Dynamics of Foreign Operations Modes and Their Combinations

DEFF Research Database (Denmark)

Benito, Gabriel R. G.; Petersen, Bent; Welch, Lawrence S.

Companies’ choice of foreign operation modes (FOM) has been a core subject of international business studies basically from its beginning (Hymer, 1960 [1976]; Root, 1964). A halfcentury of research has brought us a set of established perspectives on companies’ foreign operation mode choices...

Modeling Operating Modes for the Monju Nuclear Power Plant

DEFF Research Database (Denmark)

Lind, Morten; Yoshikawa, H.; Jørgensen, Sten Bay

2012-01-01

of the process plant, its function and its structural elements. The paper explains how the means-end concepts of MFM can be used to provide formalized definitions of plant operation modes. The paper will introduce the mode types defined by MFM and show how selected operation modes can be represented...

Startup methods for single-mode gyrotron operation

International Nuclear Information System (INIS)

Whaley, D.R.; Tran, M.Q.; Alberti, S.; Tran, T.M.; Antonsen, T.M.; Tran, C.

1995-03-01

Experimental results of startup studies on a 118 GHz TE 22,6 gyrotron are presented and compared with theory. The theoretical excitation regimes of competing modes are computed in the energy-velocity-pitch-angle plane near the operation point. The startup paths through the plane are determined by the time evolution of the beam parameters during the startup phase. These startup paths are modified by changing the anode and cathode voltage rise from zero to their nominal values and are seen to determine the cavity oscillating mode. Experimental results show specifically that competition between the TE 22,6 and TE -19,7 mode can be completely eliminated by using the proper startup method in a case where a typical triode startup results in oscillation in the competing TE -19,7 mode. These new results are shown to be in excellent agreement with theory whose approach is general and therefore applicable to gyrotrons operating in any arbitrary cavity mode. (author) 5 figs., 1 tab., 13 refs

CMOS Current-mode Operational Amplifier

OpenAIRE

Kaulberg, Thomas

1992-01-01

A fully differential-input differential-output current-mode operational amplifier (COA) is described. The amplifier utilizes three second generation current-conveyors (CCII) as the basic building blocks. It can be configured to provide either a constant gain-bandwidth product in a fully balanced current-mode feedback amplifier or a constant bandwidth in a transimpedance feedback amplifier. The amplifier is found to have a gain bandwidth product of 8 MHz, an offset current of 0.8 ¿A (signal-r...

33 CFR 334.410 - Albemarle Sound, Pamlico Sound, and adjacent waters, NC; danger zones for naval aircraft operations.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Albemarle Sound, Pamlico Sound... AND RESTRICTED AREA REGULATIONS § 334.410 Albemarle Sound, Pamlico Sound, and adjacent waters, NC; danger zones for naval aircraft operations. (a) Target areas—(1) North Landing River (Currituck Sound...

Modifications needed to operate PWR's plants in G-Mode

International Nuclear Information System (INIS)

Stainman, J.P.

1985-01-01

The production of electricity from PWR nuclear plants represents 44% of the total production of electricity in France for 1984, and 68% of the electricity produced by Thermal power plants (127 TWh over 187 TWh). These data show clearly that the French PWR plants do not work in ''base mode'' anymore but have to fit production with consumption, in other words to assume the frequency control. To participate permanently to the load follow and frequency control, it appeared that some improvements in the field of pressurizer level and pressure control were necessary as well as in the field of operator aids computer. It should be noted that these improvements are useful even without taking into account the constraints due to load follow and frequency control because of the mechanical stress in the CVCS piping, for instance. Some additional tests are planned to better identify this specific problem. The need of a more flexible operating mode than ones given by the initial system (black control rods), significantly reduced in 1973 due to the application of the ECCS criterion, led EDF and Framatome to develop a new operating mode (G. Mode) allowing a faster power escalation (5% PN/mn) whatever the fuel burn-up. This new operating mode improves significantly also the flexibility of operation when the frequency control is needed, and helps a lot the operators in such cases. All the 900 MWe Nuclear plants will be able to operate in ''G mode'' before the end of 1984

Language Differences and Operation Mode

DEFF Research Database (Denmark)

Dasi, Angels; Pedersen, Torben

2013-01-01

Language serves different purposes depending on the international activity in question. Language has many dimensions and firms’ communicative requirements vary by operational platform. We argue that different dimensions of language vary in their importance depending on the operation mode chosen...... for a foreign market, so that language distance matters in the case of a home-based sales force, while language incidence is key when operating through a local agent. The hypotheses are tested on a large data set encompassing 462 multinational corporations headquartered in Finland, South Korea, New Zealand......, and Sweden that have undertaken a business operation in a foreign country....

The quiescent H-mode regime for high performance edge localized mode-stable operation in future burning plasmas

Energy Technology Data Exchange (ETDEWEB)

Garofalo, A. M., E-mail: garofalo@fusion.gat.com; Burrell, K. H.; Meneghini, O.; Osborne, T. H.; Paz-Soldan, C.; Smith, S. P.; Snyder, P. B.; Turnbull, A. D. [General Atomics, P.O. Box 85608, San Diego, California 92186-5608 (United States); Eldon, D.; Grierson, B. A.; Solomon, W. M. [Princeton Plasma Physics Laboratory, P.O. Box 451, Princeton, New Jersey 08543-0451 (United States); Hanson, J. M. [Columbia University, 2960 Broadway, New York, New York 10027-6900 (United States); Holland, C. [University of California San Diego, 9500 Gilman Dr., La Jolla, California 92093-0417 (United States); Huijsmans, G. T. A.; Liu, F.; Loarte, A. [ITER Organization, Route de Vinon sur Verdon, 13067 St Paul Lez Durance (France); Zeng, L. [University of California Los Angeles, P.O. Box 957099, Los Angeles, California 90095-7099 (United States)

2015-05-15

For the first time, DIII-D experiments have achieved stationary quiescent H-mode (QH-mode) operation for many energy confinement times at simultaneous ITER-relevant values of beta, confinement, and safety factor, in an ITER-like shape. QH-mode provides excellent energy confinement, even at very low plasma rotation, while operating without edge localized modes (ELMs) and with strong impurity transport via the benign edge harmonic oscillation (EHO). By tailoring the plasma shape to improve the edge stability, the QH-mode operating space has also been extended to densities exceeding 80% of the Greenwald limit, overcoming the long-standing low-density limit of QH-mode operation. In the theory, the density range over which the plasma encounters the kink-peeling boundary widens as the plasma cross-section shaping is increased, thus increasing the QH-mode density threshold. The DIII-D results are in excellent agreement with these predictions, and nonlinear magnetohydrodynamic analysis of reconstructed QH-mode equilibria shows unstable low n kink-peeling modes growing to a saturated level, consistent with the theoretical picture of the EHO. Furthermore, high density operation in the QH-mode regime has opened a path to a new, previously predicted region of parameter space, named “Super H-mode” because it is characterized by very high pedestals that can be more than a factor of two above the peeling-ballooning stability limit for similar ELMing H-mode discharges at the same density.

Piezoelectric energy harvesting through shear mode operation

International Nuclear Information System (INIS)

Malakooti, Mohammad H; Sodano, Henry A

2015-01-01

Piezoelectric materials are excellent candidates for use in energy harvesting applications due to their high electromechanical coupling properties that enable them to convert input mechanical energy into useful electric power. The electromechanical coupling coefficient of the piezoelectric material is one of the most significant parameters affecting energy conversion and is dependent on the piezoelectric mode of operation. In most piezoceramics, the d 15 piezoelectric shear coefficient is the highest coefficient compared to the commonly used axial and transverse modes that utilize the d 33 and the d 31 piezoelectric strain coefficients. However, complicated electroding methods and challenges in evaluating the performance of energy harvesting devices operating in the shear mode have slowed research in this area. The shear deformation of a piezoelectric layer can be induced in a vibrating sandwich beam with a piezoelectric core. Here, a model based on Timoshenko beam theory is developed to predict the electric power output from a cantilever piezoelectric sandwich beam under base excitations. It is shown that the energy harvester operating in the shear mode is able to generate ∼50% more power compared to the transverse mode for a numerical case study. Reduced models of both shear and transverse energy harvesters are obtained to determine the optimal load resistance in the system and perform an efficiency comparison between two models with fixed and adaptive resistances. (paper)

A Current-Mode Common-Mode Feedback Circuit (CMFB) with Rail-to-Rail Operation

Science.gov (United States)

Suadet, Apirak; Kasemsuwan, Varakorn

2011-03-01

This paper presents a current-mode common-mode feedback (CMFB) circuit with rail-to-rail operation. The CMFB is a stand-alone circuit, which can be connected to any low voltage transconductor without changing or upsetting the existing circuit. The proposed CMFB employs current mirrors, operating as common-mode detector and current amplifier to enhance the loop gain of the CMFB. The circuit employs positive feedback to enhance the output impedance and gain. The circuit has been designed using a 0.18 μm CMOS technology under 1V supply and analyzed using HSPICE with BSIM3V3 device models. A pseudo-differential amplifier using two common sources and the proposed CMFB shows rail to rail output swing (± 0.7 V) with low common-mode gain (-36 dB) and power dissipation of 390 μW.

