objects of the research are uranium enrichment, fuel fabrication and reprocessing, and waste treatment and storage. 52 investigation papers of the results of the safety research in nuclear fuel cycle field in fiscal year 1996 are collected in this report. (K.I.)

Uranium demand, supply and prices, 1991-2000: a report to Greenpeace

International Nuclear Information System (INIS)

O'Faircheallaigh, C.

1990-01-01

Taking account of recent developments in relation to existing nuclear power plants and applying realistic schedules to new developments, this study has calculated estimates of future nuclear power plant capacity which are slightly lower than other published forecasts for 1996, and significantly lower (by between 7 and 9 per cent) than other forecasts for 2000. This data was then used to calculate demand for newly-mined uranium in each year from 1991 to 2000. Detailed data relating to some 40 existing uranium mines and twenty planned projects to estimate supply during the same period, have also been analysed. Combining the estimates for supply and demand, the study forecasts a small shortfall in supply during 1991-1995. However, this shortfall can be covered by a slight reduction in the uranium stocks which will exist at that time and, on the basis of experience during recent years, it is unlikely to result in more than a modest increase in prices. Supply is expected to significantly exceed demand from 1996-1998, and to slightly exceed demand in 1999-2000. This is likely to exert downward pressure on uranium prices, keeping them close to their current low levels in real terms. This information is then used to gauge the economic prospects for development of new uranium mining capacity in Australia between now and the end of the century. 18 refs., 6 tabs

Tendência temporal da amamentação na cidade do Rio de Janeiro: 1996-2006 Tendencia temporal del amamantamiento en la ciudad de Rio de Janeiro, Brasil: 1996-2006 Time trend in breast-feeding in the city of Rio de Janeiro, Southeastern Brazil: 1996-2006

Directory of Open Access Journals (Sweden)

Inês Rugani Ribeiro de Castro

2009-12-01

Full Text Available OBJETIVO: Analisar a tendência temporal da prática de aleitamento materno (AM e de aleitamento materno exclusivo (AME. MÉTODOS: Foram analisados dados de sistema de monitoramento baseado em inquéritos realizados nos anos de 1996, 1998, 2000, 2003 e 2006 durante a Campanha Nacional de Imunização na cidade do Rio de Janeiro, RJ. A população de estudo foi constituída de 19.044 crianças menores de um ano de idade que compareceram aos postos de vacinação. Para cada ano foi estudada uma amostra probabilística por conglomerado (postos de vacinação, auto-ponderada representativa da população de crianças menores de 12 meses (6 e em AMEOBJETIVO: Analizar la tendencia temporal de la práctica del amamantamiento materno (AM y del amamantamiento materno exclusivo (AME. MÉTODOS: Fueron analizados datos del sistema de monitoreo con base en pesquisas realizadas en los años de 1996, 1998, 2000, 2003 y 2006 durante la Campaña Nacional de Inmunización en la ciudad de Rio de Janeiro, Sureste de Brasil. La población de estudio fue constituida por 19.044 niños menores de un año de edad que asistieron a los puestos de vacunación. Para cada año fue estudiada una muestra probabilística por conglomerado (puestos de vacunación, autoponderada representativa de la población de niños menores de 12 meses (6 y en AMEOBJECTIVE: To analyze time trend in breast-feeding (BF and exclusive breast-feeding (EBF. METHODS: Data from a monitoring system, based on surveys conducted during the National Immunization Campaign in the city of Rio de Janeiro, Southeastern Brazil, in 1996, 1998, 2000, 2003 and 2006, were analyzed. Study population was comprised of 19,044 children younger than one year of age, who were present in vaccination stations. A probability cluster sample (vaccination stations, self-weighted and representative of the population of children younger than 12 months of age (6 and EBF<6 were found in all categories of all maternal

Global sulfur emissions from 1850 to 2000.

Science.gov (United States)

Stern, David I

2005-01-01

The ASL database provides continuous time-series of sulfur emissions for most countries in the World from 1850 to 1990, but academic and official estimates for the 1990s either do not cover all years or countries. This paper develops continuous time series of sulfur emissions by country for the period 1850-2000 with a particular focus on developments in the 1990s. Global estimates for 1996-2000 are the first that are based on actual observed data. Raw estimates are obtained in two ways. For countries and years with existing published data I compile and integrate that data. Previously published data covers the majority of emissions and almost all countries have published emissions for at least 1995. For the remaining countries and for missing years for countries with some published data, I interpolate or extrapolate estimates using either an econometric emissions frontier model, an environmental Kuznets curve model, or a simple extrapolation, depending on the availability of data. Finally, I discuss the main movements in global and regional emissions in the 1990s and earlier decades and compare the results to other studies. Global emissions peaked in 1989 and declined rapidly thereafter. The locus of emissions shifted towards East and South Asia, but even this region peaked in 1996. My estimates for the 1990s show a much more rapid decline than other global studies, reflecting the view that technological progress in reducing sulfur based pollution has been rapid and is beginning to diffuse worldwide.

Maternal mortality in Henan Province, China: changes between 1996 and 2009.

Directory of Open Access Journals (Sweden)

Fengzhi You

Full Text Available BACKGROUND: Maternal deaths occur mostly in developing countries and the majority of them are preventable. This study analyzes changes in maternal mortality and related causes in Henan Province, China, between 1996 and 2009, in an attempt to provide a reliable basis for introducing effective interventions to reduce the maternal mortality ratio (MMR, part of the fifth Millennium Development Goal. METHODS AND FINDINGS: This population-based maternal mortality survey in Henan Province was carried out from 1996 to 2009. Basic information was obtained from the health care network for women and children and the vital statistics system, from specially trained monitoring personnel in 25 selected monitoring sites and by household survey in each case of maternal death. This data was subsequently reported to the Henan Provincial Maternal and Child Healthcare Hospital. The total MMR in Henan Province declined by 78.4%, from 80.1 per 100 000 live births in 1996 to 17.3 per 100 000 live births in 2009. The decline was more pronounced in rural than in urban areas. The most common causes of maternal death during this period were obstetric hemorrhage (43.8%, pregnancy-induced hypertension (15.8%, amniotic fluid embolism (13.9% and heart disease (8.0%. The MMR was higher in rural areas with lower income, less education and poorer health care. CONCLUSION: There was a remarkable decrease in the MMR in Henan Province between 1996 and 2009 mainly in the rural areas and MMR due to direct obstetric causes such as obstetric hemorrhage. This study indicates that improving the health care network for women, training of obstetric staff at basic-level units, promoting maternal education, and increasing household income are important interventional strategies to reduce the MMR further.

Energy in 1996; L`energie en 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

Six charts are presented and discussed concerning energy utilization in France during the 1970-1996 period: national energy bill, energy intensity ratios, imported crude oil costs, energy-induced carbon dioxide emissions, operating ability ratios of EDF nuclear plants, France`s energy independence ratios. 1996 has seen an strong increase (+31%) in the energy bill, reaching 77 billions Francs, combining an increase in energy consumption and dollar exchange rate and a decline in energy conservation; carbon dioxide emission are taking up again after a strong decrease in the 80`s

Global Positioning System (GPS) survey of Augustine Volcano, Alaska, August 3-8, 2000: data processing, geodetic coordinates and comparison with prior geodetic surveys

Science.gov (United States)

Pauk, Benjamin A.; Power, John A.; Lisowski, Mike; Dzurisin, Daniel; Iwatsubo, Eugene Y.; Melbourne, Tim

2001-01-01

Between August 3 and 8,2000,the Alaska Volcano Observatory completed a Global Positioning System (GPS) survey at Augustine Volcano, Alaska. Augustine is a frequently active calcalkaline volcano located in the lower portion of Cook Inlet (fig. 1), with reported eruptions in 1812, 1882, 1909?, 1935, 1964, 1976, and 1986 (Miller et al., 1998). Geodetic measurements using electronic and optical surveying techniques (EDM and theodolite) were begun at Augustine Volcano in 1986. In 1988 and 1989, an island-wide trilateration network comprising 19 benchmarks was completed and measured in its entirety (Power and Iwatsubo, 1998). Partial GPS surveys of the Augustine Island geodetic network were completed in 1992 and 1995; however, neither of these surveys included all marks on the island.Additional GPS measurements of benchmarks A5 and A15 (fig. 2) were made during the summers of 1992, 1993, 1994, and 1996. The goals of the 2000 GPS survey were to:1) re-measure all existing benchmarks on Augustine Island using a homogeneous set of GPS equipment operated in a consistent manner, 2) add measurements at benchmarks on the western shore of Cook Inlet at distances of 15 to 25 km, 3) add measurements at an existing benchmark (BURR) on Augustine Island that was not previously surveyed, and 4) add additional marks in areas of the island thought to be actively deforming. The entire survey resulted in collection of GPS data at a total of 24 sites (fig. 1 and 2). In this report we describe the methods of GPS data collection and processing used at Augustine during the 2000 survey. We use this data to calculate coordinates and elevations for all 24 sites surveyed. Data from the 2000 survey is then compared toelectronic and optical measurements made in 1988 and 1989. This report also contains a general description of all marks surveyed in 2000 and photographs of all new marks established during the 2000 survey (Appendix A).

Statements of work for FY 1996 to 2001 for the Hanford Low-Level Tank Waste Performance Assessment Project

International Nuclear Information System (INIS)

Mann, F.M.

1995-01-01

The statements of work for each activity and task of the Hanford Low-Level Tank Waste Performance Assessment project are given for the fiscal years 1996 through 2001. The end product of this program is approval of a final performance assessment by the Department of Energy in the year 2000

Survival of HIV-positive patients starting antiretroviral therapy between 1996 and 2013

DEFF Research Database (Denmark)

Trickey, Adam; May, Margaret T.; Vehreschild, Jorg Janne

2017-01-01

Background Health care for people living with HIV has improved substantially in the past two decades. Robust estimates of how these improvements have affected prognosis and life expectancy are of utmost importance to patients, clinicians, and health-care planners. We examined changes in 3 year...... survival and life expectancy of patients starting combination antiretroviral therapy (ART) between 1996 and 2013. Methods We analysed data from 18 European and North American HIV-1 cohorts. Patients (aged ≥16 years) were eligible for this analysis if they had started ART with three or more drugs between...... ART initiation in four calendar periods (1996–99, 2000–03 [comparator], 2004–07, 2008–10). We estimated life expectancy by calendar period of initiation of ART. Findings 88 504 patients were included in our analyses, of whom 2106 died during the first year of ART and 2302 died during the second...

FY 1996 Blue Book: High Performance Computing and Communications: Foundations for America`s Information Future

Data.gov (United States)

Networking and Information Technology Research and Development, Executive Office of the President — The Federal High Performance Computing and Communications HPCC Program will celebrate its fifth anniversary in October 1996 with an impressive array of...

International seminar on year 2000 (Y2K): Progress and co-operation. Book of extended synopses

International Nuclear Information System (INIS)

1999-01-01

The IAEA Department of Safeguards established a project in 1996 for the year 2000 (Y2K) conversion activities. This project covered assessment, conversion and testing of the software applications, instrument evaluation software, embedded systems and PC hardware attached to various equipment. Significant progress has been made in converting the applications and instruments to be year 2000 compliant. At the same time Member states have made an effort as well in converting the systems used jointly at the facilities

Landelijk Meetnet Regenwatersamenstelling - Meetresultaten 2000

NARCIS (Netherlands)

Stolk AP; LLO

2002-01-01

This report presents the results of the chemical composition measurements of precipitation in the Netherlands in 2000. Measurements were performed on four-weekly samples obtained from the National Precipitation Chemistry Monitoring Network. Samples from 15 stations were analysed for main components

Theseus First Flight - May 24, 1996

Science.gov (United States)

1996-01-01

The Theseus prototype research aircraft shows off its high aspect-ratio wing as it lifts off from Rogers Dry Lake during its first test flight from NASA's Dryden Flight Research Center, Edwards, California, on May 24, 1996. The Theseus aircraft, built and operated by Aurora Flight Sciences Corporation, Manassas, Virginia, was a unique aircraft flown at NASA's Dryden Flight Research Center, Edwards, California, under a cooperative agreement between NASA and Aurora. Dryden hosted the Theseus program, providing hangar space and range safety for flight testing. Aurora Flight Sciences was responsible for the actual flight testing, vehicle flight safety, and operation of the aircraft. The Theseus remotely piloted aircraft flew its maiden flight on May 24, 1996, at Dryden. During its sixth flight on November 12, 1996, Theseus experienced an in-flight structural failure that resulted in the loss of the aircraft. As of the beginning of the year 2000, Aurora had not rebuilt the aircraft. Theseus was built for NASA under an innovative, $4.9 million fixed-price contract by Aurora Flight Sciences Corporation and its partners, West Virginia University, Morgantown, West Virginia, and Fairmont State College, Fairmont, West Virginia. The twin-engine, unpiloted vehicle had a 140-foot wingspan, and was constructed largely of composite materials. Powered by two 80-horsepower, turbocharged piston engines that drove twin 9-foot-diameter propellers, Theseus was designed to fly autonomously at high altitudes, with takeoff and landing under the active control of a ground-based pilot in a ground control station 'cockpit.' With the potential ability to carry 700 pounds of science instruments to altitudes above 60,000 feet for durations of greater than 24 hours, Theseus was intended to support research in areas such as stratospheric ozone depletion and the atmospheric effects of future high-speed civil transport aircraft engines. Instruments carried aboard Theseus also would be able to

Fractured reservoir discrete feature network technologies. Annual report, March 7, 1996--February 28, 1997

Energy Technology Data Exchange (ETDEWEB)

Dershowitz, W.S.; La Pointe, P.R.; Einstein, H.H.; Ivanova, V.

1998-01-01

This report describes progress on the project, {open_quotes}Fractured Reservoir Discrete Feature Network Technologies{close_quotes} during the period March 7, 1996 to February 28, 1997. The report presents summaries of technology development for the following research areas: (1) development of hierarchical fracture models, (2) fractured reservoir compartmentalization and tributary volume, (3) fractured reservoir data analysis, and (4) integration of fractured reservoir data and production technologies. In addition, the report provides information on project status, publications submitted, data collection activities, and technology transfer through the world wide web (WWW). Research on hierarchical fracture models included geological, mathematical, and computer code development. The project built a foundation of quantitative, geological and geometrical information about the regional geology of the Permian Basin, including detailed information on the lithology, stratigraphy, and fracturing of Permian rocks in the project study area (Tracts 17 and 49 in the Yates field). Based on the accumulated knowledge of regional and local geology, project team members started the interpretation of fracture genesis mechanisms and the conceptual modeling of the fracture system in the study area. Research on fractured reservoir compartmentalization included basic research, technology development, and application of compartmentalized reservoir analyses for the project study site. Procedures were developed to analyze compartmentalization, tributary drainage volume, and reservoir matrix block size. These algorithms were implemented as a Windows 95 compartmentalization code, FraCluster.

Longitudinal trends of HIV drug resistance in a large Canadian cohort, 1996-2016.

Science.gov (United States)

Rocheleau, G; Brumme, C J; Shoveller, J; Lima, V D; Harrigan, P R

2018-02-01

We aim to identify long-term trends in HIV drug resistance before and after combined antiretroviral therapy (cART) initiation. IAS-USA (2015) mutations were identified in 23 271 HIV protease-reverse transcriptase sequences from 6543 treatment naïve adults in British Columbia. Participants who started cART between 1996 and 2014 were followed until April 2016. Equality of proportions test was used to compare the percentage of participants with acquired drug resistance (ADR) or transmitted drug resistance (TDR) in 1996, to those in 2014. Kaplan-Meier was used to estimate time to ADR in four drug resistance categories. Multivariable regression odds ratios (OR) of ADR for select clinical variables were determined by 5-year eras of cART initiation. The proportion of individuals with ADR declined from 39% (51/132) to 3% (8/322) in 1996-2014 (p 16 years of therapy. After 5 years on therapy, participants initiating cART in 1996-2000 had 5.5-times more 3TC/FTC ADR, 5.3-times more other nRTI ADR, 4.7-times more NNRTI ADR, and 24-times more PI ADR than those starting in 2011-2014. The individuals with highest odds of developing ADR in 1996-2010 were adherent to regimens at levels between 60% and 80%, which shifted to 40% adherent in 2011-2014. HIV drug resistance transitioned from being primarily selected de-novo to being driven by TDR. Among those who started treatment in the past 5 years, ADR is rare and observed mostly in the lowest adherence strata. Copyright © 2017 European Society of Clinical Microbiology and Infectious Diseases. Published by Elsevier Ltd. All rights reserved.

KURRI progress report 1996. April 1996 - March 1997

International Nuclear Information System (INIS)

1997-11-01

This report describes the activities of the Research Reactor Institute, Kyoto University (KURRI) during the fiscal year (FY) of 1996. A total of 1506 researchers visited the KURRI to perform 106 experimental applications or to attend 17 symposia and 3 workshops. At the end of a three-year period, the scientific achievements of two research projects, 'Residual Stress and Strip Investigations of Metallic Materials by Neutron Scattering' and 'Radiation Protection to the Manageable Ionizing Radiation in the KUR facilities' were reviewed during the annual Scientific Meeting of the KURRI, held on Jan 21-23, 1997. The five-year modernization Program of the KUR and its related facirities was in progress since the reorganization for a Center of Excellence on April 1, 1995. In the FY, 1996 the maintenance and close inspections of the heavy water facility and the graphite thermal column were carried out during the reactor shutdown from Feb 24, 1997 to May 9, 1997. A total of 174 reports of project and general researches in 1996 were outlined. (M.N.)

KURRI progress report 1996. April 1996 - March 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-11-01

This report describes the activities of the Research Reactor Institute, Kyoto University (KURRI) during the fiscal year (FY) of 1996. A total of 1506 researchers visited the KURRI to perform 106 experimental applications or to attend 17 symposia and 3 workshops. At the end of a three-year period, the scientific achievements of two research projects, `Residual Stress and Strip Investigations of Metallic Materials by Neutron Scattering` and `Radiation Protection to the Manageable Ionizing Radiation in the KUR facilities` were reviewed during the annual Scientific Meeting of the KURRI, held on Jan 21-23, 1997. The five-year modernization Program of the KUR and its related facirities was in progress since the reorganization for a Center of Excellence on April 1, 1995. In the FY, 1996 the maintenance and close inspections of the heavy water facility and the graphite thermal column were carried out during the reactor shutdown from Feb 24, 1997 to May 9, 1997. A total of 174 reports of project and general researches in 1996 were outlined. (M.N.)

Energy from waste. State-of-the-art report. Statistics 1996-1999. Data 2000/2001. Austria, Belgium, Denmark, France, Germany, Great Britain, Hungary, Italy, Netherlands, Norway, Portugal, Spain, Sweden, Switzerland, USA

International Nuclear Information System (INIS)

2002-01-01

This is the 4. edition of the report on waste to energy plants in the member countries of the ISWA Working Group on Thermal Treatment of Waste. This edition presents information on the plants by year 2000/2001 and includes operational data covering the years 1996-1999. The report is based on a questionnaire that was distributed to the waste to energy plants in the member countries in 2000. Only normal MSW incineration plants with a capacity of more than 15 tonnes/day or 10,000 tonnes/year are included, which means that special plants for hazardous waste, sludge, agricultural and hospital wastes are not included. Most, but not all, plants have answered a questionnaire, and this report is mainly based on the questionnaires received and the information provided by the questionnaires. In the first section the report presents a comparison of the situation of waste to energy in: Austria, Belgium, Denmark, France, Germany, Great Britain, Hungary, Italy, Portugal, Netherlands, Norway, Spain, Sweden, and Switzerland. The statistics in this section present the number of plants, the national capacity and flue gas cleaning systems. The section also presents the amount of waste incinerated, the energy recovered and the residues generated in 1999 in the 14 countries. The second section presents the national data on the incineration plants. For the USA the figures are listed in the second part of the report. (BA)

[Trends in antibiotic consumption in Spain, 1985-2000].

Science.gov (United States)

Lázaro Bengoa, Edurne; Madurga Sanz, Mariano; de Abajo Iglesias, Francisco J

2002-04-27

The purpose of this study was to analyse the trend in antibiotics consumption to draw on the National Health System (NHS) over the last 16 years in Spain and its different Autonomous Communities (AC). Consumption data for all antibiotics used in Spain, either alone or in fixed-dose combinations, were obtained using the database ECOM. This database includes all the packages sold through retail pharmacies and reimbursed by the NHS. Data are expressed as defined dairy doses per 1,000 inhabitants per day (DHD), in accordance with the methodology recommended by the World Health Organization. Demographic data were provided by the National Institute of Statistics. In 1985 the overall consumption of antibiotics was 21.9 DHD, while in 2000 it was 20.4 DHD. It was possible to distinguish three phases over the study period. The first phase lasts until 1989, where a mild decreasing trend was observed (1.1 DHD; 5.0%), mainly due to the fall of fixed-dose combinations of antibiotics and the association of sulfamethoxazole-trimethoprim. The second phase, lasting until 1996, was characterized by a generalized increase in the consumption in all AC, with an average of 2.3 DHD (+ 11.1%), ranging from 0.4 to 4.6 DHD; this increase was mainly due to the marketing of new macrolides, cephalosporins and quinolones. Finally, there was a third phase beginning in 1996, where the consumption of antibiotics came into a sustained and generalized decline, ranging from 0.5 to 5.1 DHD, and depending on the AC (national average 2.7 DHD, 11.7% lower than that in 1996). This latter trend was mainly due to the fall of wide-spectrum penicillins. Differences between AC regarding the level of consumption were huge over the study period, although the pattern of use was quite similar. There was, for instance, a difference of 10.4 DHD between Región de Murcia and Islas Baleares in 2000, or 9.9 DHD between the former and Madrid in the same year. The consumption of antibiotics in Spain and all its AC has

[Yearly changes in antibacterial activities of cefozopran against various clinical isolates between 1996 and 2000--I. Gram-positive bacteria].

Science.gov (United States)

Suzuki, Yumiko; Nishinari, Chisato; Endo, Harumi; Tamura, Chieko; Jinbo, Keiko; Hiramatsu, Nobuyoshi; Akiyama, Kazumitsu; Koyama, Tsuneo

2002-04-01

The in vitro antibacterial activities of cefozopran (CZOP), an agent of cephems, against various clinical isolates obtained between 1996 and 2000 were yearly evaluated and compared with those of other cephems, oxacephems, carbapenems, and penicillins. Fifteen species, 1,062 strains, of Gram-positive bacteria were isolated from the clinical materials annually collected from January to December, and consisted of methicillin-susceptible Staphylococcus aureus (MSSA; n = 127), methicillin-resistant Staphylococcus aureus (MRSA; n = 123), Staphylococcus epidermidis (n = 104), Staphylococcus haemolyticus (n = 58), Streptococcus pyogenes (n = 100), Streptococcus agalactiae (n = 50), Streptococcus pneumoniae (n = 125), Enterococcus faecalis (n = 150), Enterococcus faecium (n = 50), Enterococcus avium (n = 50), and Peptostreptococcus spp. (P. anaerobius, P. asaccharolyticus, P. magnus, P. micros, P. prevotii; n = 125). CZOP possessed stable antibacterial activities against all strains tested throughout 5 years. The MIC90 of CZOP against MRSA and S. haemolyticus tended to decrease while against S. pneumoniae and Peptostreptococcus spp., tended to increase year by year. However, the MIC90 just changed a little and were consistent with the results from the studies performed until the new drug application approval. Increases in the MIC90 against S. pneumoniae were also observed with cefpirome (CPR), cefepime (CFPM), flomoxef (FMOX), sulbactam/cefoperazone (SBT/CPZ), and imipenem (IPM). Increases in the MIC90 against Peptostreptococcus spp. were also observed with ceftazidime (CAZ), CPR, CFPM, FMOX, SBT/CPZ, and IPM. The decreases in the sensitivities were not always considered to depend upon generation of resistant bacteria because the annual MIC range of each antibacterial agent was almost generally wide every year and the annual sensitivity of each strain to the agents extremely varied. In conclusion, the annual antibacterial activities of CZOP against the Gram

State-Level Trends in the Prevalence of Autism Spectrum Disorder (ASD) from 2000 to 2012: A Reanalysis of Findings from the Autism and Developmental Disabilities Network.

Science.gov (United States)

Sheldrick, R Christopher; Carter, Alice S

2018-04-13

Since 2000, the Autism and Developmental Disabilities Network (ADDM) has published detailed prevalence estimates for autism spectrum disorder (ASD) among 8 year-olds, which are widely interpreted as the U.S. national prevalence of ASD. Although differences in state-level ASD prevalence has been reported, state-level heterogeneity has not been explored systematically. We analyzed state-level estimates and trends in ASD prevalence from 2000 to 2012 using secondary data from bi-annual ADDM reports. Heterogeneity among state-level ASD prevalence estimates were apparent in 2000 and grew between 2000 and 2012. Findings highlight the need for greater understanding of how children with ASD are identified by the medical and educational systems, which has significant implications for the state-level resources required to effectively manage ASD.

Mission Command in the Age of Network-Enabled Operations: Social Network Analysis of Information Sharing and Situation Awareness

Science.gov (United States)

2016-06-22

socio-technical limitations that restrict the free flow of information and communications (e.g., Bateman , 1996). The flow of information among the...networks. Phys. A Stat. Mech. Appl. 272, 173–187. doi: 10.1016/S0378- 4371(99)00291-5 Bateman , R. L. (1996). Force XXI and the death of

Incidence of leukemias in children from El Salvador and Mexico City between 1996 and 2000: Population-based data

Directory of Open Access Journals (Sweden)

Bernáldez-Ríos Roberto

2005-04-01

Full Text Available Abstract Background There are very few studies that report the incidence of acute leukemias in children in Latin America. This work assesses the incidence of acute leukemias, between 1996 and 2000, in children from 0–14 years old who were attended at the Mexican Social Security Institute in Mexico City and in children from 0–11 years old in El Salvador. Methods Design: Population-based data. Hospitals: In San Salvador, El Salvador, Hospital Nacional de Niños "Benjamín Bloom", the only center in El Salvador which attends all children, younger than 12 years, with oncologic disease. The Pediatric Hospital and the General Hospital of the Mexican Social Security Institute in Mexico City, the only centers in Mexico City which attend all those children with acute leukemia who have a right to this service. Diagnosis: All patients were diagnosed by bone marrow smear and were divided into acute lymphoid leukemia (ALL, acute myeloid leukemia (AML, chronic myeloid leukemia (CML, and unspecified leukemias (UL. The annual incidence rate (AIR and average annual incidence rate (AAIR were calculated per million children. Cases were stratified by age and assigned to one of four age strata: 1 Results The number of cases was 375 and 238 in El Salvador and Mexico City, respectively. AAIRs in Mexico City were 44.9, 10.6, 2.5, 0.5, and 58.4 per million children for ALL, AML, CML, UL, and total leukemias, respectively. The AAIRs in El Salvador could not be calculated because the fourth age stratum in El Salvador included children only from 0–11 years old. The incidence rates for the Salvadoran group of 0–11 year olds were 34.2, 7.1, 0.6, 0.2, and 43.2 per million children for ALL, AML, CML, UL, and total leukemias, respectively. Conclusion Reported AIRs for each age group in El Salvador were similar to those from other American countries. The AAIR of ALL in Mexico City is one of the highest reported for North America.

1996 outstanding facts; Faits marquants 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

This progress report of the Direction of Studies and Research (DER) of Electricite de France (EdF) reports on some outstanding studies carried out during the year 1996 and concerning: new applications of electric power (thermal comfort, heating floors, building diagnosis, energy management, customers communicating interfaces, services, air conditioning, off-peak tariffs, power demand mastery in the industry, infrared dryers for paper industry); production means (automatic systems for nuclear power plants operation, management of reactors shutdown schedules for refuelling operations, optimization of fuel loading patterns for PWRs, neutronic and thermohydraulic computer codes for steam pipes rupture accidents, thermo-hydraulic modeling of the confinement building during post-accidental situation, 3D numerical simulation of overpressures inside reactor valves and of vortex and two-phase flow inside auxiliary pipes, control of vibrating fatigue of pipe nozzles, qualification of the adjustable speed drives of the Gravelines` cooling pumps, 3D analysis of new steam turbine designs, identification of bi-metal welding surface defects, a simple method for the evaluation of in-service fatigue of components, the probabilistic dimensioning of safety coefficients, the modeling of thermo-hydro-mechanical coupling of geo-materials for radioactive wastes storage, the supply of isolated sites using renewable energies); environment protection (batteries for electric-powered vehicles, modeling of atmospheric reactive flows, chlorination of the Dampierre`s cooling circuits for pathogen amoebas elimination, in-situ treatment of PCBs isolated transformers); and development and exploitation of materials for power networks. (J.S.).

1996 outstanding facts; Faits marquants 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-12-31

This progress report of the Direction of Studies and Research (DER) of Electricite de France (EdF) reports on some outstanding studies carried out during the year 1996 and concerning: new applications of electric power (thermal comfort, heating floors, building diagnosis, energy management, customers communicating interfaces, services, air conditioning, off-peak tariffs, power demand mastery in the industry, infrared dryers for paper industry); production means (automatic systems for nuclear power plants operation, management of reactors shutdown schedules for refuelling operations, optimization of fuel loading patterns for PWRs, neutronic and thermohydraulic computer codes for steam pipes rupture accidents, thermo-hydraulic modeling of the confinement building during post-accidental situation, 3D numerical simulation of overpressures inside reactor valves and of vortex and two-phase flow inside auxiliary pipes, control of vibrating fatigue of pipe nozzles, qualification of the adjustable speed drives of the Gravelines` cooling pumps, 3D analysis of new steam turbine designs, identification of bi-metal welding surface defects, a simple method for the evaluation of in-service fatigue of components, the probabilistic dimensioning of safety coefficients, the modeling of thermo-hydro-mechanical coupling of geo-materials for radioactive wastes storage, the supply of isolated sites using renewable energies); environment protection (batteries for electric-powered vehicles, modeling of atmospheric reactive flows, chlorination of the Dampierre`s cooling circuits for pathogen amoebas elimination, in-situ treatment of PCBs isolated transformers); and development and exploitation of materials for power networks. (J.S.).

Progress report: 1996 Radiation Safety Systems Division

International Nuclear Information System (INIS)

Bhagwat, A.M.; Sharma, D.N.; Abani, M.C.; Mehta, S.K.

1997-01-01

The activities of Radiation Safety Systems Division include (i) development of specialised monitoring systems and radiation safety information network, (ii) radiation hazards control at the nuclear fuel cycle facilities, the radioisotope programmes at Bhabha Atomic Research Centre (BARC) and for the accelerators programme at BARC and Centre for Advanced Technology (CAT), Indore. The systems on which development and upgradation work was carried out during the year included aerial gamma spectrometer, automated environment monitor using railway network, radioisotope package monitor and air monitors for tritium and alpha active aerosols. Other R and D efforts at the division included assessment of risk for radiation exposures and evaluation of ICRP 60 recommendations in the Indian context, shielding evaluation and dosimetry for the new upcoming accelerator facilities and solid state nuclear track detector techniques for neutron measurements. The expertise of the divisional members was provided for 36 safety committees of BARC and Atomic Energy Regulatory Board (AERB). Twenty three publications were brought out during the year 1996. (author)

Current Status of Groundwater Monitoring Networks in Korea

OpenAIRE

Jin-Yong Lee; Kideok D. Kwon

2016-01-01

Korea has been operating groundwater monitoring systems since 1996 as the Groundwater Act enacted in 1994 enforces nationwide monitoring. Currently, there are six main groundwater monitoring networks operated by different government ministries with different purposes: National Groundwater Monitoring Network (NGMN), Groundwater Quality Monitoring Network (GQMN), Seawater Intrusion Monitoring Network (SIMN), Rural Groundwater Monitoring Network (RGMN), Subsidiary Groundwater Monitoring Network ...

Neural Network Classifier Based on Growing Hyperspheres

Czech Academy of Sciences Publication Activity Database

Jiřina Jr., Marcel; Jiřina, Marcel

2000-01-01

Roč. 10, č. 3 (2000), s. 417-428 ISSN 1210-0552. [Neural Network World 2000. Prague, 09.07.2000-12.07.2000] Grant - others:MŠMT ČR(CZ) VS96047; MPO(CZ) RP-4210 Institutional research plan: AV0Z1030915 Keywords : neural network * classifier * hyperspheres * big -dimensional data Subject RIV: BA - General Mathematics

The Evolution of Sex Education and Students' Sexual Knowledge in Finland in the 2000s

Science.gov (United States)

Kontula, Osmo

2010-01-01

Finland is probably the only country where sex education has been studied in two consecutive national surveys, in 1996 and 2006 directed at biology and health education teachers, and in 2000 and 2006 by measuring adolescents' sexual knowledge. In 2006, responses from teachers and students could be combined for 339 schools. The most important…

Uranium industry annual 1996

International Nuclear Information System (INIS)

1997-04-01

The Uranium Industry Annual 1996 (UIA 1996) provides current statistical data on the US uranium industry's activities relating to uranium raw materials and uranium marketing. The UIA 1996 is prepared for use by the Congress, Federal and State agencies, the uranium and nuclear electric utility industries, and the public. Data on uranium raw materials activities for 1987 through 1996 including exploration activities and expenditures, EIA-estimated reserves, mine production of uranium, production of uranium concentrate, and industry employment are presented in Chapter 1. Data on uranium marketing activities for 1994 through 2006, including purchases of uranium and enrichment services, enrichment feed deliveries, uranium fuel assemblies, filled and unfilled market requirements, uranium imports and exports, and uranium inventories are shown in Chapter 2. A feature article, The Role of Thorium in Nuclear Energy, is included. 24 figs., 56 tabs

Uranium industry annual 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-04-01

The Uranium Industry Annual 1996 (UIA 1996) provides current statistical data on the US uranium industry`s activities relating to uranium raw materials and uranium marketing. The UIA 1996 is prepared for use by the Congress, Federal and State agencies, the uranium and nuclear electric utility industries, and the public. Data on uranium raw materials activities for 1987 through 1996 including exploration activities and expenditures, EIA-estimated reserves, mine production of uranium, production of uranium concentrate, and industry employment are presented in Chapter 1. Data on uranium marketing activities for 1994 through 2006, including purchases of uranium and enrichment services, enrichment feed deliveries, uranium fuel assemblies, filled and unfilled market requirements, uranium imports and exports, and uranium inventories are shown in Chapter 2. A feature article, The Role of Thorium in Nuclear Energy, is included. 24 figs., 56 tabs.

Monitoring of long-range transported air pollutants, Annual report for 1996; Overvaaking av langtransportert forurenset luft og nedboer. Atmosfaerisk tilfoersel, 1996

Energy Technology Data Exchange (ETDEWEB)

Toerseth, K.; Manoe, S.

1997-12-31

This report describes the results from the rural air- and precipitation chemistry network in Norway. In 1996, main components in precipitation were measured at 32 sites and trace elements were determined at 13 sites. The concentrations of sulphur and nitrogen compounds in air were determined at 12 sites, and concentrations of ozone at 15 sites. The highest mean concentrations of sulphate, nitrate, ammonium and strong acid in precipitation occurred along the southern coast. Low values were found from Moere og Romsdal to Troms counties. The largest wet deposition of sulphate, nitrogen components and strong acid occurred along the coast of the southernmost tip of the country. All over the country the mean concentrations of sulphate, nitrate, ammonium and strong acid in precipitation had in general increased from 1995 to 1996. Because of small annual precipitation amounts the wet depositions were the lowest measured so far at most places in Norway. The highest content of particulate sulphate and of nitrogen components in air and in precipitation were measured in Southern Norway. The mean concentrations of sulphur dioxide were highest in Finnmark due to the nickel smelters in Russia. The largest annual mean concentrations of lead, cadmium and zinc in precipitation were measured in Southern Norway. Mercury in air decreased from 1992 to 1996 while the concentrations of lead, cadmium and zinc increased. This is opposite to the trend observed in precipitation chemistry and is probably due to emissions in Eastern Europe. 47 refs., 34 figs., 37 tabs.

NASA Year 2000 (Y2K) Program Plan

Science.gov (United States)

1998-01-01

NASA initiated the Year 2000 (Y2K) program in August 1996 to address the challenges imposed on Agency software, hardware, and firmware systems by the new millennium. The Agency program is centrally managed by the NASA Chief Information Officer, with decentralized execution of program requirements at each of the nine NASA Centers, Headquarters and the Jet Propulsion Laboratory. The purpose of this Program Plan is to establish Program objectives and performance goals; identify Program requirements; describe the management structure; and detail Program resources, schedules, and controls. Project plans are established for each NASA Center, Headquarters, and the Jet Propulsion Laboratory.

Research productivity of Pakistan in medical sciences during the period 1996-2012.

Science.gov (United States)

Meo, S A; Almasri, A A; Usmani, A M

2013-11-01

This study aimed to investigate the degree of research outcome in medical science subjects in Pakistan during the period 1996-2012. In this study, the research papers published in various global science journals during the period 1996-2012 were accessed. We recorded the total number of research documents having an affiliation with a Pakistan. The main source for information was Institute of Scientific Information (ISI) Web of Science, Thomson Reuters and SCI-mago/Scopus. In global science, Pakistan contributed 58133 research papers in all science and social sciences both in ISI and non ISI indexed journals. However, in medical sciences the total number of research papers from Pakistan are 25604, citable documents 23874, citations 128061, mean citations per documents 6.45 and mean Hirsch index is 35.33. In Pakistan, the upward trend of articles published in global medical science was from the period 1996-2008. However, from 2008 the trend is markedly declined. Pakistan significantly improved its international ranking positions in research during the period 2000-2008. However, the upward trend of research papers published in global medical science could not be retained and from the year 2008 the trend started declining. This trend of research papers further declined in year 2012 compared to year 2011. It is suggested that, Pakistan must take strategic steps to enhance the research culture and increase the research and development expenditure in the country.

The Natura 2000 network and compensatory measures

DEFF Research Database (Denmark)

Møller, Lars Emil Vindfeld; Hvingel, Line Træholt

2006-01-01

of society. This is true, for instance, in connection with the continued expansion of infrastructure systems of importance to society. In other cases preference must be given to the preservation of threatened biotopes and animal species. This balancing act between society’s needs for efficient infrastructure...... of Wild Birds and the Habitat Directive, and by creating Natura 2000, established that the protection of wild animals and plants is a collective responsibility....

IMT-2000 Satellite Standards with Applications to Mobile Air Traffic Communications Networks

Science.gov (United States)

Shamma, Mohammed A.

2004-01-01

The International Mobile Telecommunications - 2000 (IMT-2000) standard and more specifically the Satellite component of it, is investigated as a potential alternative for communications to aircraft mobile users en-route and in terminal area. Its application to Air Traffic Management (ATM) communication needs is considered. A summary of the specifications of IMT-2000 satellite standards are outlined. It is shown via a system research analysis that it is possible to support most air traffic communication needs via an IMT-2000 infrastructure. This technology can compliment existing, or future digital aeronautical communications technologies such as VDL2, VDL3, Mode S, and UAT.

Investigations of microbial regeneration of abandoned mining land. Project 1: Leachate reduction in ore mining regions with high levels of heavy metal sulfides. Final report 2000; Untersuchungen zur mikrobiellen Sicherung von Bergbaualtlasten. Teilvorhaben 1: Laugungsreduzierung in Schwermetallsulfid-belasteten Erzbergbauregionen. Abschlussbericht 2000

Energy Technology Data Exchange (ETDEWEB)

Sand, W.; Jozsa, P.G.; Schippers, A.

2001-02-01

The project was aimed at the development of an optimized catalogue of measures for regeneration and reclamation of polluted mining land. Reports were published in 1995, 1996, 1997 and 1998. This report summarizes the work of 1999 and 2000. A catalogue of measures is proposed on the basis of the results. [German] Ziel des Projektes ist die Erarbeitung eines optimierten Massnahmenpaketes zur Sicherung und Sanierung von Bergbaualtlasten, die durch mikrobiologische Sauerwasserbildung und Schwermetallmobilisierung Boeden und Gewaesser kontaminieren. Die Problematik und der Stand der Kenntnisse sowie erste Ergebnisse der Bestandsaufnahmen wurden in den Jahresberichten 1995 und 1996 sowie im Fortsetzungsantrag ausfuehrlich dargestellt. Ueber die Versuchsergebnisse der Jahre 1997 und 1998 wurde bereits berichtet. Im Folgenden werden die in den Jahren 1999 und 2000 erzielten Ergebnisse zusammengefasst und eine Bewertung der Projektarbeit vorgenommen. Abschliessend wird ein Massnahmenkatalog vorgeschlagen, der bei der Planung und Durchfuehrung von Sanierungsaufgaben an Bergbaualtlasten den Anwendern die aus mikrobiologischer Sicht zu beruecksichtigenden Aspekte mit Loesungsmoeglichkeiten gebuendelt zur Verfuegung stellt. (orig.)

FY 2000 Project of international clean energy network using hydrogen conversion (WE-NET)

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-03-01

Described herein are the FY 2000 results of the research and development project aimed at construction of the international clean energy network using hydrogen conversion (WE-NET). The projects include 12 tasks; system evaluation for, e.g., optimum scenario for introduction of hydrogen energy; experiments for hydrogen safety; study on the international cooperation for WE-NET; development of power generation technology using a 100kW cogeneration system including hydrogen-firing diesel engine; developmental research on vehicles driven by a hydrogen fuel cell system; developmental research on the basic technologies for PEFC utilizing pure hydrogen; developmental research on a 30Nm{sup 3}/hour hydrogen refueling station for vehicles; developmental research on hydrogen production technology; developmental research on hydrogen transportation and storage technology, e.g., liquid hydrogen pump; research and development of the databases of and processing technology for cryogenic materials exposed to liquid hydrogen; developmental research on hydrogen absorbing alloys for small-scale hydrogen transportation and storage systems; and study on innovative and leading technologies. (NEDO)

[Peruvian scientific production in medicine and collaboration networks, analysis of the Science Citation Index 2000-2009].

Science.gov (United States)

Huamaní, Charles; Mayta-Tristán, Percy

2010-09-01

To describe the Peruvian scientific production in indexed journals in the Institute for Scientific Information (ISI) and the characteristics of the institutional collaborative networks. All papers published in the ISI database (Clinical Medicine collection) were included during 2000 to 2009 with at least one author with a Peruvian affiliation. The publication trend, address of corresponding author, type of article, institution, city (only for Peru), and country were evaluated. The collaborative networks were analized using the Pajek® software. 1210 papers were found, increasing from 61 in 2000 to 200 in 2009 (average of 121 articles/year). 30.4% articles included a corresponding author from a Peruvian institution. The average of authors per article was 8.3. Original articles represented 82.1% of total articles. Infectious diseases-related journals concentrated most of the articles. The main countries that collaborate with Peru are: USA (60.4%), England (12.9%), and Brazil (8.0%). Lima concentrated 94.7% of the publications and three regions (Huancavelica, Moquegua and Tacna) did not register any publication. Only two universities published more than one article/year and four institutions published more than 10 articles/year. Universidad Peruana Cayetano Heredia published 45% of the total number of articles, being the most productive institution and which concentrated the most number of collaborations with foreign institutions. The ministry of Health--including all dependencies--published 37.3% of the total number of publications. There is a higher level of collaboration with foreign institutions rather than local institutions. The Peruvian scientific production in medicine represented in the ISI database is very low but growing, and is concentrated in Lima and in a few institutions. The most productive Peruvian institutions collaborate more intensively with foreign journals rather than local institutions.

Monitoring the bedrock stability in Olkiluoto. Summary of campaign based GPS measurements in 1996-2011

International Nuclear Information System (INIS)

Nyberg, S.; Kallio, U.; Haekli, P.; Jokela, J.; Koivula, H.; Saaranen, V.; Rouhiainen, P.

2013-12-01

The Finnish Geodetic Institute has monitored crustal deformations in Olkiluoto since mid-1990s. This is a final report of campaign based GPS measurements carried out in 1996-2011. The aim of the research has been monitoring the bedrock stability in the Olkiluoto area. The research were started in 1995, when a local GPS network of ten pillars, called inner network, was established on Olkiluoto Island. The research area was expanded in 2003- 2005 with four new pillars (outer network) established at 5-10 km distances from the inner network. One of the pillar points is the Olkiluoto permanent GPS station. Regular biannual measurement campaigns have been carried out on other pillar points

Update: outbreak of acute febrile illness among athletes participating in Eco-Challenge-Sabah 2000--Borneo, Malaysia, 2000.

Science.gov (United States)

2001-01-19

During September 7-11, 2000, CDC was notified by the Idaho Department of Health, the Los Angeles County Department of Health Services, and the GeoSentinel Global Surveillance Network of at least 20 cases of acute febrile illness in three countries; all ill patients had participated in the Eco-Challenge-Sabah 2000 multisport expedition race in Borneo, Malaysia, during August 21-September 3, 2000. Participants included athletes from 29 U.S. states and 26 countries. This report updates the ongoing investigation of this outbreak through December 2, which suggests that Leptospira were the cause of illness and that water from the Segama River was the primary source of infection. Participants in adventure sports and exotic tourism should be aware of potential exposure to unusual and emerging infectious agents.

1996 CERN school of computing. Proceedings

Energy Technology Data Exchange (ETDEWEB)

Vandoni, C E [ed.

1996-11-19

The 1996 CERN School of Computing covered several main topics. In the field of imaging, there were contributions on image processing and handling, computer vision, image analysis and filtering (including neural networks), as well as applications of these methods in high-energy physics data analysis and in the restoration of old films. Distributed operating systems were featured, and parallel and high-performance computing were treated both from the hardware point of view and by discussing the development of tailored programming languages. The construction of detectors for the future Large Hadron Collider will be huge and complex projects. Engineering software tools for the design and simulation of these detectors were described, using some examples from the motor industry as well as experience gained from the particle physics field itself. Triggering and Data Acquisition for these experiments was another theme, and included impressions from an earlier workshop which had examined how these data can be effectively analysed when the teams are distributed all over the world. Important in this respect will be the networking capabilities of the future worldwide information highways, which was the subject of a further talk. (orig.).

1996 CERN school of computing. Proceedings

International Nuclear Information System (INIS)

Vandoni, C.E.

1996-01-01

The 1996 CERN School of Computing covered several main topics. In the field of imaging, there were contributions on image processing and handling, computer vision, image analysis and filtering (including neural networks), as well as applications of these methods in high-energy physics data analysis and in the restoration of old films. Distributed operating systems were featured, and parallel and high-performance computing were treated both from the hardware point of view and by discussing the development of tailored programming languages. The construction of detectors for the future Large Hadron Collider will be huge and complex projects. Engineering software tools for the design and simulation of these detectors were described, using some examples from the motor industry as well as experience gained from the particle physics field itself. Triggering and Data Acquisition for these experiments was another theme, and included impressions from an earlier workshop which had examined how these data can be effectively analysed when the teams are distributed all over the world. Important in this respect will be the networking capabilities of the future worldwide information highways, which was the subject of a further talk. (orig.)

[Tampa Electric Company IGCC project]. 1996 DOE annual technical report, January--December 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

Tampa Electric Company`s Polk Power Station Unit 1 (PPS-1) Integrated Gasification Combined Cycle (IGCC) demonstration project uses a Texaco pressurized, oxygen-blown, entrained-flow coal gasifier to convert approximately 2,000 tons per day of coal to syngas. The gasification plant is coupled with a combined cycle power block to produce a net 250 MW electrical power output. Coal is slurried in water, combined with 95% pure oxygen from an air separation unit, and sent to the gasifier to produce a high temperature, high pressure, medium-Btu syngas with a heat content of about 250 BTUs/cf (HHV). The syngas then flows through a high temperature heat recovery unit which cools the syngas prior to its entering the cleanup systems. Molten coal ash flows from the bottom of the high temperature heat recovery unit into a water-filled quench chamber where it solidifies into a marketable slag by-product. Approximately 10% of the raw, hot syngas at 900 F is designed to pass through an intermittently moving bed of metal-oxide sorbent which removes sulfur-bearing compounds from the syngas. PPS-1 will be the first unit in the world to demonstrate this advanced metal oxide hot gas desulfurization technology on a commercial unit. The emphasis during 1996 centered around start-up activities.