CMOS Current-mode Operational Amplifier

DEFF Research Database (Denmark)

Kaulberg, Thomas

1992-01-01

current-mode feedback amplifier or a constant bandwidth in a transimpedance feedback amplifier. The amplifier is found to have a gain bandwidth product of 8 MHz, an offset current of 0.8 ¿A (signal-range ±700¿A) and a (theoretically) unlimited slew-rate. The amplifier is realized in a standard CMOS 2......A fully differential-input differential-output current-mode operational amplifier (COA) is described. The amplifier utilizes three second generation current-conveyors (CCII) as the basic building blocks. It can be configured to provide either a constant gain-bandwidth product in a fully balanced...

Multi-mode operations for on-line uninterruptible power supply

DEFF Research Database (Denmark)

Lu, Jinghang; Savaghebi, Mehdi; Guan, Yajuan

2018-01-01

In this paper, the multi-mode operation of the on-line UPS system is investigated and corresponding control strategies are proposed. The proposed control strategies are able to achieve the seamless transition in traditional normal mode, PV-aided normal mode, enhanced eco-mode and burn-in test mod...

Analysis of a large-break LOCA at lower operational modes

Energy Technology Data Exchange (ETDEWEB)

Jeong, H.Y.; Jun, H.Y.; Lee, K. [Korea Electric Power Corporation, Taejon (Korea)

2000-10-01

To improve Technical Specifications and Emergency Operating Guidelines (EOGs) applicable at lower operational modes it is required to perform the safety analysis reflecting the operational characteristics in those modes. Because the component availability and system configurations at lower modes are different from those of power mode, the plant safety at lower modes should be confirmed through independent analyses. In the present study, a large-break loss-of-coolant accident is analyzed to evaluate the containment pressure and temperature control function for the preparation of EOGs applicable at lower modes. To reach the required shutdown condition, the plant cool-down is controlled by the secondary steam flow and auxiliary feedwater. The mass and energy releases from primary system are obtained from RELAP5/MOD3.1 calculation and the containment pressure and temperature are evaluated with CONTEMPT-LT code. The reference plant is Korean Next Generation Reactor having 4,000 MW thermal power. Two cases of cold leg LOCA initiated at Mode 3 with and without SIT operation are calculated. At the given plant conditions, all safety injection pumps are still available. The calculation at the condition of maximum mass and energy release shows that the containment pressure and temperature can be controlled within acceptable criteria, which means the operations of 2 or 4 fan coolers are the possible success paths to achieve the containment P/T control safety function. The peak cladding temperature with minimum safety injection flow does not show remarkable excursion, which implies the lower mode LOCA at Mode 3 can be bounded by the results obtained at full power from the viewpoint of ECCS performance. (author)

Characterization of pseudosingle bunch kick-and-cancel operational mode

Science.gov (United States)

Sun, C.; Robin, D. S.; Steier, C.; Portmann, G.

2015-12-01

Pseudosingle-bunch kick-and-cancel (PSB-KAC) is a new operational mode at the Advanced Light Source of Lawrence Berkeley National Laboratory that provides full timing and repetition rate control for single x-ray pulse users while being fully transparent to other users of synchrotron radiation light. In this operational mode, a single electron bunch is periodically displaced from a main bunch train by a fast kicker magnet with a user-on-demand repetition rate, creating a single x-ray pulse to be matched to a typical laser excitation pulse rate. This operational mode can significantly improve the signal to noise ratio of single x-ray pulse experiments and drastically reduce dose-induced sample damage rate. It greatly expands the capabilities of synchrotron light sources to carry out dynamics and time-of-flight experiments. In this paper, we carry out extensive characterizations of this PSB-KAC mode both numerically and experimentally. This includes the working principle of this mode, resonance conditions and beam stability, experimental setups, and diagnostic tools and measurements.

Characterization of pseudosingle bunch kick-and-cancel operational mode

Directory of Open Access Journals (Sweden)

C. Sun

2015-12-01

Full Text Available Pseudosingle-bunch kick-and-cancel (PSB-KAC is a new operational mode at the Advanced Light Source of Lawrence Berkeley National Laboratory that provides full timing and repetition rate control for single x-ray pulse users while being fully transparent to other users of synchrotron radiation light. In this operational mode, a single electron bunch is periodically displaced from a main bunch train by a fast kicker magnet with a user-on-demand repetition rate, creating a single x-ray pulse to be matched to a typical laser excitation pulse rate. This operational mode can significantly improve the signal to noise ratio of single x-ray pulse experiments and drastically reduce dose-induced sample damage rate. It greatly expands the capabilities of synchrotron light sources to carry out dynamics and time-of-flight experiments. In this paper, we carry out extensive characterizations of this PSB-KAC mode both numerically and experimentally. This includes the working principle of this mode, resonance conditions and beam stability, experimental setups, and diagnostic tools and measurements.

OPERATION MODES AND CHARACTERISTICS OF PLASMA DIPOLE ANTENNA

Directory of Open Access Journals (Sweden)

Nikolay Nikolaevich Bogachev

2014-02-01

Full Text Available Existence modes of  surface electromagnetic wave on a plasma cylinder, operating modes and characteristics of the plasma antenna were studied in this paper. Solutions of the dispersion equation of surface wave were obtained for a plasma cylinder with finite radius for different plasma density values. Operation modes of the plasma asymmetric dipole antenna with finite length and radius were researched by numerical simulation. The electric field distributions of  the plasma antenna in near antenna field and the radiation pattern were obtained. These characteristics were compared to characteristics of the similar metal antenna. Numerical models verification was carried out by comparing of the counted and measured metal antenna radiation patterns.

Optimal mode of operation for biomass production

NARCIS (Netherlands)

Betlem, Ben H.L.; Roffel, Brian; Mulder, P.

2002-01-01

The rate of biomass production is optimised for a predefined feed exhaustion using the residue ratio as a degree of freedom. Three modes of operation are considered: continuous, repeated batch, and repeated fed-batch operation. By means of the Production Curve, the transition points of the optimal

Mixed-mode Operating System for Real-time Performance

OpenAIRE

M.M. Hasan; S. Sultana; C.K. Foo

2017-01-01

The purpose of the mixed-mode system research is to handle devices with the accuracy of real-time systems and at the same time, having all the benefits and facilities of a matured Graphic User Interface (GUI) operating system which is typically nonreal-time. This mixed-mode operating system comprising of a real-time portion and a non-real-time portion was studied and implemented to identify the feasibilities and performances in practical applications (in the context of scheduled the real-time...

Mixed - mode Operating System for Real - time Performance

OpenAIRE

Hasan M. M.; Sultana S.; Foo C.K.

2017-01-01

The purpose of the mixed-mode system research is to handle devices with the accuracy of real-time systems and at the same time, having all the benefits and facilities of a matured Graphic User Interface(GUI)operating system which is typicallynon-real-time. This mixed-mode operating system comprising of a real-time portion and a non-real-time portion was studied and implemented to identify the feasibilities and performances in practical applications (in the context of scheduled the real-time e...