ANSTO - Annual Report 1996-1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-09-01

Highlights of achievements during 1996-1997 at the Australian Nuclear Science and technology (ANSTO) include: release of the new ANSTO Strategic Plan for the period till June 2000 and the establishment of a Technical Advisory Committee (TAC) of the Board. In accordance with the Strategic Plan, ANSTO has continued to focus its activities in six core business areas. The major outcomes and outputs of this work are outlined. The majority of ANSTO strategic research was directed at several topics launched during the year, including: international cooperative research to enhance safety of nuclear facilities and safeguards for nuclear materials, environmental dynamics, global climate change, radioactive waste management, ecological sustainability of the mining and mineral industries, radionuclides and radiopharmaceuticals for the 21st century and the design and process of novel interfaces. During the year major upgrades were made to he National Medical Cyclotron (NMC) and the Australian National Tandem Accelerator for Applied Research (ANTARES). The Annual Report documents the uses of these facilities by universities, industry, medicine and Government. Details are also provided of the organization development and support which support the core scientific areas. The financial statement for the year under review is also included tabs, ills, figs.

ANSTO - Annual Report 1996-1997

International Nuclear Information System (INIS)

1997-09-01

Highlights of achievements during 1996-1997 at the Australian Nuclear Science and technology (ANSTO) include: release of the new ANSTO Strategic Plan for the period till June 2000 and the establishment of a Technical Advisory Committee (TAC) of the Board. In accordance with the Strategic Plan, ANSTO has continued to focus its activities in six core business areas. The major outcomes and outputs of this work are outlined. The majority of ANSTO strategic research was directed at several topics launched during the year, including: international cooperative research to enhance safety of nuclear facilities and safeguards for nuclear materials, environmental dynamics, global climate change, radioactive waste management, ecological sustainability of the mining and mineral industries, radionuclides and radiopharmaceuticals for the 21st century and the design and process of novel interfaces. During the year major upgrades were made to he National Medical Cyclotron (NMC) and the Australian National Tandem Accelerator for Applied Research (ANTARES). The Annual Report documents the uses of these facilities by universities, industry, medicine and Government. Details are also provided of the organization development and support which support the core scientific areas. The financial statement for the year under review is also included

[Economic evaluation of the demand of medical care for mental health in Mexico: schizophrenia and depression, 1996-2000].

Science.gov (United States)

Arredondo, Armando; Ramos, René; Zúñiga, Alexis

2003-01-01

Financing protection for both, users and providers of health care services is one of the main objectives of National Program of Health in Mexico, 2001-2006. In fact one of the elements of the present health care reform initiatives is need for the efficient allocation of financial resources, using resource allocation schemes by specific health care demands that combine both the economic, clinical and the epidemiological perspectives. The evaluation of such schemes has been approached in several ways; however, in the case of mental health services, there is dearth of studies that use economic assessment methods. Moreover, such studies are of limited scope, often a response to unmated health needs, disregarding the economic implication for health services production and financing and ensuing medical care market imbalances. This paper presents the results of an evaluative research work aimed to assess the average cost of depression and schizophrenia case management, the financial resources required to meet the health care demands by type of institution, period 1996-2000, in Mexico by type of health care provider. The case management average cost for schizophrenia was $211.00 US, and that for depression was $221.00 US. The demand of services for both conditions in each type of institution showed that the greatest relative demands (96% of the national total for depression and 94% of the national total for schizophrenia) occur in three institutions: IMSS, SSA and ISSSTE. The greatest demand of the health services for the two study condition corresponded to those insured by the IMSS, followed by those uninsured who use the SSA services, and those insured by the ISSSTE. The case management costs for mental conditions are in the middle range between hypertension and diabetes in the upper end, pneumonia and diarrhea in the lower end. The case managment costs of health care demands for the selected tracer conditions differ considerably among institutions for insure populations

Pyrenean meadows in Natura 2000 network: grass production and plant biodiversity conservation

Energy Technology Data Exchange (ETDEWEB)

Reine, R.; Barrantes, O.; Chocarro, C.; Juarez, A.; Broca, A.; Maestro, M.; Ferrer, C.

2014-06-01

In semi-natural mountain meadows, yield and forage quality must be reconciled with plant biodiversity conservation. This study was performed to analyze the relationships between these three parameters. To quantify plant biodiversity and pastoral value (PV), phyto sociological inventories were performed in 104 semi-natural meadows in the Central Spanish Pyrenees included in the Natura 2000 network. Forage yields were calculated and forage samples were analyzed for relative feed value (RFV). We identified two main types of meadows: (i) those that had more intensive management, relatively close to farm buildings, with little or no slope, dominated by grasses, with low plant biodiversity, high PV and yield, but low forage quality and (ii) those that had less intensive management, distant from farm buildings, on slopes, richer in other forbs, with high plant biodiversity and forage quality, but low PV and yield. Conservation policies should emphasize less intensive management practices to maintain plant diversity in the semi-natural meadows in the Pyrenees. The widespread view that other forbs have low nutritional value should be revised in future research. These species often are undervalued by the PV method, because their nutritional quality, digestibility and intake are poorly understood. (Author)

SKB Annual Report 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-05-01

This is the annual report of the Swedish Nuclear Fuel and Waste Management Co (SKB). Part 1 of the report contains an overview of the SKB activities in different fields, and part 2 gives a description of the research and development work on nuclear waste disposal performed during 1996. Lectures and publications as well as reports issued during 1996 are listed in part 3, and summaries of the reports are listed in part 4. The task of SKB is to transport, store and dispose of the spent nuclear fuel and radioactive wastes from the nuclear power plants and to perform the research and development and other measures necessary for this work. SKB is the owner of CLAB, the Central Interim Storage Facility for spent fuel, located at Oskarshamn. CLAB was taken into operation in July 1985 and by the end of 1996 about 2500 tons of spent fuel have been received. At Forsmark the Final Repository for Radioactive Operational Waste (SFR) was taken into operation in April 1988. The repository is situated in crystalline rock under the Baltic Sea. SFR has currently a capacity of about 60000 m{sup 3} or waste. At the end of 1996 at total of 21000 m{sup 3} of waste has been deposited. Transportation from the reactor sites to CLAB and SFR is made by a specially designed ship, M/S Sigyn. The total cost for R,D and D during 1996 amounted to 124 MSEK (about 15 MUSD).

SKB Annual Report 1996

International Nuclear Information System (INIS)

1997-05-01

This is the annual report of the Swedish Nuclear Fuel and Waste Management Co (SKB). Part 1 of the report contains an overview of the SKB activities in different fields, and part 2 gives a description of the research and development work on nuclear waste disposal performed during 1996. Lectures and publications as well as reports issued during 1996 are listed in part 3, and summaries of the reports are listed in part 4. The task of SKB is to transport, store and dispose of the spent nuclear fuel and radioactive wastes from the nuclear power plants and to perform the research and development and other measures necessary for this work. SKB is the owner of CLAB, the Central Interim Storage Facility for spent fuel, located at Oskarshamn. CLAB was taken into operation in July 1985 and by the end of 1996 about 2500 tons of spent fuel have been received. At Forsmark the Final Repository for Radioactive Operational Waste (SFR) was taken into operation in April 1988. The repository is situated in crystalline rock under the Baltic Sea. SFR has currently a capacity of about 60000 m 3 or waste. At the end of 1996 at total of 21000 m 3 of waste has been deposited. Transportation from the reactor sites to CLAB and SFR is made by a specially designed ship, M/S Sigyn. The total cost for R,D and D during 1996 amounted to 124 MSEK (about 15 MUSD)

CNN Newsroom Classroom Guides, October 2000.

Science.gov (United States)

Turner Educational Services, Inc., Newtown, PA.

These classroom guides, designed to accompany the daily CNN (Cable News Network) Newsroom broadcasts for the month of October 2000, provide program rundowns, suggestions for class activities and discussion, student handouts, and a list of related news terms. Top stories include: Chinese authorities detain Falun Gong protesters on Tiananmen Square…

Genomic admixture tracks pulses of economic activity over 2,000 years in the Indian Ocean trading network.

Science.gov (United States)

Brucato, Nicolas; Kusuma, Pradiptajati; Beaujard, Philippe; Sudoyo, Herawati; Cox, Murray P; Ricaut, François-Xavier

2017-06-07

The Indian Ocean has long been a hub of interacting human populations. Following land- and sea-based routes, trade drove cultural contacts between far-distant ethnic groups in Asia, India, the Middle East and Africa, creating one of the world's first proto-globalized environments. However, the extent to which population mixing was mediated by trade is poorly understood. Reconstructing admixture times from genomic data in 3,006 individuals from 187 regional populations reveals a close association between bouts of human migration and trade volumes during the last 2,000 years across the Indian Ocean trading system. Temporal oscillations in trading activity match phases of contraction and expansion in migration, with high water marks following the expansion of the Silk Roads in the 5 th century AD, the rise of maritime routes in the 11 th century and a drastic restructuring of the trade network following the arrival of Europeans in the 16 th century. The economic fluxes of the Indian Ocean trade network therefore directly shaped exchanges of genes, in addition to goods and concepts.

PROMOTING NATURA 2000 NETWORK BENEFITS FOR LOCAL COMMUNITIES BY PRACTICING ECOTOURISM AND AGROTOURISM

Directory of Open Access Journals (Sweden)

Mirela STANCIU

2014-04-01

Full Text Available This paper presents the benefits of the local communities across Natura 2000 sites. Human activities in these areas should take into account the economic, social, cultural, and environmental protection. It examines the most common problems encountered in forests, pastures and hayfields in the area of Natura 2000 sites. There are some examples of good practice exemplified by the activities of farmers living on the radius of Natura 2000 sites in different European countries. Natura 2000 sites are suitable for development of eco-tourism and agro-tourism based on tradition and organic products, which may lead to a brand. Tourism and specifically eco-friendly tourism industries (ecotourism, agrotourism, etc. are encouraging development areas at regional and national Natura 2000 sites as a sustainable opportunity for people and nature.

ATM Tactical Network - a challenge for the military networks

NARCIS (Netherlands)

Waveren, C.J. van; Luiijf, H.A.M.; Burakowski, W.; Kopertowski, Z.

1997-01-01

The next generation of tactical networks will be based on the ATM technology. The POST-2000 tactical network is just in the designing phase. The objective of this paper is to point out the main problems which should be solved to adopt ATM technology into the tactical network environment. The

SAFARI 2000 Atmospheric Aerosol Measurements, Hand-held Hazemeters, Zambia

Data.gov (United States)

National Aeronautics and Space Administration — ABSTRACT: In conjunction with the AERONET (AErosol RObotic NETwork) participation in SAFARI 2000, the USDA Forest Service deployed handheld hazemeters in western...

Scalable Networking for Cloud Datacenters

CERN Multimedia

CERN. Geneva

2010-01-01

Andy will discuss the architectural evolution of Ethernet networks and switch architectures as they are being designed to address much larger cloud networking applications that require predictable throughput and latency.About the speakerAs Chief Development Officer, Andy Bechtolsheim is responsible for the overall product development and technical direction of Arista Networks.Previously Andy was a Founder and Chief System Architect at Sun Microsystems, where most recently he was responsible for industry standard server architecture. Andy was also a Founder and President of Granite Systems, a Gigabit Ethernet startup acquired by Cisco Systems in 1996. From 1996 until 2003 Andy served as VP/GM of the Gigabit Systems Business Unit at Cisco that developed the very successful Catalyst 4500 family of switches. Andy was also a Founder and President of Kealia, a next generation server company acquired by Sun in 2004.Andy received an M.S. in Computer Engineering from Carnegie Mellon University in 1976 and was a Ph.D. ...

ITER council proceedings: 1996

International Nuclear Information System (INIS)

1997-01-01

Records of the 10. ITER Council Meeting (IC-10), held on 26-27 July 1996, in St. Petersburg, Russia, and the 11. ITER Council Meeting (IC-11) held on 17-18 December 1996, in Tokyo, Japan, are presented, giving essential information on the evolution of the ITER Engineering Design Activities (EDA) and the cost review and safety analysis. Figs, tabs

Network Affordances

DEFF Research Database (Denmark)

Samson, Audrey; Soon, Winnie

2015-01-01

This paper examines the notion of network affordance within the context of network art. Building on Gibson's theory (Gibson, 1979) we understand affordance as the perceived and actual parameters of a thing. We expand on Gaver's affordance of predictability (Gaver, 1996) to include ecological...... and computational parameters of unpredictability. We illustrate the notion of unpredictability by considering four specific works that were included in a network art exhibiton, SPEED SHOW [2.0] Hong Kong. The paper discusses how the artworks are contingent upon the parameteric relations (Parisi, 2013......), of the network. We introduce network affordance as a dynamic framework that could articulate the experienced tension arising from the (visible) symbolic representation of computational processes and its hidden occurrences. We base our proposal on the experience of both organising the SPEED SHOW and participating...

SAFARI 2000 Atmospheric Aerosol Measurements, Hand-held Hazemeters, Zambia

Data.gov (United States)

National Aeronautics and Space Administration — In conjunction with the AERONET (AErosol RObotic NETwork) participation in SAFARI 2000, the USDA Forest Service deployed handheld hazemeters in western Zambia from...

Energy in 1996

International Nuclear Information System (INIS)

1996-01-01

Six charts are presented and discussed concerning energy utilization in France during the 1970-1996 period: national energy bill, energy intensity ratios, imported crude oil costs, energy-induced carbon dioxide emissions, operating ability ratios of EDF nuclear plants, France's energy independence ratios. 1996 has seen an strong increase (+31%) in the energy bill, reaching 77 billions Francs, combining an increase in energy consumption and dollar exchange rate and a decline in energy conservation; carbon dioxide emission are taking up again after a strong decrease in the 80's

1996 annual report

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-10-01

This report presents the activities and accomplishments of the Philippine Nuclear Research Institute (PNRI) for the calendar year 1996. The highlights of the accomplishment is about the nuclear and allied services, research development, nuclear safety and regulations, and the general administration and linkages. Also, the special S and T events especially the holding of the 2nd Philippine Nuclear Congress with Dr. Hans Blix, Director General of the IAEA, as the keynote speaker; and the celebration of the 100th year of discovery of radioactivity (1896-1996) are included in this report.

1996 annual report

International Nuclear Information System (INIS)

1997-01-01

This report presents the activities and accomplishments of the Philippine Nuclear Research Institute (PNRI) for the calendar year 1996. The highlights of the accomplishment is about the nuclear and allied services, research development, nuclear safety and regulations, and the general administration and linkages. Also, the special S and T events especially the holding of the 2nd Philippine Nuclear Congress with Dr. Hans Blix, Director General of the IAEA, as the keynote speaker; and the celebration of the 100th year of discovery of radioactivity (1896-1996) are included in this report

Monthly energy review: September 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-09-01

Energy production during June 1996 totaled 5.6 quadrillion Btu, a 0.5% decrease from the level of production during June 1995. Energy consumption during June 1996 totaled 7.1 quadrillion Btu, 2.7% above the level of consumption during June 1995. Net imports of energy during June 1996 totaled 1.6 quadrillion Btu, 4.5% above the level of net imports 1 year earlier. Statistics are presented on the following topics: energy consumption, petroleum, natural gas, oil and gas resource development, coal, electricity, nuclear energy, energy prices, and international energy. 37 figs., 59 tabs.

NIRS report concerning the cyclotron usages. FY 2000

International Nuclear Information System (INIS)

2001-07-01

This report describes the National Institute of Radiological Sciences (NIRS) cyclotron usages concerning of: Operation and improvement-development of the cyclotrons in 2000 (total 1,302 hr operation, development of the insulating septum, renewal of the magnetic channel and radiofrequency (RF) pre-amplifier, and improvement of the magnetic interference); Development of neutron detectors in the cosmic environment (the phoswich detector, low-pressure proportional counter, bubble dosimeter and new type phoswich detector); Development of detectors of charged particle components in the cosmic radiation (Liulin-4J and position sensitive silicon detector); Measurement of the energy and angular distribution of secondary electrons from water vapor with heavy-ion impact; Phase II clinical trials of proton beam therapy for ophthalmological tumors (34 patients in 1996-2000 and survival rate 100% within 3 years); Application of cyclotrons for RI production (mainly, 11 C, 13 N, 15 O and 18 F for basic and clinical PET); Studies on the spread-out peak of proton beam (for radiotherapy); and Related materials to above (details). (N.I.)

Safety analysis and neutronics of accelerator-driven transmutation of wastes with concurrent energy production. Annual report for the year 1996

International Nuclear Information System (INIS)

Gudowski, W.; Thedeen, T.; Moeller, E.

1997-02-01

The research activities have significantly expanded compared to the earlier period and were during 1996 concentrated on the following major objectives: ATW system studies, simulations, optimization and design of spallation targets, benchmarking of the calculational tools in the frame of the IAEA coordinated research project, development of the computer codes for ADS and some experimental activities on the subcritical reactor MASURCA. Under 1996 a very extensive international collaboration network has been further developed and many collaborative research projects have been launched. 31 refs

Design Of Toyota Home Service Applications For AUTO2000 Based On Android

OpenAIRE

Aswin, Arief Rahmadian

2016-01-01

AUTO2000 is a network of sales services, maintenance, repair and supply of spare parts Toyota that was established in 1975 under the name Astra Motor Sales, in 1989 changed its name to AUTO2000 with management that has been handled entirely by PT. Astra International Tbk. Services provided by AUTO2000 one of which is a service of Toyota Home Service, a service provided by the service vehicle Auto 2000 where customers can service their vehicles without having to come to the dealership Auto 200...

[Scientific production and cancer-related collaboration networks in Peru 2000-2011: a bibliometric study in Scopus and Science Citation Index].

Science.gov (United States)

Mayta-Tristán, Percy; Huamaní, Charles; Montenegro-Idrogo, Juan José; Samanez-Figari, César; González-Alcaide, Gregorio

2013-03-01

A bibliometric study was carried out to describe the scientific production on cancer written by Peruvians and published in international health journals, as well as to assess the scientific collaboration networks. It included articles on cancer written in Peru between the years 2000 and 2011 and published in health journals indexed in SCOPUS or Science Citation Index Expanded. In the 358 articles identified, an increase in the production was seen, from 4 articles in 2000 to 57 in 2011.The most studied types were cervical cancer (77 publications); breast cancer (53), and gastric cancer (37). The National Institute of Neoplastic Diseases (INEN) was the most productive institution (121 articles) and had the highest number of collaborations (180 different institutions). 52 clinical trials were identified, 29 of which had at least one author from INEN. We can conclude that, cancer research is increasing in Peru, the INEN being the most productive institution, with an important participation in clinical trials.

Environmental radioactivity 1996

International Nuclear Information System (INIS)

1997-01-01

Environmental Radioactivity in New Zealand and Rarotonga : annual report 1996 was published in May this year. The 1996 environmental radioactivity monitoring programme included, as usual, measurements in New Zealand and the Cook Islands of atmospheric, deposited and dairy product radioactivity. The environment in the New Zealand and Cook Island regions has now virtually returned to the situation in the 'pre-nuclear' era. The contination of monitoring, although at a reduced level of intensity, is basically to ensure that any change from the present state, due to any source of radioactivity does not go undetected or unquestioned. (author)

Pyrenean meadows in Natura 2000 network: grass production and plant biodiversity conservation

Directory of Open Access Journals (Sweden)

Ramón Reiné

2014-02-01

Full Text Available In semi-natural mountain meadows, yield and forage quality must be reconciled with plant biodiversity conservation. This study was performed to analyze the relationships between these three parameters. To quantify plant biodiversity and pastoral value (PV, phytosociological inventories were performed in 104 semi-natural meadows in the Central Spanish Pyrenees included in the Natura 2000 network. Forage yields were calculated and forage samples were analyzed for relative feed value (RFV. We identified two main types of meadows: (i those that had “more intensive management,” relatively close to farm buildings, with little or no slope, dominated by grasses, with low plant biodiversity, high PV and yield, but low forage quality and (ii those that had “less intensive management,” distant from farm buildings, on slopes, richer in “other forbs”, with high plant biodiversity and forage quality, but low PV and yield. Conservation policies should emphasize less intensive management practices to maintain plant diversity in the semi-natural meadows in the Pyrenees. The widespread view that “other forbs” have low nutritional value should be revised in future research. These species often are undervalued by the PV method, because their nutritional quality, digestibility and intake are poorly understood.

Production and screening of carbon products precursors from coal. Quarterly progress report, July 1, 1996--September 30, 1996

Energy Technology Data Exchange (ETDEWEB)

Zondlo, J.; Stiller, A.

1996-10-25

This quarterly report covers activities during the period from July 1, 1996 through September 30, 1996 on the development of carbon products precursor materials from coal. The first year of the project ended in February, 1996; however, the WVU research effort continued through August 14, 1997 on a no-cost extension of the original contract. PETC chose to exercise the option for continuation of the projects and $100,000 became available on August 9, 1996. The objective for year two is to focus on development of those carbon products from coal-based solvent extract precursors which have the greatest possibility for commercial success.

CTBTO Annual Report 2000

International Nuclear Information System (INIS)

2001-04-01

This report provides coverage of the achievements during the year 2000 in the implementation of the Commission's seven Major Programmes: International Monitoring System; International Data Centre; Communications; On-Site Inspection; Evaluation; Policy-Making Organs; and Administration, Coordination and Support. In regard to the International Monitoring System (IMS), the responsibilities of the Preparatory Commission include establishing a worldwide network of 321 stations (170 seismic, 60 infrasound, 11 hydroacoustic and 80 radionuclide stations) supported by 16 radionuclide laboratories. This network will be capable of registering vibrations underground, in the air and in the sea, as well as detect- ing radionuclides released into the atmosphere from a nuclear explosion. Much progress has been made in the IMS programme: about 31% of the stations have been installed or substantially meet the required specifications (compared with about 16% at the end of 1999); and 21 stations already send data to the International Data Centre over the Global Communications Infrastructure. A significant milestone was reached in 2000 with the first certification of stations as meeting all the technical requirements for IMS stations. By the end of 2000, the PTS had certified 11 stations. The main function of the International Data Centre (IDC) is to continuously monitor the data received from IMS stations for events that have characteristics of nuclear explosions and to send the results to all States Signatories for their final analysis. The Global Communications Infrastructure (GCI) provides for a two way transmission of data through a satellite communications network between the IMS stations, the IDC in Vienna and the National Data Centres (NDCs) of States Signatories. The plan for the establishment of the IDC is based on the experience of the prototype IDC in Arlington, Virginia, USA, and the PTS has benefited extensively from working in close cooperation with the prototype IDC to

1996: Disarmament at a critical juncture

International Nuclear Information System (INIS)

1997-01-01

The document contains edited transcript of the presentations made by Joseph Rotblat, winner of the Nobel Prize, and by Minoru Ohmuta and Hidehiko Yoko-o, speaking for the Mayors of Hiroshima and Nagasaki, at the United Nations on 25 April 1996, excerpts from the panel discussion on South Asia at a Critical Turning Point held on 24 September 1996, and extensive excerpts from the panel discussions held 22-24 October 1996 during Disarmament Week at the United Nations

Eesti proosa 1996 : midagi olulist : [katkend] / Udo Uibo

Index Scriptorium Estoniae

Uibo, Udo, 1956-

2009-01-01

Katkend Udo Uibo artiklist "Eesti proosa 1996 : midagi olulist". Katkendis vaadeldakse Jüri Ehlvesti romaani "Ikka veel Bagdadis" (Tartu : EÜS Veljesto kirjastus, 1996) ja novellikogu "Krutsiaania" (Tallinn : Tuum, 1996)

Eficacia y eficiencia del Programa de Control de Tuberculosis en Rioja, San Martín-Perú durante el periodo 1996 - 2000

Directory of Open Access Journals (Sweden)

Daniel Mendoza R

2001-01-01

Full Text Available Objetivo: Evaluar la eficacia y eficiencia del Programa de Control de Tuberculosis (PCT en la Red de Servicios de Salud Rioja (RSSR, San Martín-Perú, durante el período 1996-2000. Materiales y métodos: Estudio descriptivo longitudinal, que utiliza como fuente de información retrospectiva los libros de registro y seguimiento de pacientes con tuberculosis (TB del PCT de la RSSR. La muestra incluyó a los pacientes diagnosticados de TB y registrado en el PCT, excluyéndose los pacientes que presentaron reacción adversa a medicamentos que motivó cambio del esquema de tratamiento o pacientes con tratamiento irregular. Se realizó el análisis segun año, microrred (MR y esquema de tratamiento. Resultados: Se incluyeron 355 pacientes. La eficacia a nivel de red fue 99.7% y la eficiencia 93.0%. El porcentaje de abandonos fue 2.0%, fracasos 0.3%, transferencias sin confirmar (TSC 1.4%, y fallecidos 2.8%. No se determinó ninguna tendencia significativa a lo largo del periodo estudiado. A nivel de microrred, la menor eficiencia la presentaron la MR-5 y MR-3; ambas microrredes también tuvieron el mayor porcentaje de abandonos. El mayor porcentaje de fallecidos lo presentaron la MR-5 y MR-6. Se encontró un alto porcentaje de abandonos en pacientes que recibieron Esquema III y el porcentaje de fallecidos fue mayor en los que recibieron Esquema II. Conclusiones: La eficacia y eficiencia presentaron, en general, valores adecuados en la RSSR; sin embargo, pudimos identificar algunas microrredes y subpoblaciones de pacientes con altos porcentajes de fallecimientos, abandonos y TSC, situación que necesita ser corregida.

“Mind the gap!” – How well does Natura 2000 cover species of European interest?

Directory of Open Access Journals (Sweden)

Bernd Gruber

2012-12-01

Full Text Available Setting aside protected areas is widely recognized as one of the most effective measures to prevent species from extinction. Accordingly, there has been a tremendous effort by governments worldwide to establish protected areas, resulting in over 100,000 sites, which are set aside, to achieve the 10% target proposed at the Fourth World Park Congress in 1992 in Caracas. The main effort of the European to achieve this target is the Natura 2000 network of protected areas, comprising over 25,000 sites representing 18 % of the area of the 27 Member States of the European Union. The designation of Natura 2000 sites was based on species and habitats listed in the Annexes of the Habitats and Birds Directive. The effectiveness of the selection process and the resulting Natura 2000 network has often been questioned as each country made its designations largely independently and in most cases without considering the theories of optimal reserve site selection. However, the effectiveness of the selection process and the Natura 2000 network has never been explicitly analysed at the European scale. Here we present such an analysis focusing on the representation of Annex II species of the Habitats Directive in the Natura 2000 network relative to a random allocation of species to sites. Our results show that the network is effective in covering target species and minimizing the number of gap species (i.e. species not represented in a single site of the Natura 2000 network. We demonstrate that the representation is uneven among species. Some species are overrepresented and many species are only represented in a low number of sites. We show that this is mainly due to differing patterns in species ranges, as wide-spread species are inevitably represented in many sites, but narrow ranged species are often covered only by a small number of sites in a particular area. Finally, we propose a representation index that detects species that are underrepresented and could be

Friendly network robotics; Friendly network robotics

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-03-01

This paper summarizes the research results on the friendly network robotics in fiscal 1996. This research assumes an android robot as an ultimate robot and the future robot system utilizing computer network technology. The robot aiming at human daily work activities in factories or under extreme environments is required to work under usual human work environments. The human robot with similar size, shape and functions to human being is desirable. Such robot having a head with two eyes, two ears and mouth can hold a conversation with human being, can walk with two legs by autonomous adaptive control, and has a behavior intelligence. Remote operation of such robot is also possible through high-speed computer network. As a key technology to use this robot under coexistence with human being, establishment of human coexistent robotics was studied. As network based robotics, use of robots connected with computer networks was also studied. In addition, the R-cube (R{sup 3}) plan (realtime remote control robot technology) was proposed. 82 refs., 86 figs., 12 tabs.

Results of Geothermal Exploitation in Mexico During 1996; Resultados de la explotacion geotermica en Mexico en 1996

Energy Technology Data Exchange (ETDEWEB)

Gutierrez Negrin, Luis C. A. [Gerencia de Proyectos Geotermoelectricos de la Comision Federal de Electricidad, Morelia (Mexico)

1997-01-01

During 1996, 56.2 million tons of steam were produced, at an average annual rate of 6,416 tons per hour (t/h), to supply enough steam to operate of 26 geothermal-electric plants in three geothermal fields, which represent an installed capacity of 743 MW. To accomplish that production, 177 geothermal wells were operated at an average annual production of 36 t/h of steam. Electricity generation was 5,737 gigawatts-hour, which represent 3.8% of the whole electrical energy generated in Mexico in 1996. Production of steam and generation of electricity were increased in 1996, comparing with 1994 and 1995. However, unitary costs were practically the same between 1995 and 1996. The Comision Federal de Electricidad (Federal Commission for Electricity, or CFE) has programmed several geothermal- electric projects to increase the installed capacity in the fields under exploitation in new fields. Also, the CFE has some non electrical projects to reach an integral use of geothermics in Mexico. [Espanol] A fin de suministrar el vapor necesario para la generacion de 26 plantas geotermoelectricas instaladas en tres campos geotermicos, con una capacidad total de 743 megawatts (MW) durante 1996 se produjeron 56.2 millones de toneladas de vapor, a una tasa media anual de 6,416 toneladas por hora (t/h). Ello implico la operacion de 177 pozos productores, con una produccion de la energia electrica generada en Mexico en 1996. Tanto la produccion de vapor como la generacion de electricidad en 1996 se incrementaron con respecto a los anos precedentes de 1994 y 1995, pese a que los costos unitarios se mantuvieron practicamente constantes entre 1995 y 1996. La Comision Federal de Electricidad (CFE) tiene en programa varios proyectos geotermoelectricos para incrementar la capacidad instalada en los campos en explotacion y para iniciar el aprovechamiento en campos nuevos, asi como proyectos no electricos para conseguir un aprovechamiento integral de la geotermia en Mexico.

Energy Balance of the Santa Catarina State - Series 1980 -1996; Balanco energetico do Estado de Santa Catarina - Serie 1980-1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-07-01

This energy balance of the Santa Catarina State presents the following main topics that can be outstanding: economic aspects; supply and demand of energy by source 1980-1996; energy consumption by sector 1980/1996; energy interchange; and balance of the transformation centers 1980/1996.

Reduced risk of surgical site infections through surveillance in a network

NARCIS (Netherlands)

Geubbels, Eveline L. P. E.; Nagelkerke, Nico J. D.; Mintjes-de Groot, A. Joke; Vandenbroucke-Grauls, Christina M. J. E.; Grobbee, Diederick E.; de Boer, Annette S.

2006-01-01

OBJECTIVE: To estimate the effect of multicentre surveillance for nosocomial infections on patients' risk of surgical site infection (SSI). DESIGN: Prospective multi-centre cohort study, from January 1996 to December 2000. SETTING: Acute care hospitals in The Netherlands. STUDY PARTICIPANTS: All 50

Accelerator operation in 1995-1996

International Nuclear Information System (INIS)

Loyer, F.

1998-01-01

This report presents the operation of the GANIL accelerator between 1995 and 1996. A table is given in which the time distribution of the accelerator operation in the two years is indicated as: beam availability, time devoted to nuclear and non-nuclear physics research, radioactive ion separator operation, industrial irradiation, machine studies and maintenance. A statistics of the accelerated elements and their energy (MeV/u) shows an increase in the number of beam types and new beams from 18 and 9, respectively, in 1995 to 19 and 11 respectively in 1996. The report mentions also the safety incident of June 9, 1995, the failures in operation in 1995-1996 and events connected to SISSI, UGS-R and THI operations

Improving the security of the Hwang-Su protocol for mobile networks

African Journals Online (AJOL)

user

Improving the security of the Hwang-Su protocol for mobile networks. Miloud Ait ... But, it is threatened by weak ... Wireless networks (IEEE standard 802.11 1996, Gast 2005) have allowed computer systems to exchange data without cable.

ENSINANDO POLITICA.UMA ANÁLISE DO TELECURSO 2000.

Directory of Open Access Journals (Sweden)

Ivete Manetzeder Keil

2007-12-01

Full Text Available This study problematizes the power discourse present in the TV classes of the First Grade History Program of Telecurso 2000, produced and aired by Globo Network Television, seeking to register points that influence subject’s production and their world visions. In this context, it emphasizes television as a learning space that privileges a despolitized teaching of history. The First Grade History Program of Telecurso 2000, in that it does not present a critical history and despolitizes the facts that are aired, produces an artificial world that becomes the dominators´ stage for their actions and discourse.

Annual report 1995-1996

International Nuclear Information System (INIS)

1996-01-01

The annual report including financial statements of the Canada-Nova Scotia Offshore Petroleum Board (the Board) was presented for the fiscal year ending March 31, 1996. The Board's responsibilities include ensuring safe working conditions for offshore petroleum activities, protection of the environment during offshore petroleum operations, and management of offshore petroleum resources. In February of 1996, the successful completion of the CP3A well at Cohasset added in excess of 1,000,000 barrels of recoverable oil to the field. The report also discussed efforts towards improved levels of communication with government departments, agencies and other organizations having an interest in offshore oil activities, agreements concluded with the Canadian Coast Guard and the Canadian Transportation Accident Investigation and Safety Board, the Canada-Nova Scotia Environmental Coordinating Committee, the National Energy Board, and the Canada-Newfoundland Offshore Petroleum Board. During the fiscal year production amounted to 7.5 million barrels of Scotia light crude oil. In another highlight, exploratory permit was issued for the Sable Island field, a proposed development of six gas fields, effective January 1, 1996. tabs

An updated analysis of the Lucas Heights Climatology - 1975 to 1996

Energy Technology Data Exchange (ETDEWEB)

Clark, G.H

1997-06-01

Meteorological data collected from 1975 to 1996 in the Lucas Heights region have been summarised to provide an update on the climatology. Initially data were recorded in analogue form but since 1991 advanced digital recording systems have allowed more accurate and extensive statistics to be analysed. Since 1993 a network of meteorological stations has been installed through the surrounding area to investigate the influence of complex terrain on wind flow and atmospheric dispersion patterns. A large data volumes is presented together with some initial interpretation of these complex terrain influences on the Lucas Heights region climatolology. 33 refs., 25 tabs., 45 figs.

Impact of national cancer policies on cancer survival trends and socioeconomic inequalities in England, 1996-2013: population based study

Science.gov (United States)

Rachet, Bernard; Belot, Aurélien; Maringe, Camille; Coleman, Michel P

2018-01-01

Abstract Objective To assess the effectiveness of the NHS Cancer Plan (2000) and subsequent national cancer policy initiatives in improving cancer survival and reducing socioeconomic inequalities in survival in England. Design Population based cohort study. Setting England. Population More than 3.5 million registered patients aged 15-99 with a diagnosis of one of the 24 most common primary, malignant, invasive neoplasms between 1996 and 2013. Main outcome measures Age standardised net survival estimates by cancer, sex, year, and deprivation group. These estimates were modelled using regression model with splines to explore changes in the cancer survival trends and in the socioeconomic inequalities in survival. Results One year net survival improved steadily from 1996 for 26 of 41 sex-cancer combinations studied, and only from 2001 or 2006 for four cancers. Trends in survival accelerated after 2006 for five cancers. The deprivation gap observed for all 41 sex-cancer combinations among patients with a diagnosis in 1996 persisted until 2013. However, the gap slightly decreased for six cancers among men for which one year survival was more than 65% in 1996, and for cervical and uterine cancers, for which survival was more than 75% in 1996. The deprivation gap widened notably for brain tumours in men and for lung cancer in women. Conclusions Little evidence was found of a direct impact of national cancer strategies on one year survival, and no evidence for a reduction in socioeconomic inequalities in cancer survival. These findings emphasise that socioeconomic inequalities in survival remain a major public health problem for a healthcare system founded on equity. PMID:29540358

Status Report of INIS Operations April 1996 - April 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-07-01

The total number of records announced in Atomindex volume 27 (1996) was 80,516. A total of 77 Members sent input for volume 27 (1996) (78 for volume 26 (1995)). The INIS Secretariat carried out a comprehensive effort in 1996 to encourage Liaison Officers to participate more actively in INIS. Liaison Officers of 17 countries were contacted in July to remind them that they did not send any input since the beginning of 1996. As a result of this activity 10 countries sent input for the first time in 1996.

Status Report of INIS Operations April 1996 - April 1997

International Nuclear Information System (INIS)

1997-01-01

The total number of records announced in Atomindex volume 27 (1996) was 80,516. A total of 77 Members sent input for volume 27 (1996) (78 for volume 26 (1995)). The INIS Secretariat carried out a comprehensive effort in 1996 to encourage Liaison Officers to participate more actively in INIS. Liaison Officers of 17 countries were contacted in July to remind them that they did not send any input since the beginning of 1996. As a result of this activity 10 countries sent input for the first time in 1996

ARTICULATED MODES OF INTEGRATION: THE STRUCTURING OF THE EUROPEAN URBAN SYSTEM

OpenAIRE

Rozenblat, Céline; Pumain, Denise

2008-01-01

European integration is for its essential part reflected in the building of urban networks that are increasing interdependencies between cities. Evidence of this process is brought through the observation of a variety of networks whose nodes are located in cities, especially the development of international functions. Analysis of airlines networks (2000) as well as the economic linkages between multinational firms (1990,1996) provide a good illustration reflecting the dominant features of suc...

vhv supply networks, problems of network structure

Energy Technology Data Exchange (ETDEWEB)

Raimbault, J

1966-04-01

The present and future power requirements of the Paris area and the structure of the existing networks are discussed. The various limitations that will have to be allowed for to lay down the structure of a regional transmission network leading in the power of the large national transmission network to within the Paris built up area are described. The theoretical solution that has been adopted, and the features of its final achievement, which is planned for about the year 2000, and the intermediate stages are given. The problem of the structure of the National Power Transmission network which is to supply the regional network was studied. To solve this problem, a 730 kV voltage network will have to be introduced.

Shell Canada Limited 1996 annual report

International Nuclear Information System (INIS)

1996-01-01

Shell Canada Resources Limited is one of Canada's largest producers of crude oil, natural gas, natural gas liquids, sulphur and bitumen. This annual report for 1996 presented a summary review of operations and a summary of the Company's audited consolidated financial statements. Overall, the resources business delivered exceptional results in 1996. The oil products and chemicals businesses did not perform as well as expected. This less than satisfactory performance of the oil products and chemicals divisions of the the Company is reflected in the financial returns which, after excluding revenues from asset sales, left operating earnings $ 59 million below those of 1996. tabs., figs

Paul Scherrer Institut annual report 1996. Annex II: PSI life sciences and Institute for Medical Radiobiology Newsletter 1996

International Nuclear Information System (INIS)

Kuehne, G.; Gschwend, B.

1997-01-01

This annex to the PSI Annual Report 1996 reports on the progress achieved by the PSI Department II during 1996 in the fields of radiation medicine, radiopharmacy, radiation hygiene, positron emission tomography and medical radiobiology. figs., tab., refs

Savannah River Site 1996 epidemiologic surveillance report

International Nuclear Information System (INIS)

2000-01-01

This report provides a summary of epidemiologic surveillance data collected from Savannah River Site from January 1, 1996 through December 31, 1996. The data were collected by a coordinator at Savannah River Site and submitted to the Epidemiologic Surveillance Data Center located at Oak Ridge Institute for Science and Education, where quality control procedures and preliminary data analyses were carried out. The analyses were interpreted and the final report prepared by the DOE Office of Epidemiologic Studies. The information in this report provides highlights of the data analyses conducted on the 1996 data collected from Savannah River Site. The main sections of the report include: work force characteristics; absences due to injury or illness lasting 5 or more consecutive workdays; workplace illnesses, injuries, and deaths that were reportable to the Occupational Safety and Health Administration (''OSHA-recordable'' events); and disabilities and deaths among current workers. The 1996 report includes a new section on time trends that provides comparative information on the health of the work force from 1994 through 1996

Report on investigation in fiscal 2000 of industrial technology exchange with international networking organizations; 2000 nendo kokusaitekina network gata soshiki tono sangyo gijutsu koryu chosa hokokusho

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-03-01

With an objective to promote exchange of industrial technologies, investigations and analyses were made on identification of the current status of networking organizations in different countries working as windows for industrial technology exchange, and on the actual status of technology commercialization methods in overseas incubators. Activities were taken in the following three fields: 1) the current status of networking organizations and incubators in different countries, 2) typology of technology commercialization, technical fields, and success factors, and 3) possibility of the use of technology information in the networking organizations. In Item 1), investigations were performed on the current status and actual activity status of the networking organizations including research parks and individual incubators intended of information exchange, mainly in the United States, UK, and Finland. In Item 2), considerations are given on the points related to technology incubation based on the information about the networking organizations and incubators in each country, and the way the industry-academia cooperation should be. In Item 3), discussions were given on the roles of the networking organizations and the possibility of utilization of technological information in the networking organizations in Japan. (NEDO)

CONSTRUCTION THEORY AND NOISE ANALYSIS METHOD OF GLOBAL CGCS2000 COORDINATE FRAME

Directory of Open Access Journals (Sweden)

Z. Jiang

2018-04-01

Full Text Available The definition, renewal and maintenance of geodetic datum has been international hot issue. In recent years, many countries have been studying and implementing modernization and renewal of local geodetic reference coordinate frame. Based on the precise result of continuous observation for recent 15 years from state CORS (continuously operating reference system network and the mainland GNSS (Global Navigation Satellite System network between 1999 and 2007, this paper studies the construction of mathematical model of the Global CGCS2000 frame, mainly analyzes the theory and algorithm of two-step method for Global CGCS2000 Coordinate Frame formulation. Finally, the noise characteristic of the coordinate time series are estimated quantitatively with the criterion of maximum likelihood estimation.

Electricity market 2000

Energy Technology Data Exchange (ETDEWEB)

Korsfeldt, T.; Petsala, B.

2000-08-01

The electricity markets in the Nordic countries have undergone major changes since the electricity market reform work was started in the early 1990s. Sweden, Norway and Finland have a common electricity market since 1996.The work of also reforming the Danish electricity market was begun in the year 2000. The objective of the electricity market reform is to introduce increased competition,to give the consumers greater freedom of choice and also, by open and expanded trade in electricity, create the conditions for efficient pricing. The Swedish National Energy Administration is the supervisory authority as specified in the Electricity Act, and one of the tasks entrusted to it by the Government is to follow developments on the electricity market and to regularly compile and report current market information. The purpose of the present publication is to meet the need for generalized and readily accessible information on the conditions on the Nordic markets.The publication includes summaries of information from recent years concerning electricity generation and utilization in the Nordic countries, the structure of the electricity market from the players' perspective trade in electricity in the Nordic countries and in Northern Europe, electricity prices in the Nordic and other countries, and the impact of the electricity sector on the environment.

Electricity market 2000

International Nuclear Information System (INIS)

Korsfeldt, T.; Petsala, B.

2000-08-01

The electricity markets in the Nordic countries have undergone major changes since the electricity market reform work was started in the early 1990s. Sweden, Norway and Finland have a common electricity market since 1996.The work of also reforming the Danish electricity market was begun in the year 2000. The objective of the electricity market reform is to introduce increased competition,to give the consumers greater freedom of choice and also, by open and expanded trade in electricity, create the conditions for efficient pricing. The Swedish National Energy Administration is the supervisory authority as specified in the Electricity Act, and one of the tasks entrusted to it by the Government is to follow developments on the electricity market and to regularly compile and report current market information. The purpose of the present publication is to meet the need for generalized and readily accessible information on the conditions on the Nordic markets.The publication includes summaries of information from recent years concerning electricity generation and utilization in the Nordic countries, the structure of the electricity market from the players' perspective trade in electricity in the Nordic countries and in Northern Europe, electricity prices in the Nordic and other countries, and the impact of the electricity sector on the environment

Chronique de jurisprudence suisse (1996-2004)

DEFF Research Database (Denmark)

Cavaleri, Sylvie Cécile

2005-01-01

The article reviews case law on the Swiss Statute on Private International Law from 1996 to 2004. Sylvie Cavaleri's contribution concerns provisions on insolvency and bankruptcy.......The article reviews case law on the Swiss Statute on Private International Law from 1996 to 2004. Sylvie Cavaleri's contribution concerns provisions on insolvency and bankruptcy....

The Permanent GPS Network In The Iberian Peninsula

Science.gov (United States)

Fernandes, R. M. S.; Bastos, L.; Ambrosius, B. A. C.; Noomen, R.

In recent years, the number of permanent GPS sites in the Iberia Peninsula has in- creased significantly: in the beginning of 1996 there were just 2 sites with publicly available data. This number had risen to 15 by the end of 1999, and recently (end of 2001), it has reached 18. For many sites, the observation time-span is already suffi- ciently long to derive a reliable estimate of the motion of the stations. Combined with the relatively good geographical distribution of the sites, this velocity field contains unique information to study the tectonics of the Iberian Peninsula, both internally and with respect to the rest of Europe. In the framework of a combined DEOS-AOUP research project called GIN (GPS Iberian Network), the data of all available GPS sites in the region (including some in North Africa, the Azores Archipelago and France) are being processed on a daily basis since the middle of 2000 (with backward processing extending to January 1996). Following this project, DEOS became an official LAC (Local Analysis Centre) of EU- REF in the beginning of 2001. The DEOS weekly solutions are included in the official EUREF analysis chain, resulting in weekly coordinate solutions for the entire EU- REF network. The two solutions (GIN &EUREF) are computed by the DEOS-AOUP group using the same software, but applying different strategies. The differences in the solutions are analysed in order to pinpoint data problems and processing errors. Furthermore, the GIN velocity field is compared with the one derived from the offi- cial EUREF solution. Special attention is paid to the different procedures to link the solutions into a unified reference frame. Finally, this paper presents a preliminary interpretation of the contemporary tectonics of the Iberian Peninsula based on the derived velocity fields. There is evidence of significant intra-plate deformation in the Iberia region and there are indications that the Iberian block exhibits a differential motion with respect to

Report of the eighth meeting of the scientific committee of the IAEA/WHO network of SSDLs. IAEA, Vienna, 5-9 October 1998

International Nuclear Information System (INIS)

Andreo, P.

1999-01-01

The report of the seventh meeting (held in Sept/Oct., 1996) of the Scientific Committee (SSC) of the IAEA/WHO Network of Secondary Standard Dosimetry Laboratories (SSDL) was published in the SSDL Newsletter No. 36, January 1997. Conforming to its Terms of Reference, the SSC evaluated the activities of the DMRP reported for 1997-1998 and discussed the proposed programme for the Section for 1999-2000. Lone range plans for seminars and teaching courses (until 2002) were also discussed, as well as a strategic plan for the Section. The scope of the evaluation addressed the questions of: (i) the objective of the programme areas, (ii) the impact (benefit to the Member States), and (iii) the continuing relevance of Agency activities

Annual Hanford seismic report - fiscal year 1996

International Nuclear Information System (INIS)

Hartshorn, D.C.; Reidel, S.P.