Suppression and nonlinear excitation of parasitic modes in second harmonic gyrotrons operating in a very high order mode

International Nuclear Information System (INIS)

Nusinovich, Gregory S.; Pu, Ruifeng; Granatstein, Victor L.

2015-01-01

In recent years, there was an active development of high-power, sub-terahertz (sub-THz) gyrotrons for numerous applications. For example, a 0.67 THz gyrotron delivering more than 200 kW with about 20% efficiency was developed. This record high efficiency was achieved because the gyrotron operated in a high-order TE 31,8 -mode with the power of ohmic losses less than 10% of the power of outgoing radiation. That gyrotron operated at the fundamental cyclotron resonance, and a high magnetic field of about 27 T was created by a pulse solenoid. For numerous applications, it is beneficial to use gyrotrons at cyclotron harmonics which can operate in available cryomagnets with fields not exceeding 15 T. However, typically, the gyrotron operation at harmonics faces severe competition from parasitic modes at the fundamental resonance. In the present paper, we consider a similar 0.67 THz gyrotron designed for operation in the same TE 31,8 -mode, but at the second harmonic. We focus on two nonlinear effects typical for interaction between the fundamental and second harmonic modes, viz., the mode suppression and the nonlinear excitation of the mode at the fundamental harmonic by the second harmonic oscillations. Our study includes both the analytical theory and numerical simulations performed with the self-consistent code MAGY. The simulations show that stable second harmonic operation in the TE 31,8 mode is possible with only modest sacrifice of efficiency and power

The H-mode operational window as determined from the ITER H-mode database

International Nuclear Information System (INIS)

Ryter, F.; Kardaun, O.J.W.F.; Stroth, U.

1994-01-01

The H-mode is a promising regime for fusion reactors and it is essential to be able to predict its operational window in future devices. The 'H-Mode Database Working Group' started in 1992 to gather, analyze and compare H-mode threshold data from several divertor tokamaks so that predictions could be made. The database and first results were presented and the threshold database has been improved and extended since. The work has two objectives: 1) to predict the minimum heating power necessary to reach the H-mode in future devices, 2) to contribute to physics studies of the L-H transition. (author) 11 refs., 2 figs

Intensity modulated operating mode of the rotating gamma system.

Science.gov (United States)

Sengupta, Bishwambhar; Gulyas, Laszlo; Medlin, Donald; Koroknai, Tibor; Takacs, David; Filep, Gyorgy; Panko, Peter; Godo, Bence; Hollo, Tamas; Zheng, Xiao Ran; Fedorcsak, Imre; Dobai, Jozsef; Bognar, Laszlo; Takacs, Endre

2018-05-01

The purpose of this work was to explore two novel operation modalities of the rotating gamma systems (RGS) that could expand its clinical application to lesions in close proximity to critical organs at risk (OAR). The approach taken in this study consists of two components. First, a Geant4-based Monte Carlo (MC) simulation toolkit is used to model the dosimetric properties of the RGS Vertex 360™ for the normal, intensity modulated radiosurgery (IMRS), and speed modulated radiosurgery (SMRS) operation modalities. Second, the RGS Vertex 360™ at the Rotating Gamma Institute in Debrecen, Hungary is used to collect experimental data for the normal and IMRS operation modes. An ion chamber is used to record measurements of the absolute dose. The dose profiles are measured using Gafchromic EBT3 films positioned within a spherical water equivalent phantom. A strong dosimetric agreement between the measured and simulated dose profiles and penumbra was found for both the normal and IMRS operation modes for all collimator sizes (4, 8, 14, and 18 mm diameter). The simulated falloff and maximum dose regions agree better with the experimental results for the 4 and 8 mm diameter collimators. Although the falloff regions align well in the 14 and 18 mm collimators, the maximum dose regions have a larger difference. For the IMRS operation mode, the simulated and experimental dose distributions are ellipsoidal, where the short axis aligns with the blocked angles. Similarly, the simulated dose distributions for the SMRS operation mode also adopt an ellipsoidal shape, where the short axis aligns with the angles where the orbital speed is highest. For both modalities, the dose distribution is highly constrained with a sharper penumbra along the short axes. Dose modulation of the RGS can be achieved with the IMRS and SMRS modes. By providing a highly constrained dose distribution with a sharp penumbra, both modes could be clinically applicable for the treatment of lesions in close

A CMOS current-mode operational amplifier

DEFF Research Database (Denmark)

Kaulberg, Thomas

1993-01-01

current-mode feedback amplifier or a constant bandwidth in a transimpedance feedback amplifier. The amplifier is found to have a gain-bandwidth product of 3 MHz, an offset current of 0.8 μA (signal range ±700 μA), and a (theoretically) unlimited slew rate. The amplifier is realized in a standard CMOS 2......A fully differential-input, differential-output, current-mode operational amplifier (COA) is described. The amplifier utilizes three second-generation current conveyors (CCIIs) as the basic building blocks. It can be configured to provide either a constant gain-bandwidth product in a fully balanced...

Multi-operational tuneable Q-switched mode-locking Er fibre laser

Science.gov (United States)

Qamar, F. Z.

2018-01-01

A wavelength-spacing tuneable, Q-switched mode-locking (QML) erbium-doped fibre laser based on non-linear polarization rotation controlled by four waveplates and a cube polarizer is proposed. A mode-locked pulse train using two quarter-wave plates and a half-wave plate (HWP) is obtained first, and then an extra HWP is inserted into the cavity to produce different operation regimes. The evolutions of temporal and spectral dynamics with different orientation angles of the extra HWP are investigated. A fully modulated stable QML pulse train is observed experimentally. This is, to the author’s best knowledge, the first experimental work reporting QML operation without adding an extra saturable absorber inside the laser cavity. Multi-wavelength pulse laser operation, multi-pulse train continuous-wave mode-locking operation and pulse-splitting operations are also reported at certain HWP angles. The observed operational dynamics are interpreted as a mutual interaction of dispersion, non-linear effect and insertion loss. This work provides a new mechanism for fabricating cheap tuneable multi-wavelength lasers with QML pulses.

C5 capsule operation modes analysis

International Nuclear Information System (INIS)

Negut, Gh.; Ancuta, Mirela; Stefan, Violeta

2008-01-01

This paper is part of the Nuclear Research Institute Program 13 dedicated to 'TRIGA Research Reactor performance enhancing' and its objective is improving the engineering of the structural materials irradiation. The paper raises the knowledge level on C5 capsule irradiation modes and utilizes previous results in order to increase C5 performances. In the paper the irradiation modes to test zirconium yttrium sample are assessed. These tests are proposed by AECL. There are presented the C5 initial conditions and models. Also. there are presented the thermal hydraulic conditions during normal and accidental operation. The results will be used in the C5 safety report. (authors)

Startup methods for single-mode gyrotron operation

International Nuclear Information System (INIS)

Whaley, D.R.; Tran, M.Q.; Alberti, S.; Tran, T.M.; Antonsen, T.M. Jr.; Dubrovin, A.; Tran, C.

1995-01-01

Experimental results of startup studies on a 118 GHz TE 22,6 gyrotron are presented and compared with theory. The startup paths through the energy-velocity-pitch-angle plane are determined by the time evolution of the beam parameters during the startup phase. These startup paths are modified by changing the anode and cathode voltage rise from zero to their nominal values and are seen to determine the cavity oscillating mode. Experimental results show specifically that competition between the TE 22,6 and TE -19,7 mode can be completely eliminated by use of the proper startup method in a case where a typical triode startup results in oscillation in the competing TE -19,7 mode. These new results are shown to be in excellent agreement with the theory whose approach is general and therefore applicable to gyrotrons operating in any arbitrary cavity mode. (author) 3 figs., 4 refs

33 CFR 80.525 - Cape Lookout, NC to Cape Fear, NC.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cape Lookout, NC to Cape Fear, NC... INTERNATIONAL NAVIGATION RULES COLREGS DEMARCATION LINES Fifth District § 80.525 Cape Lookout, NC to Cape Fear... southeast side of the Inlet. (g) Except as provided elsewhere in this section from Cape Lookout to Cape Fear...

Online probabilistic operational safety assessment of multi-mode engineering systems using Bayesian methods

International Nuclear Information System (INIS)

Lin, Yufei; Chen, Maoyin; Zhou, Donghua

2013-01-01

In the past decades, engineering systems become more and more complex, and generally work at different operational modes. Since incipient fault can lead to dangerous accidents, it is crucial to develop strategies for online operational safety assessment. However, the existing online assessment methods for multi-mode engineering systems commonly assume that samples are independent, which do not hold for practical cases. This paper proposes a probabilistic framework of online operational safety assessment of multi-mode engineering systems with sample dependency. To begin with, a Gaussian mixture model (GMM) is used to characterize multiple operating modes. Then, based on the definition of safety index (SI), the SI for one single mode is calculated. At last, the Bayesian method is presented to calculate the posterior probabilities belonging to each operating mode with sample dependency. The proposed assessment strategy is applied in two examples: one is the aircraft gas turbine, another is an industrial dryer. Both examples illustrate the efficiency of the proposed method

Based on Intelligent Robot of E-business Distribution Center Operation Mode Research

Directory of Open Access Journals (Sweden)

Li Juntao

2016-01-01

Full Text Available According to E-business distribution center operation mode in domestic and advanced experience drawing lessons at home and abroad, this paper based on intelligent robot researches E-business distribution center operation mode. And it proposes the innovation logistics storage in E-business and sorting integration system, and elaborates its principle, characteristics, as well as studies its business mode and logistics process, and its parameters and working mode of AGV equipment.

New information technologies in operative control of modes in regional electrical power systems

OpenAIRE

ANDREY D. TEVJASHEV; TATJANA B. TIMOFEEVA

2003-01-01

The problem of development of software for management of modes in electrical power systems in connection with casual character of a load in network is considered. The stochastic mathematical model of a system for operating control of modes in regional electrical power systems is offered. The methods for problem solving of operating control and operating planning of operational modes in regional electrical power systems are developed. The application of the developed models and methods will al...

Dual-Mode Operation of an Optical Lattice Clock Using Strontium and Ytterbium Atoms.

Science.gov (United States)

Akamatsu, Daisuke; Kobayashi, Takumi; Hisai, Yusuke; Tanabe, Takehiko; Hosaka, Kazumoto; Yasuda, Masami; Hong, Feng-Lei

2018-06-01

We have developed an optical lattice clock that can operate in dual modes: a strontium (Sr) clock mode and an ytterbium (Yb) clock mode. Dual-mode operation of the Sr-Yb optical lattice clock is achieved by alternately cooling and trapping 87 Sr and 171 Yb atoms inside the vacuum chamber of the clock. Optical lattices for Sr and Yb atoms were arranged with horizontal and vertical configurations, respectively, resulting in a small distance of the order of between the trapped Sr and Yb atoms. The 1 S 0 - 3 P 0 clock transitions in the trapped atoms were interrogated in turn and the clock lasers were stabilized to the transitions. We demonstrated the frequency ratio measurement of the Sr and Yb clock transitions by using the dual-mode operation of the Sr-Yb optical lattice clock. The dual-mode operation can reduce the uncertainty of the blackbody radiation shift in the frequency ratio measurement, because both Sr and Yb atoms share the same blackbody radiation.

ANALYSIS OF OPTIMUM OPERATING MODES OF POWER TRANSFORMERS UNDER OPERATING CONDITIONS

Directory of Open Access Journals (Sweden)

I. V. Khomenko

2016-12-01

Full Text Available Purpose. The study of parallel operation optimal modes of transformer equipment for a variety of operating conditions: same or different types of transformers, with or without reactive power flows. Methodology. Losses of energy in transformers make 30 % of all losses. Therefore the choice of the economically justified parallel operation of transformers is effective action to reduce losses. Typically, in the calculations of reactive power flows in the transformers are not taken into account. It is interesting to analyze the optimal operating conditions of transformers with and without reactive power flows. Results. Calculations for transformers in distribution networks showed that the inclusion of reactive power flows in transformers significant impact on the calculated optimum regimes of transformers.

Modeling Operating Modes for the Monju Nuclear Power Plant

DEFF Research Database (Denmark)

Lind, Morten; Yoshikawa, Hidekazu; Jørgensen, Sten Bay

2012-01-01

The specification of supervision and control tasks in complex processes requires definition of plant states on various levels of abstraction related to plant operation in start-up, normal operation and shut-down. Modes of plant operation are often specified in relation to a plant decomposition in...... for the Japanese fast breeder reactor plant MONJU....

Mixed-mode Operating System for Real-time Performance

Directory of Open Access Journals (Sweden)

M.M. Hasan

2017-11-01

Full Text Available The purpose of the mixed-mode system research is to handle devices with the accuracy of real-time systems and at the same time, having all the benefits and facilities of a matured Graphic User Interface (GUI operating system which is typically nonreal-time. This mixed-mode operating system comprising of a real-time portion and a non-real-time portion was studied and implemented to identify the feasibilities and performances in practical applications (in the context of scheduled the real-time events. In this research an i8751 microcontroller-based hardware was used to measure the performance of the system in real-time-only as well as non-real-time-only configurations. The real-time portion is an 486DX-40 IBM PC system running under DOS-based realtime kernel and the non-real-time portion is a Pentium III based system running under Windows NT. It was found that mixed-mode systems performed as good as a typical realtime system and in fact, gave many additional benefits such as simplified/modular programming and load tolerance.

Analysis of the ITER cryoplant operational modes

International Nuclear Information System (INIS)

Henry, D.; Journeaux, J.Y.; Roussel, P.; Michel, F.; Poncet, J.M.; Girard, A.; Kalinin, V.; Chesny, P.

2007-01-01

In the framework of an EFDA task, CEA is carrying out an analysis of the various ITER cryoplant operational modes. According to the project integration document, ITER is designed to be operated 365 days per year in order to optimize the available time of the Tokamak. It is anticipated that operation will be performed in long periods separated by maintenance periods (e.g. 10 days continuous operation and 1 week break) with annual or bi-annual major shutdown periods of a few months for maintenance, further installation and commissioning. For this operation schedule, auxiliary subsystems like the cryoplant and the cryodistribution have to cope with different heat loads which depend on the different ITER operating states. The cryoplant consists of four identical 4.5 K refrigerators and two 80 K helium loops coupled with two LN2 modules. All of these cryogenic subsystems have to operate in parallel to remove the heat loads from the magnet, 80 K shields, cryopumps and other small users. After a brief recall of the main particularities of a cryogenic system operating in a Tokamak environment, the first part of this study is dedicated to the assessment of the main ITER operation states. A new design of refrigeration loop for the HTS current leads, the updated layout of the cryodistribution system and revised strategy for operations of the cryopumps have been taken into consideration. The relevant normal operating scenarios of the cryoplant are checked for the typical ITER operating states like plasma operation state, short term stand by, short term maintenance, or test and conditioning state. The second part of the paper is dedicated to the abnormal operating modes coming from the magnets and from those generated by the cryoplant itself. The occurrence of a fast discharge or a quench of the magnets generates large heat loads disturbances and produces exceptional high mass flow rates which have to be managed by the cryoplant, while a failure of a cryogenic component induces

33 CFR 117.822 - Beaufort Channel, NC.

Science.gov (United States)

2010-07-01

... DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.822 Beaufort Channel, NC. The... bridge need not open between the hours of 6:30 a.m. to 8 a.m. and 4:30 p.m. to 6 p.m. (b) From 10 p.m. to...

Study on a New Operational Mode of Economic Operation of Islanded Microgrids Using Electric Springs

Directory of Open Access Journals (Sweden)

Zhao Zhiyu

2018-01-01

Full Text Available With the increasing penetration of intermittent renewable energy sources (RESs into microgrids, the original operation mode of power generation determined by load demand faces severe challenges due to the uncertainties of the RESs power output. The electric springs(ESs, as an emerging technology has been verified to be effective in enabling load demand to follow power generation and stabilizing fluctuation of RESs output. This paper presents a new mode of economic operation for island microgrids including non-critical loads with embedded electric springs. Its connotation includes that i the capacity of energy storage can be reduced through the interaction of the energy storage system (ESS and the electric springs, ii the electric springs reduce the stress of peak load regulation and operational cost and iii the demand of microgrids system for ramping ability of generation units is reduced with the buffer of the electric springs. Numerical results show that the coordinated operation between electric springs and energy storage system of microgrids can bring down the investment cost for the ESS and short-term operational cost in the aspect of economic dispatch, reducing requirements for the capacity and ramp ability of the energy storage system in microgrids. Energy buffering can be achieved with lower cost and the load demand can follow power generation in the new operational mode of islanded microgrids using electric springs.