1996-12-01

Seismic monitoring (SM) at the Hanford Site was established in 1969 by the US Geological Survey (USGS) under a contract with the US Atomic Energy Commission. Since 1980, the program has been managed by several contractors under the US Department of Energy (USDOE). Effective October 1, 1996, the Seismic Monitoring workscope, personnel, and associated contracts were transferred to the USDOE Pacific Northwest National Laboratory (PNNL). SM is tasked to provide an uninterrupted collection and archives of high-quality raw and processed seismic data from the Hanford Seismic Network (HSN) located on and encircling the Hanford Site. SM is also tasked to locate and identify sources of seismic activity and monitor changes in the historical pattern of seismic activity at the Hanford Site. The data compiled are used by SM, Waste Management, and engineering activities at the Hanford Site to evaluate seismic hazards and seismic design for the Site

UNIDIR and its activities. 1996

International Nuclear Information System (INIS)

1996-04-01

The United Nations Institute for Disarmament Research (UNIDIR) was established by the General Assembly for the purpose of undertaking independent research on disarmament and related problems, particularly international security issues. This paper covers the description of UNIDIR mandate, organization and finance, fellowship program, research program for 1996 and beyond, projects to be conducted in 1996, activities done in 1994/1995, list of the major conferences held, list of publications, UNIDIR voluntary contributors, and the statute of this organization

Sixty Years of Mogollon Archaeeology: Papers From the Ninth Mogollon Conference, Silver City, New Mexico, 1996, by Stephanie M Whittlesey, SRI Press, Tucson, 1999

Directory of Open Access Journals (Sweden)

Stephen E. Nash

2000-11-01

Full Text Available "The diverse papers that were presented at the 1996 Mogollon Conference reveal the geographic, intellectual, and temporal scope of contemporary Mogollon archaeology, and almost nothing of the historical controversy surrounding the Mogollon culture concept" (Whittlesey 1999:vii. With these words, Stephanie M. Whittlesey makes it clear in the preface that Sixty Years of Mogollon Archaeology: Papers From the Ninth Mogollon Conference, Silver City, New Mexico, 1996 (SRl Press 2000 contains few papers on the history of Mogollon archaeology. It might therefore be more appropri­ately titled "Current Research in Mogollon Archaeology." The volume was apparently named to honor the sixtieth anniversary of Emil Haury's 1936 publication The Mogollon Culture of Southwestern New Mexico, which described the Mogollon for the first time.

Agency ownership, patient payment source, and length of service in home care, 1992 2000.

Science.gov (United States)

Han, Beth; McAuley, William J; Remsburg, Robin E

2007-08-01

Little is known about whether an association exists between agency ownership and length of service among home care patients with different payment sources. This study investigated how for-profit and not-for-profit agencies responded to policy changes in the 1990s with respect to length of service. We examined length of service among 37,364 home care patients using the 1992, 1994, 1996, 1998, and 2000 National Home and Hospice Care Surveys. We used Kaplan-Meier methods and Cox regression models. After we adjusted for patient and agency characteristics, our results revealed that agency ownership was not associated with length of service for patients with private insurance, Medicare, Medicaid, Medicare plus Medicaid, or Medicare plus private insurance. This finding was consistent from 1992 through 2000. Length of service among patients with Medicare decreased significantly from 1998 through 2000, but length of service among patients with Medicaid did not change significantly from 1992 through 2000. Agency ownership is not associated with patient length of service in home care. Regardless of the policy changes in the home care arena in the 1990s, for-profit and not-for-profit home health agencies behaved similarly with regard to length of service among patients within differently structured payment systems.

eHealth services and Directive on Electronic Commerce 2000/31/EC.

Science.gov (United States)

Van Gyseghem, Jean-Marc

2008-01-01

We often restrict the analysis of eHealth services to a concept of privacy. In this article, we'll demonstrate that other legislation can apply to those services as Directive 2000/31/EC on Ecommerce. By creating telematic networks or infrastructure, eHealth services are offering information services. But what are the consequences with such concept? What are the duties and rights for the actors of the network(s)? We'll try to answer to some questions, even if it won't be exhaustive.

A coherent Ising machine for 2000-node optimization problems

Science.gov (United States)

Inagaki, Takahiro; Haribara, Yoshitaka; Igarashi, Koji; Sonobe, Tomohiro; Tamate, Shuhei; Honjo, Toshimori; Marandi, Alireza; McMahon, Peter L.; Umeki, Takeshi; Enbutsu, Koji; Tadanaga, Osamu; Takenouchi, Hirokazu; Aihara, Kazuyuki; Kawarabayashi, Ken-ichi; Inoue, Kyo; Utsunomiya, Shoko; Takesue, Hiroki

2016-11-01

The analysis and optimization of complex systems can be reduced to mathematical problems collectively known as combinatorial optimization. Many such problems can be mapped onto ground-state search problems of the Ising model, and various artificial spin systems are now emerging as promising approaches. However, physical Ising machines have suffered from limited numbers of spin-spin couplings because of implementations based on localized spins, resulting in severe scalability problems. We report a 2000-spin network with all-to-all spin-spin couplings. Using a measurement and feedback scheme, we coupled time-multiplexed degenerate optical parametric oscillators to implement maximum cut problems on arbitrary graph topologies with up to 2000 nodes. Our coherent Ising machine outperformed simulated annealing in terms of accuracy and computation time for a 2000-node complete graph.

Performance profiles of major energy producers 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-01-01

This publication examines developments in the operations of the major US e energy-producing companies on a corporate level, by major line of business, by major function within each line of business, and by geographic area. In 1996, 24 companies filed Form EIA-28. The analysis and data presented in this report represents the operations of the Financial Reporting System companies in the context of their worldwide operations and in the context of the major energy markets which they serve. Both energy and nonenergy developments of these companies are analyzed. Although the focus is on developments in 1996, important trends prior to that time are also featured. Sections address energy markets in 1996; key financial developments; oil and gas exploration, development, and production; downstream petroleum in 1996; coal and alternative energy; and foreign direct investment in US energy. 30 figs., 104 tabs.

Performance profiles of major energy producers 1996

International Nuclear Information System (INIS)

1998-01-01

This publication examines developments in the operations of the major US e energy-producing companies on a corporate level, by major line of business, by major function within each line of business, and by geographic area. In 1996, 24 companies filed Form EIA-28. The analysis and data presented in this report represents the operations of the Financial Reporting System companies in the context of their worldwide operations and in the context of the major energy markets which they serve. Both energy and nonenergy developments of these companies are analyzed. Although the focus is on developments in 1996, important trends prior to that time are also featured. Sections address energy markets in 1996; key financial developments; oil and gas exploration, development, and production; downstream petroleum in 1996; coal and alternative energy; and foreign direct investment in US energy. 30 figs., 104 tabs

French natural gas industry. Key-data 2000

International Nuclear Information System (INIS)

Anon.

2001-01-01

The year 2000 is the year of deregulation of the European gas market. This short article reports on some significant economical data taken from a brochure edited by the French gas association: transport of natural gas (main suppliers), network (pipelines, distribution system), consumption (industry, residential and tertiary sectors), uses (vehicles, cogeneration units), liquefied petroleum gases (consumption in residential-tertiary, industry, agriculture and automotive applications). (J.S.)

Visualizing Consolidation in the Global Seed Industry: 1996–2008

Directory of Open Access Journals (Sweden)

Philip H. Howard

2009-12-01

Full Text Available The commercial seed industry has undergone tremendous consolidation in the last 40 years as transnational corporations entered this agricultural sector, and acquired or merged with competing firms. This trend is associated with impacts that constrain the opportunities for renewable agriculture, such as reductions in seed lines and a declining prevalence of seed saving. To better characterize the current structure of the industry, ownership changes from 1996 to 2008 are represented visually with information graphics. Since the commercialization of transgenic crops in the mid-1990s, the sale of seeds has become dominated globally by Monsanto, DuPont and Syngenta. In addition, the largest firms are increasingly networked through agreements to cross-license transgenic seed traits.

Domesday 2000 - a National Land Information System for Britain

DEFF Research Database (Denmark)

Sabel, C. E.; Ralphs, M. P.

1992-01-01

The Domesday 2000 Project aims to ensure that by the year 2000 there will be a National Land Information System for Britain, containing up to date information on land and property ownership, value and use. It is proposed that the system will make use of distributed databases connected over a wide......-area network, to integrate data from a wide variety of sources, using GIS technology to enable interested parties to access the on-line information via locally based terminals. This article explains the background to the project, before moving on to discuss the proposed format and data holdings...

Environmental Report 1996

International Nuclear Information System (INIS)

Harrach, R.J.; Gallegos, G.M.; Tate, P.J.

1997-01-01

This summary provides an overview of LLNL's environmental activities in 1996, including radiological and nonradiological surveillance, effluent and compliance monitoring, remediation, assessment of radiological releases and doses, and determination of the impact of LLNL operations on the environment and public health

Impact of national cancer policies on cancer survival trends and socioeconomic inequalities in England, 1996-2013: population based study.

Science.gov (United States)

Exarchakou, Aimilia; Rachet, Bernard; Belot, Aurélien; Maringe, Camille; Coleman, Michel P

2018-03-14

To assess the effectiveness of the NHS Cancer Plan (2000) and subsequent national cancer policy initiatives in improving cancer survival and reducing socioeconomic inequalities in survival in England. Population based cohort study. England. More than 3.5 million registered patients aged 15-99 with a diagnosis of one of the 24 most common primary, malignant, invasive neoplasms between 1996 and 2013. Age standardised net survival estimates by cancer, sex, year, and deprivation group. These estimates were modelled using regression model with splines to explore changes in the cancer survival trends and in the socioeconomic inequalities in survival. One year net survival improved steadily from 1996 for 26 of 41 sex-cancer combinations studied, and only from 2001 or 2006 for four cancers. Trends in survival accelerated after 2006 for five cancers. The deprivation gap observed for all 41 sex-cancer combinations among patients with a diagnosis in 1996 persisted until 2013. However, the gap slightly decreased for six cancers among men for which one year survival was more than 65% in 1996, and for cervical and uterine cancers, for which survival was more than 75% in 1996. The deprivation gap widened notably for brain tumours in men and for lung cancer in women. Little evidence was found of a direct impact of national cancer strategies on one year survival, and no evidence for a reduction in socioeconomic inequalities in cancer survival. These findings emphasise that socioeconomic inequalities in survival remain a major public health problem for a healthcare system founded on equity. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

Calculation of Co2 emissions from the italian energy system; Calcolo delle emissioni di CO2 dal settore energetico italiano. 1990-2000. Metodo di riferimento IPCC

Energy Technology Data Exchange (ETDEWEB)

Contaldi, M. [Agenzia Nazionale per la Protezione dell' Ambiente, Rome (Italy); La Motta, S. [ENEA, Funzione Centrale Studi, Centro Ricerche Casaccia, Rome (Italy)

2001-07-01

The calculation of Co2 emissions from the Italian energy system is the object of this work. The inventory method used is the Reference Approach from the Intergovernmental Panel for Climate Change (IPCC, 1996 revised Guidelines for National Greenhouse Gas Inventories) and the energy consumption data are taken from the Italian Energy Balance edited by the Ministry of Industry. The years analysed are those from 1990 to 2000. [Italian] Lo scopo di questo lavoro e' quello di contabilizzare le emissioni di CO2 provenienti dal settore energetico per fonte di utilizzo dell'energia, a partire direttamente dal Bilancio Energetico Nazionale (Bilancio Energetico Nazionale, BEN, a cura del Ministero Industria, Commercio ed Artigianato) ed applicando all'Italia la metodologia di riferimento per il calcolo delle emissioni della CO2 elaborata dall'Intergovernmental Panel for Climate Change (IPCC, 1996 revised Guidelines for National Greenhouse Gas Inventories). Gli anni presi in considerazione in queto lavoro sono quelli dal 1990 al 2000.

Decontamination systems information and research program. Quarterly report, January 1996--March 1996

International Nuclear Information System (INIS)

1996-04-01

West Virginia University (WVU) and the US Department of Energy, Morgantown Energy Technology Center (DOE/METC) entered into a Cooperative Agreement in August 1992 titled open-quotes Decontamination Systems Information and Research Programsclose quotes (DOE Instrument No.: DE-FC21-92MC29467). Requirements stipulated by the Agreement require WVU to submit quarterly Technical Progress reports. This report contains the efforts of the research projects comprising the Agreement for the 1st calendar quarter of 1996. For the period January 1 through December 31, 1996 twelve projects have been selected for funding, and the Kanawha Valley will continue under a no-cost extension. Three new projects have also been added to the program. This document describes these projects involving decontamination, decommissioning and remedial action issues and technologies

1996 annual report; Rapport annuel 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-12-31

This 1996 issue of the annual report of the French Commissariat a l`Energie Atomique (CEA) gives a general overview of CEA organization, activities, human resources, international relations and external communication with some budgetary informations. The main activities described concern the national defence, the fuel cycle, the nuclear reactors, the condensed matter and life sciences, the advanced technologies, the protection and transfer of knowledge and technologies, the environmental activities, the management and processing of nuclear wastes, the nuclear protection and safety, the technical and scientific information, the teaching and training, the scientific prizes, the committees, councils and commissions. (J.S.).

1996 outstanding facts

International Nuclear Information System (INIS)

1996-01-01

This progress report of the Direction of Studies and Research (DER) of Electricite de France (EdF) reports on some outstanding studies carried out during the year 1996 and concerning: new applications of electric power (thermal comfort, heating floors, building diagnosis, energy management, customers communicating interfaces, services, air conditioning, off-peak tariffs, power demand mastery in the industry, infrared dryers for paper industry); production means (automatic systems for nuclear power plants operation, management of reactors shutdown schedules for refuelling operations, optimization of fuel loading patterns for PWRs, neutronic and thermohydraulic computer codes for steam pipes rupture accidents, thermo-hydraulic modeling of the confinement building during post-accidental situation, 3D numerical simulation of overpressures inside reactor valves and of vortex and two-phase flow inside auxiliary pipes, control of vibrating fatigue of pipe nozzles, qualification of the adjustable speed drives of the Gravelines' cooling pumps, 3D analysis of new steam turbine designs, identification of bi-metal welding surface defects, a simple method for the evaluation of in-service fatigue of components, the probabilistic dimensioning of safety coefficients, the modeling of thermo-hydro-mechanical coupling of geo-materials for radioactive wastes storage, the supply of isolated sites using renewable energies); environment protection (batteries for electric-powered vehicles, modeling of atmospheric reactive flows, chlorination of the Dampierre's cooling circuits for pathogen amoebas elimination, in-situ treatment of PCBs isolated transformers); and development and exploitation of materials for power networks. (J.S.)

Energy Balance of the Sao Paulo State -1997. Base year 1996; Balanco energetico do Estado de Sao Paulo - 1997. Ano base 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-07-01

This energy balance of the Santa Catarina State presents the following main topics that can be outstanding: panorama of the energy matrix; supply and demand of energy by source 1983-1996; energy consumption by sector 1983/1996; socio-economic aspects; resources and reserves energy; and balance of the transformation centers 1984/1996.

The Indigenous World, 1996-97 = El Mundo Indigena, 1996-97.

Science.gov (United States)

Erni, Christian, Ed.

This annual publication (published separately in English and Spanish) examines political, legal, social, and educational issues concerning indigenous peoples around the world during 1996-97. Part I highlights news events and ongoing situations in specific countries. In North America, these include threats of proposed oil drilling on sacred sites…

Emotion and Social Network Perceptions: How Does Anger Bias Perceptions of Networks?

Science.gov (United States)

2013-03-01

indicate the extent to which they felt angry because previous research suggests that labeling emotions may reduce their impact (Lerner & Keltner , 2000...AFRL-AFOSR-UK-TR-2013-0009 Emotion and Social Network Perceptions: How Does Anger Bias Perceptions of Networks? Professor...REPORT TYPE Final Report 3. DATES COVERED (From – To) 26 August 2011 – 23 February 2013 4. TITLE AND SUBTITLE Emotion and Social Network

Environmental Report 1996

Energy Technology Data Exchange (ETDEWEB)

Harrach, R.J.

1996-01-01

This summary provides an overview of LLNL`s environmental activities in 1996, including radiological and nonradiological surveillance, effluent and compliance monitoring, remediation, assessment of radiological releases and doses, and determination of the impact of LLNL operations on the environment and public health.

FY 1996 Congressional budget request: Budget highlights

Energy Technology Data Exchange (ETDEWEB)

1995-02-01

The FY 1996 budget presentation is organized by the Department`s major business lines. An accompanying chart displays the request for new budget authority. The report compares the budget request for FY 1996 with the appropriated FY 1995 funding levels displayed on a comparable basis. The FY 1996 budget represents the first year of a five year plan in which the Department will reduce its spending by $15.8 billion in budget authority and by $14.1 billion in outlays. FY 1996 is a transition year as the Department embarks on its multiyear effort to do more with less. The Budget Highlights are presented by business line; however, the fifth business line, Economic Productivity, which is described in the Policy Overview section, cuts across multiple organizational missions, funding levels and activities and is therefore included in the discussion of the other four business lines.

Petroleum supply annual 1996: Volume 1

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-06-01

The Petroleum Supply Annual (PSA) contains information on the supply and disposition of crude oil and petroleum products. The publication reflects data that were collected from the petroleum industry during 1996 through annual and monthly surveys. The PSA is divided into two volumes. This first volume contains three sections: Summary Statistics, Detailed Statistics, and Refinery Capacity; each with final annual data. The summary statistics section show 16 years of data depicting the balance between supply, disposition and ending stocks for various commodities including crude oil, motor gasoline, distillate fuel oil, residual fuel oil, jet fuel propane/propylene, and liquefied petroleum gases. The detailed statistics section provide 1996 detailed statistics on supply and disposition, refinery operations, imports and exports, stocks, and transportation of crude oil and petroleum products. The refinery capacity contain listings of refineries and associated crude oil distillation and downstream capacities by State, as of January 1, 1997, as well as summaries of corporate refinery capacities and refinery storage capacities. In addition, refinery receipts of crude oil by method of transportation for 1996 are provided. Also included are fuels consumed at refineries, and lists of shutdowns, sales, reactivations, and mergers during 1995 and 1996. 16 figs., 59 tabs.

Petroleum supply annual 1996: Volume 1

International Nuclear Information System (INIS)

1997-06-01

The Petroleum Supply Annual (PSA) contains information on the supply and disposition of crude oil and petroleum products. The publication reflects data that were collected from the petroleum industry during 1996 through annual and monthly surveys. The PSA is divided into two volumes. This first volume contains three sections: Summary Statistics, Detailed Statistics, and Refinery Capacity; each with final annual data. The summary statistics section show 16 years of data depicting the balance between supply, disposition and ending stocks for various commodities including crude oil, motor gasoline, distillate fuel oil, residual fuel oil, jet fuel propane/propylene, and liquefied petroleum gases. The detailed statistics section provide 1996 detailed statistics on supply and disposition, refinery operations, imports and exports, stocks, and transportation of crude oil and petroleum products. The refinery capacity contain listings of refineries and associated crude oil distillation and downstream capacities by State, as of January 1, 1997, as well as summaries of corporate refinery capacities and refinery storage capacities. In addition, refinery receipts of crude oil by method of transportation for 1996 are provided. Also included are fuels consumed at refineries, and lists of shutdowns, sales, reactivations, and mergers during 1995 and 1996. 16 figs., 59 tabs

1996 Activity report; Rapport d`activite 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

The 1996 activity report of the Direction for Waste Management of the CEA, is presented. Its activities have been developed in the framework of the general CEA cleaning plan, and include the management of wastes generated before 1992 in R and D CEA facilities, the disposal of spent fuels generated by research reactors (Orphee and Siloe) or prototype reactors (EL4 at Brennilis), and the dismantling and cleaning of obsolete facilities such as the plutonium radiochemistry building at Fontenay-aux-Roses and the pilot workshop at Marcoule

New Working Conditions for the SPS from 2000

CERN Document Server

Nonis, M

2000-01-01

After the long shutdown (December 2000 to May 2001), the SPS complex will work with the main water-cooling loop in closed circuit. This will affect the working conditions because of the higher temperature of the supplied water (24 ° C, i.e. 15 K higher) and therefore of the air in the tunnel. The cooling installations will consequently be upgraded or replaced to meet the new needs, and several new chilled-water stations will be installed to supply the present users. The author will thoroughly explain the main aspects of all these modifications and report the results of the preliminary tests carried out in September 1996. Finally, an overview of the global costs (operational and linked to the project) will be given, taking into account the different consumption of water, electricity and the effects on the magnet components.

Us Knows Us in the UK : On Director Networks and CEO Compensation

NARCIS (Netherlands)

Renneboog, L.D.R.; Zhao, Y.

2011-01-01

We analyze the relation between CEO compensation and networks of executive and non-executive directors for all listed UK companies over the period 1996-2007. We examine whether networks are built for reasons of information gathering or for the accumulation of managerial influence. Both indirect

AGS experiments - 1994, 1995, 1996

Energy Technology Data Exchange (ETDEWEB)

Depken, J.C.

1997-01-01

This report contains the following information on the Brookhaven AGS Accelerator complex: FY 1996 AGS schedule as run; FY 1997 AGS schedule (working copy); AGS beams 1997; AGS experimental area FY 1994 physics program; AGS experimental area FY 1995 physics program; AGS experimental area FY 1996 physics program; AGS experimental area FY 1997 physics program (in progress); a listing of experiments by number; two-phage summaries of each experiment begin here, also ordered by number; listing of publications of AGS experiments begins here; and listing of AGS experimenters begins here.

AGS experiments - 1994, 1995, 1996

International Nuclear Information System (INIS)

Depken, J.C.

1997-01-01

This report contains the following information on the Brookhaven AGS Accelerator complex: FY 1996 AGS schedule as run; FY 1997 AGS schedule (working copy); AGS beams 1997; AGS experimental area FY 1994 physics program; AGS experimental area FY 1995 physics program; AGS experimental area FY 1996 physics program; AGS experimental area FY 1997 physics program (in progress); a listing of experiments by number; two-phage summaries of each experiment begin here, also ordered by number; listing of publications of AGS experiments begins here; and listing of AGS experimenters begins here

Decontamination systems information and research program. Quarterly report, January 1996--March 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-04-01

West Virginia University (WVU) and the US Department of Energy, Morgantown Energy Technology Center (DOE/METC) entered into a Cooperative Agreement in August 1992 titled {open_quotes}Decontamination Systems Information and Research Programs{close_quotes} (DOE Instrument No.: DE-FC21-92MC29467). Requirements stipulated by the Agreement require WVU to submit quarterly Technical Progress reports. This report contains the efforts of the research projects comprising the Agreement for the 1st calendar quarter of 1996. For the period January 1 through December 31, 1996 twelve projects have been selected for funding, and the Kanawha Valley will continue under a no-cost extension. Three new projects have also been added to the program. This document describes these projects involving decontamination, decommissioning and remedial action issues and technologies.

Lake Roosevelt fisheries and limnological research. Annual report 1996

International Nuclear Information System (INIS)

Cichosz, T.A.; Shields, J.P.; Underwood, K.D.; Scholz, A.; Tilson, M.B.

1997-05-01

The Lake Roosevelt Monitoring/Data Collection Program resulted from a merger between the Lake Roosevelt Monitoring Program and the Lake Roosevelt Data Collection Project. This project will model biological responses to reservoir operations, evaluate the effects of releasing hatchery origin kokanee salmon and rainbow trout on the fishery, and evaluate the success of various stocking strategies. In 1996, limnological, reservoir operation, zooplankton, and tagging data were collected. Mean reservoir elevation, storage volume and water retention time were reduced in 1996 relative to the last five years. In 1996, Lake Roosevelt reached a yearly low of 1,227 feet above mean sea level in April, a yearly high of 1,289 feet in July, and a mean yearly reservoir elevation of 1,271.4 feet. Mean monthly water retention times in Lake Roosevelt during 1996 ranged from 15.7 days in May to 49.2 days in October. Average zooplankton densities and biomass were lower in 1996 than 1995. Daphnia spp. and total zooplankton densities peaked during the summer, whereas minimum densities occurred during the spring. Approximately 300,000 kokanee salmon and 400,000 rainbow trout were released into Lake Roosevelt in 1996. The authors estimated 195,628 angler trips to Lake Roosevelt during 1996 with an economic value of $7,629,492

Lake Roosevelt Fisheries and Limnological Research : 1996 Annual Report.

Energy Technology Data Exchange (ETDEWEB)

Cichosz, Thomas A.; Underwood, Keith D.; Shields, John; Scholz, Allan; Tilson, Mary Beth

1997-05-01

The Lake Roosevelt Monitoring/Data Collection Program resulted from a merger between the Lake Roosevelt Monitoring Program and the Lake Roosevelt Data Collection Project. This project will model biological responses to reservoir operations, evaluate the effects of releasing hatchery origin kokanee salmon and rainbow trout on the fishery, and evaluate the success of various stocking strategies. In 1996, limnological, reservoir operation, zooplankton, and tagging data were collected. Mean reservoir elevation, storage volume and water retention time were reduced in 1996 relative to the last five years. In 1996, Lake Roosevelt reached a yearly low of 1,227 feet above mean sea level in April, a yearly high of 1,289 feet in July, and a mean yearly reservoir elevation of 1,271.4 feet. Mean monthly water retention times in Lake Roosevelt during 1996 ranged from 15.7 days in May to 49.2 days in October. Average zooplankton densities and biomass were lower in 1996 than 1995. Daphnia spp. and total zooplankton densities peaked during the summer, whereas minimum densities occurred during the spring. Approximately 300,000 kokanee salmon and 400,000 rainbow trout were released into Lake Roosevelt in 1996. The authors estimated 195,628 angler trips to Lake Roosevelt during 1996 with an economic value of $7,629,492.

The Conditional Scope of Selective Exposure to Political Television Media, 1996-2012

DEFF Research Database (Denmark)

Robison, Joshua; Leeper, Thomas

Pew Research Center data from 1996 to 2012, we document that exposure to ideological or partisan media is heavily conditioned by time, audience size, and individuals’ interest in national politics. Selective exposure seems to be limited to partisans with a high interest in politics viewing a handful......A considerable amount of research documents an ideological or partisan bias in media exposure: liberals and Democrats are more likely to be exposed to liberal-leaning media while conservatives and Republicans are more likely to be exposed to conservative-leaning media. Much of this research......, however, was conducted in the mid-2000’s, a politically contentious period in American politics. We argue that there are many reasons to expect this political context to be a period that encouraged high degrees of selective exposure, especially among partisans and those with high political interest. Using...

1996 Savannah River Site annual epidemiologic surveillance report

Energy Technology Data Exchange (ETDEWEB)

None

2000-03-01

This report provides a summary of epidemiologic surveillance data collected from Savannah River Site from January 1, 1996 through December 31, 1996. The data were collected by a coordinator at Savannah River Site and submitted to the Epidemiologic Surveillance Data Center located at Oak Ridge Institute for Science and Education, where quality control procedures and preliminary data analyses were carried out. The analyses were interpreted and the final report prepared by the DOE Office of Epidemiologic Studies. The information in this report provides highlights of the data analyses conducted on the 1996 data collected from Savannah River Site. The main sections of the report include: work force characteristics; absences due to injury or illness lasting 5 or more consecutive workdays; workplace illnesses, injuries, and deaths that were reportable to the Occupational Safety and Health Administration (''OSHA-recordable'' events); and disabilities and deaths among current workers. The 1996 report includes a new section on time trends that provides comparative information on the health of the work force from 1994 through 1996.

Building and measuring a high performance network architecture

Energy Technology Data Exchange (ETDEWEB)

Kramer, William T.C.; Toole, Timothy; Fisher, Chuck; Dugan, Jon; Wheeler, David; Wing, William R; Nickless, William; Goddard, Gregory; Corbato, Steven; Love, E. Paul; Daspit, Paul; Edwards, Hal; Mercer, Linden; Koester, David; Decina, Basil; Dart, Eli; Paul Reisinger, Paul; Kurihara, Riki; Zekauskas, Matthew J; Plesset, Eric; Wulf, Julie; Luce, Douglas; Rogers, James; Duncan, Rex; Mauth, Jeffery

2001-04-20

Once a year, the SC conferences present a unique opportunity to create and build one of the most complex and highest performance networks in the world. At SC2000, large-scale and complex local and wide area networking connections were demonstrated, including large-scale distributed applications running on different architectures. This project was designed to use the unique opportunity presented at SC2000 to create a testbed network environment and then use that network to demonstrate and evaluate high performance computational and communication applications. This testbed was designed to incorporate many interoperable systems and services and was designed for measurement from the very beginning. The end results were key insights into how to use novel, high performance networking technologies and to accumulate measurements that will give insights into the networks of the future.

Water levels in the Yucca Mountain Area, Nevada, 1996

International Nuclear Information System (INIS)

Graves, R.P.

1998-01-01

Water levels were monitored in 24 wells in the Yucca Mountain area, Nevada, during 1996. Twenty-two wells representing 28 depth intervals were monitored periodically, generally on a monthly basis, and 2 wells representing 3 depth intervals were monitored both hourly and periodically. All wells monitor water levels in Tertiary volcanic rocks except one that monitors water levels in paleozoic carbonate rocks. Water levels were measured using either calibrated steel tapes or a pressure sensor. Mean water-level altitudes in the Tertiary volcanic rocks ranged from about 727.86 to about 1,034.58 meters above sea level during 1996. The mean water-level altitude in the well monitoring the Paleozoic carbonate rocks was about 752.57 meters above sea level during 1996. Mean water-level altitudes for 1996 were an average of about 0.06 meter lower than 1995 mean water-level altitudes and 0.03 meter lower than 1985--95 mean water-level altitudes. During 1996, water levels in the Yucca Mountain area could have been affected by long-term pumping at the C-hole complex that began on May 8, 1996. Through December 31, 1996, approximately 196 million liters were pumped from well UE-25 c number-sign 3 at the C-hole complex. Other ground-water pumpage in the Yucca Mountain area includes annual pumpage from water-supply wells UE-25 J-12 and UE-25 J-13 of approximately 163 and 105 million liters, respectively, and pumpage from well USW G-2 for hydraulic testing during February and April 1996 of approximately 6 million liters

Year 2000 (Y2K) computer compliance guide; guidance for FDA personnel. Food and Drug Administration. Notice.

Science.gov (United States)

1999-05-14

The Food and Drug Administration (FDA) is announcing the availability of a new compliance policy guide (CPG) entitled "Year 2000 (Y2K) Computer Compliance" (section 160-800). This guidance document represents the agency's current thinking on the manufacturing and distribution of domestic and imported products regulated by FDA using computer systems that may not perform properly before, or during, the transition to the year 2000 (Y2K). The text of the CPG is included in this notice. This compliance guidance document is an update to the Compliance Policy Guides Manual (August 1996 edition). It is a new CPG, and it will be included in the next printing of the Compliance Policy Guides Manual. This CPG is intended for FDA personnel, and it is available electronically to the public.

Annual report: 1996

Energy Technology Data Exchange (ETDEWEB)

Stefanini, Alberto M; Cinausero, M; Pengo, Ruggero [eds.; Istituto Nazionale di Fisica Nucleare, Legnaro, Padova (Italy). Lab. Nazionali di Legnaro

1998-12-31

This paper describes the activities of the Laboratori Nazionali di Legnaro (LNL) of INFN during 1996. The main field of research of the laboratory is experimental nuclear physics with the use of the heavy-ion beams from the XTU Tandem accelerator and from the new ALPI Linac booster.

Annual report: 1996

International Nuclear Information System (INIS)

Stefanini, Alberto M.; Cinausero, M.; Pengo, Ruggero

1997-01-01

This paper describes the activities of the Laboratori Nazionali di Legnaro (LNL) of INFN during 1996. The main field of research of the laboratory is experimental nuclear physics with the use of the heavy-ion beams from the XTU Tandem accelerator and from the new ALPI Linac booster

Atomic energy in Lithuania: Nuclear safety in 1996; Atomine energetika Lietuvoje: Branduoline sauga 1996 m

Energy Technology Data Exchange (ETDEWEB)

Vaishnys, P; Krenevichius, R; Alejev, A; Demchenko, M [State Nuclear Power Safety Inspectorate (VATESI), Vilnius (Lithuania); and others

1998-12-31

The first annual report of VATESI - Lithuanian Nuclear Safety Authority`s activity is presented and cover description of the main results in 1996. VATESI was established in 1991 recently after regaining of independence when Ignalina NPP come into jurisdiction of Republic of Lithuania. Since the establishment in six year period of operation VATESI developed its activities considerably and now is able to perform the functions of independent regulator of nuclear safety in Lithuania. The main fields of VATESI activities in 1996 were evaluation of the safety of Ignalina NPP, supervision of Ignalina NPP`s operational safety, control of the implementation of safety improvement program SIP-1 in Ignalina NPP, development of new regulatory legislation according to IAEA standards and practices, accountancy and control of nuclear materials, regulation of radioactive waste management. Detailed description of all these activities is provided in the report. In 1996 there were no safety significant events in Ignalina NPP according to the INES scale, only five events received qualification as level 1 events. 2 tabs.,10 figs.

Population growth, movements, and status of the Nushagak Peninsula Caribou Herd following reintroduction, 1988 - 2000

Directory of Open Access Journals (Sweden)

Gail H. Collins

2003-04-01

Full Text Available Barren ground caribou (Rangifer tarandus were reintroduced to the Nushagak Peninsula, Alaska in February of 1988 after an absence of more than 100 years. Since reintroduction, herd growth and population dynamics have been monitored closely. At this time, there has been no significant dispersal from the herds' core range. The Nushagak Peninsula Caribou Herd (NPCH grew rapidly from 146 reintroduced individuals to over 1000 in 13 years. Dramatic mean annual growth during the first 6 years (1988-1994 of 38% (r = 0.32 can be attributed to the high percentage of females in the initial reintroduction, high calf production and survival, exceptional range conditions, few predators, and no hunting. However, the populations' exceptional growth (peak counts of 1400 slowed and stabilized between 1996¬1998 and then decreased between 1998 and 2000. Size, body condition and weights of calves captured in 2000 were significantly lower than those captured in 1995 and 1997. Although calf production also decreased from close to 100% (1990-1995 to about 91% (1996-2000, overall calf survival continued to be high. Legal harvest began in 1995, and harvest reports have accounted for approximately 3% of population mortality annually. Although brown bears (Ursus arctos and wolves (Canis lupus are present, the extent of predation is unknown. Mean home range of the NPCH was 674 km2 and group sizes were greatest during post-calving aggregation in July (mean = 127. Caribou population density on the Nushagak Peninsula reached approximately 1.2 caribou/km2 in 1997 before declining to about 1.0 caribou/km2. A range survey in 1994 noted only trace utilization of lichens on the Nushagak Peninsula by caribou. A subsequent survey in 1999 found moderate to severe utilization in 46% of plots, suggesting the reintroduced herd was beginning to alter range condition. Between 1997 and 2000, both calf production and condition of 10-month-old calves declined. Calving has also been delayed

Research in Particle Physics at the Santa Cruz Institute for Particle Physics, 2000-2003

International Nuclear Information System (INIS)

Abraham Seiden

2003-01-01

The Santa Cruz Institute for Particle Physics is an Organized Research Unit within the University of California system. This is a special structure allowing a focused emphasis on research and includes special commitments for space and personnel from the Santa Cruz campus. The Institute serves to consolidate the research in experimental and theoretical particle physics on campus. This report covers four separate experimental projects. The projects are the BaBar experiment, the ATLAS experiment, the GLAST space satellite, and work toward a Linear Collider and its detector. Research in High Energy Physics (last final report for period 1996-2000)

Cogema in 1996: increasing turnover and stable net results

International Nuclear Information System (INIS)

Anon.

1997-01-01

This short article gives some financial informations about the Cogema group for 1996. The net result for 1996 reached 977 millions of French Francs (FF) with respect to 973 for the previous year. The turnover reached 34.427 billions of FF in 1996 and 30.611 in 1995, which represents a 12.5% growth. In the mining sector, the turnover has decreased to 2.853 billions of FF with respect to 3.238 in 1995. In the engineering and industry services sector the turnover of the overall companies, with the exception of Cogema, has considerably progressed (2.199 billions of FF in 1996, 1.738 in 1995). (J.S.)

Petroleum industry 1996; L`industrie petroliere 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-12-31

A survey on petroleum industry activities in France and in the world in 1996 is presented. The different parts and themes of the study are: evolution of the petroleum market (international and French markets, supply and demand, prices, mark-up and taxation in France and in Europe); activities in the petroleum industries (exploration and production, maritime transportation, inland transportation and storage, refining, quality of petroleum products and substitution fuels, oil distribution); environment and safety (refining, distribution and evolution of products, pipeline and maritime transportation, exploration and production); situation of the sector`s companies (oil groups, para-petroleum French industry, scientific and technical research)

Petroleum industry 1996; L`industrie petroliere 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

A survey on petroleum industry activities in France and in the world in 1996 is presented. The different parts and themes of the study are: evolution of the petroleum market (international and French markets, supply and demand, prices, mark-up and taxation in France and in Europe); activities in the petroleum industries (exploration and production, maritime transportation, inland transportation and storage, refining, quality of petroleum products and substitution fuels, oil distribution); environment and safety (refining, distribution and evolution of products, pipeline and maritime transportation, exploration and production); situation of the sector`s companies (oil groups, para-petroleum French industry, scientific and technical research)

Third Quarter Hanford Seismic Report for Fiscal Year 2000

Energy Technology Data Exchange (ETDEWEB)

DC Hartshorn; SP Reidel; AC Rohay

2000-09-01

Hanford Seismic Monitoring provides an uninterrupted collection of high-quality raw and processed seismic data from the Hanford Seismic Network (HSN) for the U.S. Department of Energy and its con-tractors. Hanford Seismic Monitoring also locates and identifies sources of seismic activity and monitors changes in the historical pattern of seismic activity at the Hanford Site. The data are compiled, archived, and published for use by the Hanford Site for waste management, Natural Phenomena Hazards assessments, and engineering design and construction. In addition, the seismic monitoring organization works with the Hanford Site Emergency Services Organization to provide assistance in the event of a significant earthquake on the Hanford Site. The HSN and the Eastern Washington Regional Network (E WRN) consist of 42 individual sensor sites and 15 radio relay sites maintained by the Hanford Seismic Monitoring staff. The HSN uses 21 sites and the EWRN uses 36 sites; both networks share 16 sites. The networks have 46 combined data channels because Gable Butte and Frenchman Hills East are three-component sites. The reconfiguration of the telemetry and recording systems was completed during the first quarter. All leased telephone lines have been eliminated and radio telemetry is now used exclusively. For the HSN, there were 818 triggers on two parallel detection and recording systems during the third quarter of fiscal year (FY) 2000. Thirteen seismic events were located by the Hanford Seismic Network within the reporting region of 46-47{degree} N latitude and 119-120{degree} W longitude; 7 were earthquakes in the Columbia River Basalt Group, 1 was an earthquake in the pre-basalt sediments, and 5 were earthquakes in the crystalline basement. Three earthquakes occurred in known swarm areas, and 10 earthquakes were random occurrences. No earthquakes triggered the Hanford Strong Motion Accelerometers during the third quarter of FY 2000.

Energy Balance of the Santa Catarina State - Series 1980 -1996

International Nuclear Information System (INIS)

1997-01-01

This energy balance of the Santa Catarina State presents the following main topics that can be outstanding: economic aspects; supply and demand of energy by source 1980-1996; energy consumption by sector 1980/1996; energy interchange; and balance of the transformation centers 1980/1996

Report of the IAEA Nuclear Data Section to the International Nuclear Data Committee for the period 1995/1996

Energy Technology Data Exchange (ETDEWEB)

Oblozinsky, P

1997-07-01

This progress report describes the activities of the IAEA Nuclear Data Section in the years 1995 and 1996, including staff and budget, the operation of the Nuclear Data Center, the computer operations, the coordination activities of the Nuclear Data Center Networks, the nuclear data improvements projects, Technical Cooperation and technology transfer, atomic and molecular data activities, and the meetings held in the reporting period. (author). 3 figs, 10 tabs.

Report of the IAEA Nuclear Data Section to the International Nuclear Data Committee for the period 1995/1996

International Nuclear Information System (INIS)

Oblozinsky, P.

1997-07-01

This progress report describes the activities of the IAEA Nuclear Data Section in the years 1995 and 1996, including staff and budget, the operation of the Nuclear Data Center, the computer operations, the coordination activities of the Nuclear Data Center Networks, the nuclear data improvements projects, Technical Cooperation and technology transfer, atomic and molecular data activities, and the meetings held in the reporting period. (author). 3 figs, 10 tabs

EVOLUCIÓN DE LA ENFERMEDAD MENINGOCÓCICA EN LA POBLACIÓN INFANTIL DE LA COMUNIDAD VALENCIANA (1996-2000. EFECTIVIDAD DE LA VACUNACIÓN ANTIMENINGOCÓCICA A+B

Directory of Open Access Journals (Sweden)

Mercedes Goicoechea Sáez

2003-01-01

Full Text Available por serogrupo C en la Comunidad Valenciana durante 1996-1997 motivó la realización de una campaña de vacunación antimeningocócica A+C en la población de 18 meses a 19 años de edad (entre septiembre y diciembre de 1997. El objetivo de este estudio es analizar el impacto de la campaña en cuanto a la epidemiología, clínica, evolución de la enfermedad meningocócica y estado de vacunación de la población infantil con el fin de valorar la efectividad vacunal. Métodos: Los datos se obtuvieron de las historias clínicas de los niños menores de 15 años, que presentaron síntomas y signos clínicos sugestivos de enfermedad invasora con aislamiento de Neisseria. meningitidis y/o que cumplían con los criterios de definición de caso establecidos, atendidos en todos los hospitales públicos de la Comunidad Valenciana entre 1996-2000. La evolución de la incidencia se valoró mediante tasas de incidencia. La clínica y su evolución (secuelas y letalidad mediante la frecuencia y distribución por serogrupo y edad. La efectividad vacunal se calculó según la fórmula de Orestein. Resultados: Se registró un total de 302 casos de enfermedad invasora por N. meningitidis. La tasa de incidencia por serogrupo C en niños menores de 15 años disminuyó tras la campaña de vacunación desde 5,82/105 habitantes en 1997 a 1,68/105 habitantes en 1998. Tres años después de la campaña se ha vuelto a tasas similares a la época prevacunal, con un aumento por serogrupo B en los 2 últimos años. El 61% de las secuelas se da en menores de 5 años. La letalidad fue más elevada para el serogrupo C. La efectividad vacunal al tercer año tras la campaña ha sido del 83,7% para el grupo de 5-14 años y del 69,1% para el grupo de 19 meses-4 años. Conclusión: La vacuna polisacarídica se mostró efectiva para interrumpir el brote. La disminución de la incidencia del serogrupo C es atribuible a la efectividad vacunal obtenida.

Automatic Target Recognition Using Nonlinear Autoregressive Neural Networks

Science.gov (United States)

2014-03-27

series. Chakraborty et al. (1992) modeled flour prices over an eight year period for the cities of Buffalo, Minneapolis and Kansas City via a neural...on stock and commodity market prices (Kaastra & Boyd, 1996) with a goal of discovering non-linear relationships via ANNs which might provide an...Time Series A vector of past observations from a specific time interval is an example of a time series. For example, monthly stock prices from 2000

Kuidas valiti president 1996. aastal? / Rein Toomla

Index Scriptorium Estoniae

Toomla, Rein, 1951-

2002-01-01

Autor leiab 1996. aasta presidendivalimisi analüüsides, et oluliseks tuleb pidada seda, et valimised suudeti põhiseaduses ettenähtud korras läbi viia ning ei pidanud käivituma erakorraliste valimiste mehhanism. Tabelid: 1995. a. Riigikogu valimised; Riigikogu fraktsioonid 1996. a. suvel; Toetus presidendikandidaatidele; Presidendivalimised Riigikogus; Arvatavasti Lennart Meri poolt; Arvatavasti Arnold Rüütli poolt; Presidendivalimised Valimiskogus

Hydrocarbon Study 1995-1996

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — During September 1995 and May 1996, a total of 100 drop samples were taken in Upper Galveston Bay to assess potential oil spill damage to salt marsh habitats and...

NIF ICCS network design and loading analysis

International Nuclear Information System (INIS)

Tietbohl, G; Bryant, R

1998-01-01

The National Ignition Facility (NIF) is housed within a large facility about the size of two football fields. The Integrated Computer Control System (ICCS) is distributed throughout this facility and requires the integration of about 40,000 control points and over 500 video sources. This integration is provided by approximately 700 control computers distributed throughout the NIF facility and a network that provides the communication infrastructure. A main control room houses a set of seven computer consoles providing operator access and control of the various distributed front-end processors (FEPs). There are also remote workstations distributed within the facility that allow provide operator console functions while personnel are testing and troubleshooting throughout the facility. The operator workstations communicate with the FEPs which implement the localized control and monitoring functions. There are different types of FEPs for the various subsystems being controlled. This report describes the design of the NIF ICCS network and how it meets the traffic loads that will are expected and the requirements of the Sub-System Design Requirements (SSDR's). This document supersedes the earlier reports entitled Analysis of the National Ignition Facility Network, dated November 6, 1996 and The National Ignition Facility Digital Video and Control Network, dated July 9, 1996. For an overview of the ICCS, refer to the document NIF Integrated Computer Controls System Description (NIF-3738)

Die dialektiek in die waardes van die 1996 Grondwet

Directory of Open Access Journals (Sweden)

J Swanepoel

1998-11-01

Full Text Available In his paper The Dialectics in the Values of the 1996 Constitution Jan Swanepoel discusses various value statements in the 1996 Constitution of the Republic of South Africa and focuses the attention on indications of a lack of coherence as far as these value statements are concerned.He does this against the background of some introductory perspectives on the 1996 Constitution. In this regard he points out that the 1996 Constitution, as successor to the 1993 Constitution with its set of thirty four constitutional principles, can be regarded as a document of political and ideological compromise. He points out that constitutions (and in particular the value statements in Bills of Rights generally tend to be formulated rather broadly in order to promote flexibility and adaptability. He also focuses the attention on the fact that such a dialectic of values point to the variety of interests that has to be harmonized in a modern state, something which is unmistakably the case in South Africa with its heterogeneous society.The 1996 Constitution contains a variety of "value terms". A closer study of these terms does, however, indicate that these terms (value, principle, foundation, and the like are not used in a very systematic or technical fashion.The problems regarding the value statements are, however, not only of a terminological nature. There are also some substantive problems, as becomes clear from a discussion of value terms in the Preamble and in Sections 1 and 7 of the 1996 Constitution. Swanepoel indicates that a tension exists between what can be called the "process" formulation in section 1(a and the "state of affairs" formulation of the values in section 7(1. . While section 1(a speaks of "the achievement of equality" and "the advancement of human rights and freedoms", section 7(1 simply makes mention of "equality" and "freedom". The dialectic between these two formulations is discussed with reference to other relevant sections of the 1996

The 30/20 GHz communications satellite trunking network study

Science.gov (United States)

Kolb, W.

1981-01-01

Alternative transmission media for a CONUS-wide trunking network in the years 1990 and 2000 are examined. The alternative technologies comprised fiber optic cable, conventional C- and Ku-band satellites, and 30/20 GHz satellites. Three levels of implementation were considered - a 10-city network, a 20-city network, and a 40-city network. The cities selected were the major metropolitan areas with the greatest communications demand. All intercity voice, data, and video traffic carried more than 40 miles was included in the analysis. In the optimized network, traffic transmitted less than 500 miles was found to be better served by fiber optic cable in 1990. By the year 2000, the crossover point would be down to 200 miles, assuming availability of 30/20 GHz satellites.

La agricultura colombiana en 1996 (comportamiento de sus principales variables The Agriculture in Colombia during 1996

Directory of Open Access Journals (Sweden)

Vásquez Ordoñez Rafael

1997-12-01

Full Text Available El presente artículo describe y analiza el comportamiento del sector agrícola del país durante 1996. Para ello, hemos estudiado la evolución de cada una de las variables más importantes del sector, tales como el crecimiento del Producto Bruto Agrícola, el crédíto, los precios, las importaciones y exportaciones, la estructura de tenencia de la tierra, las inversiones y el desempeño de los productos agrícolas más significativos.This article deals with the agriculture in Colombia during 1996. Founded on some indicators such as growth of the production, land reform, credits, prizes, balance of payment, etc. It gathers information and analyses the mains economics and management techniques carried out by Agriculture Ministery, to garantee an appropriate administration of the agricultural sector in Colombia. It has also been consideret the suitable actions to solve the mains problems of the agricultural sector. Finally, some results obtained to december 1996 are presented.

1996 annual report; Rapport annuel 1996

Energy Technology Data Exchange (ETDEWEB)

Scheller, M [CEO, 75 - Paris (France)

1997-12-31

The 1996 annual report of the French national office of aerospace studies and researches (ONERA) presents the missions, organization, financial and operating highlights, sites and workforce, research activity, facilities, international relations and human resources of this company. ONERA`s research goals are the following: spanning the spectrum of civil and military aircraft requirements, feeding the booming civil aviation market, the development of tomorrow`s supersonic transport, the French-German cooperation on future helicopters design, design of aircraft and missile navigation instruments, applied research and simulation on turbo-machineries, development support for Ariane rocket and reentry vehicles, earth and space observation, ground and airborne radars, tactical and strategic missiles, hypersonic propulsion, development of new materials and enhanced numerical simulation. (J.S.)

1996 annual report; Rapport annuel 1996

Energy Technology Data Exchange (ETDEWEB)

Scheller, M. [CEO, 75 - Paris (France)

1996-12-31

The 1996 annual report of the French national office of aerospace studies and researches (ONERA) presents the missions, organization, financial and operating highlights, sites and workforce, research activity, facilities, international relations and human resources of this company. ONERA`s research goals are the following: spanning the spectrum of civil and military aircraft requirements, feeding the booming civil aviation market, the development of tomorrow`s supersonic transport, the French-German cooperation on future helicopters design, design of aircraft and missile navigation instruments, applied research and simulation on turbo-machineries, development support for Ariane rocket and reentry vehicles, earth and space observation, ground and airborne radars, tactical and strategic missiles, hypersonic propulsion, development of new materials and enhanced numerical simulation. (J.S.)

Assistência e mortalidade neonatal no setor público do Município do Rio de Janeiro, Brasil: uma análise do período 1994/2000 Neonatal care and mortality in public hospitals in Rio de Janeiro, Brazil, 1994/2000

Directory of Open Access Journals (Sweden)

Maria Auxiliadora de Souza Mendes Gomes

2005-08-01

Full Text Available Este artigo apresenta uma avaliação da intervenção realizada pela Secretaria Municipal de Saúde do Rio de Janeiro(SMS-RJ (estratégias de organização e qualificação da assistência neonatal na rede municipal, incluindo a ampliação dos leitos neonatais de risco, com o objetivo de reduzir a mortalidade neonatal. Analisamos as mudanças ocorridas no atendimento dos diferentes prestadores do setor público (período 1994/2000, na taxa de mortalidade neonatal dos nascimentos ocorridos nas instituições do Sistema Único de Saúde (1995/2000 e o perfil das internações em quatro Unidades de Terapia Intensiva Neonatal (UTIN da SMS-RJ (2000. Encontramos a concentração do atendimento neonatal de risco nas unidades municipais (de 28,0% do atendimento de nascidos vivos prematuros, em 1994, para 67,0% em 2000, redução na mortalidade neonatal dos nascimentos ocorridos no SUS (de 19,9 óbitos por mil nascidos vivos em 1996 para 15,5 em 2000. Não houve redução nas taxas de prematuridade e baixo peso ao nascer entre as mães residentes no Município do Rio de Janeiro. Na análise das internações nas UTIN encontramos elevada proporção de neonatos de mães moradoras de outros municípios, 14,0% de mães que não realizaram pré-natal e 32,0% de mortalidade entre neonatos com peso ao nascer This article analyzes an intervention by the Rio de Janeiro Municipal Health Department (SMS-RJ, Brazil, to reduce the neonatal mortality rate (strategies for organizing and upgrading neonatal care in the municipal system, including an increase in the number of neonatal high-risk beds. We studied the trends in neonatal mortality rate (1995/2000, neonatal care provided in different public hospitals (1994/2000, and admissions profile and mortality in four neonatal intensive care units (NICUs under the SMS-RJ (2000. There was a concentration of high-risk neonatal care in the municipal hospitals (an increase from 28.0% of the care provided for live premature

Nuclear Physics in Poland 1996-2006

International Nuclear Information System (INIS)

Broda, R.; Dobaczewski, J.; Jastrzebski, J.; Palacz, M.; Styczen, J.

2007-12-01

This Report is a result of the Polish Nuclear Physics Network (PNPN) action having as objective the mapping study of the basic and applied research in this domain in Poland. In the often employed slang it constitutes one of the '' deliverables '' of the EWON (East-West Outreach) Network, operating within the I3- (Integrated Infrastructure Initiative) EURONS, one of the Nuclear Physics projects in the Six Framework Programme (FP6). However, although prepared within the nuclear structure EURONS framework, this mapping study also reports on the activities in the hadron physics in Poland (organized in the FP6 within a second Nuclear Physics project I3-Hadron Physics) as well as in Nuclear Theory and Applications of Nuclear Physics. The Report contains references to activities and published papers from the last ten years: 1996 - 2006. In some cases also slightly older data are included, if necessary, for the completeness of the reported subjects. The Report is organized as follows. After the information on Polish Nuclear Physics Network (a part of the EWON Network), a few overview papers describe the main domains of the PNPN scientific activity. The contents of these papers were previously presented during the NuPECC meeting, held in Krakow June 9, 2006. A number (89) of more detailed contributions (together with appropriate references) emanating from various research groups follows the review articles. Some of the contributions provide concise summaries of wide research activities. Other authors preferred to report separately or individually on narrower topics. Most of the presented activities were conducted within the international collaborations. However, the adopted policy was that only Polish researchers are indicated as authors of the contributions, whereas the international collaborations are reflected by (all) authors of cited publications. The Polish Nuclear Physics Long-Range Plan prepared recently by the Nuclear Physics Committee of the National Atomic Energy

Costs of and public funds for Natura 2000 in the Netherlands

NARCIS (Netherlands)

Leneman, H.; Bogaardt, M.J.; Roza, P.

2009-01-01

This report offers an estimate of the costs of maintaining or restoring the Natura-2000 network to a favourable status in the Netherlands. Also, an assessment is made of how many financial resources are potentially available to cover these costs from European funds, Dutch State funds and Dutch

FY 1996 Report on the industrial science and technology research and development project. R and D of brain type computer architecture; 1996 nendo nogata computer architecture no kenkyu kaihatsu seika hokokusho

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-03-01

It is an object of this project to develop an information processing device based on a completely new architecture, in order to technologically realize human-oriented information processing mechanisms, e.g., memory, learning, association of ideas, perception, intuition and value judgement. Described herein are the FY 1996 results. For development of an LSI based on a neural network in the primary visual cortex, it is confirmed that the basic circuit structure comprising the position-signal generators, memories, signal selectors and adders is suitable for development of the LSI circuit for a neural network function (Hough transform). For development of realtime parallel distributed processor (RPDP), the basic specifications are established for, e.g., local memory capacity of RPDP, functions incorporated in RPDP and number of RPDPs incorporated in the RPDP chip, operating frequency and clock supply method, and estimated power consumption and package, in order to realize the RPDP chip. For development and advanced evaluation of large-scale neural network silicon chip, the chip developed by the advanced research project is incorporated with learning rules, cell models and failure-detection circuits, to design the evaluation substrate incorporated with the above chip. The evaluation methods and implementation procedures are drawn. (NEDO)

AGS experiments -- 1995, 1996 and 1997

Energy Technology Data Exchange (ETDEWEB)

Depken, J.C.; Presti, P.L.

1997-12-01

This report contains (1) FY 1995 AGS schedule as run; (2) FY 1996 AGS schedule as run; (3) FY 1997 AGS schedule as run; (4) FY 1998--1999 AGS schedule (proposed); (5) AGS beams 1997; (6) AGS experimental area FY 1995 physics program; (7) AGS experimental area FY 1996 physics program; (8) AGS experimental area FY 1997 physics program; (9) AGS experimental area FY 1998--1999 physics program (proposed); (10) a listing of experiments by number; (11) two-page summaries of each experiment, in order by number; and (12) listing of publications of AGS experiments.

AGS experiments - 1995, 1996 and 1997

International Nuclear Information System (INIS)

Depken, J.C.; Presti, P.L.

1997-12-01

This report contains (1) FY 1995 AGS schedule as run; (2) FY 1996 AGS schedule as run; (3) FY 1997 AGS schedule as run; (4) FY 1998--1999 AGS schedule (proposed); (5) AGS beams 1997; (6) AGS experimental area FY 1995 physics program; (7) AGS experimental area FY 1996 physics program; (8) AGS experimental area FY 1997 physics program; (9) AGS experimental area FY 1998--1999 physics program (proposed); (10) a listing of experiments by number; (11) two-page summaries of each experiment, in order by number; and (12) listing of publications of AGS experiments

Client Location in 802.11 Networks

Science.gov (United States)

2007-03-01

The Encyclopedia of Networking. 1995. Alameda. 3. Forouzan, Behrouz A. TCP/IP Protocol Suite. 2nd ed. New York: Mc- Graw Hill, 2003. 4. Holt, Keith...Proceedings. April 2003: 1353-1358. 18. Willingham, Stephen . Navy Pursuing ‘Smaller, Deployable, Interactive’ Networked Systems. Nov 2000. National

Natural radionuclides by gammaspectrometry in region of West-south Serbia, for 1998, 1997 and 1996

Energy Technology Data Exchange (ETDEWEB)

Tanaskovic, I.; Vukovic, D.M. [Institute of Occupational and Radiological Health, Deligradska 29, Belgrade, Yugoslavia, Faculty of Physical Chemistry, Studentski trg 12, Belgrade (Yugoslavia); Markovic, D. [Faculty of Physical Chemistry, Belgrade (Yugoslavia)

2000-05-01

Region of West Serbia, known as Uzicki region, as a agriculture and industry region, with cities: Uzice, Cacak, Kraljevo and Valjevo is important part of Yugoslavia for development. Radioactivity comes mostly from natural radionuclides and partly from long-lived radionuclides from non natural sources as a consequence of Chernobyl accident. Monitoring of environment has proceeded by vertical methodology. We analyzed: aerosol, soil, fallout (wet and dry deposition), rivers, lakes, drinking water, human and animal food. Results from analyze of samples of environment contains very low activity, actually activity of changes of basic signal. Results for 1998, 1997 and 1996 are: 1. Gamma dose was measure in Belgrade with median years values: 0.103 {mu}G/h (1998), 0.077 {mu}G/h (1997) and 0.0722 {mu}G/h (1996). 2. By gammaspectrometry analyze of air of months samples for each year, results shows activity of changes of basic signal. The signals are coming from natural radionuclides. 3. {sup 137}Cs, as a long lived radionuclide, with remarkable activity in soil analyzed from Zlatibor and result are :32.3-173 Bq/kg (1998), -Bq/kg (1997) and 33-122.7 Bq/kg (1996). 4. Activity in the rivers for these region not analyzed. 5. Activity of drinking waters, from city network shows low level of activity which comes from {sup 40}K, for both places. 6. Activity in human food, measured in yogurt, meats, bread and agricultural products comes from {sup 40}K Uzice 32.4-168 Bq/kg (1998), Bq/kg (1997) and 55.2-164 Bq/kg (1996). Activities of {sup 137}Cs are 1 Bq/kg. Results of analyze of animal food shows same results. The samples were collected according to methods determined by the Regulations. (author)

Natural radionuclides by gammaspectrometry in region of West-south Serbia, for 1998, 1997 and 1996

International Nuclear Information System (INIS)

Tanaskovic, I.; Vukovic, D.M.; Markovic, D.

2000-01-01

Region of West Serbia, known as Uzicki region, as a agriculture and industry region, with cities: Uzice, Cacak, Kraljevo and Valjevo is important part of Yugoslavia for development. Radioactivity comes mostly from natural radionuclides and partly from long-lived radionuclides from non natural sources as a consequence of Chernobyl accident. Monitoring of environment has proceeded by vertical methodology. We analyzed: aerosol, soil, fallout (wet and dry deposition), rivers, lakes, drinking water, human and animal food. Results from analyze of samples of environment contains very low activity, actually activity of changes of basic signal. Results for 1998, 1997 and 1996 are: 1. Gamma dose was measure in Belgrade with median years values: 0.103 μG/h (1998), 0.077 μG/h (1997) and 0.0722 μG/h (1996). 2. By gammaspectrometry analyze of air of months samples for each year, results shows activity of changes of basic signal. The signals are coming from natural radionuclides. 3. 137 Cs, as a long lived radionuclide, with remarkable activity in soil analyzed from Zlatibor and result are :32.3-173 Bq/kg (1998), -Bq/kg (1997) and 33-122.7 Bq/kg (1996). 4. Activity in the rivers for these region not analyzed. 5. Activity of drinking waters, from city network shows low level of activity which comes from 40 K, for both places. 6. Activity in human food, measured in yogurt, meats, bread and agricultural products comes from 40 K Uzice 32.4-168 Bq/kg (1998), Bq/kg (1997) and 55.2-164 Bq/kg (1996). Activities of 137 Cs are 1 Bq/kg. Results of analyze of animal food shows same results. The samples were collected according to methods determined by the Regulations. (author)

Ames Laboratory annual site environmental report, calendar year 1996

International Nuclear Information System (INIS)

1998-04-01

This report summarizes the environmental status of Ames Laboratory for calendar year 1996. It includes descriptions of the Laboratory site, its mission, the status of its compliance with applicable environmental regulations, its planning and activities to maintain compliance, and a comprehensive review of its environmental protection, surveillance and monitoring programs. Ames Laboratory is located on the campus of Iowa State University (ISU) and occupies twelve buildings owned by the Department of Energy (DOE). The Laboratory also leases space in ISU owned buildings. Laboratory activities involve less than ten percent of the total chemical use and approximately one percent of the radioisotope use on the ISU campus. In 1996, the Office of Assurance and Assessment merged with the Environment, Safety and Health Group forming the Environment, Safety, Health and Assurance (ESH and A) office. In 1996, the Laboratory accumulated and disposed of wastes under US Environmental Protection Agency (EPA) issued generator numbers. Ames Laboratory submitted a Proposed Site Treatment Plan to EPA in December 1995. This plan complied with the Federal Facilities Compliance Act (FFCA). It was approved by EPA in January 1996. The consent agreement/consent order was issued in February 1996. Pollution awareness, waste minimization and recycling programs, implemented in 1990 and updated in 1994, continued through 1996. Included in these efforts were a waste white paper and green computer paper recycling program. Ames Laboratory also continued to recycle salvageable metal and used oil, and it recovered freon for recycling. All of the chemical and nearly all of the radiological legacy wastes were properly disposed by the end of 1996. Additional radiological legacy waste will be properly disposed during 1997

Monitoring of radiation in the environment in the Netherlands. Results in 2000

Energy Technology Data Exchange (ETDEWEB)

Knetsch, G.J. (ed.)

2002-07-01

This report presents the results of radioactivity measurements in the environment in the Netherlands carried out by RIVM, RIZA, RIKZ and Inspectorate for Health Protection and Veterinary Public Health in 2000. Measurements of radioactivity have been carried out in airborne particulates, deposition, surface water, seawater, drinking water and food (honey, game, blueberry and mushrooms). Results for ambient dose equivalent rates have been obtained from the National Radioactivity Monitoring Network. No measurements were done in milk. In 2000 no elevated levels of radioactivity were found in the Dutch environment.

Telerobotics: through-the-Internet teleoperation of the ABB IRB 2000 industrial robot

Science.gov (United States)

Alvares, Alberto J.; Caribe de Carvalho, Guilherme; Paulinyi, Luis F. d. A.; Alfaro, Sadek C. A.

1999-11-01

Robotic systems can be controlled remotely through the use of telerobotics. This work presents a through-the-internet teleoperation system for remotely operating the IRB2000 industrial robot. The IRB2000 controller allows external access through a RS232 serial communication link, which is based on a 42 function proprietary communication protocol. The proposed teleoperation system uses this communication capability by connecting it to a local area network based on TCP/IP (Transport Control Protocol/Internet Protocol). The system was implemented using a Client/Server architecture, having as server a UNIX (LINUX) platform.

Monitoring of radiation in the environment in the Netherlands. Results in 2000

CERN Document Server

Knetsch, G J

2002-01-01

This report presents the results of radioactivity measurements in the environment in the Netherlands carried out by RIVM, RIZA, RIKZ and Inspectorate for Health Protection and Veterinary Public Health in 2000. Measurements of radioactivity have been carried out in airborne particulates, deposition, surface water, seawater, drinking water and food (honey, game, blueberry and mushrooms). Results for ambient dose equivalent rates have been obtained from the National Radioactivity Monitoring Network. No measurements were done in milk. In 2000 no elevated levels of radioactivity were found in the Dutch environment

STAR: Visualization and infrastructure software. Progress report, 1996

International Nuclear Information System (INIS)

Moore, C.F.

1996-11-01

One of the two primary experiments approved for day-one operation at the Relativistic Heavy Ion Collider (RHIC) is the Solenoidal Tracker at RHIC (STAR). This report summarizes the work carried out by personnel from the University of Texas at Austin on the STAR experiment at RHIC during the calendar year 1995--1996. Topics covered are: (1) STAR visualization; (2) DFM, the Data File Manager; (3) LEV: Logging of Environment and Version Information; (4) TBR: the Table Browser; (5) STIC (Star Idl Compiler); (6) CDS (Code Style checker); (7) TOP (Table Operators); (8) Publications 1995--1996; (i) Abstracts of conference or symposium proceedings and reports 1995--1996; and (10) Personnel

STAR: Visualization and infrastructure software. Progress report, 1996

Energy Technology Data Exchange (ETDEWEB)

Moore, C.F.

1996-11-01

One of the two primary experiments approved for day-one operation at the Relativistic Heavy Ion Collider (RHIC) is the Solenoidal Tracker at RHIC (STAR). This report summarizes the work carried out by personnel from the University of Texas at Austin on the STAR experiment at RHIC during the calendar year 1995--1996. Topics covered are: (1) STAR visualization; (2) DFM, the Data File Manager; (3) LEV: Logging of Environment and Version Information; (4) TBR: the Table Browser; (5) STIC (Star Idl Compiler); (6) CDS (Code Style checker); (7) TOP (Table Operators); (8) Publications 1995--1996; (i) Abstracts of conference or symposium proceedings and reports 1995--1996; and (10) Personnel.

Development scheme of the public power transportation network

International Nuclear Information System (INIS)

2005-01-01

Article 14 of the modified law from February 10, 2000 relative to the modernization and development of the electric utility foresees that the development scheme of the public power transportation network is regularly submitted to the approval of the ministry of energy after advice from the energy regulation commission. The development scheme identifies the areas of 'power fragility' with respect to the existing or future constraints susceptible to occur at the short- or medium-term on the French power grid. This document comprises the text of the law 2000-108 from February 10, 2000, and the complete development scheme with its appendixes (regulatory and administrative context relative to network projects, constraints relative to each administrative region). (J.S.)

Progress report of the IAEA Nuclear Data Section, 2000-2001

International Nuclear Information System (INIS)

2002-01-01

This paper is the progress report of the IAEA Nuclear Data Section for the years 2000-2001. The paper comprises the following topics: Budget and staff summary, nuclear data compilations, nuclear data services, development of new generation databases, the network co-ordination of the nuclear reaction data centres and of the nuclear structure and decay data evaluators. (a.n.)

1996 NRC annual report. Volume 13

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-10-01

This 22nd annual report of the US Nuclear Regulatory Commission (NRC) describes accomplishments, activities, and plans made during Fiscal Year 1996 (FH 1996)--October 1, 1995, through September 30, 1996. Significant activities that occurred early in FY 1997 are also described, particularly changes in the Commission and organization of the NRC. The mission of the NRC is to ensure that civilian uses of nuclear materials in the US are carried out with adequate protection of public health and safety, the environment, and national security. These uses include the operation of nuclear power plants and fuel cycle plants and medical, industrial, and research applications. Additionally, the NRC contributes to combating the proliferation of nuclear weapons material worldwide. The NRC licenses and regulates commercial nuclear reactor operations and research reactors and other activities involving the possession and use of nuclear materials and wastes. It also protects nuclear materials used in operation and facilities from theft or sabotage. To accomplish its statutorily mandated regulatory mission, the NRC issues rules and standards, inspects facilities and operations, and issues any required enforcement actions.

1996 NRC annual report. Volume 13

International Nuclear Information System (INIS)

1997-01-01

This 22nd annual report of the US Nuclear Regulatory Commission (NRC) describes accomplishments, activities, and plans made during Fiscal Year 1996 (FH 1996)--October 1, 1995, through September 30, 1996. Significant activities that occurred early in FY 1997 are also described, particularly changes in the Commission and organization of the NRC. The mission of the NRC is to ensure that civilian uses of nuclear materials in the US are carried out with adequate protection of public health and safety, the environment, and national security. These uses include the operation of nuclear power plants and fuel cycle plants and medical, industrial, and research applications. Additionally, the NRC contributes to combating the proliferation of nuclear weapons material worldwide. The NRC licenses and regulates commercial nuclear reactor operations and research reactors and other activities involving the possession and use of nuclear materials and wastes. It also protects nuclear materials used in operation and facilities from theft or sabotage. To accomplish its statutorily mandated regulatory mission, the NRC issues rules and standards, inspects facilities and operations, and issues any required enforcement actions

Analogue Signal Processing: Collected Papers 1996-97

DEFF Research Database (Denmark)

1997-01-01

This document is a collection of the papers presented at international conferences and in international journals by the analogue signal processing group of the Department of Information Technology, Technical University of Denmark, in 1996 and 1997.......This document is a collection of the papers presented at international conferences and in international journals by the analogue signal processing group of the Department of Information Technology, Technical University of Denmark, in 1996 and 1997....

1996 site environmental report, January--December 1996

International Nuclear Information System (INIS)

Cellamare, R.; Dannatt, G.; Dubrow, M.

1997-09-01

This report provides information about environmental programs and compliance with environmental regulations in calendar year 1996 (CY96) at the Stanford Linear Accelerator Center (SLAC). SLAC is a national laboratory operated by Stanford University under contract with the US Department of Energy (DOE) and is devoted to experimental and theoretical research in elementary particle physics in basic sciences using synchrotron radiation, and in accelerator physics and technology. The most significant information in this report is summarized briefly in the following sections: (1) releases; (2) environmental restoration; (3) hazardous and radioactive wastes; (4) air quality; (5) storm water and industrial wastewater; (6) PCB's; (7) assessments; (8) environmental radiological program; (9) groundwater; and (10) additional information

[A commentary on the Ruling of the Tribuna Constitucional 212/1996 of 19 December 1996 (I)].

Science.gov (United States)

González Morán, L

1998-01-01

This article is a commentary on Spain's Constitutional Court's ruling of 19 December 1996 (STC 212/1996), on the challenge (596/89) on grounds of alleged unconstitutionality made against Law 42/1988, 28 December, which regulates the donation of human embryos and foetuses or the cells, tissues and organs therefrom. The article is structured as follows: it opens with a summary of Law 42/1988, since this is felt necessary to understand the subsequent challenge made on grounds of alleged unconstitutionality. We then provide specific details of the challenge and the resulting ruling, before concluding with some critical remarks on the aforementioned Law and ruling.

Studierbereitschaft und Wahl von ingenieurwissenschaftlichen Studienfächern: Eine empirische Untersuchung sächsischer Abiturienten der Abschlussjahrgänge 1996, 1998 und 2000

OpenAIRE

Becker, Rolf

2000-01-01

Ausgangspunkt der vorliegenden empirischen Untersuchung ist zum einen die Frage, warum nach einem rückläufigen Trend bis 1998 die Studierneigung sächsischer Abiturienten wieder angestiegen ist und zum anderen die Frage, warum sich seit 1996 wieder mehr sächsische Abiturienten für das Ingenieurstudium interessieren. Diese Entwicklung wird anhand der Humankapital- und Werterwartungstheorie zu erklären versucht. Im Vordergrund stehen dabei die Mechanismen, die letztlich zur Entscheidung für oder...

Re-Use of Clean Coal Technology By-Products in the Construction of Low Permeability Liners. Final report, 10/1/1996 - 3/31/2000

Energy Technology Data Exchange (ETDEWEB)

Wolfe, William E. [The Ohio State Univ., Columbus, OH (United States); Butalia, Tarunjit S. [The Ohio State Univ., Columbus, OH (United States); Whitlach, Jr., E. Earl [The Ohio State Univ., Columbus, OH (United States); Mitsch, William [The Ohio State Univ., Columbus, OH (United States)

2000-12-31

This final project report presents the results of a research program conducted at The Ohio State University from October 1, 1996 to March 31, 2000 to investigate the use of stabilized flue gas desulfurization (FGD) materials in the construction of low permeability liners. The objective of the research program was to establish field-verified time-dependent relationships for the performance of liners constructed from stabilized FGD by-products generated in Ohio. The project objective was accomplished with a coordinated program of testing and analyzing small scale laboratory specimens under controlled conditions, medium-scale wetland mesocosms, and a full-scale pond facility. Although the specific uses directly addressed by this report include liners for surface impoundments, the results presented in this study are also useful in other applications including design of daily cover and liners for landfills, seepage cutoff walls and trenches and for nutrient retention and pollution mitigation wetlands. The small scale laboratory tests, medium scale mesocosm wetland experiments, and construction and monitoring of a full-scale FGD lined facility (capacity of one million gallons) shows that stabilized FGD materials can be used as low permeability liners in the construction of water and manure holding ponds, and constructed wetlands for wastewater treatment. Actual permeability coefficients in the range of 10^-7 cm/sec (3 x 10^-9 ft/sec) can be obtained in the field by properly compacting lime and fly ash enriched stabilized FGD materials. Leachate from the FGD material meets Ohio’s non-toxic criteria for coal combustion by-products, and for most potential contaminants the national primary and secondary drinking water standards are also met. The low permeability non-toxic FGD material investigated in this study poses very minimal risks, if any, for groundwater contamination. Constructed FGD-lined wetlands offer the opportunity for increased phosphorous

Hydrography, Polk County was flown in May 1996. Ayres Associates, Madison, digitized all hydrography features and provided this data as a two-dimensional AutoCAD drawing file. In 2006 Polk County converted the AutoCAD hydrography file into and shapefile creating the h, Published in 1996, 1:24000 (1in=2000ft) scale, Polk County Government.

Data.gov (United States)

NSGIC Local Govt | GIS Inventory — Hydrography dataset current as of 1996. Polk County was flown in May 1996. Ayres Associates, Madison, digitized all hydrography features and provided this data as a...

1996 technical progress report

International Nuclear Information System (INIS)

1997-01-01

Summaries of the researches are grouped into programs as follows: research and development in food and agriculture; research and development in health, environment and industry which includes all the PNRI research projects in 1996; scientific and technological services; and the nuclear regulations, licensing and safeguards of the institute

Swiss electricity statistics 1996

International Nuclear Information System (INIS)

1997-01-01

This detailed article discusses the following subjects: Survey of electricity supply in Switzerland in 1996; The Swiss electricity balance; Electric power generation; Electric power consumption; Generation, consumption and loads on selected days; Energy trade with other countries; Expansion capacities until 2003; Financial situation and appendix. (orig./RHM) [de

1996 technical progress report

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-12-31

Summaries of the researches are grouped into programs as follows: research and development in food and agriculture; research and development in health, environment and industry which includes all the PNRI research projects in 1996; scientific and technological services; and the nuclear regulations, licensing and safeguards of the institute.

Second Quarter Hanford Seismic Report for Fiscal Year 2000

International Nuclear Information System (INIS)

Hartshorn, D.C.; Reidel, S.P.; Rohay, A.C.

2000-01-01

Hanford Seismic Monitoring provides an uninterrupted collection of high-quality raw and processed seismic data from the Hanford Seismic Network (HSN) for the US Department of Energy and its contractors. Hanford Seismic Monitoring also locates and identifies sources of seismic activity and monitors changes in the historical pattern of seismic activity at the Hanford Site. The data are compiled, archived, and published for use by the Hanford Site for waste management, Natural Phenomena Hazards assessments, and engineering design and construction. In addition, the seismic monitoring organization works with the Hanford Site Emergency Services Organization to provide assistance in the event of a significant earthquake on the Hanford Site. The HSN and the Eastern Washington Regional Network (EWRN) consist of 42 individual sensor sites and 15 radio relay sites maintained by the Hanford Seismic Monitoring staff. The HSN uses 21 sites and the EWRN uses 36 sites; both networks share 16 sites. The networks have 46 combined data channels because Gable Butte and Frenchman Hills East are three-component sites. The reconfiguration of the telemetry and recording systems was completed during the first quarter. All leased telephone lines have been eliminated and radio telemetry is now used exclusively. For the HSN, there were 506 triggers on two parallel detection and recording systems during the second quarter of fiscal year (FY) 2000. Twenty-seven seismic events were located by the Hanford Seismic Network within the reporting region of 46--47degree N latitude and 119--120degree W longitude; 12 were earthquakes in the Columbia River Basalt Group, 2 were earthquakes in the pre-basalt sediments, 9 were earthquakes in the crystalline basement, and 5 were quarry blasts. Three earthquakes appear to be related to geologic structures, eleven earthquakes occurred in known swarm areas, and seven earthquakes were random occurrences. No earthquakes triggered the Hanford Strong Motion

Second Quarter Hanford Seismic Report for Fiscal Year 2000

Energy Technology Data Exchange (ETDEWEB)

DC Hartshorn; SP Reidel; AC Rohay

2000-07-17

Hanford Seismic Monitoring provides an uninterrupted collection of high-quality raw and processed seismic data from the Hanford Seismic Network (HSN) for the US Department of Energy and its contractors. Hanford Seismic Monitoring also locates and identifies sources of seismic activity and monitors changes in the historical pattern of seismic activity at the Hanford Site. The data are compiled, archived, and published for use by the Hanford Site for waste management, Natural Phenomena Hazards assessments, and engineering design and construction. In addition, the seismic monitoring organization works with the Hanford Site Emergency Services Organization to provide assistance in the event of a significant earthquake on the Hanford Site. The HSN and the Eastern Washington Regional Network (EWRN) consist of 42 individual sensor sites and 15 radio relay sites maintained by the Hanford Seismic Monitoring staff. The HSN uses 21 sites and the EWRN uses 36 sites; both networks share 16 sites. The networks have 46 combined data channels because Gable Butte and Frenchman Hills East are three-component sites. The reconfiguration of the telemetry and recording systems was completed during the first quarter. All leased telephone lines have been eliminated and radio telemetry is now used exclusively. For the HSN, there were 506 triggers on two parallel detection and recording systems during the second quarter of fiscal year (FY) 2000. Twenty-seven seismic events were located by the Hanford Seismic Network within the reporting region of 46--47{degree} N latitude and 119--120{degree} W longitude; 12 were earthquakes in the Columbia River Basalt Group, 2 were earthquakes in the pre-basalt sediments, 9 were earthquakes in the crystalline basement, and 5 were quarry blasts. Three earthquakes appear to be related to geologic structures, eleven earthquakes occurred in known swarm areas, and seven earthquakes were random occurrences. No earthquakes triggered the Hanford Strong Motion

First quarter Hanford seismic report for fiscal year 2000

Energy Technology Data Exchange (ETDEWEB)

DC Hartshorn; SP Reidel; AC Rohay

2000-02-23

Hanford Seismic Monitoring provides an uninterrupted collection of high-quality raw and processed seismic data from the Hanford Seismic Network (HSN) for the US Department of Energy and its contractors. Hanford Seismic Monitoring also locates and identifies sources of seismic activity and monitors changes in the historical pattern of seismic activity at the Hanford Site. The data are compiled, archived, and published for use by the Hanford Site for waste management, Natural Phenomena Hazards assessments, and engineering design and construction. In addition, the seismic monitoring organization works with the Hanford Site Emergency Services Organization to provide assistance in the event of a significant earthquake on the Hanford Site. The HSN and the Eastern Washington Regional Network (EWRN) consist of 42 individual sensor sites and 15 radio relay sites maintained by the Hanford Seismic Monitoring staff. The HSN uses 21 sites and the EW uses 36 sites; both networks share 16 sites. The networks have 46 combined data channels because Gable Butte and Frenchman Hills East are three-component sites. The reconfiguration of the telemetry and recording systems was completed during the first quarter. All leased telephone lines have been eliminated and radio telemetry is now used exclusively. For the HSN, there were 311 triggers on two parallel detection and recording systems during the first quarter of fiscal year (FY) 2000. Twelve seismic events were located by the Hanford Seismic Network within the reporting region of 46--47{degree}N latitude and 119--120{degree}W longitude; 2 were earthquakes in the Columbia River Basalt Group, 3 were earthquakes in the pre-basalt sediments, 9 were earthquakes in the crystalline basement, and 1 was a quarry blast. Two earthquakes appear to be related to a major geologic structure, no earthquakes occurred in known swarm areas, and 9 earthquakes were random occurrences. No earthquakes triggered the Hanford Strong Motion Accelerometers

Progress report 1996 - 1997; Rapport d'activite 1996 - 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-07-01

This report reviews the activities of the laboratory for the years 1996 and 1997. Laboratory's activities are driven by an important international program on particle physics and astro-particles. 9 topics are presented: 1) physics at LHC: the ATLAS experiment, 2) the search for a new physics at LEP : DELPHI experiment, 3) neutrino oscillations: NOMAD and TONIC experiments, 4) the experiments H1 at HERA, 5) CP breaking: BABAR experiment, 6) DO experiment at the Tevatron, 7) gamma radiation sources: CAT experiment, 8) supernova, and 9) the project of the AUGER observatory.

Energy Balance of the Sao Paulo State -1997. Base year 1996

International Nuclear Information System (INIS)

1997-01-01

This energy balance of the Santa Catarina State presents the following main topics that can be outstanding: panorama of the energy matrix; supply and demand of energy by source 1983-1996; energy consumption by sector 1983/1996; socio-economic aspects; resources and reserves energy; and balance of the transformation centers 1984/1996

1996 Annual report; 1996 Informe anual

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-12-31

This annual report present information of the main activities on the scope of the radiation protection and nuclear safety of the Nuclear Regulatory Authority (ARN) of the Argentina during 1996. The activities are developed in 10 chapters and 2 appendices, were are described the activities and the bases of the Argentine Regulatory System. The followings chapters and appendices are: 1.-Evolution of the nuclear regulatory activities in the Argentina since the beginnings in the CNEA. 2.-Regulatory system, laws and regulations. 3.-Institutional relations with national and international organizations. 4. and 5.-Safeguards and inspections of the nuclear installations. 6.-Radiation control of the occupational and public doses. 7.-Radiological emergencies. 8.-Projects and tasks scientific-technological. 9.-Training courses and meetings. 10.-Economic and human recourses. Appendix I.-Regulatory documentation. Appendix II.- Inspections of nuclear installations.

Waste Tax 1987-1996

DEFF Research Database (Denmark)

Andersen, M. S.; Dengsøe, N.; Brendstrup, S.

The report gives an ex-post evaluation of the Danish waste tax from 1987 to 1996. The evaluation shows that the waste tax has had a significant impact on the reductions in taxable waste. The tax has been decisive for the reduction in construction and demolition waste, while for the heavier...

Enforcement actions: Significant actions resolved individual actions. Semiannual progress report, January 1996--June 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-08-01

This document summarizes significant enforcement actions that have been resolved during the period of January-June 1996. The report includes copies of Orders and Notices of Violations sent by the Nuclear Regulatory Commission to individuals with respect to the enforcement actions.

Enforcement actions: Significant actions resolved individual actions. Semiannual progress report, January 1996--June 1996

International Nuclear Information System (INIS)

1996-08-01

This document summarizes significant enforcement actions that have been resolved during the period of January-June 1996. The report includes copies of Orders and Notices of Violations sent by the Nuclear Regulatory Commission to individuals with respect to the enforcement actions

Savannah River Site environmental report for 1996 summary

International Nuclear Information System (INIS)

Arnett, M.W.

1997-01-01

The Savannah River Site (SRS) publishes an environmental report each year to provide environmental monitoring and surveillance results to the US department of Energy (DOE), the public, Congress, state and federal regulators, universities, local governments, the news media, environmental and civic groups. The Savannah River Site Environmental Report for 1996 (WSRC-TR-97-0171) contains detailed information on site operations, environmental monitoring and surveillance programs, environmental compliance activities, and special projects for the calendar year 1996. The purpose of this document is to give a brief overview of the site and its activities, to summarize the report and the impact of 1996 SRS operations on the environment and the public, and to provide a brief explanation of radiation and dose

Quarterly coal report, October--December 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-05-01

The Quarterly Coal Report (QCR) provides comprehensive information about US coal production, distribution, exports, imports, receipts, prices, consumption, and stocks to a wide audience, including Congress, Federal and State agencies, the coal industry, and the general public. Coke production, consumption, distribution, imports, and exports data are also provided. This report presents detailed quarterly data for October through December 1996 and aggregated quarterly historical data for 1990 through the third quarter of 1996. Appendix A displays, from 1988 on, detailed quarterly historical coal imports data. To provide a complete picture of coal supply and demand in the US, historical information has been integrated in this report. 8 figs., 72 tabs.

Before the year 2000: Artificial neural networks may set the standard

International Nuclear Information System (INIS)

Michal, R.A.

1994-01-01

The use of artifical neural networks (ANNs) for monitoring of equipment and components in nuclear power plants could be commonplace before the turn of the century. Within five years, the relative inexpensiveness of neural networks could usher in a technology that will be used to detect incipient faults in machinery and increase effectiveness of maintenance scheduling. Working since November 1992 with the Electric Power Research Institute on research and development of the technology, SynEx and another Virginia-based company, A ampersand T, Inc., will later this year demonstrate prototype ANN systems at Consolidated Edison Company and New York State Electric Gas fossil fuel power plants. (Fossil fuel plants were chosen for the project because of easier access, as opposed to the security measures in place at nuclear facilities.) The demonstration will utilize sensors and the neural network systems to detect abnormal equipment behavior, sending signals back to centralized monitoring boards located in each plant's control room. The cost of the project, including research and development, will reach $1 million. However, the cost of installing a neural network at a nuclear plant within the next five years, according to Birdsall, could be as low as $10,000 to $15,000, with hopes of reducing the expenditure to just $5000

RE-SONANCEI March 1996

Indian Academy of Sciences (India)

Maynard Smith says" fifteen years later, when I decided to leave engineering and train as a biologist, I entered. RESONANCE I March 1996. S Thangavelu is with Statistics and Mathematics Unit,. Indian Statistical Institute, R V College Post, Banga- lore 560 059. University College, London, where Haldane was at that time a ...

Radiocesium in reindeer the slaughter-season 1996/97

International Nuclear Information System (INIS)

Aahman, B.

1997-10-01

During the slaughter season 1996/1997 (1 July 1996 to 30 June 1997), 731 reindeer in Sweden (1.2% of the total number of slaughtered reindeer) were condemned because of too high levels of radiocaesium (over 1 500 Bq 137 Cs per kg fresh meat). This was less than during the previous year, 1995/1996 (when 2% were condemned) and a large improvement compared to earlier years (before 1994). The main reason was that a large part of the slaughtered animals had been slaughtered early in the autumn - when radiocaesium levels are lower than in winter- (8952 reindeer) or that they had been fed uncontaminated feed during some period before slaughter (about 9 900 reindeer). The decreasing number of condemned reindeer is also an effect of generally declining radiocaesium levels in reindeer. The average decline in freely grazing reindeer corresponds to an effective ecological half-life at 3.4 years for the period 1986/87 to 1991/92 and a corresponding half-life 5.6 years for the following 5 years (until 1996/97). The predictions for 1996/97 and the official regulations for control of radiocaesium in reindeer meat were well in accordance with the measured levels of radiocaesium in the slaughtered reindeer. Totally about 22 000 reindeer carcasses were monitored for 137 Cs. The main part of the meat control was made by direct monitoring of gamma radiation from reindeer carcasses at the slaughter house. In this way, the number of muscle samples that were monitored for radiocaesium was kept at a low level (4 198 samples)

Distribución estival del stock sureño de la merluza argentina (Merluccius hubbsi Marini, 1933 en el área de cría (44°-47°S en relación con parámetros oceanógraficos (1996-2001 Summer distribution of the southern stock of the Argentine hake (Merluccius hubbsi Marini, 1933 in the nursery area (44°-47°S in relation to oceanographic parameters (1996-2001

Directory of Open Access Journals (Sweden)

Elena Louge

2011-01-01

Full Text Available Se analizaron las variables temperatura y salinidad en verano, durante el período 1996-2001 en el área de cría del efectivo patagónico de la merluza argentina Merluccius hubbsi. Estas variables oceanógraficas se relacionaron con las variaciones en la abundancia de la población, a través de un modelo lineal general. Se determinaron los valores medios y las anomalías de temperatura y salinidad de fondo. Las anomalías térmicas positivas más extremas se produjeron en 1999 y 2000, mientras que el año más frío fue 1996. La anomalía de salinidad más baja se registró en 1996 y la más alta en el 2000. La merluza se concentró principalmente en las zonas de gradientes térmicos y salinos Los juveniles se hallaron preferentemente en el Golfo San Jorge en aguas con temperaturas entre 8º y 10°C y salinidades entre 33,2 y 33,6 y los adultos dentro y fuera del mismo, con temperaturas de fondo entre 8º y 12°C y salinidades 33,2 y 33,5. Las mayores densidades de juveniles se hallaron en aguas de menor profundidad, con valores elevados de salinidad y menores valores de temperatura respecto de los adultos. Estos se concentraron tanto en el sector norte del golfo y en la Bahía Camarones, en aguas con relativamente alta temperatura y escasa profundidad, como sobre la plataforma frente al golfo, donde las aguas tienen menor salinidad debido a la deriva de la Corriente Patagónica de aguas diluidas. No se observaron cambios en la distribución de la población en los años con anomalías ambientales marcadas.Summer temperature and salinity data in the nursery ground of the Patagonian stock of Argentine hake Merluccius hubbsi recorded from 1996 to 2001 were analyzed. These oceanographic variables were related to variations in the hake population abundance by means of a general linear model. Mean values and anomalies of bottom temperatures and salinity fields were determined. The most extreme positive thermal anomalies occurred in 1999 and 2000

An outbreak of meningococcal meningitis in Gauteng, Spring 1996 ...

African Journals Online (AJOL)

Objective. To describe a Neisseri.a meningitidis outbreak in Gauteng during the period 1 July to 31 December 1996. Design. A descriptive study. Setting. Patients with meningococcal meningitis in Gauteng who had been diagnosed by laboratory means, or notified during the period 1 July to 31 December 1996.

2000 Annual report: synthesis; 2000 Resenia de actividades

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-07-01

This synthesis of the Annual Report 2000 present information of the main activities on the scope of the radiation protection and nuclear safety of the Nuclear Regulatory Authority (NRA) of the Argentina during 2000.

Arrangements for transition from the 1985 edition (as amended 1990) to the 1996 edition of the IAEA Transport Regulations

International Nuclear Information System (INIS)

2001-01-01

In December 1996 the International Atomic Energy Agency published the 1996 Edition of the Regulations for the Safe Transport of Radioactive Material (formerly Safety Series No. 6) in a document called ST-1. That document has served as the basis for revising the UN Committee of Experts Recommendations on the Safe Transport of Dangerous Goods (published in 1999 as ''Model Regulations''), and as the basis for the Class 7 portions of the forthcoming revisions of RID, ADR, IMO (IMDG Code), ICAO (Technical Instructions) and IATA modal dangerous goods regulations. ST-1 was subsequently reviewed and revised with minor editorial corrections, and in 2000, a revised English version of the regulations called TS-R-1 (ST-1, Revised) was published. Difficulties may arise when applying the Regulations during the transition from the 1985 Edition of the Transport Regulations to the 1996 Edition of these regulations. These difficulties come mainly from the differences between the two sets of regulations, e.g. the definition of radioactive material with the new nuclide specific exemption levels, the new values of A 1 /A 2 , the annual dose limits, the related documentation, the labelling requirements for fissile material package, the changes in UN numbers and proper shipping names, the shipment of fissile material by air, etc. This TECDOC is intended to provide guidance on the implementation of changes in the Regulations for the Safe Transport of Radioactive Material. This guidance may be used to facilitate compliance with the Regulations. This guidance is aimed at all users of the regulations including National Competent Authorities, consignors, consignees and carriers

Lifelong Literacies. Papers from the 1996 Conference (Manchester, England, United Kingdom, May 1996).

Science.gov (United States)

Fitzpatrick, Stella, Ed.; Mace, Jane, Ed.

This collection of 17 papers, presented at a conference in May 1996, documents some of the current thinking about adult literacy education in Great Britain. The first of the three sections of the papers, "Some Context," contains two analyses of the political and economic realities within which potential participants in adult literacy and…

Artificial Neural Network Analysis System

Science.gov (United States)

2001-02-27

Contract No. DASG60-00-M-0201 Purchase request no.: Foot in the Door-01 Title Name: Artificial Neural Network Analysis System Company: Atlantic... Artificial Neural Network Analysis System 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) Powell, Bruce C 5d. PROJECT NUMBER 5e. TASK NUMBER...34) 27-02-2001 Report Type N/A Dates Covered (from... to) ("DD MON YYYY") 28-10-2000 27-02-2001 Title and Subtitle Artificial Neural Network Analysis

Annual report 2000; Rapport annuel 2000

Energy Technology Data Exchange (ETDEWEB)

NONE

2002-07-01

This report presents the activities of the Cogema group, its reports on management and its financial situation for the year 2000: presentation of TOPCO, boards of directors, profile, main consolidated data, year 2000 highlights, group activities (mining-chemistry, enrichment, reprocessing-recycling, engineering, services, sustainable development, health and safety, quality policy, human resources, R and D, communication), organization chart of the consolidated Cogema group, financial statements, directory. (J.S.)

Abstracts and papers of the 1996 International RERTR Meeting

International Nuclear Information System (INIS)

1996-10-01

The 1996 International Meeting on Reduced Enrichment for Research and Test Reactors (RERTR) was sponsored by the Korea Atomic Energy Research Institute and the International Atomic Energy Agency and was held in Seoul, Korea, on 6-10 October 1996. The abstracts and available papers that were presented at this meeting are provided. The most important subject dealt with was progress of the Reduced Enrichment Research and Test Reactor (RERTR) Program. The major events, findings, and activities of 1996 are reviewed with the results which the RERTR Program has achieved by the end of 1995 in collaboration of the ANL and its many international partners

Abstracts and papers of the 1996 International RERTR Meeting

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-10-01

The 1996 International Meeting on Reduced Enrichment for Research and Test Reactors (RERTR) was sponsored by the Korea Atomic Energy Research Institute and the International Atomic Energy Agency and was held in Seoul, Korea, on 6-10 October 1996. The abstracts and available papers that were presented at this meeting are provided. The most important subject dealt with was progress of the Reduced Enrichment Research and Test Reactor (RERTR) Program. The major events, findings, and activities of 1996 are reviewed with the results which the RERTR Program has achieved by the end of 1995 in collaboration of the ANL and its many international partners.

1996 Progress report on energies and raw materials; 1996 rapport d`activite energies et matieres premieres

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

The 1996 annual progress report, from the French Department of Energy, reviews the key points of the French policy for energy and raw materials: competitiveness, environmental protection, long term supply safety, and public service. 1996 was marked by positive results for the French energy industry, difficulties for the oil refining industry, and a new impetus for renewable energies. Five surveys are presented: nuclear safety in Eastern Europe, the european directive on electric power domestic market, evolution of the oil market, conditions of refining in France, and restructuring of the Mine bureau (BRGM). 40 prominent facts are briefly reviewed, concerning sustainable energy development, nuclear energy, electric power and gas, coal, oil products, raw materials. Diagrams on energy and raw materials are also included

1996 Progress report on energies and raw materials; 1996 rapport d`activite energies et matieres premieres

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-12-31

The 1996 annual progress report, from the French Department of Energy, reviews the key points of the French policy for energy and raw materials: competitiveness, environmental protection, long term supply safety, and public service. 1996 was marked by positive results for the French energy industry, difficulties for the oil refining industry, and a new impetus for renewable energies. Five surveys are presented: nuclear safety in Eastern Europe, the european directive on electric power domestic market, evolution of the oil market, conditions of refining in France, and restructuring of the Mine bureau (BRGM). 40 prominent facts are briefly reviewed, concerning sustainable energy development, nuclear energy, electric power and gas, coal, oil products, raw materials. Diagrams on energy and raw materials are also included

Natural radionuclides by gammaspectrometry in region of Vojvodina, in Yugoslavia for 1998, 1997 and 1996

International Nuclear Information System (INIS)

Javorina, L.R.; Vukovic, D.M.; Markovic, D.