Advances towards QH-mode viability for ELM-stable operation in ITER

International Nuclear Information System (INIS)

Garofalo, A.M.; Burrell, K.H.; DeBoo, J.C.; Schaffer, M.J.; Snyder, P.B.; Solomon, W.M.; Park, J.-K.; Lanctot, M.J.; Reimerdes, H.; McKee, G.R.; Schmitz, L.

2011-01-01

The application of static, non-axisymmetric, nonresonant magnetic fields (NRMFs) to high beta DIII-D plasmas has allowed sustained operation with a quiescent H-mode (QH-mode) edge and both toroidal rotation and neutral beam injected torque near zero. Previous studies have shown that QH-mode operation can be accessed only if sufficient radial shear in the plasma flow is produced near the plasma edge. In past experiments, this flow shear was produced using neutral beam injection (NBI) to provide toroidal torque. In recent experiments, this torque was nearly completely replaced by the torque from applied NRMFs. The application of the NRMFs does not degrade the global energy confinement of the plasma. Conversely, the experiments show that the energy confinement quality increases with lower plasma rotation. Furthermore, the NRMF torque increases plasma resilience to locked modes at low rotation. These results open a path towards QH-mode utilization as an edge-localized mode (ELM)-stable H-mode in the self-heated burning plasma scenario, where toroidal momentum input from NBI may be small or absent.

Comparison of mechanical behavior of TiN, TiNC, CrN/TiNC, TiN/TiNC films on 9Cr18 steel by PVD

Science.gov (United States)

Feng, Xingguo; Zhang, Yanshuai; Hu, Hanjun; Zheng, Yugang; Zhang, Kaifeng; Zhou, Hui

2017-11-01

TiN, TiNC, CrN/TiNC and TiN/TiNC films were deposited on 9Cr18 steel using magnetron sputtering technique. The morphology, composition, chemical state and crystalline structure of the films were observed and analyzed by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) and scanning electron microscopy (SEM). Hardness and adhesion force were tested by nanoindentation and scratch tester, respectively. The friction and wear behavior of TiN, TiNC, CrN/TiNC and TiN/TiNC films sliding against GCr15 balls were investigated and compared synthetically using ball-on-disk tribometer. It was found that Tisbnd N, Tisbnd C, Tisbnd Nsbnd C and Csbnd C bonds were formed. The TiN/TiNC film was composed of TiN, TiC and TiNC phases. Hardness and adhesion force results indicated that although the TiN film possessed the highest hardness, its adhesion force was lowest among all the films. Tribological test results showed that the friction coefficient of TiN/TiNC was much lower than that of TiN and the wear rate decreases remarkably from 2.3 × 10-15 m3/Nm to 7.1 × 10-16 m3/Nm, which indicated the TiN/TiNC film has better wear resistance.

The Radiation Safety Interlock System for Top-Up Mode Operation at NSRRC

CERN Document Server

Chen Chien Rong; Kao, Sheau-Ping; Liu, Joseph; Sheu, Rong-Jiun; Wang, Jau-Ping

2005-01-01

The radiation safety interlock systems of NSRRC have been operated for more than a decade. Some modification actions have been implemented in the past to perfect the safe operation. The machine and its interlock system were originally designed to operate at the decay mode. Recently some improvement programs to make the machine injection from original decay mode to top-up mode at NSRRC has initiated. For users at experimental area the radiation dose resulted from top-up re-fill injections where safety shutters of beam-lines are opened will dominate. In addition to radiation safety action plans such as upgrading the shielding, enlarging the exclusion zones and improving the injection efficiency, the interlock system for top-up operation is the most important to make sure that injection efficiency is acceptable. To ensure the personnel radiation safety during the top-up mode, the safety interlock upgrade and action plans will be implemented. This paper will summarize the original design logic of the safety inter...

Identifying a "default" visual search mode with operant conditioning.

Science.gov (United States)

Kawahara, Jun-ichiro

2010-09-01

The presence of a singleton in a task-irrelevant domain can impair visual search. This impairment, known as the attentional capture depends on the set of participants. When narrowly searching for a specific feature (the feature search mode), only matching stimuli capture attention. When searching broadly (the singleton detection mode), any oddball captures attention. The present study examined which strategy represents the "default" mode using an operant conditioning approach in which participants were trained, in the absence of explicit instructions, to search for a target in an ambiguous context in which one of two modes was available. The results revealed that participants behaviorally adopted the singleton detection as the default mode but reported using the feature search mode. Conscious strategies did not eliminate capture. These results challenge the view that a conscious set always modulates capture, suggesting that the visual system tends to rely on stimulus salience to deploy attention.

Energy and Exergy Performance of three FPSO Operational Modes

DEFF Research Database (Denmark)

Sánchez, Yamid Alberto Carranza; Junior, Silvio de Oliveira; da Silva, Julio Augusto Mendes

2015-01-01

by the FPSO operator. Energy and exergy criteria have been applied to evaluate and compare the performance of components and systems of the three operational modes of the FPSO. The processing and utilities plants have been modeled and simulated by using Aspen HYSYS®. Results indicate that higher oil content...

Mixed enrichment core design for the NC State University PULSTAR Reactor

International Nuclear Information System (INIS)

Mayo, C.W.; Verghese, K.; Huo, Y.G.

1997-12-01

The North Carolina State University PULSTAR Reactor license was renewed for an additional 20 years of operation on April 30, 1997. The relicensing period added additional years to the facility operating time through the end of the second license period, increasing the excess reactivity needs as projected in 1988. In 1995, the Nuclear Reactor Program developed a strategic plan that addressed the future maintenance, development, and utilization of the facility. Goals resulting from this plan included increased academic utilization of the facility in accordance with its role as a university research facility, and increased industrial service use in accordance with the mission of a land grant university. The strategic plan was accepted, and it is the intent of the College of Engineering to operate the PULSTAR Reactor as a going concern through at least the end of the current license period. In order to reach the next relicensing review without prejudice due to low excess reactivity, it is desired to maintain sufficient excess reactivity so that, if relicensed again, the facility could continue to operate without affecting users until new fuel assistance was provided. During the NC State University license renewal, the operation of the PULSTAR Reactor at the State University of New York at Buffalo (SUNY Buffalo) was terminated. At that time, the SUNY Buffalo facility had about 240 unused PULSTAR Reactor fuel pins with 6% enrichment. The objective of the work reported here was to develop a mixed enrichment core design for the NC State University PULSTAR reactor which would: (1) demonstrate that 6% enriched SUNY buffalo fuel could be used in the NC State University PULSTAR Reactor within the existing technical specification safety limits for core physics parameters; (2) show that use of this fuel could permit operating the NC State University PULSTAR Reactor to 2017 with increased utilization; and (3) assure that the decision whether or not to relicense the facility would

Seven Operation Modes and Simulation Models of Solar Heating System with PCM Storage Tank

Directory of Open Access Journals (Sweden)

Juan Zhao

2017-12-01

Full Text Available A physical model and dynamic simulation models of a solar phase-change heat storage heating system with a plate solar collector, phase-change material (PCM storage tank, plate heat exchanger, and auxiliary heat sources were established. A control strategy and numerical models for each of seven different operation modes that cover the entire heating season of the system were developed for the first time. The seven proposed operation modes are Mode 1: free cooling; Mode 2: reservation of heat absorbed by the solar collector in the PCM storage tank when there is no heating demand; Mode 3: direct supply of the heating demand by the solar collector; Mode 4: use of the heat absorbed by the solar collector to meet the heating demands, with the excess heat stored in the PCM storage tank; Mode 5: use of heat stored in the PCM storage tank to meet the heating demands, Mode 6: combined use of heat stored in the PCM storage tank and the auxiliary heating sources to meet the heating demands; and Mode 7: exclusive use of the auxiliary heat sources in order to meet the heating demands. Mathematical models were established for each of the above seven operation modes, taking into consideration the effects of the outdoor meteorological parameters and terminal load on the heating system. The real-time parameters for the entire heating season of the system with respect to the different operation modes can be obtained by solving the simulation models, and used as reference for the optimal design and operation of the actual system.

Symplectic Group Representation of the Two-Mode Squeezing Operator in the Coherent State Basis

Science.gov (United States)

Fan, Hong-Yi; Chen, Jun-Hua

2003-11-01

We find that the coherent state projection operator representation of the two-mode squeezing operator constitutes a loyal group representation of symplectic group, which is a remarkable property of the coherent state. As a consequence, the resultant effect of successively applying two-mode squeezing operators are equivalent to a single squeezing in the two-mode Fock space. Generalization of this property to the 2n-mode case is also discussed. The project supported by National Natural Science Foundation of China under Grant No. 10575057

Laser modes as an eigenfunction of an operator equation

International Nuclear Information System (INIS)

Ripper, J.E.; Campos, M.D.; Pudensi, M.A.A.

A new method is proposed of arriving to an approximate solution into mode problems which cannot be treated by the traditional methods. Basically the idea is to treat the laser mode as an eigenfunction of an operator equation so that the mathematical methods developed to treat the wave equations in quantum mechanics can be used as tools to solve the equation. (L.C.) [pt

Optimal Protection Coordination for Microgrid under Different Operating Modes

Directory of Open Access Journals (Sweden)

Ming-Ta Yang

2013-01-01

Full Text Available Significant consequences result when a microgrid is connected to a distribution system. This study discusses the impacts of bolted three-phase faults and bolted single line-to-ground faults on the protection coordination of a distribution system connected by a microgrid which operates in utility-only mode or in grid-connected mode. The power system simulation software is used to build the test system. The linear programming method is applied to optimize the coordination of relays, and the relays coordination simulation software is used to verify if the coordination time intervals (CTIs of the primary/backup relay pairs are adequate. In addition, this study also proposes a relays protection coordination strategy when the microgrid operates in islanding mode during a utility power outage. Because conventional CO/LCO relays are not capable of detecting high impedance fault, intelligent electrical device (IED combined with wavelet transformer and neural network is proposed to accurately detect high impedance fault and identify the fault phase.

Simulation and Analysis of the Hybrid Operating Mode in ITER

International Nuclear Information System (INIS)

Kessel, C.E.; Budny, R.V.; Indireshkumar, K.

2005-01-01

The hybrid operating mode in ITER is examined with 0D systems analysis, 1.5D discharge scenario simulations using TSC and TRANSP, and the ideal MHD stability is discussed. The hybrid mode has the potential to provide very long pulses and significant neutron fluence if the physics regime can be produced in ITER. This paper reports progress in establishing the physics basis and engineering limitation for the hybrid mode in ITER

Innovative operating modes and techniques for the spaceborne imaging radar-C instrument

Science.gov (United States)

Huneycutt, Bryan L.

1990-01-01

The operation of the spaceborne imaging radar-C (SIR-C) is discussed. The SIR-C instrument has been designed to obtain simultaneous multifrequency and simultaneous multipolarization radar images from a low earth orbit. It is a multiparameter imaging radar which will be flown during at least two different seasons. The instrument has been designed to operate in innovative modes such as the squint alignment mode, the extended aperture mode, the scansar mode, and the interferometry mode. The instrument has been designed to demonstrate innovative engineering techniques such as beam nulling for echo tracking, pulse-repetition frquency hopping for Doppler centroid tracking, generating the frequency step chirp for radar parameter flexibility, block floating point quantizing for data rate compression, and elevation beamwidth broadening for increasing the swath illumination.

Circuit breaker operation and potential failure modes during an earthquake

International Nuclear Information System (INIS)

Lambert, H.E.; Budnitz, R.J.

1987-01-01

This study addresses the effect of a strong-motion earthquake on circuit breaker operation. It focuses on the loss of offsite power (LOSP) transient caused by a strong-motion earthquake at the Zion Nuclear Power Plant. This paper also describes the operator action necessary to prevent core melt if the above circuit breaker failure modes occur simultaneously on three 4.16 KV buses. Numerous circuit breakers important to plant safety, such as circuit breakers to diesel generators and engineered safety systems (ESS), must open and/or close during this transient while strong motion is occurring. Potential seismically-induced circuit-breaker failures modes were uncovered while the study was conducted. These failure modes include: circuit breaker fails to close; circuit breaker trips inadvertently; circuit breaker fails to reclose after trip. The causes of these failure modes include: Relay chatter causes the circuit breaker to trip; Relay chatter causes anti-pumping relays to seal-in which prevents automatic closure of circuit breakers; Load sequencer failures. The incorporation of these failure modes as well as other instrumentation and control failures into a limited scope seismic probabilistic risk assessment is also discussed in this paper

Online channel operation mode: Game theoretical analysis from the supply chain power structure

Directory of Open Access Journals (Sweden)

Song Huang

2015-11-01

Full Text Available Purpose: Dual-channels have been widely used in practice, and the pricing decisions and the online channel operation mode choice have been the core problems in dual-channel supply chain management. This paper focuses on the online channel operation mode choice from the supply chain power structures based on game theoretical analysis. Design/methodology/approach: This paper utilizes three kinds of game theoretical models to analyze the impact of supply chain power structures on the optimal pricing and online channel operation mode choice. Findings: Results derived in this paper indicate that when the self-price elasticity is large, the power structures have no direct impact on the decisions. However, when the self-price elasticity is small and customers’ preference for the online channel is low, then in the MS market, it is better for the retailer to operate the online channel, while in the RS market or in the VN market, it is better for the manufacturer to operate the online channel. Research limitations/implications: In this paper, we do not consider stochastic demand and asymmetric information, which may not well suit the reality. Originality/value: This paper provides a different perspective to analyze the impact of supply chain power structures on the pricing decisions and online channel operation mode choice. The comparison of these two online channel operation modes in this paper is also a unique point.

Gamma irradiation facility: Evaluation of operational modes

International Nuclear Information System (INIS)

Adesanmi, C.A.; Ali, M.S.; Shonowo, O.A.; Akueche, E.C.; Sadare, O.O.; Mustapha, T.K.; Yusuf, U.; Inyanda, A.K.

2007-01-01

The multipurpose Gamma Irradiation Facility (GIF) at the Nuclear Technology Centre (NTC), Sheda Science and Technology Complex (SHETSCO), Abuja, Nigeria is designed as a semi-commercial plant with facilities for research and development (R and D). The design takes into account the different needs of the various research applications which require a wide dose range, a variety of techniques, different product sizes, shapes, mass, volume, densities and types. Programmable doses are used for food irradiation (0.04 - 10 kGy), biological seed mutation breeding and sterile insect technique (STI) (0.01- 5 kGy) sterilization of medical, pharmaceutical and cosmetic products and packages (up to 25 kGy) and cross-linking of polymers (up to 100 kGy). The six different modes of operations (sample elevator, stationary, swiveling, 2-path inner lane and 2-path outer lane and 4-path line) were evaluated. The dose range, mass range and range of irradiation time practicable were established and advantages for radiation processing of food and industrial products were enumerated for the six modes of operations for the first time

OPTIMIZATION OF AGGREGATION AND SEQUENTIAL-PARALLEL EXECUTION MODES OF INTERSECTING OPERATION SETS

Directory of Open Access Journals (Sweden)

G. М. Levin

2016-01-01

Full Text Available A mathematical model and a method for the problem of optimization of aggregation and of sequential- parallel execution modes of intersecting operation sets are proposed. The proposed method is based on the two-level decomposition scheme. At the top level the variant of aggregation for groups of operations is selected, and at the lower level the execution modes of operations are optimized for a fixed version of aggregation.