2000-01-01

Region of Vojvodina, as a agriculture region in Yugoslavia is important part of Yugoslavia. Monitoring of radioactivity in environment had established in the tree points: Novi Sad and Subotica as cities and Palic as a National park. Radioactivity comes mostly from natural radionuclides and partly from long-lived radionuclides from non natural sources as a consequence of Chernobyl accident. Monitoring of environment has proceeded by vertical methodology. We analyzed: aerosol, soil, fallout (wet and dry deposition), rivers, lakes, drinking water, human and animal food. Results from analyze of samples from environment contains very low activity, actually activity of changes of basic signal. Results for 1998, 1997 and 1996 are: 1. Gamma dose was measure in Belgrade with median years values: 0.103 μG/h (1998), 0.077 μG/h (1997) and 0.072 μG/h (1996). 2. By gammaspectrometry analyze of air of months samples for each year, results shows activity of changes of basic signal. The signals are coming from natural radionuclides. 3. 137 Cs, as a long lived radionuclide, with remarkable activity in soil are: Novi Sad 4.40-19.2 Bq/kg (1998), 8.2-16.3 Bq/kg (1997) and 5.0-10.8 Bq/kg (1996) and Palic 8.9-15.9 Bq/kg (1998), - Bq/kg (1997) and 5.02-13.4 Bq/kg (1996). 4. Activity in rivers Danube (Novi Sad) and Tisa (Kanjiza) belongs to 40 K, while activities of 137 Cs, 226 Ra, 232 Th, 235 U and 238 U are in traces. Activity of river sediment comes from 137 Cs with values 0.4-46 Bq/kg of dry samples (river Danube). Activity in fish, mixture, white fish and others comes from 40 K 55-100 Bq/kg and 137 Cs 0.2-0.8 Bq/kg. 5. Activity of drinking waters, from city network shows low level of activity which comes from 40 K, for both places. 6. Activity in milk comes from 40 K: Novi Sad 31-59 Bq/l (1998), 36-59 Bq/l (1997) and 28-49.42 Bq/l (1996). Activities of 137 Cs are on the same level of detection. 7. Activity in the human food, measured in yogurt, meats, bread and agricultural

Natural radionuclides by gammaspectrometry in region of Vojvodina, in Yugoslavia for 1998, 1997 and 1996

Energy Technology Data Exchange (ETDEWEB)

Javorina, L.R.; Vukovic, D.M. [Institute of Occupational and Radiological Health, Deligradska 29, Belgrade, Yugoslavia, Faculty of Physical Chemistry, Studentski trg 12, Belgrade (Yugoslavia); Markovic, D. [Faculty of Physical Chemistry, Belgrade (Yugoslavia)

2000-05-01

Region of Vojvodina, as a agriculture region in Yugoslavia is important part of Yugoslavia. Monitoring of radioactivity in environment had established in the tree points: Novi Sad and Subotica as cities and Palic as a National park. Radioactivity comes mostly from natural radionuclides and partly from long-lived radionuclides from non natural sources as a consequence of Chernobyl accident. Monitoring of environment has proceeded by vertical methodology. We analyzed: aerosol, soil, fallout (wet and dry deposition), rivers, lakes, drinking water, human and animal food. Results from analyze of samples from environment contains very low activity, actually activity of changes of basic signal. Results for 1998, 1997 and 1996 are: 1. Gamma dose was measure in Belgrade with median years values: 0.103 {mu}G/h (1998), 0.077 {mu}G/h (1997) and 0.072 {mu}G/h (1996). 2. By gammaspectrometry analyze of air of months samples for each year, results shows activity of changes of basic signal. The signals are coming from natural radionuclides. 3. {sup 137}Cs, as a long lived radionuclide, with remarkable activity in soil are: Novi Sad 4.40-19.2 Bq/kg (1998), 8.2-16.3 Bq/kg (1997) and 5.0-10.8 Bq/kg (1996) and Palic 8.9-15.9 Bq/kg (1998), - Bq/kg (1997) and 5.02-13.4 Bq/kg (1996). 4. Activity in rivers Danube (Novi Sad) and Tisa (Kanjiza) belongs to {sup 40}K, while activities of {sup 137}Cs, {sup 226}Ra, {sup 232}Th, {sup 235}U and {sup 238}U are in traces. Activity of river sediment comes from {sup 137}Cs with values 0.4-46 Bq/kg of dry samples (river Danube). Activity in fish, mixture, white fish and others comes from {sup 40}K 55-100 Bq/kg and {sup 137}Cs 0.2-0.8 Bq/kg. 5. Activity of drinking waters, from city network shows low level of activity which comes from {sup 40}K, for both places. 6. Activity in milk comes from {sup 40}K: Novi Sad 31-59 Bq/l (1998), 36-59 Bq/l (1997) and 28-49.42 Bq/l (1996). Activities of {sup 137}Cs are on the same level of detection. 7. Activity in

RCA annual report 1996. Draft

International Nuclear Information System (INIS)

1997-02-01

In accordance with Article VII.4 of the Regional Co-operative Agreement for Research, Development and Training Related to Nuclear Science and Technology 1987 and extended in 1992, a draft report of activities for the calendar year 1996 is submitted

KURRI progress report 1995. April 1995 - March 1996

International Nuclear Information System (INIS)

1996-11-01

1995 is the first year into the 'second life' of KURRI. Following the suggestion of the Science Council, the research divisions were reorganized from old 16 divisions into 6 large divisions on April 1, 1995, and the five year modernization program of the Kyoto University reactor (KUR) and its related facilities was begun. The KUR added 1,165 h of operation during the past fiscal year. 2,002 researchers in total visited the KURRI to perform 148 experimental applications or to attend 16 symposia and 6 workshops. At the end of three year period, the scientific achievements of five research projects were reviewed during the annual scientific meeting of the KURRI held on January 25 and 26, 1996. On March 18, 1996, the KURRI celebrated the reorganization of the Center of Excellence, and the international symposium on the advance in neutron optics and the related research facilities was held for the following three days. The replacement of the heavy water facility was carried out during the reactor shutdown from December, 1995 to May, 1996. The user operation of the KUR was resumed on July 15, 1996. In this book, research activities, organization, research divisions and laboratories, the operation and development of facilities, radiation protection and monitoring, publications, meetings and seminars are reported. (K.I.)

KURRI progress report 1995. April 1995 - March 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-11-01

1995 is the first year into the `second life` of KURRI. Following the suggestion of the Science Council, the research divisions were reorganized from old 16 divisions into 6 large divisions on April 1, 1995, and the five year modernization program of the Kyoto University reactor (KUR) and its related facilities was begun. The KUR added 1,165 h of operation during the past fiscal year. 2,002 researchers in total visited the KURRI to perform 148 experimental applications or to attend 16 symposia and 6 workshops. At the end of three year period, the scientific achievements of five research projects were reviewed during the annual scientific meeting of the KURRI held on January 25 and 26, 1996. On March 18, 1996, the KURRI celebrated the reorganization of the Center of Excellence, and the international symposium on the advance in neutron optics and the related research facilities was held for the following three days. The replacement of the heavy water facility was carried out during the reactor shutdown from December, 1995 to May, 1996. The user operation of the KUR was resumed on July 15, 1996. In this book, research activities, organization, research divisions and laboratories, the operation and development of facilities, radiation protection and monitoring, publications, meetings and seminars are reported. (K.I.)

Westcoast Energy annual report 2000: linking new supply to growing markets

International Nuclear Information System (INIS)

2000-01-01

Financial information from Westcoast Energy Inc. was presented along with a review of their operations throughout 2000. Westcoast Energy is a leading energy company with assets reported at $15.1 billion. In 2000, net income was reported at $340 million, up from $222 million in 1999. The company's network of gathering, processing, transportation, distribution, power generation and storage facilities rely on clean-burning natural gas as the energy source. In 2000, Westcoast's British Columbia pipeline system was further extended into the Northwest Territories with the connection of new reserves at Fort Liard. In addition, start-up on the Alliance and Vector pipelines linked Eastern Canada and the Central United States. Construction was also completed on two major lateral pipelines for the Maritimes and Northeast Pipeline, extending service into Atlantic Canadian markets. This report also presented consolidated financial statements and common share information. Revenue and expenditure statements were summarized by source. tabs., figs

Water supply at Los Alamos during 1996. Progress report

International Nuclear Information System (INIS)

McLin, S.G.; Purtymun, W.D.; Maes, M.N.; Longmire, P.A.

1997-12-01

Production of potable municipal water supplies during 1996 totaled about 1,368.1 million gallons from wells in the Guaje, Pajarito, and Otowi well fields. There was no water used from either the spring gallery in Water Canyon or from Guaje Reservoir during 1996. About 2.6 million gallons of water from Los Alamos Reservoir was used for lawn irrigation. The total water usage in 1996 was about 1,370.7 million gallons, or about 131 gallons per day per person living in Los Alamos County. Groundwater pumpage was up about 12.0 million gallons in 1996 compared with the pumpage in 1995. This report fulfills requirements specified in US Department of Energy (DOE) Order 5400.1 (Groundwater Protection Management Program), which requires the Los Alamos National Laboratory (LANL) to monitor and document groundwater conditions below Pajarito Plateau and to protect the regional aquifer from contamination associated with Laboratory operations. Furthermore, this report also fulfills special conditions by providing information on hydrologic characteristics of the regional aquifer, including operating conditions of the municipal water supply system

Progress report 1996 - 1997; Rapport d'activite 1996 - 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-07-01

This report reviews the activities of the laboratory for the years 1996 and 1997. Laboratory's activities are driven by an important international program on particle physics and astro-particles. 9 topics are presented: 1) physics at LHC: the ATLAS experiment, 2) the search for a new physics at LEP : DELPHI experiment, 3) neutrino oscillations: NOMAD and TONIC experiments, 4) the experiments H1 at HERA, 5) CP breaking: BABAR experiment, 6) DO experiment at the Tevatron, 7) gamma radiation sources: CAT experiment, 8) supernova, and 9) the project of the AUGER observatory.

Houston prefreshman enrichment program (Houston PREP). Final report, June 10, 1996--August 1, 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-10-01

The 1996 Houston Pre-freshman Enrichment Program (PREP) was conducted on the campus of the University of Houston-Downtown from June 10 to August 1, 1996. Program Participants were recruited from the Greater Houston area. All participants were identified as high achieving students with an interest in learning about the engineering and science professions. The goal of the program was to better prepare our pre-college youth prior to entering college as mathematics, science and engineering majors. The program participants were middle school and high school students from the Aldine, Alief, Channel View, Crockett, Cypress-Fairbanks, Fort Bend, Galena Park, Houston, Humble, Katy, Klein, North Forest, Pasadena, Private, and Spring Branch Independent School Districts. Of the 197 students starting the program, 170 completed, 142 students were from economically and socially disadvantage groups underrepresented in the engineering and science professions, and 121 of the 197 were female. Our First Year group for 1996 composed of 96% minority and women students. Our Second and Third Year students were 100% and 93.75% minority or women respectively. This gave an overall minority and female population of 93.75%. This year, special efforts were again made to recruit students from minority groups, which caused a significant increase in qualified applicants. However, due to space limitations, 140 applicants were rejected. Investigative and discovery learning were key elements of PREP. The academic components of the program included Algebraic Structures, Engineering, Introduction to Computer Science, Introduction to Physics, Logic and Its Application to Mathematics, Probability and Statistics, Problem Solving Seminar using computers and PLATO software, SAT Preparatory Seminars, and Technical Writing.

A compilation of U.S. Geological Survey pesticide concentration data for water and sediment in the Sacramento–San Joaquin Delta region: 1990–2010

Science.gov (United States)

Orlando, James L.

2013-01-01

��National Water Quality Assessment Program (NAWQA; http://water.usgs.gov/ nawqa/) and National Stream Quality Accounting Network (NASQAN; http://water.usgs.gov/nasqan/)—and through projects associated with the USGS Toxics Substances Hydrology Program (http://toxics.usgs.gov/). In addition, data were collected during multiple research projects that were supported by various federal, state, and local agencies. Although these data have been previously published in some form, it is hoped that by focusing on samples collected within the delta region and presenting these data in a concise format, they will be a valuable resource for scientists, resource managers, and members of the public working to understand the role of pesticides in the POD and their potential effects on the overall health of the delta ecosystem.

Adaptive Regularization of Neural Networks Using Conjugate Gradient

DEFF Research Database (Denmark)

Goutte, Cyril; Larsen, Jan

1998-01-01

Andersen et al. (1997) and Larsen et al. (1996, 1997) suggested a regularization scheme which iteratively adapts regularization parameters by minimizing validation error using simple gradient descent. In this contribution we present an improved algorithm based on the conjugate gradient technique........ Numerical experiments with feedforward neural networks successfully demonstrate improved generalization ability and lower computational cost...

EIA publications directory 1996

International Nuclear Information System (INIS)

1997-05-01

This edition of the EIA Publications Directory contains titles and abstracts of periodicals and one-time reports produced by the Energy Information Administration (EIA) from January through December 1996. The body of the Directory contains citations and abstracts arranged by broad subject categories; metadata, coal, oil and gas, nuclear, electricity, renewable and energy/alternative fuels, multifuel, end-use consumption, models, and forecasts

Giving USA 1997: The Annual Report on Philanthropy for the Year 1996.

Science.gov (United States)

Kaplan, Ann E., Ed.

This report presents a comprehensive review of private philanthropy in the United States during 1996. After a preliminary section, the first section presents data on giving, using text, graphs, and charts. Sections cover: overall 1996 contributions; changes in giving by source and use; total giving (1966-1996); inflation-adjusted giving in 5-year…

TNX/HLW Long Shaft Pumps 1995-2000

International Nuclear Information System (INIS)

VanPelt, B.

2002-01-01

Problems with long shaft pumps are becoming clearer due to increased use, better instrumentation, more analysis, and increased testing activity. The problems are with reliability and not with hydraulic performance. The root cause of reliability problems is usually excessive vibration caused by design. The outlook for satisfactory pumps is improved as understanding of problems increases. Promising developments are emerging such as the tilt pad bearing. Alternative configurations, such as gas filled columns and submerged motor pumps, will require development. Continued development, in general, should be expected due to changing technology and industry changes. This report describes thirteen distinct pump programs starting with leakage of original mixer pumps in the 1980s and ending with the testing of tilt pad bearings now in progress. Eight of the programs occurred from 1996 to 2000. All involve long shaft pumps; all involve testing at TNX; and all involve a problem of some kind. The co mmon technical issue among the activities is vibration and shaft (or rotor) instability due to journal bearings. In every case, excessive shaft vibration is a reasonable and probable explanation for some or all of the problems

Epidemiologic study of Kawasaki disease at a single hospital in Daejeon, Korea (1987 through 2000).

Science.gov (United States)

Lee, Kyung-Yil; Han, Ji-Whan; Lee, Hyung-Shin; Hong, Ja-Hyun; Hahn, Seung-Hoon; Lee, Joon-Sung; Whang, Kyung-Tai

2004-01-01

We evaluated the epidemiology and a range of clinical characteristics in children with Kawasaki disease (KD) in one area of South Korea. We retrospectively analyzed 506 medical records of children with KD, who were admitted at Daejeon St. Mary's Hospital from January 1987 through December 2000. The mean annual frequency was 36.1 +/- 11.1 cases per year. There were 55 cases (10.9%) in 1993, 50 cases (9.9%) in 1994 and 47 cases (9.3%) in 2000. There was a slightly higher occurrence in summer with no significant difference in seasonal frequency. Age distribution ranged from 2 months to 13 years of age (mean, 2.4 +/- 1.7 years) and 485 children (95.8%) were 500 mg/day for 4 to 5 days, 231 cases, 45.7%) and one dose IVIG (2.0 g/kg, 210 cases, 41.5%) were used. Between 1996 and 2000, 143 cases were treated with only one dose IVIG, and 21 cases (14.7%) showed coronary artery lesions (CAL). Among the 143 cases 22 cases (15.4%) were retreated with IVIG and/or steroid pulse therapy. The incidence of CAL in this group was 50.0%. In Daejeon, Korea, KD showed slight annual variations without seasonal differences. The rate of CAL in acute stage with one dose IVIG therapy (2 g/kg) was 8.3% in the IVIG responders.

The German Radiation Protection Ordinance of 2000: a survey and comparison with the former regulations

International Nuclear Information System (INIS)

Wolf, H.

2000-01-01

The radiation protection standards defined by the European Union in May 1996, as well as the EU directive for the protection of patients, effective since June 1997, have to be incorporated into the law and administrative regulations of the Federal Republic of Germany by the 13th of May 2000. The German BMU, the ministry responsible for nuclear safety and radiation protection, presented the draft law for departmental consultation about the amendment of the StlSchV in December 1999. This draft law is the basis of the expert discussions of the meeting. One major change for instance is that for the first time, a broad classification system has been applied, which facilitates orientation. (orig./CB) [de

JAS'2000

CERN Multimedia

2000-01-01

Are you interested in beam dynamics? Do you work on the LHC injectors or CLIC or maybe feasibility studies fornew machines? Then this is for youJAS'2000: Joint CERN-Japan-JINR-Russia-US SchoolFrontiers of Accelerator Technology: High Quality Beams to be held on a river boat between St. Petersburg and Moscow 1 to 14 July 2000. For further information see eitherhttp://schools.web.cern.ch/Schools/CAS/ orhttp://www.indiana.edu/~uspas/programs/js/jas2000.html

The annual report for 1996

International Nuclear Information System (INIS)

1997-07-01

Article VI.J of the Agency's Statute requires the Board of Governors to submit 'an annual report to the General Conference concerning the affairs of the Agency and any projects approved by the Agency'. This report covers the period 1 January to 31 December 1996

Current Status of Groundwater Monitoring Networks in Korea

Directory of Open Access Journals (Sweden)

Jin-Yong Lee

2016-04-01

Full Text Available Korea has been operating groundwater monitoring systems since 1996 as the Groundwater Act enacted in 1994 enforces nationwide monitoring. Currently, there are six main groundwater monitoring networks operated by different government ministries with different purposes: National Groundwater Monitoring Network (NGMN, Groundwater Quality Monitoring Network (GQMN, Seawater Intrusion Monitoring Network (SIMN, Rural Groundwater Monitoring Network (RGMN, Subsidiary Groundwater Monitoring Network (SGMN, and Drinking Water Monitoring Network (DWMN. The Networks have a total of over 3500 monitoring wells and the majority of them are now equipped with automatic data loggers and remote terminal units. Most of the monitoring data are available to the public through internet websites. These Networks have provided scientific data for designing groundwater management plans and contributed to securing the groundwater resource particularly for recent prolonged drought seasons. Each Network, however, utilizes its own well-specifications, probes, and telecommunication protocols with minimal communication with other Networks, and thus duplicate installations of monitoring wells are not uncommon among different Networks. This mini-review introduces the current regulations and the Groundwater Monitoring Networks operated in Korea and provides some suggestions to improve the sustainability of the current groundwater monitoring system in Korea.

Observations and analysis of self-similar branching topology in glacier networks

Science.gov (United States)

Bahr, D.B.; Peckham, S.D.

1996-01-01

Glaciers, like rivers, have a branching structure which can be characterized by topological trees or networks. Probability distributions of various topological quantities in the networks are shown to satisfy the criterion for self-similarity, a symmetry structure which might be used to simplify future models of glacier dynamics. Two analytical methods of describing river networks, Shreve's random topology model and deterministic self-similar trees, are applied to the six glaciers of south central Alaska studied in this analysis. Self-similar trees capture the topological behavior observed for all of the glaciers, and most of the networks are also reasonably approximated by Shreve's theory. Copyright 1996 by the American Geophysical Union.

Poverty Monitor 2000

NARCIS (Netherlands)

2000-01-01

Original title: Armoedemonitor 2000. The Poverty Monitor 2000 (Armoedemonitor 2000) contains the most up-to-date figures on poverty in the Netherlands. The data were collected and analysed by the Netherlands Institute for Social Research/SCP and Statistics Netherlands (CBS). The extent of

Hazards Control Department 1996 Annual Report

Energy Technology Data Exchange (ETDEWEB)

Richards, J.

1997-06-30

This annual report on the activities of the Hazards Control Department (HCD) in 1996 is part of the department's continuing effort to foster a working environment at Lawrence Livermore National Laboratory where every person has the means, ability, and desire to work safely. The significant accomplishments and activities, the various services provided, and research into Environment, Safety, and Health (ES&H) issues by HCD would not have been possible without the many and ongoing contributions by its employees and support personnel. The HCD Leadership Team thanks each and every one in the department for their efforts and work in 1996 and for their personal commitment to keeping one of the premier research and scientific institutions in the world today a safe and healthy place.

Implementation of IRR99 and IRMER2000 in UK hospitals

International Nuclear Information System (INIS)

Beddoe, A.; Temperton, D.; Rafiqi, E.; Larkin, E.; Jones, T.

2004-01-01

In the United Kingdom, the Ionising Radiations Regulations 1999 (IRR99) replaced the Ionising Radiations Regulations 1985 (IRR85) from January 2000. The main aim of the new regulations and the associated Code of Practice was similar to the old ones, namely to establish a framework for ensuring that exposure to ionising radiation from work activities was kept as low as reasonably practicable (ALARP). IRR99 reflects the 1990 Recommendations of the International Commission on Radiological Protection (ICRP60) via the 1996 (European) Basic Safety Standards Directive 96/29/EURATOM. Major changes were revised dose limits, the introduction of prior risk assessment for new premises or practices, and a formally instituted QA programme on radiation equipment used for medical exposures. In May 2000, the Ionising Radiation (Medical Exposure) Regulations 2000 (IR(ME)R2000) came into force to implement requirements of the European Directive 97/43/EURATOM. These further extended the justification and optimisation principles of the previous Ionising Radiation (Protection of Persons Undergoing Medical Exposure or Treatment) Regulations 1988 (POPUMET) by requiring every medical exposure to be justified by a practitioner and by introducing diagnostic reference levels (DRLs) for radiological exposures (including nuclear medicine). Other roles were also defined, including referrers, operators and medical physics experts, each with legal responsibility under IR(ME)R2000 for their part in the diagnostic or therapeutic process. Many aspects of good professional practice were made mandatory and the overall management of medical exposures had to be documented into formal written procedures. Examples of these procedures include: the methods by which the patient is identified, the system for ensuring a written report of the outcome of an examination is carried out and how the procedures themselves are controlled. In addition, staff who are entitled to carry out the various roles under IR

Mainstreaming gender equality in the sustainable development process: 1992-1996.

Science.gov (United States)

1997-01-01

One of the major contributions of Economic Commission for Africa (ECA) in the mainstreaming of gender equality into a sustainable development process was organizing the 5th African Regional Conference on Women in November 1994, in which a comprehensive policy document was formulated and adopted by all African governments. The policy contained in a document entitled the African Platform for Action (APA), which promotes the advancement of women through sustainable development. Its recommendations are being implemented together with the Global Platform for Action (GPA). To ensure the implementation of APA and GPA, ECA has set up various monitoring and implementation-coordinating groups such as the African Regional Coordinating Committee and the African Women's Communications and Development Network. In addition, ECA also facilitated the creation of the African Women Committee for Peace in November 1996, which will ensure the participation of women in the peace process at the highest level. All work programs of the ECA are expected to mainstream gender in their plans and activities.

The Human Dimension of Networks

Science.gov (United States)

2008-06-01

Networking Organizational Issues Authors: Bruce J. West Ph.D. Army Research Office Elizabeth K. Bowman Ph.D. Army Research Laboratory – Human...Contact: Elizabeth K.Bowman AMSRD-ARL-HR Bulding 459, Aberdeen Proving Ground, MD 21005 410-278-5924 EBowman@arl.army.mil 1 Report Documentation Page...L.E. Brus , Nature 383, 802 (1996); M. Kuno, D.P. Fromim, s.R. Hohmson, A. Gallagher and D.J. Nesbitt, Phys. Rev. B 67, 125304 (2003); K.R. Shimizu

Human genome program report. Part 2, 1996 research abstracts

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-11-01

This report contains Part 2 of a two-part report to reflect research and progress in the US Department of Energy Human Genome Program from 1994 through 1996, with specified updates made just before publication. Part 2 consists of 1996 research abstracts. Attention is focused on the following: sequencing; mapping; informatics; ethical, legal, and social issues; infrastructure; and small business innovation research.

Alberta oil and gas industry : annual statistics for 1996

International Nuclear Information System (INIS)

1997-01-01

Alberta's 1996 annual and historical statistics for the supply and disposition of the following oil and gas products was presented: (1) crude oil and equivalent, (2) natural gas, (3) ethane, (4) propane, (5) butanes, (6) natural gas liquids, and (7) sulphur. Statistics regarding the deliveries and average price of the products and statistical data on drilling activity during 1996 were also included. Tables

1996 Activity report

International Nuclear Information System (INIS)

1996-01-01

The 1996 activity report of the Direction for Waste Management of the CEA, is presented. Its activities have been developed in the framework of the general CEA cleaning plan, and include the management of wastes generated before 1992 in R and D CEA facilities, the disposal of spent fuels generated by research reactors (Orphee and Siloe) or prototype reactors (EL4 at Brennilis), and the dismantling and cleaning of obsolete facilities such as the plutonium radiochemistry building at Fontenay-aux-Roses and the pilot workshop at Marcoule

The Illegal Immigration Reform and Immigrant Responsibility Act of 1996: an overview.

Science.gov (United States)

Fragomen, A T

1997-01-01

"On September 30, 1996, President Clinton signed the Illegal Immigration Reform and Immigrant Responsibility Act of 1996 (1996 Act), Pub. L. No. 104-208, 110 Stat. 3009. After an intense lobbying effort by the business community, most provisions relating to legal immigration were omitted from the final bill. Instead, the 1996 Act focuses on illegal immigration reform and includes some of the toughest measures ever taken against illegal immigration." Aspects considered include border enforcement, penalities against alien smuggling and document fraud, deportation and exclusion proceedings, employer sanctions, welfare provisions, and changes to existing refugee and asylum procedures. excerpt

Annual report of SPring-8, 1996

International Nuclear Information System (INIS)

1997-01-01

This report summarizes the activities of the SPring-8 Project in 1996. The purpose of the SPring-8 Project is to construct the world's most brilliant synchrotron radiation source in the soft and hard x-ray regions. The construction of the facility started in 1990, and the Project approaches its final stage of construction with the most outstanding progress in 1996 being the successful commissioning of the injector linac and the booster synchrotron. Installation of the linac was completed by the end of 1995 and the power test of the entire system started in January 1996. After the RF aging of the waveguide and accelerator columns for three months, the commissioning of the linac started on August 1 and it succeeded to accelerate electrons up to 1 GeV one week later. As for the booster synchrotron, its installation and precise alignment were completed in September. After the full power test of two months, the synchrotron commissioning started on December 6. Electrons were accelerated up to 8 GeV on December 16. The installation of all magnets in the storage ring was completed and the precise alignment of focusing magnets is under way. The installation of vacuum chambers and RF cavities has already been completed and the evacuation test is going on. The commissioning of the storage ring is scheduled in March, 1997. (M.N.)

DOE occupational radiation exposure 1996 report

Energy Technology Data Exchange (ETDEWEB)

NONE

1996-12-31

The goal of the US Department of Energy (DOE) is to conduct its radiological operations to ensure the health and safety of all DOE employees including contractors and subcontractors. The DOE strives to maintain radiation exposures to its workers below administrative control levels and DOE limits and to further reduce these exposures and releases to levels that are ``As Low As Reasonably Achievable`` (ALARA). The DOE Occupational Radiation Exposure Report, 1996 provides summary and analysis of the occupational radiation exposure received by individuals associated with DOE activities. The DOE mission includes stewardship of the nuclear weapons stockpile and the associated facilities, environmental restoration of DOE and precursor agency sites, and energy research. Collective exposure at DOE has declined by 80% over the past decade due to a cessation in opportunities for exposure during the transition in DOE mission from weapons production to cleanup, deactivation and decommissioning, and changes in reporting requirements and dose calculation methodology. In 1996, the collective dose decreased by 10% from the 1995 value due to decreased doses at five of the seven highest-dose DOE sites. For 1996, these sites attributed the reduction in collective dose to the completion of several decontamination and decommissioning projects, reduced spent fuel storage activities, and effective ALARA practices. This report is intended to be a valuable tool for managers in their management of radiological safety programs and commitment of resources.

DOE occupational radiation exposure 1996 report

International Nuclear Information System (INIS)

1996-01-01

The goal of the US Department of Energy (DOE) is to conduct its radiological operations to ensure the health and safety of all DOE employees including contractors and subcontractors. The DOE strives to maintain radiation exposures to its workers below administrative control levels and DOE limits and to further reduce these exposures and releases to levels that are ''As Low As Reasonably Achievable'' (ALARA). The DOE Occupational Radiation Exposure Report, 1996 provides summary and analysis of the occupational radiation exposure received by individuals associated with DOE activities. The DOE mission includes stewardship of the nuclear weapons stockpile and the associated facilities, environmental restoration of DOE and precursor agency sites, and energy research. Collective exposure at DOE has declined by 80% over the past decade due to a cessation in opportunities for exposure during the transition in DOE mission from weapons production to cleanup, deactivation and decommissioning, and changes in reporting requirements and dose calculation methodology. In 1996, the collective dose decreased by 10% from the 1995 value due to decreased doses at five of the seven highest-dose DOE sites. For 1996, these sites attributed the reduction in collective dose to the completion of several decontamination and decommissioning projects, reduced spent fuel storage activities, and effective ALARA practices. This report is intended to be a valuable tool for managers in their management of radiological safety programs and commitment of resources

Gene : CBRC-SARA-01-1996 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SARA-01-1996 Novel UN D UNKNOWN NU2C_ANTFO 0.004 26% gb|AAQ05281.1| NADH dehydrogenase subunit B [Metas...equoia glyptostroboides] 0.044 26% MILMLFLLGSSPRSLIHPRAILKTFPIVCCCLYAFCSLTSLILSLAVL

Technology Uses in Campus Activism from 2000 to 2008: Implications for Civic Learning

Science.gov (United States)

Biddix, J. Patrick

2010-01-01

This qualitative study examines use of information and communication technologies (ICTs) such as computers, cell phones, text messaging, and social networking sites, for campus activism. Participants were 22 student leaders representing eight campuses from 2000 to 2008. The focus of this study was two-fold: first, to describe the form and function…

JAERI TANDEM and V.D.G. annual report 1996. April 1, 1996 - March 31, 1997

International Nuclear Information System (INIS)

Takeuchi, Suehiro; Ikezoe, Hiroshi; Iwamoto, Akira; Sataka, Masao; Nagame, Yuichiro; Shoji, Tokio; Okabe, Takashi; Maekawa, Hiroshi

1997-09-01

This annual report describes research activities which have been performed with the JAERI tandem accelerator and the Van de Graaf accelerator from April 1, 1996 to March 31, 1997. Summary reports of 48 papers, and list of publications, personnel and cooperative researches with universities are contained. (author)

Radioactivity in food and the environment, 1996

International Nuclear Information System (INIS)

1997-09-01

This report continues the series which combines the results of the radioactivity monitoring programmes previously published by MAFF in two documents: the 'Terrestrial Radioactivity Monitoring Programme (TRAMP) Report: Radioactivity in food and agricultural products in England and Wales' and the 'Aquatic Environment Monitoring Report: Radioactivity in surface and coastal waters of the British Isles' (AEMR). For the first time the report includes the results of all environmental monitoring for radioactivity carried out on behalf of the regulatory authority in Scotland. These results were previously presented in the 'Statistical Bulletin: Environmental Monitoring for Radioactivity in Scotland' (e.g. The Scottish Office, (1996). Measurements in 1996 included the analysis of samples of food and other materials from the environment and detection of beta and gamma dose rates in the environment. The results show that radionuclide concentrations and radiation dose rates were generally similar to those in 1995. However, near Sellafield, despite the general downward trend in disposals from the site during 1996, there were some increases in concentrations of technetium-99 and carbon-14 in marine foodstuffs reflecting disposals from and operations on the site in previous years. These operations included processing of stored wastes and the operation of the Enhanced Actinide Removal Plant (EARP). The Thermal Oxide Reprocessing Plant (THORP) continued its commissioning phase in 1996 and its disposals had little effect on food and the marine environment. The results of the monitoring have been interpreted in terms of public radiation exposures using data on activity levels in food and local surveys to establish potential 'critical groups' of people likely to be most exposed. (author)

Specialized software utilities for gamma ray spectrometry. Final report of a co-ordinated research project 1996-2000

International Nuclear Information System (INIS)

2002-03-01

A Co-ordinated Research Project (CRP) on Software Utilities for Gamma Ray Spectrometry was initiated by the International Atomic Energy Agency in 1996 for a three year period. In the CRP several basic applications of nuclear data handling were assayed which also dealt with the development of PC computer codes for various spectrometric purposes. The CRP produced several software packages: for the analysis of low level NaI spectra; user controlled analysis of gamma ray spectra from HPGe detectors; a set of routines for the definition of the detector resolution function and for the unfolding of experimental annihilation spectra; a program for the generation of gamma ray libraries for specific applications; a program to calculate true coincidence corrections; a program to calculate full-energy peak efficiency calibration curve for homogenous cylindrical sample geometries including self-attenuation correction; and a program for the library driven analysis of gamma ray spectra and for the quantification of radionuclide content in samples. In addition, the CRP addressed problems of the analysis of naturally occurring radioactive soil material gamma ray spectra, questions of quality assurance and quality control in gamma ray spectrometry, and verification of the expert system SHAMAN for the analysis of air filter spectra obtained within the framework of the Comprehensive Nuclear Test Ban Treaty. This TECDOC contains 10 presentations delivered at the meeting with the description of the software developed. Each of the papers has been indexed separately

Planning integration FY 1996 program plan. Revision 1

International Nuclear Information System (INIS)

1995-09-01

This Multi-Year Program Plan (MAP) Planning Integration Program, Work Breakdown Structure (WBS) Element 1.8.2, is the primary management tool to document the technical, schedule, and cost baseline for work directed by the US Department of Energy (DOE), Richland Operations Office (RL). As an approved document, it establishes an agreement between RL and the performing contractors for the work to be performed. It was prepared by Westinghouse Hanford Company (WHC) and Pacific Northwest Laboratory (PNL). The MYPPs for the Hanford Site programs are to provide a picture from fiscal year (FY) 1996 through FY 2002. At RL Planning and Integration Division (PID) direction, only the FY 1996 Planning Integration Program work scope has been planned and presented in this MAP. Only those known significant activities which occur after FY 1996 are portrayed in this MAP. This is due to the uncertainty of who will be accomplishing what work scope when, following the award of the Management and Integration (M ampersand I) contract

Atomic energy in Lithuania: Nuclear safety in 1996

International Nuclear Information System (INIS)

Vaishnys, P.; Krenevichius, R.; Alejev, A.; Demchenko, M.

1997-01-01

The first annual report of VATESI - Lithuanian Nuclear Safety Authority's activity is presented and cover description of the main results in 1996. VATESI was established in 1991 recently after regaining of independence when Ignalina NPP come into jurisdiction of Republic of Lithuania. Since the establishment in six year period of operation VATESI developed its activities considerably and now is able to perform the functions of independent regulator of nuclear safety in Lithuania. The main fields of VATESI activities in 1996 were evaluation of the safety of Ignalina NPP, supervision of Ignalina NPP's operational safety, control of the implementation of safety improvement program SIP-1 in Ignalina NPP, development of new regulatory legislation according to IAEA standards and practices, accountancy and control of nuclear materials, regulation of radioactive waste management. Detailed description of all these activities is provided in the report. In 1996 there were no safety significant events in Ignalina NPP according to the INES scale, only five events received qualification as level 1 events

Technical Report 2000; Memoria Tecnica 2000

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-07-01

The technical memory 2000 of the Nuclear Regulatory Authority (NRA) of the Argentine Republic, compile the papers published in the subject on radiation protection and nuclear safety, safeguards and physical protection, and presented in congress or meetings of these specialities by personnel of the mentioned institution during 2000. In this edition the documents are presented on: Nuclear safety; Radiobiology; Occupational doses; Radiochemical; Environmental studies; Emergency plans; Radiation accidents; and International safeguards. Some of them are realized by agreements between the Nuclear Regulatory Authority of Argentina, universities and other national and international organizations.

Canadian Petroleum Products Institute 1996 annual review

International Nuclear Information System (INIS)

1996-01-01

The Canadian Petroleum Products Institute (CPPI) is an association of Canadian companies involved in the downstream sector of the petroleum industry which includes refining, distributing and marketing of petroleum products. CPPI's mandate includes: (1) establishing environmental policies, (2) establishing working relationships with governments to develop public policy, (3) developing guidelines for the safe handling of petroleum products, and (4) providing information about the petroleum industry to the public. Canada's 19 refineries processed an average of 1.5 million barrels of crude oil per day in 1996. Domestic sources of crude made up 61 per cent of crude oil processed in 1996. Total exports during the year amounted to 105 million barrels. Some of the issues that the CPPI focused on during 1996 included the controversy over the future of the octane enhancing fuel additive MMT, fuel quality standards for transportation fuels and reformulated fuels, gasoline pricing, air quality and workplace safety. CPPI members' participation in the Voluntary Challenge and Registry (VCR) program towards reducing greenhouse gas emissions was also discussed. The industry was also actively involved in seeking to improve its refinery wastewater discharges

EARLINET: towards an advanced sustainable European aerosol lidar network

Science.gov (United States)

Pappalardo, G.; Amodeo, A.; Apituley, A.; Comeron, A.; Freudenthaler, V.; Linné, H.; Ansmann, A.; Bösenberg, J.; D'Amico, G.; Mattis, I.; Mona, L.; Wandinger, U.; Amiridis, V.; Alados-Arboledas, L.; Nicolae, D.; Wiegner, M.

2014-03-01

The European Aerosol Research Lidar Network, EARLINET was founded in 2000 as a research project for establishing a quantitative, comprehensive and statistically significant database for the horizontal, vertical, and temporal distribution of aerosols on a continental scale. Since then EARLINET is continuing to provide the most extensive collection of ground-based data for the aerosol vertical distribution over Europe. This paper gives an overview of the network's main developments since 2000 and introduces the dedicated EARLINET special issue which reports on the present innovative and comprehensive technical solutions and scientific results related to the use of advanced lidar remote sensing techniques for the study of aerosol properties as developed within the network in the last thirteen years. Since 2000, EARLINET has strongly developed in terms of number of stations and spatial distribution, from 17 stations in 10 countries in 2000, to 27 stations in 16 countries in 2013. EARLINET has strongly developed also in terms of technological advances with the spread of advanced multi-wavelength Raman lidar stations in Europe. The developments for the quality assurance strategy, the optimization of instruments and data processing and dissemination of data have contributed to a significant improvement of the network towards a more sustainable observing system, with an increase of the observing capability and a reduction of operational costs. Consequently, EARLINET data have already been extensively used for many climatological studies, long-range transport events, Saharan dust outbreaks, plumes from volcanic eruptions and for model evaluation and satellite data validation and integration. Future plans are in the direction of continuous measurements and near real time data delivery in close cooperation with other ground-based networks, as in the ACTRIS research infrastructure, and with the modelling and satellite community, bridging the research community with the

SSDL newsletter. No. 36

International Nuclear Information System (INIS)

1997-01-01

The seventh meeting of the Scientific Committee of the IAEA/WHO Network of Secondary Standard Dosimetry Laboratories (SSDL) was held in Vienna at the Agency headquarters on 30 September to 4 October 1996. According to the Terms of Reference, the SSC evaluated the activities of the Dosimetry Section reported for 1995-1996 and discussed the proposed programme for the Section for 1997-1998. Long-term plans for seminars and teaching courses (until the year 2000) were also discussed. The scope of the evaluation was addressed to the fundamental questions of: the objective of the programme area; the impact (benefits to the Member States); its continuing relevance as an Agency activity

Environmental policy. Ambient radioactivity levels and radiation doses in 1996; Umweltpolitik. Umweltradioaktivitaet und Strahlenbelastung im Jahr 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-10-01

The report is intended as information for the German Bundestag and Bundesrat as well as for the general population interested in issues of radiological protection. The information presented in the report shows that in 1996, the radiation dose to the population was low and amounted to an average of 4 millisievert (mSv), with 60% contributed by natural radiation sources, and 40% by artificial sources. The major natural source was the radioactive gas radon in buildings. Anthropogenic radiation exposure almost exclusively resulted from application of radioactive substances and ionizing radiation in the medical field, for diagnostic purposes. There still is a potential for reducing radiation doses due to these applications. In the reporting year, there were 340 000 persons occupationally exposed to ionizing radiation. Only 15% of these received a dose different from zero, the average dose was 1.8 mSv. The data show that the anthropogenic radiation exposure emanating from the uses of atomic energy or applications of ionizing radiation in technology is very low. (orig./CB) [Deutsch] Der vorliegende Bericht ueber die `Umweltradioaktivitaet und Strahlenbelastung im Jahr 1996` richtet sich an Bundestag und Bundesrat und darueber hinaus an alle an Fragen des Strahlenschutzes interessierte Buerger. Der Bericht belegt, dass die Strahlenbelastung der Bevoelkerung im Jahr 1996 gering war und insgesamt durchschnittlich 4 Millisievert (mSv) betrug. Dieser Wert war zu 60% auf natuerliche und zu 40% auf kuenstliche Strahlenquellen zurueckzufuehren. Den wesentlichen Beitrag zur natuerlichen Strahlenbelastung lieferte das radioaktive Gas Radon in Wohnungen. Die zivilisatorische Strahlenexposition der Bevoelkerung wurde fast ausschliesslich durch die Anwendung radioaktiver Stoffe und ionisierender Strahlen in der Medizin im Rahmen der Diagnostik hervorgerufen. Hier bestehen nach wie vor Moeglichkeiten zur Reduktion der Strahlenbelastung. Im Jahre 1996 waren 340 000 Personen beruflich

CEA 1996 survey of accounting policies and practices

International Nuclear Information System (INIS)

Constant, M.

1997-01-01

A survey of accounting policies and practices of some of Canada's largest electrical utilities was presented. The first survey was done in 1981 and then updated in 1986, 1991 and 1996. The dominating issues affecting accounting practices in the 1996 survey were regulation versus deregulation, corporate governance, risk management, research and development costs, new ventures, and environmental liabilities. The Survey examined eight areas of accounting concern, among them financial statement concepts, statement of operations, assets, liabilities, equity, special topics, and financial ratios and other statistics

AECL annual report 1996-1997

International Nuclear Information System (INIS)

1997-01-01

The 1996/1997 Annual Report of Atomic Energy of Canada Ltd. (AECL) is published and submitted to the Honourable member of parliament, Minister of Natural Resources. Included in this report are messages from marketing, commercial operations, product development, CANDU research, waste management, environmental management, financial review and copies of financial statements

AECL annual report 1996-1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-07-01

The 1996/1997 Annual Report of Atomic Energy of Canada Ltd. (AECL) is published and submitted to the Honourable member of parliament, Minister of Natural Resources. Included in this report are messages from marketing, commercial operations, product development, CANDU research, waste management, environmental management, financial review and copies of financial statements.

Changing organizational structures of jihadist networks in the Netherlands

NARCIS (Netherlands)

de Bie, Jasper L.; de Poot, Christianne J.; Freilich, Joshua D.; Chermak, Steven M.

2017-01-01

This paper uses Social Network Analysis to study and compare the organizational structures and division of roles of three jihadist networks in the Netherlands. It uses unique longitudinal Dutch police data covering the 2000–2013 period. This study demonstrates how the organizational structures

TIARA annual report 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-11-01

This annual report describes research activities which have been performed with the JAERI TIARA (Takasaki Ion Accelerators for Advanced Radiation Application) facilities from April 1, 1996 to March 31, 1997. Summary reports of 88 papers and 4 brief descriptions on the status of TIARA in the period are contained. A list of publications, the type of research collaborations and organization of TIARA are also given as appendices. (J.P.N.)

Florentine Renaissance Resources. Online Tratte of Office Holders 1282-1532, Ed. by D. Herlihy, R. Burr Litchfield, A. Molho, R. Barducci, 2000. Online Catasto of 1427, Ed. by D. Herlihy, C. Klapisch-Zuber, Vers. 1.2., Brown University, Providence, R.I.

Directory of Open Access Journals (Sweden)

Marco Bicchierai

2002-12-01

Full Text Available Florentine Renaissance Resources. - Online Tratte of Office Holders 1282-1532, Edited by David Herlihy, R. Burr Litchfield, Anthony Molho and Roberto Barducci , 2000 - Online Catasto of 1427, Edited by David Herlihy, Christiane Klapisch-Zuber, Version 1.2., Brown University, Providence, R.I. , 1996

Violence in television commercials during nonviolent programming. The 1996 Major League Baseball playoffs.

Science.gov (United States)

Anderson, C

1997-10-01

To identify the frequency of violent television commercials aired during major league baseball playoffs, traditionally thought to be a family-oriented viewing time. All 6 World Series games televised on the Fox Television Network (Fox), all 5 American League Championship Series playoff games televised by the National Broadcasting Company (NBC), and 4 first-round playoff games televised by ESPN Sports Television Network (ESPN) were videotaped in October 1996. During the 15 televised games reviewed, 104 (6.8%) of the 1528 commercials contained violent content. Sixty-one commercials (10 per game) that included violent interactions were noted during the World Series, 30 (6 per game) during the American League Championship Series, and 13 (3 per game) during the 4 first-round playoff games for a total of 104. In these 104 violent commercials, 69 contained at least 1 violent act, 90 contained at least 1 violent threat, and 27 contained evidence of at least 1 violent consequence. Seventy (67.3%) of the violent commercials were promotions for television programs, 7 (6.7%) were cable television program advertisements, and 20 (19.2%) were big-screen movie promotions. Twenty (71.4%) of 28 big-screen movie promotions were violent. Twenty-two (21.2%) of the 104 violent commercials and 7 "nonviolent" commercials contained blood or other graphic content, all of which were televised during the Fox presentation of the World Series. Fox also accounted for all 24 violent commercials that used a knife. Guns were involved in 25 violent commercials on NBC (5.0 per game), in 20 on Fox (3.33 per game), and in 7 on ESPN (1.75 per game). Overt violent content in commercials during the 1996 major league playoffs was common and consisted mainly of promotions for television programs and big-screen movies. It is counterintuitive to find such commercials in nonviolent programming and makes it difficult for parents to avoid exposing their children to this form of violence.

ANSTO strategic plan 1996/1997-1999/2000

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-12-31

This Strategic Plan for ANSTO is the result of major reviews of its processes, capabilities, activities, performance and structures. It responds to the views of its stakeholders to provide Australia with the capacity to benefit from the peaceful uses of nuclear science and technology. Five core areas are identified. Within these areas, the quality services are being delivered and the development of knowledge has the potential for generating future economic benefits, as well as for sustaining essential nuclear-related capabilities. In addition, the strategic plan provides the framework through which ANSTO will provide specific, on demand scientific services to government, industry, academia and research organisations. The plan sets out objectives and strategies which the Board and ANSTO staff believe will ensure that the organisation will continue to fulfil its mission. The plan also identifies the planning processes and the mechanisms for performance evaluation

ANSTO strategic plan 1996/1997-1999/2000

International Nuclear Information System (INIS)

1998-01-01

This Strategic Plan for ANSTO is the result of major reviews of its processes, capabilities, activities, performance and structures. It responds to the views of its stakeholders to provide Australia with the capacity to benefit from the peaceful uses of nuclear science and technology. Five core areas are identified. Within these areas, the quality services are being delivered and the development of knowledge has the potential for generating future economic benefits, as well as for sustaining essential nuclear-related capabilities. In addition, the strategic plan provides the framework through which ANSTO will provide specific, on demand scientific services to government, industry, academia and research organisations. The plan sets out objectives and strategies which the Board and ANSTO staff believe will ensure that the organisation will continue to fulfil its mission. The plan also identifies the planning processes and the mechanisms for performance evaluation

Oil program implementation plan FY 1996--2000

Energy Technology Data Exchange (ETDEWEB)

NONE

1995-04-01

This document reaffirms the US Department of Energy (DOE) Office of Fossil Energy commitment to implement the National Oil Research Program in a way to maximize assurance of energy security, economic growth, environmental protection, jobs, improved economic competitiveness, and improved US balance of trade. There are two sections and an appendix in this document. Section 1 is background information that guided its formulation and a summary of the Oil Program Implementation Plan. This summary includes mission statements, major program drivers, oil issues and trends, budget issues, customers/stakeholders, technology transfer, measures of program effectiveness, and benefits. Section 2 contains more detailed program descriptions for the eight technical areas and the NIPER infrastructure. The eight technical areas are reservoir characterization; extraction research; exploration, drilling, and risk-based decision management; analysis and planning; technology transfer; field demonstration projects; oil downstream operations; and environmental research. Each description contains an overview of the program, descriptions on main areas, a discussion of stakeholders, impacts, planned budget projections, projected schedules with Gantt charts, and measures of effectiveness. The appendix is a summary of comments from industry on an earlier draft of the plan. Although changes were made in response to the comments, many of the suggestions will be used as guidance for the FY 1997--2001 plan.