An overmoded relativistic backward wave oscillator with efficient dual-mode operation

International Nuclear Information System (INIS)

Xiao, Renzhen; Li, Jiawei; Bai, Xianchen; Song, Zhimin; Teng, Yan; Ye, Hu; Li, Xiaoze; Sun, Jun; Chen, Changhua; Zhang, Xiaowei

2014-01-01

A dual-mode operation mechanism in an overmoded relativistic backward wave oscillator is presented. The electron beam interacts with the −1st space harmonic of TM 01 mode synchronously in the slow wave structure. Then the backward propagating TM 01 mode is converted to the forward propagating TM 02 mode. As the phase velocity of the volume harmonic of TM 02 mode is about twice that of the surface harmonic of TM 01 mode, the TM 02 mode also plays an important role in the high-power microwave generation. Particle-in-cell simulation shows that an efficiency of 48% and a significant improvement of the power capacity have been obtained

Transverse mode instabilities in burst operation of high-power fiber laser systems

Science.gov (United States)

Jauregui, Cesar; Stihler, Christoph; Tünnermann, Andreas; Limpert, Jens

2018-02-01

We propose, to the best of our knowledge, the first mitigation strategy for TMI based on controlling the phase shift between the thermally-induced index grating and the modal intensity pattern. In particular, in this work we present a study of transverse mode instabilities in burst operation in a high-power fiber laser system. It is shown that, with a careful choice of the parameters, this operation regime can potentially lead to the mitigation of TMI by forcing an energy transfer from the higher-order-modes into the fundamental mode during the burst.

Distributed Generation using Indirect Matrix Converter in Boost Operating Mode

DEFF Research Database (Denmark)

Liu, Xiong; Loh, Poh Chiang; Wang, Peng

2011-01-01

, reverse power flow operation of IMC can be implemented to meet voltage boost requirement, where the input ac source is connected to the converter's voltage source side and the output utility grid or load is connected to the current source side. This paper proposes control schemes of IMC under reverse...... power flow operation for both grid-connected and isolated modes with distributed generation suggested as a potential application. In grid-connected mode, the commanded power must be extracted from the input ac source to the grid, in addition to guarantee sinusoidal input/output waveforms, unity input...

Controlling the mode of operation of organic transistors through side-chain engineering

KAUST Repository

Giovannitti, Alexander

2016-10-11

Electrolyte-gated organic transistors offer low bias operation facilitated by direct contact of the transistor channel with an electrolyte. Their operation mode is generally defined by the dimensionality of charge transport, where a field-effect transistor allows for electrostatic charge accumulation at the electrolyte/semiconductor interface, whereas an organic electrochemical transistor (OECT) facilitates penetration of ions into the bulk of the channel, considered a slow process, leading to volumetric doping and electronic transport. Conducting polymer OECTs allow for fast switching and high currents through incorporation of excess, hygroscopic ionic phases, but operate in depletion mode. Here, we show that the use of glycolated side chains on a thiophene backbone can result in accumulation mode OECTs with high currents, transconductance, and sharp subthreshold switching, while maintaining fast switching speeds. Compared with alkylated analogs of the same backbone, the triethylene glycol side chains shift the mode of operation of aqueous electrolyte-gated transistors from interfacial to bulk doping/transport and show complete and reversible electrochromism and high volumetric capacitance at low operating biases. We propose that the glycol side chains facilitate hydration and ion penetration, without compromising electronic mobility, and suggest that this synthetic approach can be used to guide the design of organic mixed conductors.

Controlling the mode of operation of organic transistors through side-chain engineering

Science.gov (United States)

Giovannitti, Alexander; Sbircea, Dan-Tiberiu; Inal, Sahika; Nielsen, Christian B.; Bandiello, Enrico; Hanifi, David A.; Sessolo, Michele; Malliaras, George G.; McCulloch, Iain; Rivnay, Jonathan

2016-01-01

Electrolyte-gated organic transistors offer low bias operation facilitated by direct contact of the transistor channel with an electrolyte. Their operation mode is generally defined by the dimensionality of charge transport, where a field-effect transistor allows for electrostatic charge accumulation at the electrolyte/semiconductor interface, whereas an organic electrochemical transistor (OECT) facilitates penetration of ions into the bulk of the channel, considered a slow process, leading to volumetric doping and electronic transport. Conducting polymer OECTs allow for fast switching and high currents through incorporation of excess, hygroscopic ionic phases, but operate in depletion mode. Here, we show that the use of glycolated side chains on a thiophene backbone can result in accumulation mode OECTs with high currents, transconductance, and sharp subthreshold switching, while maintaining fast switching speeds. Compared with alkylated analogs of the same backbone, the triethylene glycol side chains shift the mode of operation of aqueous electrolyte-gated transistors from interfacial to bulk doping/transport and show complete and reversible electrochromism and high volumetric capacitance at low operating biases. We propose that the glycol side chains facilitate hydration and ion penetration, without compromising electronic mobility, and suggest that this synthetic approach can be used to guide the design of organic mixed conductors. PMID:27790983

The periodically pulsed mode of operation of magnet systems in particle accelerators

International Nuclear Information System (INIS)

Stange, G.

1980-01-01

Since in many applications in particle accelerator technology the beam duty factor, defined by the ratio of beam pulse length to the pulse to pulse period, is very small- typically in the order of 10 - 3 to 10 - 9 - it is interesting to operate the beam optical magnetic system in the periodically pulsed mode as well. Thus, by reducing the average Ohmic losses, it is possible to save energy and material. The pulsed mode of operation of magnet systems is especially adapted to those of linear accelerators and their beam transport systems, since linear accelerators are exclusively operated in this mode. But it is equally suitable for transport systems between cyclic accelerators and large storage rings as they are under development at present. (orig./WL) [de

Mevva ion source operated in purely gaseous mode

International Nuclear Information System (INIS)

Yushkov, G.Y.; MacGill, R.A.; Brown, I. G.

2003-01-01

We have operated a vacuum arc ion source in such a way as to form beams of purely gaseous ions. The vacuum arc configuration that is conventionally used to produce intense beams of metal ions was altered so as to form gaseous ion beams, with only minimal changes to the external circuitry and no changes at all internally to the ion source. In our experiments we formed beams from oxygen (O + and O 2 + ), nitrogen (N + and N 2 + ), argon (Ar + ) and carbon dioxide (C + , CO 2 + , O + and O 2 + ) at extraction voltage of 2 to 50 kV. We used a pulsed mode of operation, with beam pulses approximately 50 milliseconds long and repetition rate 10 pulses per second, for a duty cycle of about 50%. Downstream ion beam current as measured by a 5 cm diameter Faraday cup was typically 0.5 mA pulse or about 250 (micro)A time averaged. This time averaged beam current is very similar to that obtained for metal ions when the source is operated in the usual vacuum arc mode. Here we describe the modifications made to the source and the results of our investigations

Recent progress towards advanced mode of operation on JET

International Nuclear Information System (INIS)

Litaudon, X.; Crisanti, F.; Frigione, D.

2003-01-01

This series of slides presents the recent performance of JET concerning ITB (internal transport barrier) operating mode. Pellet refuelling without ITB destruction has been achieved at n eo /n GW ∼ 1. A wide reversed shear ITB (3.6 m) has been sustained with mild ELM (edge localized modes) and no apparent impurity accumulation. ITBs have been maintained thanks to a simultaneous optimisation of the q-profile and edge condition, which opens the way for a steady-state ITB

Thermal characterization of phacoemulsification probes operated in axial and torsional modes.

Science.gov (United States)

Zacharias, Jaime

2015-01-01

To analyze temperature increases and identify potential sources of heat generated when sleeved and sleeveless phacoemulsification probes were operated in axial and torsional modes using the Infiniti Vision System with the Ozil torsional handpiece. Phacodynamics Laboratory, Pasteur Ophthalmic Clinic, Santiago, Chile. Experimental study. Two computer-controlled thermal transfer systems were developed to evaluate the contribution of internal metal stress and tip-to-sleeve friction on heat generation during phacoemulsification using axial and torsional ultrasound modalities. Both systems incorporated infrared thermal imaging and used a black-body film to accurately capture temperature measurements. Axial mode was consistently associated with greater temperature increases than torsional mode whether tips were operated with or without sleeves. In tests involving bare tips, axial mode and torsional mode peaked at 51.7°C and 34.2°C, respectively. In an example using sleeved tips in which a 30.0 g load was applied for 1 second, temperatures for axial mode reached 45°C and for torsional mode, 38°C. Friction between the sleeved probe and the incisional wall contributed more significantly to the temperature increase than internal metal stress regardless of the mode used. In all experiments, the temperature increase observed with axial mode was greater than that observed with torsional mode, even when conditions such as power or amplitude and flow rate were varied. Tip-to-sleeve friction was a more dominant source of phaco probe heating than internal metal stress. The temperature increase due to internal metal stress was greater with axial mode than with torsional mode. Dr. Zacharias received research funding from Alcon Laboratories, Inc., to conduct this study. He has no financial or proprietary interest in any material or method mentioned. Copyright © 2015 ASCRS and ESCRS. Published by Elsevier Inc. All rights reserved.