Corporate plan 1995/1996 to 1999/2000

International Nuclear Information System (INIS)

1995-03-01

The National Radiological Protection Board is a public authority established by the Radiological Protection Act 1970. As with all non-departmental public bodies, it is required to prepare a Corporate Plan; it has done so annually since 1986. In this issue, summary sections on background, objectives, and finances are followed by nine sections describing the major areas of work in a structured manner with objectives, achievements, and directions set out. (UK)

Corporate plan 1996/97 to 2000/01

International Nuclear Information System (INIS)

1996-01-01

The main purpose of this corporate plan is to describe the broad programme of work for the planning period and the manner in which it is to be implemented, to identify the strategic and specific objectives and to make the necessary financial forecasts. (author)

INEEL BNCT research program. Annual report, January 1, 1996--December 31, 1996

International Nuclear Information System (INIS)

Venhuizen, J.R.

1997-04-01

This report is a summary of the progress and research produced for the Idaho National Engineering and Environmental Laboratory (INEEL) Boron Neutron Capture Therapy (BNCT) Research Program for calendar year 1996. Contributions from the individual investigators about their projects are included, specifically, physics: treatment planning software, real-time neutron beam measurement dosimetry, measurement of the Finnish research reactor epithermal neutron spectrum, BNCT accelerator technology; and chemistry: analysis of biological samples and preparation of 10 B enriched decaborane

EARLINET: towards an advanced sustainable European aerosol lidar network

Science.gov (United States)

Pappalardo, G.; Amodeo, A.; Apituley, A.; Comeron, A.; Freudenthaler, V.; Linné, H.; Ansmann, A.; Bösenberg, J.; D'Amico, G.; Mattis, I.; Mona, L.; Wandinger, U.; Amiridis, V.; Alados-Arboledas, L.; Nicolae, D.; Wiegner, M.

2014-08-01

The European Aerosol Research Lidar Network, EARLINET, was founded in 2000 as a research project for establishing a quantitative, comprehensive, and statistically significant database for the horizontal, vertical, and temporal distribution of aerosols on a continental scale. Since then EARLINET has continued to provide the most extensive collection of ground-based data for the aerosol vertical distribution over Europe. This paper gives an overview of the network's main developments since 2000 and introduces the dedicated EARLINET special issue, which reports on the present innovative and comprehensive technical solutions and scientific results related to the use of advanced lidar remote sensing techniques for the study of aerosol properties as developed within the network in the last 13 years. Since 2000, EARLINET has developed greatly in terms of number of stations and spatial distribution: from 17 stations in 10 countries in 2000 to 27 stations in 16 countries in 2013. EARLINET has developed greatly also in terms of technological advances with the spread of advanced multiwavelength Raman lidar stations in Europe. The developments for the quality assurance strategy, the optimization of instruments and data processing, and the dissemination of data have contributed to a significant improvement of the network towards a more sustainable observing system, with an increase in the observing capability and a reduction of operational costs. Consequently, EARLINET data have already been extensively used for many climatological studies, long-range transport events, Saharan dust outbreaks, plumes from volcanic eruptions, and for model evaluation and satellite data validation and integration. Future plans are aimed at continuous measurements and near-real-time data delivery in close cooperation with other ground-based networks, such as in the ACTRIS (Aerosols, Clouds, and Trace gases Research InfraStructure Network) www.actris.net, and with the modeling and satellite

The contribution of Earth observation technologies to the reporting obligations of the Habitats Directive and Natura 2000 network in a protected wetland

Directory of Open Access Journals (Sweden)

Adrián Regos

2018-03-01

Full Text Available Background Wetlands are highly productive systems that supply a host of ecosystem services and benefits. Nonetheless, wetlands have been drained and filled to provide sites for building houses and roads and for establishing farmland, with an estimated worldwide loss of 64–71% of wetland systems since 1900. In Europe, the Natura 2000 network is the cornerstone of current conservation strategies. Every six years, Member States must report on implementation of the European Habitats Directive. The present study aims to illustrate how Earth observation (EO technologies can contribute to the reporting obligations of the Habitats Directive and Natura 2000 network in relation to wetland ecosystems. Methods We analysed the habitat changes that occurred in a protected wetland (in NW Spain, 13 years after its designation as Natura 2000 site (i.e., between 2003 and 2016. For this purpose, we analysed optical multispectral bands and water-related and vegetation indices derived from data acquired by Landsat 7 TM, ETM+ and Landsat 8 OLI sensors. To quantify the uncertainty arising from the algorithm used in the classification procedure and its impact on the change analysis, we compared the habitat change estimates obtained using 10 different classification algorithms and two ensemble classification approaches (majority and weighted vote. Results The habitat maps derived from the ensemble approaches showed an overall accuracy of 94% for the 2003 data (Kappa index of 0.93 and of 95% for the 2016 data (Kappa index of 0.94. The change analysis revealed important temporal dynamics between 2003 and 2016 for the habitat classes identified in the study area. However, these changes depended on the classification algorithm used. The habitat maps obtained from the two ensemble classification approaches showed a reduction in habitat classes dominated by salt marshes and meadows (24.6–26.5%, natural and semi-natural grasslands (25.9–26.5% or sand dunes (20.7–20

Competitive Advantage in the Creation of a Network of Solidarity Based Economy: the case of Ceará Bee Network

Directory of Open Access Journals (Sweden)

Rosângela Andrade Pessoa

2009-12-01

Full Text Available The fast growth of solidarity based economic networks and their acting power within businesses’ development is one of the remarkable phenomena of the last decade. The Bee Network of economic solidarity illustrates the dynamics of this new form of productive organization, in which entrepreneurs get together, in cooperation, aiming at raising their competitiveness. The main research objective in this study was to investigate the perception of the Bee Network members about the competitive advantages resulting from their participation in the network. Furthermore, the study sought to identify the solutions reached by the Bee Network in relation to solidarity based cooperation that creates competitiveness. Porter´s (1996 model of five forces was used as a theoretical framework. The methodology was a case study and the data analyzed through descriptive and content analysis. The results indicated that the network formation has become a competitive advantage for the group of honey producers, who emphasized its benefits for their business, especially related to scale gains from the group´s purchases, governmental support for financing and training for honey production.

Innovative Governance Strategies in Meetings Destination Networks

DEFF Research Database (Denmark)

Gyimóthy, Szilvia; Larson, Mia

2013-01-01

Innovative Governance Strategies in Meetings Destination Networks Introduction, problem statement and aims of the study Collaborative regional networks has been long considered as a must in successful tourism development (Dredge & Jenkins 2003) owing to benefits such as scale and scope economics......, as well as joint planning and coordination of supply facilities. However, the setting up and governance of destination networks is paved with managerial challenges, including, among others: the balancing of conflicting stakeholder interest (Wilkinson & March 2008), and bridging over the gap between...... the bureaucratic culture of public administration and the marketing culture adopted by private tourism firms (Palmer 1996). This regional coordinating role must be undertaken in spite of limited ownership, budget or power to control how individual firms deliver (D’Angella & Go 2007). Furthermore, various actors...

Evaluating the Effectiveness of Natura 2000 Network for Wolf Conservation: A Case-Study in Greece

Science.gov (United States)

Votsi, Nefta-Eleftheria P.; Zomeni, Maria S.; Pantis, J. D.

2016-02-01

The wolf ( Canis lupus) is used as a case study to rate Natura 2000 sites in Greece based on preferred wolf habitat characteristics and test whether the network is suitable for their conservation. Road density, agricultural area, site area, connectivity, food availability (i.e., presence of natural prey), and elevation in 237 sites are combined in a logistic regression model. The occurrence of the wolf's natural prey was the most prevalent factor determining wolf presence, followed by agricultural cover. Considering the current status of these features at N2K site level, most sites currently hosting wolves (85.7 %) have good or excellent prospects for the long-term presence of the wolf. On the contrary, 11 sites which now have wolves are predicted to be ineffective in keeping them in the future due to the absence of wild ungulates and their high agricultural coverage. Four sites with no wolf presence currently have excellent prospects to host wolves in the future. Roadless sites are a priority for protection and retaining their current condition is strongly suggested. The proposed approach aims to detect gaps in protection for the wolf and identify priority sites in need of mitigation actions. It can also assist the assessment of conservation policies in Greece and elsewhere toward accomplishing set goals in protected areas. By focusing on wolf protection, we hope to increase agencies' attention to deal with conservation effectiveness, especially in cases like Greece, where a number of sites are insufficiently known and protected and management measures are not properly implemented.

High Energy Physics Division semiannual report of research activities, January 1, 1996--June 30, 1996

International Nuclear Information System (INIS)

Norem, J.; Rezmer, R.; Wagner, R.

1997-07-01

This report describes the research conducted in the High Energy Physics Division of Argonne National Laboratory during the period of January 1 - June 30, 1996. Topics covered here include experimental and theoretical particle physics, advanced accelerator physics, detector development, and experimental facilities research. List of Division publications and colloquia are included

Control externo de la calidad del diagnóstico serológico del dengue en laboratorios de países de las Américas, 1996-2001 Quality control of the serological diagnosis of dengue in laboratories throughout the Americas, 1996-2001

Directory of Open Access Journals (Sweden)

María G. Guzmán

2003-12-01

Full Text Available OBJETIVO: Dar a conocer los resultados de cuatro controles externos de la calidad del diagnóstico serológico del dengue realizados en la Región de las Américas en el período de 1996- 2001 y presentar los resultados obtenidos por los laboratorios participantes. MÉTODOS: Se realizaron controles externos de la calidad del diagnóstico serológico del dengue en 1996-1997, 1998-1999, 1999-2000 y 2000-2001. Paneles compuestos por 20 sueros (12 de estos positivos a anticuerpos IgM contra el dengue fueron enviados a laboratorios de la Región para que participaran en los controles realizados. Los sueros de los paneles eran negativos a anticuerpos contra el virus de la inmunodeficiencia humana y el virus de la hepatitis C, así como al antígeno de superficie de la hepatitis B, y fueron almacenados a -20 °C hasta su envío en refrigeración a los laboratorios participantes. La presencia de anticuerpos IgM se determinó mediante un ensayo inmunoenzimático (ELISA de captura, mientras que el título de anticuerpos IgG se determinó por inhibición de la hemoaglutinación o ELISA de IgG. Los resultados de la determinación de anticuerpos IgM contra el dengue que no coincidían con los del centro de referencia se consideraron discordantes. El título de anticuerpos IgG se consideró discordante cuando los resultados difirieron en dos diluciones o más con respecto al resultado del centro de referencia. RESULTADOS: Un total de 27 laboratorios recibió 59 paneles de sueros de 1996 a 2001, y se recibieron los resultados del análisis de 54 de esos paneles (91,5%. De 1 080 sueros (20 X 54, 95,6% coincidieron con el laboratorio de referencia en cuanto a los resultados de la detección de anticuerpos IgM contra el dengue. Además, en 47 paneles (87% la coincidencia con el laboratorio de referencia se observó en 90% de las muestras del panel o más. De los 27 paneles para los cuales se recibieron los resultados de los títulos de anticuerpos IgG contra el

Quarterly coal report July--September 1996, February 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-02-01

The Quarterly Coal Report (QCR) provides comprehensive information about US coal production, distribution, exports, imports, receipts, prices, consumption, and stocks to a wide audience, including Congress, Federal and State agencies, the coal industry, and the general public. Coke production, consumption, distribution, imports, and exports data are also provided. This report presents detailed quarterly data for July through September 1996 and aggregated quarterly historical data for 1990 through the second quarter of 1996. Appendix A displays, from 1988 on, detailed quarterly historical coal imports data. 8 figs., 72 tabs.

Go For the Gold...Read! Louisiana Summer Reading Program, 1996.

Science.gov (United States)

White, Dorothy J., Ed.

A manual for the 1996 Louisiana Summer Reading Program is presented in five sections with an Olympic and sports-related theme and illustrations. An evaluation form, a 1996 monthly calendar, and clip art images are provided. The first section covers promotion and publicity, and contains facts about the Olympics, promotion ideas, and sample news…

Petroleum supply annual 1996: Volume 2

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-06-01

The Petroleum Supply Annual (PSA) contains information on the supply and disposition of crude oil and petroleum products. The publication reflects data that were collected from the petroleum industry during 1996 through monthly surveys. The PSA is divided into two volumes. The first volume contains three sections: Summary Statistics, Detailed Statistics, and Refinery Capacity; each with final annual data. The second volume contains final statistics for each month of 1996, and replaces data previously published in the Petroleum Supply Monthly (PSM). The tables in Volumes 1 and 2 are similarly numbered to facilitate comparison between them. Explanatory Notes, located at the end of this publication, present information describing data collection, sources, estimation methodology, data quality control procedures, modifications to reporting requirements and interpretation of tables. Industry terminology and product definitions are listed alphabetically in the Glossary. 35 tabs.

Petroleum supply annual 1996: Volume 2

International Nuclear Information System (INIS)

1997-06-01

The Petroleum Supply Annual (PSA) contains information on the supply and disposition of crude oil and petroleum products. The publication reflects data that were collected from the petroleum industry during 1996 through monthly surveys. The PSA is divided into two volumes. The first volume contains three sections: Summary Statistics, Detailed Statistics, and Refinery Capacity; each with final annual data. The second volume contains final statistics for each month of 1996, and replaces data previously published in the Petroleum Supply Monthly (PSM). The tables in Volumes 1 and 2 are similarly numbered to facilitate comparison between them. Explanatory Notes, located at the end of this publication, present information describing data collection, sources, estimation methodology, data quality control procedures, modifications to reporting requirements and interpretation of tables. Industry terminology and product definitions are listed alphabetically in the Glossary. 35 tabs

1996 Talisman Energy Inc. annual report

International Nuclear Information System (INIS)

Anon.

1997-01-01

A review of operations, revenues and expenditures during 1996 by Talisman Energy Inc., was made available for the benefit of shareholders. Talisman Energy is an independent, Canadian-based international upstream oil and gas company. The company's main business activities include exploration, development, production and marketing of crude oil, natural gas and natural gas liquids. Production comes from Canada, the North Sea and Indonesia. This report presented an operations review, consolidated financial statements, common share information, discussed outlook on prices, expectations of future production, business plans for drilling and exploration and expectations of capital expenditures, debt levels and royalty rates. Financially, 1996 was a good year for Talisman Energy, with share values increasing by 65 per cent over year-end 1995. On February 12, 1997, Talisman announced plans to offer to purchase all of the outstanding common shares of Wascana Energy Inc. tabs., figs

Natural radionuclides by gammaspectrometry in the Belgrade, capital city in Yugoslavia for 1998, 1997 and 1996

International Nuclear Information System (INIS)

Vukovic, D.M.; Markovic, D.

2000-01-01

Region of Belgrade, 44 0 18' north width and 21 o 35' east length, 134 m under the sea, as a capital city of Yugoslavia is important part of monitoring of radioactivity in environment. Radioactivity comes mostly from natural radionuclides and partly from long-lived radionuclides from non natural sources as a consequence of Chernobyl accident. Monitoring of environment has proceeded by vertical methodology. We analyzed: aerosol, soil, fallout (wet and dry deposition), rivers, lakes, drinking water, human and animal food. Results from analyze of samples from environment contains very low activity, actually activity of changes of basic signal. Results for 1998, 1997 and 1996 are: 1. Gamma dose rate, with values from 0.072 μG/h to 0.170 μG/h, with median years values: 0.103 μG/h (1998), 0.077 μG/h (1997) and 0.072 μG/h (1996). 2. By gammaspectrometry analyze of air as months samples for each year, results shows activity of changes of basic signal. The signals are coming from natural radionuclides. 3. 137 Cs, as a long lived radionuclide, with remarkable activity in soil has values: 14-19 Bq/kg (1998), 12-111 Bq/kg (1997) and 7-39 Bq/kg (1996). 4. Activity in rivers Sava (Belgrade) and Danube (Zemun) belongs to 40 K, while activities of 137 Cs, 226 Ra, 232 Th, 235 U and 238 U are in traces. Activity of river sediment comes from 137 Cs with values 0.4-46 Bq/kg of dry samples (river Danube). Activity in fish, mixture, white fish and others comes from 40 K 55-100 Bq/kg and 137 Cs 0.2-0.8 Bq/kg. 5. Activity of drinking waters, from city network shows low level of activity which comes from 40 K. 6. Activity in milk comes from 40 K 46.5-61.2 Bq/l (1998), 33-59 Bq/l (1997) and 31-54 Bq/l (1996). Activities of 137 Cs are on the same level of detection. 7. Activity in the human food, measured in yogurt, meats, bread and agricultural products comes from 40 K 44-310 Bq/kg (1998), 31-238 Bq/kg (1997) and 36-122 Bq/kg (1996). Activities of 137 Cs are 1 Bq/kg. Results of analyze

Population Characteristics and Seasonal Movement Patterns of the Rattlesnake Hills Elk Herd - Status Report 2000

Energy Technology Data Exchange (ETDEWEB)

Tiller, B.L.; Zufelt, R.K.; Turner, S.; Cadwell, L.L.; Bender, L.; Turner, G.K.

2000-10-10

Population characteristics of the Rattlesnake Hills elk herd indicate reduced herd growth rates from the 1980s compared to the 1990s (McCorquodale 1988; Eberhardt 1996). However, the population continued to grow approximately 25% annually through the 1990s, reaching a high of 838 animals in summer 1999. Calf recruitment rates appear to be cyclic and are likely related to reduced calf survival during the first weeks of life; however, late-term abortions may also have occurred. The cause(s) could be predator-related and/or a function of shifts in nutritional condition (age-class distributions, assuming older-age cows are less likely to recruit calves, major climate shifts) or changes in the human-related disturbances during gestation, and/or calf rearing periods. In fall 1999 and spring 2000, the population was reduced from 838 individuals to 660 individuals. The primary controlling factors were modified hunting seasons on private and state lands and the large-scale roundup conducted in spring 2000. Continued removal of animals (particularly females) within the population will be pivotal to maintain the population at a level that minimizes land damage complaints, animal-vehicle collisions, use of central Hanford areas, and deterioration of natural resources.

Airline Quality Rating 1996

OpenAIRE

Bowen, Brent D.; Headley, Dean E.

1996-01-01

The Airline Quality Rating (AQR) was developed and first announced in early 1991 as an objective method of comparing airline performance on combined multiple factors important to consumers. Development history and calculation details for the AQR rating system are detailed in The Airline Quality Rating issued in April, 1991, by the National Institute for Aviation Research at Wichita State University. This current report, Airline Quality Rating 1996, contains monthly Airline Quality Rating scor...

Registratie van Seksueel Overdraagbare Aandoeningen bij GGD-en: jaarverslag 1996

NARCIS (Netherlands)

Laar MJW van de; Termorshuizen F; CIE

1998-01-01

In 1996 the total number of consultations on STD and HIV-testing at STD clinics and municipal health services was 13,226 and increased with 12.5% compared with 1995 (women 18%; men 7%). The total number of diagnosed STD was 4,976 and increased with 10.1% in 1996 compared with 1995 (women 16.9%; men

Networks as Tools for Urban Sustainability

DEFF Research Database (Denmark)

Jensen, Jesper Ole; Tollin, Nicola

2004-01-01

Due to the increasing number of networks related to sustainable development (SUD) the paper focuses on understanding in which way networks can be considered useful tools for sustainable urban development, taking particularly into consideration the networks potential of spreading innovative policies...... will be discussed through a case study of a Danish municipal network on Sustainable Development, Dogme 2000 . This network has become quite successful in terms of learning and innovation, committing actors, and influencing local policies, to a larger extent than other SUD-networks the municipalities are involved in....... By applying the GREMI -theories of “innovative milieux” (Aydalot, 1986; Camagni, 1991) to the case study, we will suggest some reasons for the benefits achieved by the Dogme-network, compared to other networks. This analysis will point to the existence of an “innovative milieu” on sustainability within...

Environmentally assisted cracking in light water reactors. Semiannual report July 1996 - December 1996

International Nuclear Information System (INIS)

Chopra, O.K.; Chung, H.M.; Gavenda, D.J.

1997-10-01

This report summarizes work performed by Argonne National Laboratory on fatigue and environmentally assisted cracking (EAC) in light water reactors from July 1996 to December 1996. Topics that have been investigated include (a) fatigue of carbon, low-alloy, and austenitic stainless steels (SSs) used in reactor piping and pressure vessels, (b) irradiation-assisted stress corrosion cracking of Type 304 SS, (c) EAC of Alloy 600, and (d) characterization of residual stresses in welds of boiling water reactor (BWR) core shrouds by numerical models. Fatigue tests were conducted on ferritic and austenitic SSs in water that contained various concentrations of dissolved oxygen to determine whether a slow strain rate applied during various portions of a tensile-loading cycle are equally effective in decreasing fatigue life. Slow-strain-rate-tensile tests were conducted in simulated BWR water at 288 C on SS specimens irradiated to a low fluence in the Halden reactor and the results were compared with similar data from a control-blade sheath and neutron-absorber tubes irradiated in BWRs to the same fluence level. Crack-growth-rate tests were conducted on compact-tension specimens from a low-carbon content heat of Alloy 600 in high-purity oxygenated water at 289 C. Residual stresses and stress intensity factors were calculated for BWR core shroud welds

Electric trade in the United States, 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-12-01

Wholesale trade in electricity plays an important role for the US electric utility industry. Wholesale, or bulk power, transactions allow electric utilities to reduce power costs, increase power supply options, and improve reliability. In 1996, the wholesale trade market totaled 2.3 trillion kilowatthours, over 73% of total sales to ultimate consumers. This publication, Electric Trade in the United States 1996 (ELECTRA), is the sixth in a series of reports on wholesale power transactions prepared by the Office of Coal, Nuclear, Electric and Alternate Fuels, Energy Information Administration (EIA). The electric trade data are published biennially. The first report presented 1986 data, and this report provides information on the electric power industry during 1996. The electric trade data collected and presented in this report furnish important information on the wholesale structure found within the US electric power industry. The patterns of interutility trade in the report support analyses of wholesale power transactions and provide input for a broader understanding of bulk power market issues that define the emerging national electric energy policies. The report includes information on the quantity of power purchased, sold, exchanged, and wheeled; the geographical locations of transactions and ownership classes involved; and the revenues and costs. 1 fig., 43 tabs.

Progress report 2000

International Nuclear Information System (INIS)

2001-01-01

Clean Air Hamilton is the new name of the Hamilton-Wentworth Air Quality Initiative and its implementation committee, which began in 1995 as a collaborative, multi-sectoral effort to identify and examine important air quality issues and to implement strategies to reduce many of the harmful emissions that endanger human health. During the year 2000 Clean Air Hamilton focused on nine program areas. Strategies were initiated to (1) reduce single occupancy auto trips, (2) purchase low emission vehicles, (3) model transportation emissions, (4) reduce smog-causing emissions, (5) plant trees, (6) provide advice on air quality related land use and transportation issues for consideration in city-wide planning, (7) promote public awareness through social marketing, (8) study fugitive road dust, and (9) reduce transboundary air pollution. A number of indicators to measure progress in efforts to improve air quality have been developed; many of these indicators show significant improvements which, taken collectively, show a positive trend toward cleaner air. The report highlights major accomplishment of Clean Air Hamilton; reports trends in ambient air quality data; assesses human health impacts of air quality, and recommends strategies for further improvements. Among major improvements, inhalable particulate (PM10) levels have decreased by about 20 per cent since 1991; sulphur dioxide levels dropped by 40 per cent since 1989 at industrial sampling sites and 20 per cent at the downtown sampling site; the air pollution index has remained under the advisory level of 32 at all API stations in Hamilton since June 1996. Benzene levels in air decreased by over 50 per cent near the Dofasco plant compared to the five-year composite average from 1994-1998. Given these accomplishments, participants in Clean Air Hamilton believe that while there is much room for improvement, the efforts to date have been worthwhile and provide encouragement for the future. 14 figs., 4 appendices

1996 annual report

International Nuclear Information System (INIS)

1996-01-01

This 1996 issue of the annual report of the French Commissariat a l'Energie Atomique (CEA) gives a general overview of CEA organization, activities, human resources, international relations and external communication with some budgetary informations. The main activities described concern the national defence, the fuel cycle, the nuclear reactors, the condensed matter and life sciences, the advanced technologies, the protection and transfer of knowledge and technologies, the environmental activities, the management and processing of nuclear wastes, the nuclear protection and safety, the technical and scientific information, the teaching and training, the scientific prizes, the committees, councils and commissions. (J.S.)

Petroleum industry 1996

International Nuclear Information System (INIS)

1997-01-01

A survey on petroleum industry activities in France and in the world in 1996 is presented. The different parts and themes of the study are: evolution of the petroleum market (international and French markets, supply and demand, prices, mark-up and taxation in France and in Europe); activities in the petroleum industries (exploration and production, maritime transportation, inland transportation and storage, refining, quality of petroleum products and substitution fuels, oil distribution); environment and safety (refining, distribution and evolution of products, pipeline and maritime transportation, exploration and production); situation of the sector's companies (oil groups, para-petroleum French industry, scientific and technical research)

Tank Vapor Characterization Project: Annual status report for FY 1996

International Nuclear Information System (INIS)

Silvers, K.L.; Fruchter, J.S.; Huckaby, J.L.; Almeida, T.L.; Evans, J.C. Jr.; Pool, K.H.; Simonen, C.A.; Thornton, B.M.

1997-01-01

In Fiscal Year 1996, staff at the Vapor Analytical Laboratory at Pacific Northwest National Laboratory performed work in support of characterizing the vapor composition of the headspaces of radioactive waste tanks at the Hanford Site. Work performed included support for technical issues and sampling methodologies, upgrades for analytical equipment, analytical method development, preparation of unexposed samples, analyses of tank headspaces samples, preparation of data reports, and operation of the tank vapor database. Progress made in FY 1996 included completion and issuance of 50 analytical data reports. A sampling system comparison study was initiated and completed during the fiscal year. The comparison study involved the vapor sampling system (VSS), a truck-based system, and the in situ vapor sampling system (ISVS), a cart-based system. Samples collected during the study were characterized for inorganic, permanent gases, total non-methane organic compounds and organic speciation by SUMMA trademark and TST methods. The study showed comparable sampling results between the systems resulting in the program switching from the VSS to the less expensive ISVS methodology in late May 1996. A temporal study was initiated in January 1996 in order to understand the influences seasonal temperatures changes have on the vapors in the headspace of Hanford waste tanks. A holding time study was initiated in the fourth quarter of FY 1996. Samples were collected from tank S-102 and rushed to the laboratory for time zero analysis. Additional samples will be analyzed at 1, 2, 4, 8, 16, and 32 weeks

Annual Report 2000

International Nuclear Information System (INIS)

2001-01-01

This document describes the research and development projects carried out at CIEMAT in the areas that form the basis of our activities; energy and environment, along with the objectives, scope and most significant results; information on human resources, as well as direct and indirect expenditures and cost of personnel is included for each project in order to given an idea of its real dimensions. The results complied here correspond to 2000 achievements. Finally, the predicted dedication of personnel with degrees presented in the general data for each project corresponds to the year 2000. We hope that this information will be of use to persons and institutions interested in CIEMAT activities and that it will stimulate collaboration with other researchers, technology centres and companies interested in the same and related subjects. Annex I and II compile some general data on CIEMAT FOR 2000: A flowchart, 2000 collaboration, financial and human resources (i), and a bibliography of articles published in national and international journals during 2000. (Author)

1996 year-end market review

International Nuclear Information System (INIS)

Anon.

1996-01-01

A summary of financial data for uranium markets in 1996 is provided. Spot market activity and buyers and sellers of spot uranium are outlined for the restricted and unrestricted market. Data on the concentrates, uranium hexafluoride, enriched uranium product, and term uranium markets are also presented. Market data is also provided for conversion and enrichment services

Environmentally assisted cracking in light water reactors. Semiannual progress report, January 1996--June 1996

International Nuclear Information System (INIS)

Chopra, O.K.; Chung, H.M.; Gruber, E.E.

1997-05-01

This report summarizes work performed by Argonne National Laboratory on fatigue and environmentally assisted cracking (EAC) in light water reactors from January 1996 to June 1996. Topics that have been investigated include (a) fatigue of carbon, low-alloy, and austenitic stainless steels (SSs) used in reactor piping and pressure vessels, (b) irradiation-assisted stress corrosion cracking of Type 304 SS, and (c) EAC of Alloys 600 and 690. Fatigue tests were conducted on ferritic and austenitic SSs in water that contained various concentrations of dissolved oxygen (DO) to determine whether a slow strain rate applied during various portions of a tensile-loading cycle are equally effective in decreasing fatigue life. Slow-strain-rate-tensile tests were conducted in simulated boiling water reactor (BWR) water at 288 degrees C on SS specimens irradiated to a low fluence in the Halden reactor and the results were compared with similar data from a control-blade sheath and neutron-absorber tubes irradiated in BWRs to the same fluence level. Crack-growth-rate tests were conducted on compact-tension specimens from several heats of Alloys 600 and 690 in air and high-purity, low-DO water. 83 refs., 60 figs., 14 tabs

Environmentally assisted cracking in light water reactors. Semiannual progress report, January 1996--June 1996

Energy Technology Data Exchange (ETDEWEB)

Chopra, O.K.; Chung, H.M.; Gruber, E.E. [and others

1997-05-01

This report summarizes work performed by Argonne National Laboratory on fatigue and environmentally assisted cracking (EAC) in light water reactors from January 1996 to June 1996. Topics that have been investigated include (a) fatigue of carbon, low-alloy, and austenitic stainless steels (SSs) used in reactor piping and pressure vessels, (b) irradiation-assisted stress corrosion cracking of Type 304 SS, and (c) EAC of Alloys 600 and 690. Fatigue tests were conducted on ferritic and austenitic SSs in water that contained various concentrations of dissolved oxygen (DO) to determine whether a slow strain rate applied during various portions of a tensile-loading cycle are equally effective in decreasing fatigue life. Slow-strain-rate-tensile tests were conducted in simulated boiling water reactor (BWR) water at 288{degrees}C on SS specimens irradiated to a low fluence in the Halden reactor and the results were compared with similar data from a control-blade sheath and neutron-absorber tubes irradiated in BWRs to the same fluence level. Crack-growth-rate tests were conducted on compact-tension specimens from several heats of Alloys 600 and 690 in air and high-purity, low-DO water. 83 refs., 60 figs., 14 tabs.

CBTs Budget for 1997 og Arbejdsplaner for 1996 - 1999

DEFF Research Database (Denmark)

Jeppesen, Palle

1996-01-01

For Center for Bredbånds Telekommunikation beskrives budget for 1997 samt forskningsplaner for 1996-1999 for områderne optiske netværk, gigabit elektronik, optiske bølgeledere og bredbåndsswitching samt for højhastighedssystemer.......For Center for Bredbånds Telekommunikation beskrives budget for 1997 samt forskningsplaner for 1996-1999 for områderne optiske netværk, gigabit elektronik, optiske bølgeledere og bredbåndsswitching samt for højhastighedssystemer....

Presidential Green Chemistry Challenge: 1996 Academic Award

Science.gov (United States)

Presidential Green Chemistry Challenge 1996 award winner, Professor Mark Holtzapple, developed methods to convert waste biomass (e.g., sewage sludge, agricultural wastes), into animal feed, industrial chemicals, or fuels.

Work at Forsmark since ASSET 1996

Energy Technology Data Exchange (ETDEWEB)

Loewenhielm, G; Andersson, O [Forsmark Kraftgrupp AB, Oesthammar (Sweden)

1997-10-01

The following directions of work at Forsmark since ASSET 1996 are briefly described: peer review follow-up; work related to peer review, Forsmark 2 mini-ASSET; MTO(man-technology-organization)-analysis method, concept development, combination of MTO and ASSET methods; Forsmark INES manual.

Annual report 1996 NV Gemeenschappelijk Kolenbureau Elektriciteitsproduktiebedrijven (GKE)

International Nuclear Information System (INIS)

1997-01-01

GKE Vliegasunie is responsible for supplying the coal for the Dutch electricity generating companies and for the sale of the construction raw materials produced as by-products of coal-based electricity generation. In 1996 emphasis was placed on achieving the lowest coal prices possible and therefore working towards achieving the lowest electricity price in Europe. The annual report also gives details of GKE Vliegasunie's business and activities during the year including information on coal markets, logistics, coal markets, throughput and coal stocks and coal fly ash production. Financial data for the year ending 31 December 1996 is included

Evolución de la enfermedad meningocócica en la población infantil de la Comunidad Valenciana (1996-2000: Efectividad de la vacunación antimeningocócica A+C

Directory of Open Access Journals (Sweden)

Goicoechea Sáez Mercedes

2003-01-01

Full Text Available Fundamento: El incremento de la enfermedad meningocócica por serogrupo C en la Comunidad Valenciana durante 1996-1997 motivó la realización de una campaña de vacunación antimeningocócica A+C en la población de 18 meses a 19 años de edad (entre septiembre y diciembre de 1997. El objetivo de este estudio es analizar el impacto de la campaña en cuanto a la epidemiología, clínica, evolución de la enfermedad meningocócica y estado de vacunación de la población infantil con el fin de valorar la efectividad vacunal. Métodos: Los datos se obtuvieron de las historias clínicas de los niños menores de 15 años, que presentaron síntomas y signos clínicos sugestivos de enfermedad invasora con aislamiento de Neisseria. meningitidis y/o que cumplían con los criterios de definición de caso establecidos, atendidos en todos los hospitales públicos de la Comunidad Valenciana entre 1996-2000. La evolución de la incidencia se valoró mediante tasas de incidencia. La clínica y su evolución (secuelas y letalidad mediante la frecuencia y distribución por serogrupo y edad. La efectividad vacunal se calculó según la fórmula de Orestein. Resultados: Se registró un total de 302 casos de enfermedad invasora por N. meningitidis. La tasa de incidencia por serogrupo C en niños menores de 15 años disminuyó tras la campaña de vacunación desde 5,82/10(5 habitantes en 1997 a 1,68/10(5 habitantes en 1998. Tres años después de la campaña se ha vuelto a tasas similares a la época prevacunal, con un aumento por serogrupo B en los 2 últimos años. El 61% de las secuelas se da en menores de 5 años. La letalidad fue más elevada para el serogrupo C. La efectividad vacunal al tercer año tras la campaña ha sido del 83,7% para el grupo de 5-14 años y del 69,1% para el grupo de 19 meses-4 años. Conclusión: La vacuna polisacarídica se mostró efectiva para interrumpir el brote. La disminución de la incidencia del serogrupo C es atribuible a la

1995-1996 Landsat TM False Color Composite

Data.gov (United States)

Minnesota Department of Natural Resources — Land imagery derived from 30 meter resolution Thematic Mapper satellite data. Source imagery dates ranging from June 1995 to June 1996. DNR performed additional...

Safety against releases in severe accidents. Annual report 1996. Project plan 1997; Saekerhet mot utslaepp vid reaktorhaverier. Aarsrapport 1996. Plans 1997

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-01-01

The work scope of the RAK-2 project is divided into three sub-projects: RAK-2.1 Severe Accident Phenomenology; RAK-2.2 Computerised Accident Management; RAK-2.3 Reactors In Nordic Surroundings. The work in subproject 1 progresses roughly according to budget and time schedule. Some adjustments in the technical work scope were made during 1996. Main tasks of RAK-2.1 in 1996: Complete recriticality studies for Nordic BWRs; Investigate phenomena related to late phase melt progression; Issue and NKS Final Technical Report on KTH experiments. Main tasks of RAK-2.2 in 1996: CAMS would be further developed with signal validation, tracking simulation, state identification and PSA and risk monitoring applications; Carry out a feasibility study for development of a PWR version of CAMS in collaboration with EdF, France; Use CAMS in the Halden Man-Machine laboratory to perform human factor studies. Main tasks of RAK-2.3 in 1996: Collect and report data from the British reactor types AGR, MAGNOX and PWR; Make a report on accidents in nuclear ships; Put the collected data together in a common data base covering neighbour reactors treated in SIK-3 and RAK-2.3; Update the data in the former SIK-3 report if needed. The work in project 2 progresses according to plans. The data collection of British reactors with in sub-project 3 has been delayed significantly due to difficulty of obtaining information from some of the British utilities, but the problems are expected to be solved by the end of 1997. (EG).

CTD data from CTD casts in the Northeast Pacific Ocean from NOAA Ship DISCOVERER and other platforms from 1996-03-09 to 1996-06-24 (NODC Accession 9600096)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — CTD data were collected from CTD casts from NOAA Ship DISCOVERER and other platforms in the Northeast Pacific Ocean from 09 March 1996 to 24 June 1996. Data were...

Licensee contractor and vendor inspection status report. Quarterly report, October--December 1996

International Nuclear Information System (INIS)

1997-03-01

This periodical covers the results of inspections performed by the NRC's Special Inspection Branch, Vendor Inspection Section, that have been distributed to the inspected organizations during the period from October 1996 through December 1996

Alternatives to traditional transportation fuels 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-01

Interest in alternative transportation fuels (ATF`s) has increased in recent years due to the drives for cleaner air and less dependence upon foreign oil. This report, Alternatives to Traditional Transportation Fuels 1996, provides information on ATFs, as well as the vehicles that consume them.

1996 scientific report; Rapport scientifique 1996

Energy Technology Data Exchange (ETDEWEB)

Berhouet, F.; Delavault, E.; Dupuy, P.; Legre, J.; Comte, M.; Panek, H.; Martin-Daguet, V.; Fleche, J.L.; Meis, C.; Kupecek, Ph.; Mennerat, G.; Mauchien, P.; Chaleard, C.; Kocon, S.; Lacour, J.L.; Gueneau, C.; Dauvois, V.; Gonella, C.; Berhier, C.; Lameille, J.M. [CEA Saclay, 91 - Gif-sur-Yvette (France). Dept. des Procedes d`enrichissement] [and others

1997-12-31

This report presents the work realized in 1996 by CEA-DCC (Direction du Cycle du Combustible). The main study fields are: laser beam stabilization, copper vapor laser (LVC) modelling, vapor density measurements, light transport in thick vapor, uranium evaporation, GdR-PRACTIS activities, uranyl organo phosphates, actinide extraction, ultra son in chemistry, oxidation mechanisms, salt free processes, tributyl phosphate (TBP) stability, cation exchanging membranes, filtering mineral membranes, liquid-liquid extraction processes, centrifugal contactor, supercritical phase, iodine reduction, weapon plutonium reprocessing, long term waste packaging, clay behaviour modelling; gas formation in deep storages, water-clay chemical interaction, nuclear glass behaviour, actinide storage dies, radionuclide release in storage, waste storage dies, iodine conditioning, cesium extraction by calix[4]arene molecules, decontamination foam, oxidation by supercritical water, decontamination by electrolysis, microorganism actions on metals, long life radionuclide determination in wastes, active and passive tomography, sulfated wastes, zircon-titanates ceramics, direct storage of irradiated fuel, caramel type fuel dismantling, radioprotection calculation codes, diffraction of backscattered electrons, infrared light coherent source, optical spectrometry, physical and chemical aspect of corium, iron-nickel-chromium alloy corrosion, natural uranium perspective, Atalante installation, interlaboratory comparisons. (A.C.)

1996 scientific report; Rapport scientifique 1996

Energy Technology Data Exchange (ETDEWEB)

Berhouet, F; Delavault, E; Dupuy, P; Legre, J; Comte, M; Panek, H; Martin-Daguet, V; Fleche, J L; Meis, C; Kupecek, Ph; Mennerat, G; Mauchien, P; Chaleard, C; Kocon, S; Lacour, J L; Gueneau, C; Dauvois, V; Gonella, C; Berhier, C; Lameille, J M [CEA Saclay, 91 - Gif-sur-Yvette (France). Dept. des Procedes d` enrichissement; and others

1998-12-31

This report presents the work realized in 1996 by CEA-DCC (Direction du Cycle du Combustible). The main study fields are: laser beam stabilization, copper vapor laser (LVC) modelling, vapor density measurements, light transport in thick vapor, uranium evaporation, GdR-PRACTIS activities, uranyl organo phosphates, actinide extraction, ultra son in chemistry, oxidation mechanisms, salt free processes, tributyl phosphate (TBP) stability, cation exchanging membranes, filtering mineral membranes, liquid-liquid extraction processes, centrifugal contactor, supercritical phase, iodine reduction, weapon plutonium reprocessing, long term waste packaging, clay behaviour modelling; gas formation in deep storages, water-clay chemical interaction, nuclear glass behaviour, actinide storage dies, radionuclide release in storage, waste storage dies, iodine conditioning, cesium extraction by calix[4]arene molecules, decontamination foam, oxidation by supercritical water, decontamination by electrolysis, microorganism actions on metals, long life radionuclide determination in wastes, active and passive tomography, sulfated wastes, zircon-titanates ceramics, direct storage of irradiated fuel, caramel type fuel dismantling, radioprotection calculation codes, diffraction of backscattered electrons, infrared light coherent source, optical spectrometry, physical and chemical aspect of corium, iron-nickel-chromium alloy corrosion, natural uranium perspective, Atalante installation, interlaboratory comparisons. (A.C.)

Fractured reservoir discrete feature network technologies. Final report, March 7, 1996 to September 30, 1998

Energy Technology Data Exchange (ETDEWEB)

Dershowitz, William S.; Einstein, Herbert H.; LaPoint, Paul R.; Eiben, Thorsten; Wadleigh, Eugene; Ivanova, Violeta

1998-12-01

This report summarizes research conducted for the Fractured Reservoir Discrete Feature Network Technologies Project. The five areas studied are development of hierarchical fracture models; fractured reservoir compartmentalization, block size, and tributary volume analysis; development and demonstration of fractured reservoir discrete feature data analysis tools; development of tools for data integration and reservoir simulation through application of discrete feature network technologies for tertiary oil production; quantitative evaluation of the economic value of this analysis approach.

SULA 2 - Energy-efficient steel and metal production. Yearbook 1996; SULA 2 - Perusmetallien energiataloudellinen valmistus. Vuosikirja 1996

Energy Technology Data Exchange (ETDEWEB)

Hakulin, H. [ed.

1996-12-31

The main objective of SULA 2 programme are (1) reduction of specific energy consumption, (2) reduction of harmful emissions and impact on the environment, (3) promoting technology export. Participants in the programme are the steel and base metal producers; Fundia wire, Imatra Steel Oy Ab, Outokumpu Oy and Rautaruukki Oy, as well as universities with laboratories for research on metal producing processes and their control such as Helsinki University of Technology, University of Oulu, Aabo Akademi and Tampere University of Technology. The programme consists of 32 research projects, of which 14 are applied technology. The total funding for 1995-1996 is 52,5 mill. FIM. Information on the research results is exchanged at the SULA-seminars arranged in 1994, 1996 and at the beginning of 1999. In connection with the seminars a yearbook will be published. The yearbook contains the reports of all the programme projects

SULA 2 - Energy-efficient steel and metal production. Yearbook 1996; SULA 2 - Perusmetallien energiataloudellinen valmistus. Vuosikirja 1996

Energy Technology Data Exchange (ETDEWEB)

Hakulin, H [ed.

1997-12-31

The main objective of SULA 2 programme are (1) reduction of specific energy consumption, (2) reduction of harmful emissions and impact on the environment, (3) promoting technology export. Participants in the programme are the steel and base metal producers; Fundia wire, Imatra Steel Oy Ab, Outokumpu Oy and Rautaruukki Oy, as well as universities with laboratories for research on metal producing processes and their control such as Helsinki University of Technology, University of Oulu, Aabo Akademi and Tampere University of Technology. The programme consists of 32 research projects, of which 14 are applied technology. The total funding for 1995-1996 is 52,5 mill. FIM. Information on the research results is exchanged at the SULA-seminars arranged in 1994, 1996 and at the beginning of 1999. In connection with the seminars a yearbook will be published. The yearbook contains the reports of all the programme projects

Thermal regulation 2000: one year later; RT 2000: un an apres

Energy Technology Data Exchange (ETDEWEB)

NONE

2002-05-01

This meeting, organized by the research center of Gaz de France (Cegibat), aims at drawing up a progress status of the French thermal regulation (RT 2000), one year after its enforcement on June 1, 2000: status, experience feedback and recommendations; Gaz de France assistance and solutions; tools at the disposition of designers (labelling of equipments, simulation softwares..); practical examples of implementation of the RT 2000 in office buildings, residential buildings and sport complexes. (J.S.)

Annual statistical information 1996; Informe estatistico anual 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-31

This annual statistical report aims to propagate the information about the generation, transmission and distribution systems evolution and about the electric power market from the Parana State, Brazil, in 1996. The electric power consumption in the distribution area of the Parana Power Company (COPEL) presented a growth about 6,7%. The electric power production in the the COPEL plants increased 42,2% higher than 1995, due to the outflows verified in the Iguacu river and to the long period of the affluence reduction that the Southern region tanks coursed during this year. This report presents statistical data about the following topics: a) electric power energy balance from the Parana State; b) electric power energy balance from the COPEL - own generation, certain interchange, electric power requirement, direct distribution and the electric system 6 graphs, 3 maps, 61 tabs.; e-mail: splcnmr at mail.copel.br

Sulfur dioxide and primary carbonaceous aerosol emissions in China and India, 1996-2010

Science.gov (United States)

Lu, Z.; Zhang, Q.; Streets, D. G.

2011-09-01

China and India are the two largest anthropogenic aerosol generating countries in the world. In this study, we develop a new inventory of sulfur dioxide (SO2) and primary carbonaceous aerosol (i.e., black and organic carbon, BC and OC) emissions from these two countries for the period 1996-2010, using a technology-based methodology. Emissions from major anthropogenic sources and open biomass burning are included, and time-dependent trends in activity rates and emission factors are incorporated in the calculation. Year-specific monthly temporal distributions for major sectors and gridded emissions at a resolution of 0.1°×0.1° distributed by multiple year-by-year spatial proxies are also developed. In China, the interaction between economic development and environmental protection causes large temporal variations in the emission trends. From 1996 to 2000, emissions of all three species showed a decreasing trend (by 9 %-17 %) due to a slowdown in economic growth, a decline in coal use in non-power sectors, and the implementation of air pollution control measures. With the economic boom after 2000, emissions from China changed dramatically. BC and OC emissions increased by 46 % and 33 % to 1.85 Tg and 4.03 Tg in 2010. SO2 emissions first increased by 61 % to 34.0 Tg in 2006, and then decreased by 9.2 % to 30.8 Tg in 2010 due to the wide application of flue-gas desulfurization (FGD) equipment in power plants. Driven by the remarkable energy consumption growth and relatively lax emission controls, emissions from India increased by 70 %, 41 %, and 35 % to 8.81 Tg, 1.02 Tg, and 2.74 Tg in 2010 for SO2, BC, and OC, respectively. Monte Carlo simulations are used to quantify the emission uncertainties. The average 95 % confidence intervals (CIs) of SO2, BC, and OC emissions are estimated to be -16 %-17 %, -43 %-93 %, and -43 %-80 % for China, and -15 %-16 %, -41 %-87 %, and -44 %-92 % for India, respectively. Sulfur content, fuel use, and sulfur retention of hard coal and

Inter-relationship between scaling exponents for describing self-similar river networks

Science.gov (United States)

Yang, Soohyun; Paik, Kyungrock

2015-04-01

Natural river networks show well-known self-similar characteristics. Such characteristics are represented by various power-law relationships, e.g., between upstream length and drainage area (exponent h) (Hack, 1957), and in the exceedance probability distribution of upstream area (exponent ɛ) (Rodriguez-Iturbe et al., 1992). It is empirically revealed that these power-law exponents are within narrow ranges. Power-law is also found in the relationship between drainage density (the total stream length divided by the total basin area) and specified source area (the minimum drainage area to form a stream head) (exponent η) (Moussa and Bocquillon, 1996). Considering that above three scaling relationships all refer to fundamental measures of 'length' and 'area' of a given drainage basin, it is natural to hypothesize plausible inter-relationship between these three scaling exponents. Indeed, Rigon et al. (1996) demonstrated the relationship between ɛ and h. In this study, we expand this to a more general ɛ-η-h relationship. We approach ɛ-η relationship in an analytical manner while η-h relationship is demonstrated for six study basins in Korea. Detailed analysis and implications will be presented. References Hack, J. T. (1957). Studies of longitudinal river profiles in Virginia and Maryland. US, Geological Survey Professional Paper, 294. Moussa, R., & Bocquillon, C. (1996). Fractal analyses of tree-like channel networks from digital elevation model data. Journal of Hydrology, 187(1), 157-172. Rigon, R., Rodriguez-Iturbe, I., Maritan, A., Giacometti. A., Tarboton, D. G., & Rinaldo, A. (1996). On Hack's Law. Water Resources Research, 32(11), 3367-3374. Rodríguez-Iturbe, I., Ijjasz-Vasquez, E. J., Bras, R. L., & Tarboton, D. G. (1992). Power law distributions of discharge mass and energy in river basins. Water Resources Research, 28(4), 1089-1093.

Summary of the Hanford Site environmental report for calendar year 1996

International Nuclear Information System (INIS)

Hanf, R.W.; O'Connor, G.P.; Dirkes, R.L.

1997-08-01

This report summarizes the 420-page Hanford Site Environmental Report for Calendar Year 1996. The Hanford Site environmental report is prepared annually to summarize environmental data and information, describe environmental management performance, demonstrate the status of compliance with environmental regulations, and highlight major environmental programs and efforts. The summary is designed to briefly: describe the Hanford Site and its mission; summarize the status in 1996 of compliance with environmental regulations; describe environmental programs at the Hanford Site; discuss estimated radionuclide exposure to the public from 1996 Hanford Site activities; present information on effluent monitoring and environmental surveillance, including groundwater protection and monitoring; and discuss activities to ensure quality

Summary of the Hanford Site environmental report for calendar year 1996

Energy Technology Data Exchange (ETDEWEB)

Hanf, R.W.; O`Connor, G.P.; Dirkes, R.L. [eds.] [comps.

1997-08-01

This report summarizes the 420-page Hanford Site Environmental Report for Calendar Year 1996. The Hanford Site environmental report is prepared annually to summarize environmental data and information, describe environmental management performance, demonstrate the status of compliance with environmental regulations, and highlight major environmental programs and efforts. The summary is designed to briefly: describe the Hanford Site and its mission; summarize the status in 1996 of compliance with environmental regulations; describe environmental programs at the Hanford Site; discuss estimated radionuclide exposure to the public from 1996 Hanford Site activities; present information on effluent monitoring and environmental surveillance, including groundwater protection and monitoring; and discuss activities to ensure quality.

Annual report of JMTR, FY 1996. April 1, 1996 - March 31, 1997

Energy Technology Data Exchange (ETDEWEB)

Ooka, Norikazu; Fujiki, Kazuo; Nishiwaki, Kei-ichiro [eds.; Japan Atomic Energy Research Inst., Oarai, Ibaraki (Japan). Oarai Research Establishment; and others

1998-02-01

During FY 1996, the JMTR was operated for 2 complete cycles (118th and 119th cycles) and was utilized for the research and development programs on the reactor technology for LWRs, HTTR and fusion reactor, as well as for basic research of fuels and materials, and for radio-isotope productions. With regard to technology development in the JMTR, improvement of evaluation technique for local neutron spectrum, development of new oxygen sensor for oxide fuel pellet are proceeded. A research on the blanket material for thermonuclear fusion reactor was also progressed. (author)

Notice of the Electric Power Control Commission at the 1 february 2001 on the decree concerning the information confidentiality held by the public networks of transportation or electric power distribution, taking into account for the application of the 16 and 20 sections of the law number 2000-108 of the 20 february 2000 related to the modernization and the development of the electrical utilities; Avis de la Commission de regulation de l'electricite en date du 1 fevrier 2001 sur le decret relatif a la confidentialite des informations detenues par les gestionnaires de reseaux publics de transport ou de distribution d'electricite pris pour l'application des articles 16 et 20 de la loi no 2000-108 du 20 fevrier 2000 relative a la modernisation et au developpement du service public de l'electricite

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-07-01

This document presents the decree concerning the information confidentiality held by the public networks of transportation or electric power distribution, taking into account for the application of the 16 and 20 sections of the law number 2000-108 of the 20 february 2000 related to the modernization and the development of the electrical utilities and a comment of this decree by J. Syrota. (A.L.B.)

AGFW. Main report of the district heat supply 1996; AGFW. Hauptbericht der Fernwaermeversorgung 1996. Technische Daten zur Fernwaermeversorgung in Deutschland 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-11-01

A total of 232 district heating companies participated in the main report of district heating 1996. See the table for the distribution of corporate data per federal state (orig.) [Deutsch] Die in Tafeln 1 bis 15 ausgewiesenen Zahlen beziehen sich auf Angaben, die von der AGFW direkt bei den Unternehmen erhoben wurden. Seit 1995 werden die Angaben, die im Ostteil von Berlin erhoben wurden, dem Bundesland Berlin mit der Kennziffer 11 zugeordnet. Die AGFW bedankt sich bei den Unternehmen fuer die gute Zusammenarbeit (orig.)

Maternal nutritional status (as measured by height, weight and BMI) in Bangladesh: trends and socio-economic association over the period 1996 to 2007.

Science.gov (United States)

Mohsena, Masuda; Goto, Rie; Mascie-Taylor, Cg Nicholas

2016-06-01

To analyse trends in maternal nutritional status in Bangladesh over a 12-year period and to examine the associations between nutritional status and socio-economic variables. Maternal nutritional status indicators were height, weight and BMI. Socio-economic variables used were region, residency, education and occupation of the mothers and their husbands, house type, and possession score in the household. Bangladesh Demographic and Health Surveys (1996, 2000, 2004 and 2007) were the source of data. A total of 16 278 mothers were included. All of the socio-economic variables showed significant associations with maternal nutritional status indicators. Regional variation was found to be present; all three indicators were found to be lowest in the Sylhet division. Upward trends in maternal height, weight and BMI were evident from no possessions to four possessions in households, and for no education to higher education of women and their husbands. Bangladeshi mothers measured in 2007 were found to be on average 0·34 cm taller and 3·36 kg heavier than mothers measured in 1996. Between 1996 and 2007 maternal underweight fell from nearly 50 % to just over 30 % while overweight and obesity increased from about 3 % to over 9 % (WHO cut-offs) or from 7 % to nearly 18 % (Asian cut-offs). The study reveals that over the 12-year period in Bangladesh there has been a substantial reduction in maternal underweight accompanied by a considerable increase in obesity. It is also evident that malnutrition in Bangladesh is a multidimensional problem that warrants a proper policy mix and programme intervention.

Treatment for retinopathy of prematurity in Denmark in a ten-year period (1996-2005): Is the incidence increasing?

DEFF Research Database (Denmark)

Slidsborg, C.; Olesen, H.B.; Jensen, Peter Koch

2008-01-01

about neonatal parameters. These parameters, along with birth in the latter half of the period (2001-2005), were analyzed as risk factors for retinopathy of prematurity. The national registry for blind and visually impaired children was accessed to obtain information about visual impairment attributable...... and 2001 to 2005. Of all of the early-detected, visually impaired children, 16% had not been treated for retinopathy of prematurity and were considered screening failures. CONCLUSIONS. The incidence of retinopathy of prematurity treatment in Denmark has more than doubled during the past half...... contributed to the increased incidence in the latter half of the period. Of the study population, 0.6% were registered as visually impaired because of retinopathy of prematurity within 2 years after birth (early-detected visual impairment). The incidences were not significantly different between 1996 to 2000...

Suncor Energy 1996 annual report

International Nuclear Information System (INIS)

1996-01-01

A review of revenues, expenditures and earnings, and 1996 operational highlights of Suncor Energy were presented. Suncor Energy is a leader in oil sands extraction and upgrading technology. In 1996 the company increased its earnings to $187 million, an increase of 24% over the previous year. It achieved record production of 77,600 barrels per day, up from 76,000 barrels per day in 1995. It commissioned a $190 million sulphur dioxide reduction plant which, in concert with other improvements, will cut sulphur dioxide emissions to 25 per cent of 1990 levels. It achieved regulatory approvals on plant expansion and the Steepbank Mine project. It began construction of the bridge across the Athabasca River that will connect Suncor's oil sands plant with the new Steepbank Mine. It added 30 million barrels of oil equivalent of proven new reserves and initiated the first phase of the Burnt Lake heavy oil project. It repositioned and restructured its wholesale and retail marketing businesses in Ontario and Quebec and positioned its Sunoco branded retail business in the top 10 per cent of its markets. Goals for 1997, for each of the company's three business divisions, were also given prominent attention. tabs., figs

Federal Energy Regulatory Commission`s fiscal year 1996 financial statement audit

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-02-14

This report presents the results of the independent certified public accountants` audit of the Federal Energy Regulatory Commission`s (FERC) financial statements as of September 30, 1996. The auditors have expressed an unqualified opinion on the 1996 statement of financial position and the related statements of operations and changes in net position.

Utilizing Cross-Layer Information to Improve Performance in JPEG2000 Decoding

Directory of Open Access Journals (Sweden)

Hannes Persson

2007-01-01

Full Text Available We focus on wireless multimedia communication and investigate how cross-layer information can be used to improve performance at the application layer, using JPEG2000 as an example. The cross-layer information is in the form of soft information from the physical layer. The soft information, which is supplied by a soft decision demodulator, yields reliability measures for the received bits and is fed into two soft input iterative JPEG2000 image decoders. When errors are detected with the error detecting mechanisms in JPEG2000, the decoders utilize the soft information to point out likely transmission errors. Hence, the decoders can correct errors and increase the image quality without making time-consuming retransmissions. We believe that the proposed decoding method utilizing soft information is suitable for a general IP-based network and that it keeps the principles of a layered structure of the protocol stack intact. Further, experimental results with images transmitted over a simulated wireless channel show that a simple decoding algorithm that utilizes soft information can give high gains in image quality compared to the standard hard-decision decoding.

[Smoking among psychology students over a ten-year period (1996-2006)].

Science.gov (United States)

Míguez Varela, María del Carmen; Becoña Iglesias, Elisardo

2009-11-01

The purpose of this study was to analyze the evolution of smoking among Psychology students at the University of Santiago de Compostela (Spain) over a ten-year period (1986-2006). We also assessed the extent of knowledge of the Spanish health legislation on tobacco (Ley 28/2005) and its effect on smoking. We administered a questionnaire to representative samples of students from the 1st year of their Psychology course to the 5th year, on four occasions. In the academic year 1996-1997 (N = 835), 34% of the sample claimed to be daily smokers; in 1999-2000 (N = 842), the figure was 35.2%; in 2003-2004 (N = 835) it was 31.9%; and in 2006-2007 (N = 688), it was 22.8%. Moreover, in the last assessment, 97.1% of the sample reported being aware of the legislation (Ley 28/2005) and 41.9% of the smokers claimed that it had some degree of influence on their smoking. It can be stated that, although overall current prevalence of smoking is similar to that of 10 years ago, a significant change is observed in the profile of smokers. This change is expressed in lower levels of nicotine dependence and a decrease in the percentage of daily smokers, together with an increase in occasional smokers.

Task 11: Technology development integration. Semi-annual report, April 1, 1996--September 30, 1996

Energy Technology Data Exchange (ETDEWEB)

Musich, M.A.

1997-05-01

A review was conducted of three systems analysis (SA) studies performed by Lockheed Idaho Technologies Company (LITCO) on integrated thermal treatment systems (ITTSs) and integrated nonthermal treatment systems (INTSs) for the remediation of mixed low-level waste (MLLW) stored throughout the U.S. Department of Energy (DOE) weapons complex. The review was performed by an independent team led by the Energy & Environmental Research Center (EERC), including Science Applications International Corporation, the Waste Policy Institute (WPI), and Virginia Tech. The three studies reviewed were as follows: (1) Integrated Thermal Treatment System Study, Phase 1 - issued July 1994, (2) Integrated Thermal Treatment System Study, Phase 2 - issued February 1996, and (3) Integrated Nonthermal Treatment System Study - drafted March 1996. The three studies were commissioned by DOE to be SA studies of environmental management (EM) systems. The purpose of LITCO`s engineering evaluation of the MLLW treatment system alternatives was to help DOE in the prioritization of research, development, and demonstration activities for remediation technologies. The review of these three studies was structured to further aid DOE in its current and future decision-making processes. The methodology in the studies was compared to a sound systems engineering (SE) approach to help DOE determine which tasks still need to be accomplished to complete a thorough design/review.

Task 11: Technology development integration. Semi-annual report, April 1, 1996--September 30, 1996

International Nuclear Information System (INIS)

Musich, M.A.

1997-01-01

A review was conducted of three systems analysis (SA) studies performed by Lockheed Idaho Technologies Company (LITCO) on integrated thermal treatment systems (ITTSs) and integrated nonthermal treatment systems (INTSs) for the remediation of mixed low-level waste (MLLW) stored throughout the U.S. Department of Energy (DOE) weapons complex. The review was performed by an independent team led by the Energy ampersand Environmental Research Center (EERC), including Science Applications International Corporation, the Waste Policy Institute (WPI), and Virginia Tech. The three studies reviewed were as follows: (1) Integrated Thermal Treatment System Study, Phase 1 - issued July 1994, (2) Integrated Thermal Treatment System Study, Phase 2 - issued February 1996, and (3) Integrated Nonthermal Treatment System Study - drafted March 1996. The three studies were commissioned by DOE to be SA studies of environmental management (EM) systems. The purpose of LITCO's engineering evaluation of the MLLW treatment system alternatives was to help DOE in the prioritization of research, development, and demonstration activities for remediation technologies. The review of these three studies was structured to further aid DOE in its current and future decision-making processes. The methodology in the studies was compared to a sound systems engineering (SE) approach to help DOE determine which tasks still need to be accomplished to complete a thorough design/review

Electric sales and revenue 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-12-01

Information is provided on electricity sales, associated revenue, average revenue per kilowatthour sold, and number of consumers throughout the US. The data provided in the Electric Sales and Revenue are presented at the national, Census division, State, and electric utility levels. The information is based on annual data reported by electric utilities for the calendar year ending December 31, 1996. 16 figs., 20 tabs.

Instream Flows Incremental Methodology :Kootenai River, Montana : Final Report 1990-2000.

Energy Technology Data Exchange (ETDEWEB)

Hoffman, Greg; Skaar, Don; Dalbey, Steve (Montana Department of Fish, Wildlife and Parks, Libby, MT)

2002-11-01

Regulated rivers such as the Kootenai River below Libby Dam often exhibit hydrographs and water fluctuation levels that are atypical when compared to non-regulated rivers. These flow regimes are often different conditions than those which native fish species evolved with, and can be important limiting factors in some systems. Fluctuating discharge levels can change the quantity and quality of aquatic habitat for fish. The instream flow incremental methodology (IFIM) is a tool that can help water managers evaluate different discharges in terms of their effects on available habitat for a particular fish species. The U.S. Fish and Wildlife Service developed the IFIM (Bovee 1982) to quantify changes in aquatic habitat with changes in instream flow (Waite and Barnhart 1992; Baldridge and Amos 1981; Gore and Judy 1981; Irvine et al. 1987). IFIM modeling uses hydraulic computer models to relate changes in discharge to changes in the physical parameters such as water depth, current velocity and substrate particle size, within the aquatic environment. Habitat utilization curves are developed to describe the physical habitat most needed, preferred or tolerated for a selected species at various life stages (Bovee and Cochnauer 1977; Raleigh et al. 1984). Through the use of physical habitat simulation computer models, hydraulic and physical variables are simulated for differing flows, and the amount of usable habitat is predicted for the selected species and life stages. The Kootenai River IFIM project was first initiated in 1990, with the collection of habitat utilization and physical hydraulic data through 1996. The physical habitat simulation computer modeling was completed from 1996 through 2000 with the assistance from Thomas Payne and Associates. This report summarizes the results of these efforts.

US Shipbuilding International Market Study, 1996-2005

National Research Council Canada - National Science Library

1995-01-01

The following report presents the results of a study undertaken by A & P Appledore International on behalf of NSRP SP-4, to forecast international commercial shipbuilding demand over the 10 year period 1996 to 2005...

Hydraulic Network Modelling of Small Community Water Distribution ...

African Journals Online (AJOL)

Prof Anyata

community (Sakwa) water distribution network in North Eastern geopolitical region of Nigeria using. WaterCAD ..... Table 1: Criteria Relating Population to Water Demand (NWSP, 2000) ..... timely manner ... Department, Middle East Technical.

International VLBI Service for Geodesy and Astrometry 2000 Annual Report

Science.gov (United States)

Vandenberg, N. R. (Editor); Baver, K. D. (Editor); Smith, David E. (Technical Monitor)

2000-01-01

This volume of reports is the 2000 Annual Report of the International Very Long Base Interferometry (VLBI) Service for Geodesy and Astrometry (IVS). The individual reports were contributed by VLBI groups in the international geodetic and astrometric community who constitute the permanent components of IVS. The IVS 2000 Annual Report documents the work of the IVS components for the period March 1, 1999 (the official inauguration date of IVS) through December 31, 2000. The reports document changes, activities, and progress of the IVS. The entire contents of this Annual Report also appear on the IVS web site at http://ivscc.gsfc.nasa.gov/publications/ar2000. This book and the web site are organized as follows: (1) The first section contains general information about IVS, a map showing the location of the components, information about the Directing Board members, and the report of the IVS Chair; (2) The second section of Special Reports contains a status report of the IVS Working Group on GPS phase center mapping, a reproduction of the resolution making IVS a Service of the International Astronomical Union (IAU), and a reprint of the VLBI Standard Interface (VSI); (3) The next seven sections hold the component reports from the Coordinators, Network Stations, Operation Centers, Correlators, Data Centers, Analysis Centers, and Technology Development Centers; and (4) The last section includes reference information about IVS: the Terms of Reference, the lists of Member and Affiliated organizations, the IVS Associate Member list, a complete list of IVS components, the list of institutions contributing to this report, and a list of acronyms. The 2000 Annual Report demonstrates the vitality of the IVS and the outstanding progress we have made during our first 22 months.

Public Safety Broadband Network Architecture Description

Science.gov (United States)

2013-08-01

could be used to add an in-app purchase to the user’s mobile phone bill. Major operators , such as AT& T , Deutsche Telekom, Orange, Telefonica and...3GPP technologies such as CDMA2000 and WiMAX networks. MME Mobility Managemen t Entity The MME is the key control-node for the LTE access-network... operator ( operator -managed small cells, etc.) or provides sufficient security (authentication, encryption, etc.). See Figure D3. Figure D3: ITU- T

Ground-water quality in the southeastern Sacramento Valley aquifer, California, 1996

Science.gov (United States)

Milby Dawson, Barbara J.

2001-01-01

In 1996, the U.S. Geological Survey sampled 29 domestic wells and 2 monitoring wells in the southeastern Sacramento Valley as part of the U.S. Geological Survey's National Water-Quality Assessment (NAWQA) Program. This area, designated as the NAWQA Sacramento subunit study area, was chosen because it had the largest amount of ground-water use in the Sacramento River Basin. The Sacramento subunit study area is about 4,400 square kilometers and includes intense agricultural and urban development. The wells sampled ranged from 14.9 to 79.2 meters deep. Ground-water samples from 31 wells were analyzed for 6 field measurements, 14 inorganic constituents, 6 nutrient constituents, organic carbon, 86 pesticides, 87 volatile organic compounds, tritium (hydrogen-3), radon-222, deuterium (hydrogen-2), and oxygen-18. Nitrate levels were lower than the 2000 drinking-water standards in all but one well, but many detections were in the range that indicated an effect by human activities on ground-water quality. Radon was detected in all wells, and was measured at levels above the proposed Federal 2000 maximum contaminant level in 90 percent of the wells. Five pesticides and one pesticide degradation product were detected in ground-water samples and concentrations were below 2000 drinking-water standards. All pesticides detected during this study have been used in the Sacramento Valley. Thirteen volatile organic compounds were detected in ground water. One detection of trichloroethene was above Federal 2000 drinking-water standards, and another, tetrachloromethane, was above California 1997 drinking-water standards; both occurred in a well that had eight volatile organic compound detections and is near a known source of ground-water contamination. Pesticides and volatile organic compounds were detected in agricultural and urban areas; both pesticides and volatile organic compounds were detected at a higher frequency in urban wells. Ground-water chemistry indicates that natural

Natural radionuclides by gammaspectrometry in the Belgrade, capital city in Yugoslavia for 1998, 1997 and 1996

Energy Technology Data Exchange (ETDEWEB)

Vukovic, D.M. [Institute for Occupational and Radiological Health, Belgrade (Yugoslavia); Markovic, D. [Faculty of Physical Chemistry, Belgrade (Yugoslavia)

2000-05-01

Region of Belgrade, 44 0 18' north width and 21 o 35' east length, 134 m under the sea, as a capital city of Yugoslavia is important part of monitoring of radioactivity in environment. Radioactivity comes mostly from natural radionuclides and partly from long-lived radionuclides from non natural sources as a consequence of Chernobyl accident. Monitoring of environment has proceeded by vertical methodology. We analyzed: aerosol, soil, fallout (wet and dry deposition), rivers, lakes, drinking water, human and animal food. Results from analyze of samples from environment contains very low activity, actually activity of changes of basic signal. Results for 1998, 1997 and 1996 are: 1. Gamma dose rate, with values from 0.072 {mu}G/h to 0.170 {mu}G/h, with median years values: 0.103 {mu}G/h (1998), 0.077 {mu}G/h (1997) and 0.072 {mu}G/h (1996). 2. By gammaspectrometry analyze of air as months samples for each year, results shows activity of changes of basic signal. The signals are coming from natural radionuclides. 3. {sup 137}Cs, as a long lived radionuclide, with remarkable activity in soil has values: 14-19 Bq/kg (1998), 12-111 Bq/kg (1997) and 7-39 Bq/kg (1996). 4. Activity in rivers Sava (Belgrade) and Danube (Zemun) belongs to {sup 40}K, while activities of {sup 137}Cs, {sup 226}Ra, {sup 232}Th, {sup 235}U and {sup 238}U are in traces. Activity of river sediment comes from {sup 137}Cs with values 0.4-46 Bq/kg of dry samples (river Danube). Activity in fish, mixture, white fish and others comes from {sup 40}K 55-100 Bq/kg and {sup 137}Cs 0.2-0.8 Bq/kg. 5. Activity of drinking waters, from city network shows low level of activity which comes from {sup 40}K. 6. Activity in milk comes from {sup 40}K 46.5-61.2 Bq/l (1998), 33-59 Bq/l (1997) and 31-54 Bq/l (1996). Activities of {sup 137}Cs are on the same level of detection. 7. Activity in the human food, measured in yogurt, meats, bread and agricultural products comes from {sup 40}K 44-310 Bq/kg (1998), 31

Final report for the 1996 Engineer Starters Program (Pre-Freshmen Enrichment Program)

Energy Technology Data Exchange (ETDEWEB)

Sharpe, L. Jr.

1996-08-15

This report has been developed for the North Carolina Agricultural and Technical State University College of Engineering, Department of Energy and other foundations/corporations sponsoring the 1996 Engineer Starters Program and for general information. The College of Engineering conducted its Annual outreach program for Middle and High School students from July 8 to August 2, 1996. The continuing primary goal of this program is to expose youth to the various challenging opportunities in the Mathematics and Science based careers, Engineering and Technology. The curriculum for the summer of 1996 included: Mathematics; Science; Computers; Graphics; Problem Solving; Career Explorations; Communications; Field Trips to Manufacturing Plants/Industries; and Engineering Projects/Designs. The 1996 program included rising seventh through tenth graders. Parental involvement was instituted as a vital component of the summer experiences. The primary objective is to increase the number of minorities entering engineering and science professions.

The geography of hotspots of rarity-weighted richness of birds and their coverage by Natura 2000.

Science.gov (United States)

Albuquerque, Fábio Suzart de; Gregory, Andrew

2017-01-01

A major challenge for biogeographers and conservation planners is to identify where to best locate or distribute high-priority areas for conservation and to explore whether these areas are well represented by conservation actions such as protected areas (PAs). We aimed to identify high-priority areas for conservation, expressed as hotpots of rarity-weighted richness (HRR)-sites that efficiently represent species-for birds across EU countries, and to explore whether HRR are well represented by the Natura 2000 network. Natura 2000 is an evolving network of PAs that seeks to conserve biodiversity through the persistence of the most patrimonial species and habitats across Europe. This network includes Sites of Community Importance (SCI) and Special Areas of Conservation (SAC), where the latter regulated the designation of Special Protected Areas (SPA). Distribution maps for 416 bird species and complementarity-based approaches were used to map geographical patterns of rarity-weighted richness (RWR) and HRR for birds. We used species accumulation index to evaluate whether RWR was efficient surrogates to identify HRRs for birds. The results of our analysis support the proposition that prioritizing sites in order of RWR is a reliable way to identify sites that efficiently represent birds. HRRs were concentrated in the Mediterranean Basin and alpine and boreal biogeographical regions of northern Europe. The cells with high RWR values did not correspond to cells where Natura 2000 was present. We suggest that patterns of RWR could become a focus for conservation biogeography. Our analysis demonstrates that identifying HRR is a robust approach for prioritizing management actions, and reveals the need for more conservation actions, especially on HRR.

Entanglement effects in model polymer networks

Science.gov (United States)

Everaers, R.; Kremer, K.

The influence of topological constraints on the local dynamics in cross-linked polymer melts and their contribution to the elastic properties of rubber elastic systems are a long standing problem in statistical mechanics. Polymer networks with diamond lattice connectivity (Everaers and Kremer 1995, Everaers and Kremer 1996a) are idealized model systems which isolate the effect of topology conservation from other sources of quenched disorder. We study their behavior in molecular dynamics simulations under elongational strain. In our analysis we compare the measured, purely entropic shear moduli G to the predictions of statistical mechanical models of rubber elasticity, making extensive use of the microscopic structural and topological information available in computer simulations. We find (Everaers and Kremer 1995) that the classical models of rubber elasticity underestimate the true change in entropy in a deformed network significantly, because they neglect the tension along the contour of the strands which cannot relax due to entanglements (Everaers and Kremer (in preparation)). This contribution and the fluctuations in strained systems seem to be well described by the constrained mode model (Everaers 1998) which allows to treat the crossover from classical rubber elasticity to the tube model for polymer networks with increasing strand length within one transparant formalism. While this is important for the description of the effects we try to do a first quantitative step towards their explanation by topological considerations. We show (Everaers and Kremer 1996a) that for the comparatively short strand lengths of our diamond networks the topology contribution to the shear modulus is proportional to the density of entangled mesh pairs with non-zero Gauss linking number. Moreover, the prefactor can be estimated consistently within a rather simple model developed by Vologodskii et al. and by Graessley and Pearson, which is based on the definition of an entropic

48 CFR 1552.235-76 - Treatment of Confidential Business Information (APR 1996).

Science.gov (United States)

2010-10-01

... Business Information (APR 1996). 1552.235-76 Section 1552.235-76 Federal Acquisition Regulations System... Provisions and Clauses 1552.235-76 Treatment of Confidential Business Information (APR 1996). As prescribed in 1535.007-70(c), insert the following clause: Treatment of Confidential Business Information (TSCA...

Fiscal Year 1996 Annual Report and Five-Year (1996-2000) Strategic Investment Plan

Science.gov (United States)

1996-03-01

Laboratory vn SERDP ACRONYMS LAAP LAMS LANL LARPS LCA LCAAP LIBS LIF LIN LIS LLNL LMS LNAPL LOVA LRS&T MADOM MAHRSI MARPOL MAS...FY 1995 $(K) Boiler/Engine Emissions Evaluation of Metal Perovskite Catalysts for Nox Reduction (AF) 25 Compact, Closed-Loop Controlled Waste...3 z re \\ > <: pq O- CP-2 SERDP COMPLIANCE SERDP FY96 PROJECT 1. SERDP Thrust Area: Compliance 2. Title: Evaluation of Metal Perovskite

Paul Scherrer Institut annual report 1996. Annex I. PSI-F1-Newsletter 1996 nuclear and particle physics. Muons in solid-state physics and chemistry

Energy Technology Data Exchange (ETDEWEB)

Herlach, D.; Kettle, P.R.; Buechli, C. [eds.] [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

1997-02-01

This newsletter contains reports from the F1-Department and its Divisions. The contributions are categorized as follows: - activities of the F1-Department of PSI, - nuclear and particle physics supported by the Department, -applications of muons in solid-state physics and chemistry. Groups were asked to present new, preliminary or final results obtained in 1996, as well as a publication list, related to F1-supported work which had appeared in scientific journals during 1996. (author) figs., tabs., refs.

Paul Scherrer Institut annual report 1996. Annex I. PSI-F1-Newsletter 1996 nuclear and particle physics. Muons in solid-state physics and chemistry

International Nuclear Information System (INIS)

Herlach, D.; Kettle, P.R.; Buechli, C.

1997-02-01

This newsletter contains reports from the F1-Department and its Divisions. The contributions are categorized as follows: - activities of the F1-Department of PSI, - nuclear and particle physics supported by the Department, -applications of muons in solid-state physics and chemistry. Groups were asked to present new, preliminary or final results obtained in 1996, as well as a publication list, related to F1-supported work which had appeared in scientific journals during 1996. (author) figs., tabs., refs

[Changing medical practices and nosocomial infection rates in French maternity units from 1997 to 2000].

Science.gov (United States)

Vincent-Boulétreau, A; Caillat-Vallet, E; Dumas, A M; Ayzac, L; Chapuis, C; Emery, M N; Girard, R; Haond, C; Lafarge-Leboucher, J; Tissot-Guerraz, F; Fabry, J

2005-04-01

In this study we describe the changes in medical practices and nosocomial infection rates in obstetrics observed through a surveillance network in the South East of France. The maternity units which belong to this network participated in voluntary surveillance using the network's methodology. The criteria for the diagnosis of nosocomial infections were in accordance with the methods described by the Centers for Disease Control and Prevention. 101240 pregnancies including 18503 caesareans (18.3%) were included in the network from 1997 to 2000. During the study period, nosocomial infection rates following caesarean section and vaginal delivery decreased respectively from 7.8% to 4.3% (p infection control programs in maternity units has been confirmed by the results of this surveillance network. During the study period, both obstetrics-related risk factors for nosocomial infection and observed hospital-acquired infection rates were dramatically reduced, what prove an improvement of quality of care in maternity units.

Coal industry annual 1996

International Nuclear Information System (INIS)

1997-11-01

This report presents data on coal consumption, coal distribution, coal stocks, coal prices, and coal quality, and emissions for Congress, Federal and State agencies, the coal industry, and the general public. Appendix A contains a compilation of coal statistics for the major coal-producing States.This report does not include coal consumption data for nonutility power producers that are not in the manufacturing, agriculture, mining, construction, or commercial sectors. Consumption for nonutility power producers not included in this report is estimated to be 24 million short tons for 1996. 14 figs., 145 tabs

Coal industry annual 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-11-01

This report presents data on coal consumption, coal distribution, coal stocks, coal prices, and coal quality, and emissions for Congress, Federal and State agencies, the coal industry, and the general public. Appendix A contains a compilation of coal statistics for the major coal-producing States.This report does not include coal consumption data for nonutility power producers that are not in the manufacturing, agriculture, mining, construction, or commercial sectors. Consumption for nonutility power producers not included in this report is estimated to be 24 million short tons for 1996. 14 figs., 145 tabs.

Progress report 1996 - 1997

International Nuclear Information System (INIS)

1998-01-01

This report reviews the activities of the laboratory for the years 1996 and 1997. Laboratory's activities are driven by an important international program on particle physics and astro-particles. 9 topics are presented: 1) physics at LHC: the ATLAS experiment, 2) the search for a new physics at LEP : DELPHI experiment, 3) neutrino oscillations: NOMAD and TONIC experiments, 4) the experiments H1 at HERA, 5) CP breaking: BABAR experiment, 6) DO experiment at the Tevatron, 7) gamma radiation sources: CAT experiment, 8) supernova, and 9) the project of the AUGER observatory

NAEP 1996 Trends in Writing: Fluency and Writing Conventions. Holistic and Mechanics Scores in 1984 and 1996.

Science.gov (United States)

Ballator, Nada; Farnum, Marisa; Kaplan, Bruce

Supplementary to "NAEP 1996 Trends in Academic Progress," this report describes two aspects of writing for which change has been measured since 1984: writing fluency as determined by holistic scoring; and mastery of the conventions of written English as determined by mechanics scoring. The introduction discusses the layout and means of…

Lower Grande Ronde smolt trap monitoring. Annual report 1996

International Nuclear Information System (INIS)

Setter, A.; Carmichael, R.W.

1998-01-01

The authors sampled downstream migrating salmonids at Boggan's Oasis in the Grande Ronde River with a screw trap during 1995 and a scoop trap during 1996. Sampling began in March and terminated early in June. Wild spring chinook and wild/hatchery steelhead were collected and marked to assess migration patterns and timing. Fish were marked with tags in order to obtain downstream migration data with minimal fish handling. Observations were recorded when a fish swam through an interrogation monitor at hydroelectric facilities downstream. The second year for monitoring smolts leaving the Grande Ronde River was completed in 1995. The authors continued to pursue moving to a permanent location downstream for 1997 because of the limitations for trapping smolts at Boggan's Oasis. This involved reconnaissance surveys of several potential sites near the mouth of the river from 1994--1996. During February of 1996, a water velocity and bottom topography assessment was completed. Results of the assessment were used for siting the anchoring tower structure upstream approximately 1.2 miles from the mouth of the Grande Ronde River

European Stirling forum 2000. Proceedings; Europaeisches Stirling Forum 2000. Tagungsband

Energy Technology Data Exchange (ETDEWEB)

NONE

2000-07-01

This document comprises all 42 papers presented at the 'European Stirling Forum 2000', held in Osnabrueck on February 22-24, 2000. Among others, the following subjects were discussed: Thermodynamics, new developments, Stirling engines, free piston heat pumps, flow optimisation of regenerators for Stirling engines, simulation for modelling of flow and heat transfer in the gas cycle of Stirling engines, design and performance, Stirling refrigerators, economic efficiency of biomass Stirling engines, power control of a Stirling CHP system, a Stirling refrigerator for ultralow temperatures in the refrigeration industry. [German] Das vorliegende Dokument enthaelt alle (42) Beitraege der Referenten des 'Europaeischen Stirling Forums 2000', das vom 22. bis 24. Februar 2000 in Osnabrueck stattgefunden hat. Einige der behandelten Themenschwerpunkte im Zusammenhang mit der Stirling-Maschine waren die Thermodynamik, neue Entwicklungen des Kreisprozesses, Heissgasmotoren, Freikolben-Waermepumpe, stroemungstechnische Optimierung von Regeneratoren fuer Stirling-Maschinen, Simulation zur Modellierung der Stroemung und Waermeuebertragung im Gaskreislauf von Stirling-Maschinen, Entwurf und Betriebsverhalten, Stirling-Kaeltemaschine, Wirtschaftlichkeit von Biomasse-Stirlingmotoren, Leistungsregelung eines Stirling-Blockheizkraftwerks, Anwendung eines Stirling-Kuehlers, zum Ultratiefkuehlen in der Kuehlindustrie. (AKF)

Status of the NASA Micro Pulse Lidar Network (MPLNET): overview of the network and future plans, new version 3 data products, and the polarized MPL

Science.gov (United States)

Welton, Ellsworth J.; Stewart, Sebastian A.; Lewis, Jasper R.; Belcher, Larry R.; Campbell, James R.; Lolli, Simone

2018-04-01

The NASA Micro Pulse Lidar Network (MPLNET) is a global federated network of Micro-Pulse Lidars (MPL) co-located with the NASA Aerosol Robotic Network (AERONET). MPLNET began in 2000, and there are currently 17 long-term sites, numerous field campaigns, and more planned sites on the way. We have developed a new Version 3 processing system including the deployment of polarized MPLs across the network. Here we provide an overview of Version 3, the polarized MPL, and current and future plans.

Public utilities in networks: competition perspectives and new regulations

International Nuclear Information System (INIS)

Bergougnoux, J.

2000-01-01

This report makes first a status about the historical specificities, the present day situation and the perspectives of evolution of public utilities in networks with respect to the European directive of 1996 and to the 4 sectors of electricity, gas, railway transport and postal service. Then, it wonders about the new institutions and regulation procedures to implement to conciliate the public utility mission with the honest competition. (J.S.)

Rapport du congrès EUROCALL 2000 et du symposium InSTIL 2000 (Dundee, Ecosse

Directory of Open Access Journals (Sweden)

Pierre Machu

2000-12-01

Full Text Available Le congrès annuel de EUROCALL (2000 (European Association for Computer Assisted Language Learning s'est déroulé du 31 août au 2 septembre 2000 à l'Université d'Abertay-Dundee et avait pour thème : Innovations dans l'apprentissage des langues au troisième millénaire - Réseaux pour la formation continue, interdisciplinarité et réponse intelligente de la machine (voir le site EUROCALL 2000 (2000. Environ 230 délégués provenant de 30 pays se sont rassemblés à Dundee. Les séances plénières et les communications (présentation de recherches ou démonstrations s'articulaient par conséquent autour de sous-thèmes tels que recherche en acquisition d'une langue seconde et ALAO, exploitation ou conception de matériaux pour la toile, communication médiatisée par ordinateur, centres de langues et apprentissage des langues de spécialité, traitement du language naturel et technologie de la parole. La technologie de la parole était également au coeur des préoccupations et travaux des 80 participants au symposium d'InSTIL 2000 (2000 (Intégration des technologies de la parole dans l'apprentissage des langues qui s'est déroulé durant les deux jours précédant le congrès EUROCALL 2000. InSTIL 2000 était organisé par le groupe d'intérêts spéciaux (GIS InSTIL (2000, (Integrating Speech Technology in Language Learning issu des trois associations CALICO (2000 (Computer Assisted Language Instruction Consortium, EUROCALL (2000 et ISCA (2000 (International Speech Communication Association.

Veebruarikuus 2000 lahkunuid / Aare Ermel

Index Scriptorium Estoniae

Ermel, Aare, 1957-2013

2000-01-01

Surid : Autant-Lara, Claude prantsuse režissöör (5.08.1903-5.02.2000), Vadim, Roger ukraina päritolu prantsuse režissöör (26.01.1928-11.02.2000), Kedrova, Lila vene päritolu prantsuse näitlejanna (1918-16.02.2000), Martelli, Otello itaalia filmioperaator (19.05.1903-20.02.2000)

Digital Denmark: From Information Society to Network Society

DEFF Research Database (Denmark)

Henten, Anders; Falch, Morten

2000-01-01

for a welfare society. However, globalisation and the spreading use of new information and communication technologies and services challenge this position. This article examines Denmark's performance in implementing its IS 2000 plans, the background to the Digital Denmark report, and its implications......The Danish Government recently issued a new policy report, Digital Denmark, on the "conversion to a network society", as a successor to its Information Society 2000 report (1994). This is part of a new round of information society policy vision statements that are, or will be forthcoming from...... national governments everywhere. Denmark provides an interesting case study because it ranks high in the benchmark indicators of information network society developments. This position has been obtained largely by public sector initiatives and without erosion of the highly reputed Scandinavian model...

Erastamisele mittekuuluvate elamute nimekirja kinnitamine

Index Scriptorium Estoniae

1995-01-01

Lisa: Erastamisele mittekuuluvate elamute nimekiri; Muudatus: Tallinna Linnavolikogu otsus nr 117, 20. okt. 1994; nr 2, 12. jaanuar 1995 nr 100, 28. juuni 1995; nr 120, 21. september 1995; nr 54, 30. mai 1996; nr 69, 27. juuni 1996; nr 70, 27.juuni 1996; 2. oktoober 1997 nr 178; 11. detsember 1997 nr 207; 28. mai 1998 nr 67 ; 10. dets. 1998 nr. 181 ; 11. märts 1999 nr 37 ; 9. septemebr 1999 otsus nr 214; Tallinna Linnavolikogu 7. oktoobri 1999 otsus nr 246; Tallinna Linnavolikogu 23. märsti 2000 otsus nr 112. Täiendamine: Tallinna Linnavolikogu 23. märsti 2000 otsus nr 113; Muudatus: Tallinna Linnavolikogu 22. veebruari 2000 otsus nr 51; 4. mai 2000 otsus nr 139; 4. mai 2000 otsus nr 141; 15. juuni 2000 otsus nr 240; 19. oktoobri 2000 otsus nr 355; 16. novembri 2000 otsus nr 386

Investigations of introduced species in Pearl Harbor; Oahu, Hawaii, from 1996-01-11 to 1996-09-18 (NODC Accession 0000330)

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The marine and estuarine invertebrate and fish communities in Pearl Harbor, Oahu, Hawaii were surveyed between January and October, 1996. Samples were taken and...

Presidential Green Chemistry Challenge: 1996 Small Business Award

Science.gov (United States)

Presidential Green Chemistry Challenge 1996 award winner, Donlar, developed thermal polyaspartate, a nontoxic, biodegradable, biobased polymer made in a highly efficient process for use in agriculture, water treatment, etc.

Energie-Versorgung Schwaben AG. Report on the 58th business year 1996; Energie-Versorgung Schwaben AG. Bericht ueber das 58. Geschaeftsjahr 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-09-01

The present report describes the tasks and activities of one of the German power economy`s large integrated companies which operate large-scale power plants. The 1996 business report disclases extensive financial data (balance, profit and loss account etc.). The purpose of the business is to produce, transmit or transport, respectively, and distribute electricity, long-distance thermal energy, and gas. (RHM) [Deutsch] Es wird eine Beschreibung der Aufgaben und Aktivitaeten dieses grossen Verbundunternehmens und Grosskraftwerksbetreibers der deutschen Elektrizitaetswirtschaft gegeben, wobei der Geschaeftsbericht 1996 zahlreiche finanzielle Daten (Bilanz, Gewinn- und Verlustrechnung etc.) offenlegt. Der Zweck des Unternehmens ist die Erzeugung, Fortleitung und Verteilung von elektrischem Strom, von Fernwaerme und Gas. (RHM)

Environmental Report 1996, Volume 2

Energy Technology Data Exchange (ETDEWEB)

Harrach, R.J.

1996-01-01

This is Volume 2 of the Lawrence Livermore National Laboratory`s (LLNL`s) annual Environmental Report 1996, prepared for the US Department of Energy. Volume 2 supports Volume 1 summary data and is essentially a detailed data report that provides individual data points, where applicable. Volume 2 includes information on monitoring of air, air effluents, sewerable water, surface water, ground water, soil and sediment, vegetation and foodstuff, environmental radiation, and quality assurance.

US long distance fiber optic networks: Technology, evolution and advanced concepts. Volume 3: Advanced networks and economics

Science.gov (United States)

1986-10-01

This study projects until 2000 the evolution of long distance fiber optic networks in the U.S. Volume 1 is the executive Summary. Volume 2 focuses on fiber optic components and systems that are directly related to the operation of long-haul networks. Optimistic, pessimistic and most likely scenarios of technology development are presented. The activities of national and regional companies implementing fiber long haul networks are also highlighted, along with an analysis of the market and regulatory forces affecting network evolution. Volume 3 presents advanced fiber optic network concept definitions. Inter-LATA traffic is quantified and forms the basis for the construction of 11-, 15-, 17-, and 23-node networks. Using the technology projections from Volume 2, a financial model identifies cost drivers and determines circuit mile costs between any two LATAs. A comparison of fiber optics with alternative transmission concludes the report.

Bioenergy research programme. Yearbook 1996. Peat and field biomass; Bioenergian tutkimusohjelma. Vuosikirja 1996. Turpeen ja peltobiomassojen tuotantotekniikka

Energy Technology Data Exchange (ETDEWEB)

Nikku, P [ed.

1997-12-01

The aim of the programme is to increase the use of economically profitable and environmentally sound bioenergy by improving the competitiveness of present peat and wood fuels. Research and development projects will also develop new economically competitive biofuels, new equipment and methods for production, handling and utilisation of biofuels. The total funding for 1996 was 27.3 million FIM and the number of projects 63. The number of projects concerning peat production was 7 and that of field biomass projects 4. Results of the projects carried out in 1996 are presented in this publication. The development target in the research area of peat production is to improve the competitiveness of peat by reducing the production costs by 20 % (by 5-6 FIM/MWh) from the level of 1992, and to reduce the environmental impacts. The target of the research area of peat production is possible to achieve if the sub-targets are achieved. The production costs are reduced by 5 % if the width of the production field is increased from 20 m to 60 m, by 8 % if the degree of utilisation of solar energy is increased from 30 % to 40 %, by 6.5 % if the value of peat remaining on the cutover field is reduced from 3 000 MWh to 1 500 MWh, by 3 % if light and fireproof machines are developed, and by 3 % if combined peat and wood harvesting is applied. The production costs will be reduced by 24 % if the different sub-targets are achieved. In this programme no common target for the field biomass projects was set. Field biomass projects are mainly funded by the Finnish Ministry of Agriculture and Forestry. Most of the research projects were completed in 1996. (orig.)

Annual report 2000; Rapport annuel 2000

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-07-01

This report presents the industrial activities and the financial results of the Framatome group (Framatome-SA) in 2000. and Siemens have merged their nuclear activities and have created Framatome-ANP (advanced nuclear power) owned by Framatome (66%) and Siemens (34%). This new society represents a turnover of 3 millions Euros and a staff of 13.000 employees. In the sector of connectors, FCI (Framatome Connectors International) has reinforced its second position in the world, FCI has enjoyed a high growth in the sector of telecommunication and has created a department dealing with optic fibers. 32% of the activities of Framatome-SA have been performed in France, 26% in North America and 42% in the rest of the world. In 2000 the trading results after having paid taxes reached 306 millions Euros, it represents 6.1% of the turnover. (A.C.)

Enforcement actions: Significant actions resolved reactor licensees. Semiannual progress report, July 1996--December 1996

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-04-01

This compilation summarizes significant enforcement actions that have been resolved during the period (July-December 1996) and includes copies of letters, Notices, and Orders sent by the Nuclear Regulatory Commission to reactor licensees with respect to these enforcement actions. It is anticipated that the information in this publication will be widely disseminated to managers and employees engaged in activities licensed by the NRC, so that actions can be taken to improve safety by avoiding future violations similar to those described in this publication.

Enforcement actions: Significant actions resolved reactor licensees. Semiannual progress report, July 1996--December 1996

International Nuclear Information System (INIS)

1997-04-01

This compilation summarizes significant enforcement actions that have been resolved during the period (July-December 1996) and includes copies of letters, Notices, and Orders sent by the Nuclear Regulatory Commission to reactor licensees with respect to these enforcement actions. It is anticipated that the information in this publication will be widely disseminated to managers and employees engaged in activities licensed by the NRC, so that actions can be taken to improve safety by avoiding future violations similar to those described in this publication

Developing a network: the PMM process.

Science.gov (United States)

Kamara, A

1997-11-01

Since 1988, the Prevention of Maternal Mortality (PMM) Network has developed, implemented and evaluated projects that focus directly on prevention of maternal deaths. The Network, which consists of 11 multidisciplinary teams in West Africa and one at Columbia University, grew from discussions between the Carnegie Corporation of New York and researchers at Columbia School of Public Health. Its goals are: to strengthen capacities in developing countries; to provide program models for preventing maternal deaths; and to inform policymakers about the importance of maternal mortality. This paper describes the development and functioning of the Network. The initial steps included identifying interested partners in Africa and encouraging them to form multidisciplinary teams. Each African team received two grants: one to perform a needs assessment and then another to develop and implement projects based on the results. The Columbia team provided technical assistance in a variety of ways, including site visits, workshops and correspondence. Teams tested program models and reported findings both to local policymakers and in international fora. Collaboration with government and community leaders helped facilitate progress at all stages. At the PMM Network Results Conference in 1996, the teams decided to continue their work by forming the Regional PMM (RPMM) Network, an entirely African entity.

Store tobacco policies: a survey of store managers, California, 1996-1997.

Science.gov (United States)

Weinbaum, Z; Quinn, V; Rogers, T; Roeseler, A

1999-01-01

To identify store tobacco policies and retailer perception and beliefs that may have contributed to changes in compliance with youth access laws in California. In the winter of 1996-7, a cross sectional, follow up telephone survey was conducted of California store managers whose stores were anonymously surveyed for illegal tobacco sales in the summer of 1996 (that is, 1996 Youth Tobacco Purchase Survey, YTPS). A simple random sample of stores from a list of California stores likely to sell tobacco, used in the 1996 YTPS. 334 managers (77%) of the 434 stores surveyed in 1996 responded to the survey. After eliminating stores that stopped selling tobacco or were under new management or ownership, 320 responses of store managers were included in the analysis. The stores were analysed by type of ownership: chain, which included corporate managed (n = 61); franchise owned (n = 56); and independent (n = 203). Responses of store managers were linked with the 1996 YTPS outcomes. Manager responses were compared by chi2 tests. Logistic regression analyses were conducted to identify store factors associated with illegal tobacco sales. A lower likelihood of illegal sales rate was associated with the chain stores when compared with the independent stores (odds ratio (OR) = 0.4, 95% confidence interval (CI) 0.2 to 0.9). A lower likelihood of illegal tobacco sales was found in stores that implemented tobacco related activities in the previous year such as changing tobacco displays (OR = 0.5, 95% CI 0.2 to 0.9) or adding new warning signs (OR = 0.7, 95% CI 0.4 to 1.2). Store managers' beliefs that youth were sent to their stores to do compliance checks also resulted in a lower likelihood of illegal sales (OR = 0.7, 95% CI 0.4 to 1.1). Store tobacco youth access policies, and managers' beliefs about the extent of youth access enforcement in the community, are important in reducing illegal tobacco sales to minors.

Status of the NASA Micro Pulse Lidar Network (MPLNET: overview of the network and future plans, new version 3 data products, and the polarized MPL

Directory of Open Access Journals (Sweden)

Welton Ellsworth J.

2018-01-01

Full Text Available The NASA Micro Pulse Lidar Network (MPLNET is a global federated network of Micro-Pulse Lidars (MPL co-located with the NASA Aerosol Robotic Network (AERONET. MPLNET began in 2000, and there are currently 17 long-term sites, numerous field campaigns, and more planned sites on the way. We have developed a new Version 3 processing system including the deployment of polarized MPLs across the network. Here we provide an overview of Version 3, the polarized MPL, and current and future plans.

R-2000 home health study : Homeowner health in R-2000 and new conventional homes

International Nuclear Information System (INIS)

Parekh, A.

2002-01-01

A field study was conducted by Health Canada and Natural Resources Canada (NRCan) to evaluate self-reported health symptoms by residents of R-2000 and conventional homes in Nova Scotia and New Brunswick. It involved 52 energy efficient R-2000 and 50 conventionally built houses. Health Canada collected and analyzed data concerning changes in occupant health after moving into R-2000 houses and similar conventional houses. Definite trends in improvements of respiratory symptoms of occupants in R-2000 houses were revealed, compared to the results obtained for occupants of conventional houses. New occupants of R-2000 houses reported significant improvement in indoor air quality in 94 per cent of cases, while only 77 per cent of conventional homeowners reported similar results. Fifty six per cent of the occupants of R-2000 homes reported a general improvement in their health, compared to 32 per cent in conventional houses. The testing of houses in other regions is being planned by Health Canada. tabs

1996 Activities report on energies and raw materials

International Nuclear Information System (INIS)

1996-01-01

The 1996 activity survey of the French General Directory for Energy and Raw Materials, which main objectives are to preserve the competitiveness of French economy, enhance environmental protection, secure the long term supply safety and maintain the public service basis for energy supply, is presented. The main themes of the survey are: the nuclear safety in Eastern Europe, the electric power inland market, the evolution of the oil market in 1996, the situation of refining in France, restructuring the BRGM (Mining and Geological Research Bureau), followed by brief facts concerning the sustainable energy development, nuclear energy, electric power, electricity and gas common issues, gas, coal, petroleum products, raw materials and underground materials. A series of global diagrams concludes the survey

Communication of 7 February 1996 received from the Permanent Mission of Australia to the International Atomic Energy Agency

International Nuclear Information System (INIS)

1996-01-01

On 7 February 1996, the Director General received a communication of 6 February 1996 from the Resident Representative of Australia transmitting Statements made by the Prime Minister of Australia on 28 January 1996 about the sixth nuclear test by France at Fangataufa and on 30 January 1996 about the subsequent announcement of France's commitment to sign the South Pacific Nuclear Free Zone Treaty and a Comprehensive Test Ban Treaty in 1996

International nuclear power status 2000; International kernekraftstatus 2000

Energy Technology Data Exchange (ETDEWEB)

Lauritzen, B.; Majborn, B.; Nonboel, E.; Oelgaard, P.L. [eds.

2001-03-01

This report is the seventh in a series of annual reports on the international development of nuclear power with special emphasis on reactor safety. For 2000, the report contains: 1. General trends in the development of nuclear power. 2. Deposition of low-level radioactive waste. 3. Statistical information on nuclear power production (in 1999). 4. An overview of safety-relevant incidents in 2000. 5. The development in Sweden. 6. The development in Eastern Europe. 7. The development in the rest of the world. 8. Trends in the development of reactor types. 9. Trends in the development of the nuclear fuel cycle. (au)

Evaluation of mercury contamination in sediments from Santos - Sao Vicente Estuarine system, in period of 1996 -2000; Avaliacao da contaminacao por mercurio dos sedimentos do Estuario Santos - Sao Vicente, no periodo de 1996-2000

Energy Technology Data Exchange (ETDEWEB)

Hortellani, Marcos Antonio

2003-07-01

The distribution of mercury contamination in the Santos - Sao Vicente Estuarine System was observed through the analysis of seventy seven surface sediments samples collected in two series. In different periods and points, since the Channel of Piacaguera, the head of the system, , through the estuarine arms of Santos and Sao Vicente as far as the Bay of Santos, about 30 Km downstream, and in different mangrove areas, including industrial and harbor influence zones. The obtained values ranged from 0.03 to 1.19 {mu}g g {sup -1} About 90% of the samples of the first series collected among 1997-1998 and 50% of the second series collected among 1999-2000 presented levels of Hg > 0,13 {mu}g g {sup -1} ,limit considered by the Canadian legislation and adopted by CETESB, below which doesn't happen adverse effect in the biological community. And about 35% of samples of the first series and 11 % of the second series presented concentrations of Hg > 0.698 {mu}g g {sup -1} probable level of occurrence of adverse effect in the biological community. These results indicate an increase of the mercury levels caused by the industrial, port and urban activities. The mercury concentration in sediments was determined by using an Atomic Absorption Spectrophotometer, coupling with a flow injection system by a cold vapor generation, using a manual injection valve (FIA-CVAAS). The estimate of the uncertainties associated to this procedure was calculated. The following elements were also determined: Fe, Al, Zn, Ni, Pb, Cd, Cr and Co in 46 samples of the second series, by atomic absorption spectrometry. In order to verify possible relationship among all the investigated elements in the samples sediments, was carried out a statistical study, using the SPSS-8.0 software. Pearson correlation and Principal Component's analysis were used for with the objective to identify of major relationship for additional exploration of the general behavior of the data. (author)

Support Networks for the Greek Family with Preschool or School-Age Disabled Children

Science.gov (United States)

Tsibidaki, Assimina; Tsamparli, Anastasia

2007-01-01

Introduction: The interaction of the family with disabled children with the support networks is a research area of high interest (Hendriks, De Moor, Oud & Savelberg, 2000). It has been shown that support networks may prove to be very helpful for a family and especially for a family with a disabled child. Support networks play a primordial role…

Region of interest and windowing-based progressive medical image delivery using JPEG2000

Science.gov (United States)

Nagaraj, Nithin; Mukhopadhyay, Sudipta; Wheeler, Frederick W.; Avila, Ricardo S.

2003-05-01

An important telemedicine application is the perusal of CT scans (digital format) from a central server housed in a healthcare enterprise across a bandwidth constrained network by radiologists situated at remote locations for medical diagnostic purposes. It is generally expected that a viewing station respond to an image request by displaying the image within 1-2 seconds. Owing to limited bandwidth, it may not be possible to deliver the complete image in such a short period of time with traditional techniques. In this paper, we investigate progressive image delivery solutions by using JPEG 2000. An estimate of the time taken in different network bandwidths is performed to compare their relative merits. We further make use of the fact that most medical images are 12-16 bits, but would ultimately be converted to an 8-bit image via windowing for display on the monitor. We propose a windowing progressive RoI technique to exploit this and investigate JPEG 2000 RoI based compression after applying a favorite or a default window setting on the original image. Subsequent requests for different RoIs and window settings would then be processed at the server. For the windowing progressive RoI mode, we report a 50% reduction in transmission time.

PATINA Network - Performance of coil coating in natural atmospheres of Ibero-America

Directory of Open Access Journals (Sweden)

Rosales, B. M.

2003-12-01

Full Text Available The research work performed on 12 coil coating materials in the frame of the PATINA Network (Anticorrosive Protection in the Atmosphere sponsored by CYTED is discussed. It includs the task accomplished by Science and Technology institutions of Ibero-America on formulations supplied by different prcoduction Sector companies from the participating countries, between 1996 and 2000. Coil coating schemes were exposed outdoors, according to ISO 2810 standards, in 9 ambient conditions of the MICAT (Ibero-American Test Stations Network, CYTED. The protective characteristics on the steel base metal was determined as a function of time, following ISO 4628 and ASTM D 3274 standards. Electrochemical impedance spectroscopy (EIS was applied on various materials after 1, 2, 3 years and 42 months exposure, to evaluate the weathering effect in different atmospheric conditions.

Se discute el trabajo realizado sobre 12 diferentes recubrimientos para banda continua en el marco de la Red PATINA (Protección Anticorrosiva en la Atmósfera, patrocinada por el CYTED. Incluye las actividades llevadas a cabo por instituciones de Ciencia y Técnica de Iberoamérica, sobre distintas formulaciones provistas por empresas productoras de los países participantes, entre 1996 y 1999. Se expusieron a la intemperie, en distintas condiciones ambientales de la Red de Estaciones MICAT, CYTED, siguiendo la norma ISO 2810, recubrimientos de diferentes formulaciones. Se evaluaron las características protectoras sobre el acero de base en función de los parámetros medio-ambientales y los tiempos de exposición programados, según la normas ISO 4628, 4623 y ASTM D 3274. Se aplicaron dos esquemas de protección orgánicos sobre las muestras de acero, otros cuatro sobre muestras de acero previamente protegido con Zn y otros seis sobre acero galvanizado (2 y recubierto con galvalume (4, con y sin incisión en cada esquema hasta llegar el acero. Se discuten los resultados obtenidos

Doses to patients from medical X-ray examinations in the UK. 2000 review

CERN Document Server

Hart, D; Wall, B F

2002-01-01

In 1992 NRPB established a National Collation Centre for measurements of doses to patients made by x-ray departments throughout the UK. This report is the second in a series of five-yearly reviews of the national patient dose database and analyses the information collected during the period January 1996 to December 2000. It includes the results of 28,000 entrance surface dose (ESD) measurements and 13,000 dose-area product (DAP) measurements for single radiographs, and 140,000 DAP measurements and 128,000 records of the fluoroscopy time for complete examinations, collected from 371 hospitals throughout the UK. Information on the patient dose distributions and exposure conditions for over 30 types of examination and radiograph is presented. National reference doses based on the rounded third quartile values of these dose distributions are recommended and are seen to be about 20% lower than corresponding values in the previous (1995) review. They have approximately halved since the original UK national referenc...

Annual report 1996-97

International Nuclear Information System (INIS)

1997-01-01

The second annual report of the Council for the Central Laboratory of the Research Councils (CCLRC) for the year 1996-1997 is presented together with the organisation's accounts for the year. CCLRC exists to promote high quality scientific and engineering research by providing facilities and technical expertise in support of basic, strategic and applied research programmes funded by United Kingdom and overseas sources. The corporate objectives are listed together with evidence of adherence to each and financial data presented on how CCLRC funds are distributed. Research programme highlights, commercial and operation activities are also described. (UK)

Papillary thyroid carcinoma in Denmark 1996-2008

DEFF Research Database (Denmark)

Londero, Stefano Christian; Krogdahl, Annelise; Bastholt, Lars

2013-01-01

question this assumption. Methods: National, unselected, prospective cohort study of 1350 papillary thyroid cancer patients in Denmark from 1996 to 2008. Objective: To analyze changes in incidence by time and to identify factors which might influence detection rate. Results: A rise in incidence is seen...

48 CFR 1552.235-75 - Access to Toxic Substances Control Act Confidential Business Information (APR 1996).

Science.gov (United States)

2010-10-01

... Control Act Confidential Business Information (APR 1996). 1552.235-75 Section 1552.235-75 Federal... Confidential Business Information (APR 1996). As prescribed in 1535.007(b), insert the following provision: Access to Toxic Substances Control Act Confidential Business Information (APR 1996) In order to perform...

Hawaii Small Boat Cost-Earnings Data: 1995-1996

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — These data represent a cost-earnings study of the Hawaii small boat fishery in 1995-1996. Data collected include fisher classification, vessel characteristics,...

ECP divisional training: plan 1996

OpenAIRE

Storr, Kenneth Mick

1996-01-01

The divisional training plan is produced each year at the request of the Joint Training Board (JTB) following a recommendation in the 1991 CERN Training Plan which states that divisions should produce a plan setting out training priorities. This plan presents a review of training activities. a report on ECP progress in implementing the recommendations of the 1995 CERN training plan, a discussion of divisional training objectives, and a summary of training requests generated by the 1996 period...

Annual report and accounts 1996

International Nuclear Information System (INIS)

1997-12-01

This report outlines the work of the Radiological Protection Institute of Ireland (RPII) during 1996. Some developments during the year were the concerns about the effects in the Irish Sea of increased discharges of technetium-99 from Sellafield, an international emergency exercise which incorporated an exercise of Ireland's National Emergency Plan dor Nuclear Accidents, the organisation of a conference marking the tenth anniversary of the Chernobyl accident and further work on the Institute's national survey of radon in dwellings

Interim sanitary landfill groundwater monitoring report. 1996 Annual report

International Nuclear Information System (INIS)

Bagwell, L.A.

1997-01-01

Eight wells of the LFW series monitor groundwater quality in the Steed Pond Aquifer (Water Table) beneath the Interim Sanitary Landfill at the Savannah River Site. These wells are sampled semiannually to comply with the South Carolina Department of Health and Environmental Control Modified Municipal Solid Waste Permit 025500-1120 and as part of the SRS Groundwater Monitoring Program. Trichlorofluoromethane and 1,1,1-trichloroethane were elevated in one sidegradient well and one downgradient well during 1996. Zinc was elevated in three downgradient wells and also was detected in the associated laboratory blanks for two of those wells. Specific conductance was elevated in one background well and one sidegradient well. Barium and copper exceeded standards in one sidegradient well, and dichloromethane (a common laboratory contaminant) was elevated in another sidegradient well. Barium, copper, and dichloromethane were detected in the associated blanks for these wells, also. The groundwater flow direction in the Steed Pond Acquifer (Water Table) beneath the Interim Sanitary Landfill was to the southeast (universal transverse Mercator coordinates). The flow rate in this unit was approximately 210 ft/year during first quarter 1996 and 180 ft/yr during third quarter 1996

Building beef cow nutritional programs with the 1996 NRC beef cattle requirements model.

Science.gov (United States)

Lardy, G P; Adams, D C; Klopfenstein, T J; Patterson, H H

2004-01-01

Designing a sound cow-calf nutritional program requires knowledge of nutrient requirements, diet quality, and intake. Effectively using the NRC (1996) beef cattle requirements model (1996NRC) also requires knowledge of dietary degradable intake protein (DIP) and microbial efficiency. Objectives of this paper are to 1) describe a framework in which 1996NRC-applicable data can be generated, 2) describe seasonal changes in nutrients on native range, 3) use the 1996NRC to predict nutrient balance for cattle grazing these forages, and 4) make recommendations for using the 1996NRC for forage-fed cattle. Extrusa samples were collected over 2 yr on native upland range and subirrigated meadow in the Nebraska Sandhills. Samples were analyzed for CP, in vitro OM digestibility (IVOMD), and DIP. Regression equations to predict nutrients were developed from these data. The 1996NRC was used to predict nutrient balances based on the dietary nutrient analyses. Recommendations for model users were also developed. On subirrigated meadow, CP and IVOMD increased rapidly during March and April. On native range, CP and IVOMD increased from April through June but decreased rapidly from August through September. Degradable intake protein (DM basis) followed trends similar to CP for both native range and subirrigated meadow. Predicted nutrient balances for spring- and summer-calving cows agreed with reported values in the literature, provided that IVOMD values were converted to DE before use in the model (1.07 x IVOMD - 8.13). When the IVOMD-to-DE conversion was not used, the model gave unrealistically high NE(m) balances. To effectively use the 1996NRC to estimate protein requirements, users should focus on three key estimates: DIP, microbial efficiency, and TDN intake. Consequently, efforts should be focused on adequately describing seasonal changes in forage nutrient content. In order to increase use of the 1996NRC, research is needed in the following areas: 1) cost-effective and

Mapping and deterring violent extremist networks in North-West Africa

DEFF Research Database (Denmark)

Walther, Olivier; Leuprecht, Christian

connections of VEOs and the effect of borders on the spatial patterns of armed groups. Social network analysis reveals that the network involving VEOs had a low density, a low level of transitivity, and contained few central actors, three typical characteristics of negative-tie networks. Al Qaeda...... in the Islamic Maghreb (AQIM) is unquestionably the most connected VEO, which in purely network terms can be seen as a liability. Spatial analysis shows that, while violence was almost exclusively concentrated within Algeria between 1997 and 2004, cross-border movements intensified in the mid-2000s following...

Understanding the tariff. Access to the public power transportation network

International Nuclear Information System (INIS)

2002-01-01

Since the European directive of December 19, 1996 about the common rules of the European power market, the eligible companies can chose their power supplier anywhere in Europe. The manager of the French power transportation network (RTE) supplies a network access to these companies according to a tariff fixed by the decree no. 2002-1014 from July 19, 2002. The aim of this document is to explain this tariff: tariffing principles ('mail-stamp' principle, voltage domain, subscribed output power tariffs, input power tariffs), tariffing elements (access to the grid, elements of output tariffs (subscribed power, overload, emergency tariffs, modifications etc..)), invoicing modalities, output tariffs, definitions. (J.S.)

Compilation of the opinions expressed by the CCTN in 1996; Raccolta dei pareri espressi dalla CCTN nel 1996

Energy Technology Data Exchange (ETDEWEB)

Camoni, I [Istituto Superiore di Sanita` , Rome (Italy). Lab. di Tossicologia Applicata; Mucci, N [ISPESL, Monteporzio Catone, Rome (Italy). Dipt. di Medicina del Lavoro

1997-06-01

The opinion expressed by the Italian National Advisory Toxicological Committee (CCTN) in 1996 are presented. Among the most important opinions the following may be mentioned: (1) toxic properties of substances deriving from Cannabis sativa; (2) reproductive-toxicity of friazolic pesticides; (3) re-evaluations of the carcinogenic evidences of several chemical substances.

Construction of the NIFS campus information network, NIFS-LAN

Energy Technology Data Exchange (ETDEWEB)

Tsuda, Kenzo; Yamamoto, Takashi; Kato, Takeo; Nakamura, Osamu; Watanabe, Kunihiko; Watanabe, Reiko; Tsugawa, Kazuko; Kamimura, Tetsuo

2000-10-01

The advanced NIFS campus information network, NIFS-LAN, was designed and constructed as an informational infrastructure in 1996, 1997 and 1998 fiscal year. NIFS-LAN was composed of three autonomous clusters classified from research purpose; Research Information cluster, Large Helical Device Experiment cluster and Large-Scale Computer Simulation Research cluster. Many ATM(Asychronous Transfer Mode) switching systems and switching equipments were used for NIFS-LAN. Here, the outline of NIFS-LAN is described. (author)

Study of a cutaneous leishmaniasis outbreak in General Vedia, Province of Chaco, 1996 Surto de leishmaniose cutânea em General Vedia, Provincia de Chaco, 1996

Directory of Open Access Journals (Sweden)

O. Daniel SALOMON

2001-04-01

Full Text Available Between March and July 1996, a focalized epidemic outbreak of cutaneous leishmaniasis in General Vedia, province of Chaco, associated to the gallery forest of the Oro river was verified. The incidence rate in the area, which was 0-2/000 cases in preceding years, reached 8/000 cases in 1996. The risk of symptomatic infection was similar between sexes, but was different when analizing the different age groups by sex, suggesting a greater relative importance of the peridomestic transmission for the females and of the transmission in the subtropical forest for the males. Specimens of Lutzomyia intermedia, a species already incriminated as a vector of Leishmaniasis in other provinces of northern Argentina, were captured and identified in the focus locality in May 1996. The possible causes of the outbreak related to the climatic variables and the vector abundance are analyzed and the results in the framework of possible preventive and control activities are discussed.Entre março e julho de 1996, foi verificado um surto epidêmico focalizado de leishmaniose cutânea na localidade de Geral Vedia, província de Chaco, associado com a floresta de galeria do rio de Oro. A taxa de incidência na área que era 0-2/000 casos em anos anteriores, alcançou 8/000 casos em 1996. O risco de infecção sintomática era semelhante entre sexos, mas era diferente quando foram analizados os grupos de idade diferentes segundo sexo, sugerindo maior importância relativa da transmissão na área peridoméstica nas mulheres e da transmissão na floresta subtropical nos homens. Espécimes de Lutzomyia intermedia, espécie já incriminada como vetor de Leishmaniose em outras províncias do norte da Argentina, foram capturadas e identificadas na localidade em maio de 1996. São analisadas as possíveis causas do surto relacionadas às variáveis climáticas e a abundância do vetor e os resultados são discutidas na estrutura de possíveis atividades de prevenção e

Application of Auto CAD 2000

International Nuclear Information System (INIS)

Kim, Hyeong Jun

1999-11-01

This book deals with basic of AutoCAD, beginning AutoCAD 2000, using design center of AutoCAD 2000, adding drawing element with design center, drawing lines, using 2D edit command, making layer, hatching, dimensioning, entering letters on the floor plan, making 3D object, practice of 3D command, edition of 3D object, making solid, rendering object, and using internet in AutoCAD 2000. This book is introduction of AutoCAD 2000 for beginner.

Work report 1995-1996; Informe de Labores 1995-1996

Energy Technology Data Exchange (ETDEWEB)

National Institute of Nuclear Research

1997-12-31

The Instituto Nacional de Investigaciones Nucleares presents the results obtained from the activities carried out during the period 1995-1996. This report is divided into 3 main sections, plus a statistical appendix. The first section points out the importance that the Institute has obtained within the national context, as well as within the state industry of Mexico, emphasizing the support given to the Central Nucleoelectrica of Laguna Verde (sponsored by the Comision Federal de Electricidad), and to the technical cooperation programs, at international level, in the fields of nuclear science and technology. The second section gathers the results of operation and investment, dedicated to cover the expenses of services and employment, commercialization, administrative development, productivity and operative efficiency; external economic relations and some relevant aspects of the budget and financial situation. The third one corresponds to the researches that are actually being developed; their results will be presented in the forthcoming reports. (Author).

International Youth Nuclear Congress 2000. Film

International Nuclear Information System (INIS)

OST Film Production Studio; YDRNS Information Technology Services, Ltd.

2001-01-01

This CD-ROM contains 28 minutes 30 seconds of video-film about programme of International Youth Nuclear Congress 2000 (IYNC 2000). There is documentary video-film about IYNC 2000, also presented are: the Opening panel of the IYNC 2000, every day work of IYNC 2000, Congress people; the fun run; Entertainment excursion in Bratislava, about excursion in Mochovce NPP as well as in IAEA

Consolidated results 2000. Forecasts 2001; Resultats consolides 2000. Perspectives 2001

Energy Technology Data Exchange (ETDEWEB)

NONE

2001-07-01

This document presents an economic analysis of the Group Gaz De France consolidated results for the year 2000. The main topics are the evolution of the energy market, the great economic growth for the five businesses of the Group (exploration-production, trade, transport, distribution and services), financial results affected by the supply costs increase, the position reinforcement among the gas leaders in Europe and the highlights of 2000. (A.L.B.)

Working Papers in Educational Linguistics, 1996-1997.

Science.gov (United States)

Furumoto, Mitchell A., Ed.; And Others

1997-01-01

Reports of language research in the 1996 issue include: "Corpus Planning for the Southern Peruvian Quechua Language" (Serafin M. Coronel-Molina); "Foreign Language Planning in U.S. Higher Education: The Case of a Graduate Business Program" (Mitchell A. Furumoto); "Charting New Directions: Of Communication in a Social…

Social Networks in the Tourism Industry: An Investigation of Charleston, South Carolina

Science.gov (United States)

Ying, Tianyu

2010-01-01

Over the last decade, increasing attention has been given to the networking in the tourism industry (Lynch, 2000; Pavlovich, 2003). The existing literature mainly focuses on the interrelationships among tourism stakeholders at sector level and the structure of the interorganizational networks in tourism industry. However, little research has been…

Savannah River site environmental report for 1996

Energy Technology Data Exchange (ETDEWEB)

Arnett, M.; Mamatey, A. [eds.

1998-12-31

The mission at the Savannah River Site (SRS) has changed from the production of nuclear weapons materials for national defense to the management of site-generated waste, restoration of the surrounding environment, and the development of industry in and around the site. However, SRS-through its prime operating contractor, Westinghouse Savannah River Company (WSRC)-continues to maintain a comprehensive environmental monitoring program. In 1996, effluent monitoring and environmental surveillance were conducted within a 31,000-square-mile area in and around SRS that includes neighboring cities, towns, and counties in Georgia and South Carolina and extends up to 100 miles from the site. Though the environmental monitoring program was streamlined in 1996-to improve its cost-effectiveness without compromising data quality or reducing its overall ability to produce critical information-thousands of samples of air, surface water, groundwater, food products, drinking water, wildlife, rainwater, soil, sediment, and vegetation were collected and analyzed for radioactive and nonradioactive contaminants.

Savannah River site environmental report for 1996

International Nuclear Information System (INIS)

Arnett, M.; Mamatey, A.

1998-01-01

The mission at the Savannah River Site (SRS) has changed from the production of nuclear weapons materials for national defense to the management of site-generated waste, restoration of the surrounding environment, and the development of industry in and around the site. However, SRS-through its prime operating contractor, Westinghouse Savannah River Company (WSRC)-continues to maintain a comprehensive environmental monitoring program. In 1996, effluent monitoring and environmental surveillance were conducted within a 31,000-square-mile area in and around SRS that includes neighboring cities, towns, and counties in Georgia and South Carolina and extends up to 100 miles from the site. Though the environmental monitoring program was streamlined in 1996-to improve its cost-effectiveness without compromising data quality or reducing its overall ability to produce critical information-thousands of samples of air, surface water, groundwater, food products, drinking water, wildlife, rainwater, soil, sediment, and vegetation were collected and analyzed for radioactive and nonradioactive contaminants

[Quality system Vision 2000].

Science.gov (United States)

Pasini, Evasio; Pitocchi, Oreste; de Luca, Italo; Ferrari, Roberto

2002-12-01

A recent document of the Italian Ministry of Health points out that all structures which provide services to the National Health System should implement a Quality System according to the ISO 9000 standards. Vision 2000 is the new version of the ISO standard. Vision 2000 is less bureaucratic than the old version. The specific requests of the Vision 2000 are: a) to identify, to monitor and to analyze the processes of the structure, b) to measure the results of the processes so as to ensure that they are effective, d) to implement actions necessary to achieve the planned results and the continual improvement of these processes, e) to identify customer requests and to measure customer satisfaction. Specific attention should be also dedicated to the competence and training of the personnel involved in the processes. The principles of the Vision 2000 agree with the principles of total quality management. The present article illustrates the Vision 2000 standard and provides practical examples of the implementation of this standard in cardiological departments.

State heating oil and propane program. Final report, 1995--1996

International Nuclear Information System (INIS)

Rizzolo, D.R.

1997-01-01

This reports documents the 1995-1996 United States Department of Energy (USDOE) program to monitor No. 2 heating oil and propane prices. Data reported encompass states that are heavily dependent on these products. Twelve surveys were conducted semimonthly to obtain the necessary price information from retail fuel merchants and propane dealers. Surveys began on October 2, 1995 and ended on March 18, 1996. Responses were analyzed to avoid questionable prices. Tables and graphs included in the report reflect the general activity of the prices furnished during the surveys. 3 figs., 2 tabs

Vision for city gas business management up to the year of 2000

Energy Technology Data Exchange (ETDEWEB)

Araki, Mutsuo

1988-03-01

Summary of the VISION FOR MANAGEMENT UP TO 2000 and the related main subjects practiced are reported. The MULTIPLE ENERGY ERA of competition for the same demand among vairous kinds of energy has started. Increase in the demand rate of 3.6%/year is expected for city gas in urban areas. The NATURAL GAS BIG PROJECT (introduction of LNG, construction of main lines for natural gas transportation, change in the amount of heat by natural gas) is now expected to be completed in October which will materialize a drastic rationalization of the NETWORK SYSTEM. Reconstruction of ENERGY UTILIZATION SYSTEM to conform with the rationalization is required in the future. As examples of executing the 2000 VISION, reports are made on radical enterprise reform, establishment of research system (establishment of URBAN LIFE RESEARCH LABORATORY), development of residence reform business, new business in food industry, and establishment of strategical organizations.

Radiation practices 1996

International Nuclear Information System (INIS)

Havukainen, R.

1997-05-01

At the end of 1996, there were 1,762 valid safety licences in Finland for the use of radiation. In addition, there were 2,052 responsible parties for dental x-ray diagnostics. The registry of the Finnish Centre for Radiation and Nuclear Safety listed 13,360 radiation sources and 313 radionuclide laboratories. The import of radioactive substances amounted to 1.14 x 10 +16 Bq and export to 7.78 x 10 +13 Bq. A total of 4.02 x 10 +13 Bq of short-lived radionuclides were produced in Finland. There were 11,842 workers monitored for radiation exposure at 1,352 work sites. Of these employees, 27% received an annual dose exceeding the recording level. The total dose recorded in the dose registry (sum of individual dosimeter readings) was 7.96 manSv in 1996, with nuclear power plant workers accounting for 69% of this total. The annual dosimeter reading of ten medical doctors (radiologists, interventional radiologists and cardiologists) and eight nuclear power plant employees was equal to or in excess of 20 mSv. Effective doses, however, did not exceed the dose limit of 50 mSv established for one-year monitoring periods. The sum of dosimeter readings (depth dose) on the lead-rubber apron of one interventional radiologist was 242 mSv. It was verified that the annual dose limit for the lens of the eye, 150 mSv, had been exceeded in this case. This high dose was caused by the fact that the radiologist had carried out multiple examinations where unusually high exposure to radiation was an unavoidable part of the task. Report was made of 12 incidents of anomalies in the use of radiation. None of these proved to have caused significant radiation exposure to the radiation source operators. Five of these cases occurred in radiotherapy, three in use of a radiation source in industry, three in transport of radiation sources and one in use of solarium appliances. Radiation-contaminated material was found in 17 shipments of scrap. (orig.)

Radiation practices 1996

Energy Technology Data Exchange (ETDEWEB)

Havukainen, R. [ed.

1997-05-01

At the end of 1996, there were 1,762 valid safety licences in Finland for the use of radiation. In addition, there were 2,052 responsible parties for dental x-ray diagnostics. The registry of the Finnish Centre for Radiation and Nuclear Safety listed 13,360 radiation sources and 313 radionuclide laboratories. The import of radioactive substances amounted to 1.14 x 10{sup +16} Bq and export to 7.78 x 10{sup +13} Bq. A total of 4.02 x 10{sup +13} Bq of short-lived radionuclides were produced in Finland. There were 11,842 workers monitored for radiation exposure at 1,352 work sites. Of these employees, 27% received an annual dose exceeding the recording level. The total dose recorded in the dose registry (sum of individual dosimeter readings) was 7.96 manSv in 1996, with nuclear power plant workers accounting for 69% of this total. The annual dosimeter reading of ten medical doctors (radiologists, interventional radiologists and cardiologists) and eight nuclear power plant employees was equal to or in excess of 20 mSv. Effective doses, however, did not exceed the dose limit of 50 mSv established for one-year monitoring periods. The sum of dosimeter readings (depth dose) on the lead-rubber apron of one interventional radiologist was 242 mSv. It was verified that the annual dose limit for the lens of the eye, 150 mSv, had been exceeded in this case. This high dose was caused by the fact that the radiologist had carried out multiple examinations where unusually high exposure to radiation was an unavoidable part of the task. Report was made of 12 incidents of anomalies in the use of radiation. None of these proved to have caused significant radiation exposure to the radiation source operators. Five of these cases occurred in radiotherapy, three in use of a radiation source in industry, three in transport of radiation sources and one in use of solarium appliances. Radiation-contaminated material was found in 17 shipments of scrap. (orig.)

Seismicity Catalog Collection, 2150 BC to 1996 AD

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The Seismicity Catalog Collection is a compilation data on over four million earthquakes dating from 2150 BC to 1996 AD from NOAA's National Geophysical Data Center...

Introduction of a super speed network in JNC

International Nuclear Information System (INIS)

Nosaki, Nobuhisa; Aoki, Kazuhisa; Narita, Nobuiku

2002-01-01

The construction of a super speed and broadband network with high cost performance is now possible through the resent remarkable development of information-communication technologies. Under such circumstances, the modification of LAN and WAN to the super speed network was required in accordance with the recent network demand in JNC. The trend of the information-communication technologies and the needs of information-communication infrastructure were reviewed as the first step. A modification of WAN to the super speed network with high cost performance was established in fiscal year 2000. This paper introduces the work procedures and the modification of the WAN in order to acquire a reduction in the running cost and the super speed network in the fiscal year. (author)

Summaries of FY 1996 engineering research

Energy Technology Data Exchange (ETDEWEB)

NONE

1997-06-01

This report documents the Basic Energy Sciences (BES) Engineering Research Program for fiscal year 1996; it provides a summary for each of the program projects in addition to a brief program overview. The report is intended to provide staff of Congressional committees, other executive departments, and other DOE offices with substantive program information so as to facilitate governmental overview and coordination of Federal research programs. Of equal importance, its availability facilitates communication of program information to interested research engineers and scientists. Each BES Division administers basic, mission oriented research programs in the area indicated by its title. The BES Engineering Research Program is one such program; it is administered by the Engineering and Geosciences Division of BES. In preparing this report the principal investigators were asked to submit summaries for their projects that were specifically applicable to fiscal year 1996. The summaries received have been edited if necessary, but the press for timely publication made it impractical to have the investigators review and approve the revised summaries prior to publication. For more information about a given project, it is suggested that the investigators be contacted directly.

The Copenhagen Forum 1996-2016

DEFF Research Database (Denmark)

Ry Nielsen, Jens Carl; Raine, John

2016-01-01

Purpose: This chapter tells the story of the initiation, development (over two decades) and collective contribution of the Copenhagen Forum since its foundation in 1996. This Forum comprises a grouping of teachers and directors of masters-level public administrative programmes (notably the MPA) f...... the inspiration for this volume, and the individual contributions, derive. It is a context that has been all about a shared fascination with, and collective commitment to, the advancement of learning and development among practicing public managers....

Estimates and Predictions of Methane Emissions from Wastewater in China from 2000 to 2020

Science.gov (United States)

Du, Mingxi; Zhu, Qiuan; Wang, Xiaoge; Li, Peng; Yang, Bin; Chen, Huai; Wang, Meng; Zhou, Xiaolu; Peng, Changhui

2018-02-01

Methane accounts for 20% of the global warming caused by greenhouse gases, and wastewater is a major anthropogenic source of methane. Based on the Intergovernmental Panel on Climate Change greenhouse gas inventory guidelines and current research findings, we calculated the amount of methane emissions from 2000 to 2014 that originated from wastewater from different provinces in China. Methane emissions from wastewater increased from 1349.01 to 3430.03 Gg from 2000 to 2014, and the mean annual increase was 167.69 Gg. The methane emissions from industrial wastewater treated by wastewater treatment plants (EIt) accounted for the highest proportion of emissions. We also estimated the future trend of industrial wastewater methane emissions using the artificial neural network model. A comparison of the emissions for the years 2020, 2010, and 2000 showed an increasing trend in methane emissions in China and a spatial transition of industrial wastewater emissions from eastern and southern regions to central and southwestern regions and from coastal regions to inland regions. These changes were caused by changes in economics, demographics, and relevant policies.

2000 Annual report: synthesis

International Nuclear Information System (INIS)

2001-01-01

This synthesis of the Annual Report 2000 present information of the main activities on the scope of the radiation protection and nuclear safety of the Nuclear Regulatory Authority (NRA) of the Argentina during 2000

Annual report 1996

Energy Technology Data Exchange (ETDEWEB)

Chmielewska, D.; Infeld, E.; Zupranski, P. [eds.

1997-12-31

In the presented report the research activities of the Soltan Institute for Nuclear Studies (SINS) in year 1996 are described. The report is divided into parts in which the research in SINS departments and laboratories are described and namely in: Department of Nuclear Reactions, Department of Nuclear Spectroscopy and Technique, Department of Nuclear Electronics, Department of Radiation Shielding and Dosimetry, Department of Plasma Physics and Technology, Department of High Energy Physics, Department of Cosmic Radiation Physics, Department of Atomic Nucleus Theory, Department of Radiation Detectors, Department of Accelerator Physics and Technology, Sections for Standards and Patents and Establishment for Nuclear Equipment. All sections include an introduction in which whole of mentioned department activity is briefly presented. Additionally the information about: list of personnel, seminars held at the department and published papers is given.

Annual report 1996

International Nuclear Information System (INIS)

Chmielewska, D.; Infeld, E.; Zupranski, P.

1997-01-01

In the presented report the research activities of the Soltan Institute for Nuclear Studies (SINS) in year 1996 are described. The report is divided into parts in which the research in SINS departments and laboratories are described and namely in: Department of Nuclear Reactions, Department of Nuclear Spectroscopy and Technique, Department of Nuclear Electronics, Department of Radiation Shielding and Dosimetry, Department of Plasma Physics and Technology, Department of High Energy Physics, Department of Cosmic Radiation Physics, Department of Atomic Nucleus Theory, Department of Radiation Detectors, Department of Accelerator Physics and Technology, Sections for Standards and Patents and Establishment for Nuclear Equipment. All sections include an introduction in which whole of mentioned department activity is briefly presented. Additionally the information about: list of personnel, seminars held at the department and published papers is given

CY2000 Hanford Site Mixed Waste Land Disposal Restrictions Report Vol. 1 Storage Report and Vol 2: Characterization and Treatment Report [SEC 1 thru SEC 4

International Nuclear Information System (INIS)

MCDONALD, K.M.

2001-01-01

This volume presents information about the storage and minimization of mixed waste and potential sources for the generation of additional mixed waste. This information is presented in accordance with Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement) (Ecology et al. 1996) Milestone M-26-01K. It is Volume 1 of a two-volume report on the status of Hanford Site land-disposal-restricted mixed waste, other mixed waste, and other waste that the parties have agreed to include in this report. This volume also contains the approval page for both volumes and assumptions, accomplishments, and some other information that also pertains to waste characterization and treatment, which are addressed in Volume 2. Appendix A lists the land disposal restriction (LDR) reporting requirements and explains where they are addressed in this report. The reporting period for this document is from January 1, 2000, to December 31, 2000

Filtering in Hybrid Dynamic Bayesian Networks

Science.gov (United States)

Andersen, Morten Nonboe; Andersen, Rasmus Orum; Wheeler, Kevin

2000-01-01

We implement a 2-time slice dynamic Bayesian network (2T-DBN) framework and make a 1-D state estimation simulation, an extension of the experiment in (v.d. Merwe et al., 2000) and compare different filtering techniques. Furthermore, we demonstrate experimentally that inference in a complex hybrid DBN is possible by simulating fault detection in a watertank system, an extension of the experiment in (Koller & Lerner, 2000) using a hybrid 2T-DBN. In both experiments, we perform approximate inference using standard filtering techniques, Monte Carlo methods and combinations of these. In the watertank simulation, we also demonstrate the use of 'non-strict' Rao-Blackwellisation. We show that the unscented Kalman filter (UKF) and UKF in a particle filtering framework outperform the generic particle filter, the extended Kalman filter (EKF) and EKF in a particle filtering framework with respect to accuracy in terms of estimation RMSE and sensitivity with respect to choice of network structure. Especially we demonstrate the superiority of UKF in a PF framework when our beliefs of how data was generated are wrong. Furthermore, we investigate the influence of data noise in the watertank simulation using UKF and PFUKD and show that the algorithms are more sensitive to changes in the measurement noise level that the process noise level. Theory and implementation is based on (v.d. Merwe et al., 2000).

ISOLDE 1996-1999: Preparing for new science opportunities

CERN Multimedia

CERN. Geneva

2014-01-01

1996-1999 was a time in which ISOLDE saw important changes. In order to make space for REX-ISOLDE the experimental hall saw its first extension and first equipment for REX-ISOLDE was installed and commissioned.

Building 2000

International Nuclear Information System (INIS)

Den Ouden, C.; Steemers, T.C.

1992-01-01

This is the first volume of Building 2000, a pilot project of the Commission's R and D-programme 'Solar Energy Applications to Buildings' with the purpose of encouraging the adoption of solar architecture in large buildings. In this first rich illustrated volume the results of the design studies illustrating passive solar architecture in buildings in the European Community are presented in particular for the building categories as mentioned in the subtitle. In a second volume, a similar series of studies is presented for the building categories: office buildings, public buildings and hotels and holiday complexes. Several Design Support Workshops were organized during the Building 2000 programme during which Building 2000 design teams could directly exchange ideas with the various design advice experts represented at these workshops. In the second part of the Building 2000 final report a summary of a selection of many reports is presented (15 papers), as produced by Design Support experts. Most of the design support activities resulted in changes of the various designs, as have been reported by the design teams in the brochures presented in the first part of this book. It is to be expected that design aids and simulation tools for passive solar options, daylighting concepts, comfort criteria etc., will be utilized more frequently in the future. This will result in a better exchange of information between the actual design practitioners and the European R and D community. This technology transfer will result in buildings with a higher quality with respect to energy and environmental issues

Building 2000

International Nuclear Information System (INIS)

Den Ouden, C.; Steemers, T.C.

1992-01-01

This is the second volume of Building 2000, a pilot project of the Commission's R and D-programme 'Solar Energy Applications to Buildings' with the purpose of encouraging the adoption of solar architecture in large buildings. In this second rich illustrated volume the results of the design studies illustrating passive solar architecture in buildings in the European Community are presented in particular for the building categories as mentioned in the subtitle. In the first volume, a similar series of studies is presented for the building categories: schools, laboratories and universities, and sports and educational centres. Several Design Support Workshops were organized during the Building 2000 programme during which Building 2000 design teams could directly exchange ideas with the various design advice experts represented at these workshops. In the second part of the Building 2000 final report a summary of a selection of many reports is presented (11 papers), as produced by Design Support experts. Most of the design support activities resulted in changes of the various designs, as have been reported by the design teams in the brochures presented in the first part of this book. It is to be expected that design aids and simulation tools for passive solar options, daylighting concepts, comfort criteria etc., will be utilized more frequently in the future. This will result in a better exchange of information between the actual design practitioners and the European R and D community. This technology transfer will result in buildings with a higher quality with respect to energy and environmental issues

Building 2000

Energy Technology Data Exchange (ETDEWEB)

Den Ouden, C [EGM Engineering BV, Dordrecht (Netherlands); Steemers, T C [Commission of the European Communities, Brussels (Belgium)

1992-01-01

This is the second volume of Building 2000, a pilot project of the Commission's R and D-programme 'Solar Energy Applications to Buildings' with the purpose of encouraging the adoption of solar architecture in large buildings. In this second rich illustrated volume the results of the design studies illustrating passive solar architecture in buildings in the European Community are presented in particular for the building categories as mentioned in the subtitle. In the first volume, a similar series of studies is presented for the building categories: schools, laboratories and universities, and sports and educational centres. Several Design Support Workshops were organized during the Building 2000 programme during which Building 2000 design teams could directly exchange ideas with the various design advice experts represented at these workshops. In the second part of the Building 2000 final report a summary of a selection of many reports is presented (11 papers), as produced by Design Support experts. Most of the design support activities resulted in changes of the various designs, as have been reported by the design teams in the brochures presented in the first part of this book. It is to be expected that design aids and simulation tools for passive solar options, daylighting concepts, comfort criteria etc., will be utilized more frequently in the future. This will result in a better exchange of information between the actual design practitioners and the European R and D community. This technology transfer will result in buildings with a higher quality with respect to energy and environmental issues.

Building 2000

Energy Technology Data Exchange (ETDEWEB)

Den Ouden, C [EGM Engineering BV, Dordrecht (Netherlands); Steemers, T C [Commission of the European Communities, Brussels (Belgium)

1992-01-01

This is the first volume of Building 2000, a pilot project of the Commission's R and D-programme 'Solar Energy Applications to Buildings' with the purpose of encouraging the adoption of solar architecture in large buildings. In this first rich illustrated volume the results of the design studies illustrating passive solar architecture in buildings in the European Community are presented in particular for the building categories as mentioned in the subtitle. In a second volume, a similar series of studies is presented for the building categories: office buildings, public buildings and hotels and holiday complexes. Several Design Support Workshops were organized during the Building 2000 programme during which Building 2000 design teams could directly exchange ideas with the various design advice experts represented at these workshops. In the second part of the Building 2000 final report a summary of a selection of many reports is presented (15 papers), as produced by Design Support experts. Most of the design support activities resulted in changes of the various designs, as have been reported by the design teams in the brochures presented in the first part of this book. It is to be expected that design aids and simulation tools for passive solar options, daylighting concepts, comfort criteria etc., will be utilized more frequently in the future. This will result in a better exchange of information between the actual design practitioners and the European R and D community. This technology transfer will result in buildings with a higher quality with respect to energy and environmental issues.

The Beginner’s Guide to Nation-Building

Science.gov (United States)

2007-01-01

1979–1996 Guatemala 1997–1999 1962–1996 Nigeria 1999–2001 1966–1999 Peru 2000–2002 1980–2000 Uruguay 2000–2001 1973–1985 Panama 2001–2002 1968–1989...chronic illnesses such as diabetes and heart disease. To deliver these services, the inter- vening authorities, host government, and ministry of health