Scaling of mode shapes from operational modal analysis using harmonic forces

Science.gov (United States)

Brandt, A.; Berardengo, M.; Manzoni, S.; Cigada, A.

2017-10-01

This paper presents a new method for scaling mode shapes obtained by means of operational modal analysis. The method is capable of scaling mode shapes on any structure, also structures with closely coupled modes, and the method can be used in the presence of ambient vibration from traffic or wind loads, etc. Harmonic excitation can be relatively easily accomplished by using general-purpose actuators, also for force levels necessary for driving large structures such as bridges and highrise buildings. The signal processing necessary for mode shape scaling by the proposed method is simple and the method can easily be implemented in most measurement systems capable of generating a sine wave output. The tests necessary to scale the modes are short compared to typical operational modal analysis test time. The proposed method is thus easy to apply and inexpensive relative to some other methods for scaling mode shapes that are available in literature. Although it is not necessary per se, we propose to excite the structure at, or close to, the eigenfrequencies of the modes to be scaled, since this provides better signal-to-noise ratio in the response sensors, thus permitting the use of smaller actuators. An extensive experimental activity on a real structure was carried out and the results reported demonstrate the feasibility and accuracy of the proposed method. Since the method utilizes harmonic excitation for the mode shape scaling, we propose to call the method OMAH.

A novel ToF-SIMS operation mode for sub 100 nm lateral resolution: Application and performance

International Nuclear Information System (INIS)

Kubicek, Markus; Holzlechner, Gerald; Opitz, Alexander K.; Larisegger, Silvia; Hutter, Herbert; Fleig, Jürgen

2014-01-01

A novel operation mode for time of flight-secondary ion mass spectrometry (ToF-SIMS) is described for a TOF.SIMS 5 instrument with a Bi-ion gun. It features sub 100 nm lateral resolution, adjustable primary ion currents and the possibility to measure with high lateral resolution as well as high mass resolution. The adjustment and performance of the novel operation mode are described and compared to established ToF-SIMS operation modes. Several examples of application featuring novel scientific results show the capabilities of the operation mode in terms of lateral resolution, accuracy of isotope analysis of oxygen, and combination of high lateral and mass resolution. The relationship between high lateral resolution and operation of SIMS in static mode is discussed.

Stability of the superconductive operating mode in high current-density devices

International Nuclear Information System (INIS)

Wipf, S.L.

1979-01-01

The superconductive operating mode represents a thermal equilibrium that can tolerate a certain amount of disturbance before it is lost. The basin of attraction (BOA), in many ways equivalent to a potential well, is a measure of the size of disturbance needed to lift the device from the superconductive into a resistive operating mode. The BOA for a simple geometry is calculated and discussed. Experimental results are reported, showing how the concept is used to gain information on the disturbances occurring in a superconducting device

Optimal Control of Micro Grid Operation Mode Seamless Switching Based on Radau Allocation Method

Science.gov (United States)

Chen, Xiaomin; Wang, Gang

2017-05-01

The seamless switching process of micro grid operation mode directly affects the safety and stability of its operation. According to the switching process from island mode to grid-connected mode of micro grid, we establish a dynamic optimization model based on two grid-connected inverters. We use Radau allocation method to discretize the model, and use Newton iteration method to obtain the optimal solution. Finally, we implement the optimization mode in MATLAB and get the optimal control trajectory of the inverters.

Recent progress towards advanced mode of operation on JET

Energy Technology Data Exchange (ETDEWEB)

Litaudon, X. [Association Euratom-CEA Cadarache, 13 - Saint-Paul-lez-Durance (France); Crisanti, F.; Frigione, D. [Association Euratom-ENEA sulla Fusione Centro Ricerche Energia Frascati (Italy)] [and others

2003-07-01

This series of slides presents the recent performance of JET concerning ITB (internal transport barrier) operating mode. Pellet refuelling without ITB destruction has been achieved at n{sub eo}/n{sub GW} {approx} 1. A wide reversed shear ITB (3.6 m) has been sustained with mild ELM (edge localized modes) and no apparent impurity accumulation. ITBs have been maintained thanks to a simultaneous optimisation of the q-profile and edge condition, which opens the way for a steady-state ITB.

QUIESCENT H-MODE, AN ELM-FREE HIGH-CONFINEMENT MODE ON DIII-D WITH POTENTIAL FOR STATIONARY STATE OPERATION

Energy Technology Data Exchange (ETDEWEB)

WEST,WP; BURRELL,KH; deGRASSIE,JS; DOYLE,EJ; GREENFIELD,CM; LASNIER,CJ; SNYDER,PB; ZENG,L

2003-08-01

OAK-B135 The quiescent H-mode (QH-mode) is an ELM-free and stationary state mode of operation discovered on DIII-D. This mode achieves H-mode levels of confinement and pedestal pressure while maintaining constant density and radiated power. The elimination of edge localized modes (ELMs) and their large divertor loads while maintaining good confinement and good density control is of interest to next generation tokamaks. This paper reports on the correlations found between selected parameters in a QH-mode database developed from several hundred DIII-D counter injected discharges. Time traces of key plasma parameters from a QH-mode discharge are shown. On DIII-D the negative going plasma current (a) indicates that the beam injection direction is counter to the plasma current direction, a common feature of all QH-modes. The D{sub {alpha}} time behavior (c) shows that soon after high powered beam heating (b) is applied, the discharge makes a transition to ELMing H-mode, then the ELMs disappear, indicating the start of the QH period that lasts for the remainder of the high power beam heating (3.5 s). Previously published work showing density and temperature profiles indicates that long-pulse, high-triangularity QH discharges develop an internal transport barrier in combination with the QH edge barrier. These discharges are known as quiescent, double-barrier discharges (QDB). The H-factor (d) and stored energy (c) rise then saturate at a constant level and the measured axial and minimum safety factors remain above 1.0 for the entire QH duration. During QDB operation the performance of the plasma can be very good, with {beta}{sub N}*H{sub 89L} product reaching 7 for > 10 energy confinement times. These discharges show promise that a stationary state can be achieved.

QUIESCENT H-MODE, AN ELM-FREE HIGH-CONFINEMENT MODE ON DIII-D WITH POTENTIAL FOR STATIONARY STATE OPERATION

International Nuclear Information System (INIS)

WEST, WP; BURRELL, KH; DeGRASSIE, JS; DOYLE, EJ; GREENFIELD, CM; LASNIER, CJ; SNYDER, PB; ZENG, L.

2003-01-01

OAK-B135 The quiescent H-mode (QH-mode) is an ELM-free and stationary state mode of operation discovered on DIII-D. This mode achieves H-mode levels of confinement and pedestal pressure while maintaining constant density and radiated power. The elimination of edge localized modes (ELMs) and their large divertor loads while maintaining good confinement and good density control is of interest to next generation tokamaks. This paper reports on the correlations found between selected parameters in a QH-mode database developed from several hundred DIII-D counter injected discharges. Time traces of key plasma parameters from a QH-mode discharge are shown. On DIII-D the negative going plasma current (a) indicates that the beam injection direction is counter to the plasma current direction, a common feature of all QH-modes. The D α time behavior (c) shows that soon after high powered beam heating (b) is applied, the discharge makes a transition to ELMing H-mode, then the ELMs disappear, indicating the start of the QH period that lasts for the remainder of the high power beam heating (3.5 s). Previously published work showing density and temperature profiles indicates that long-pulse, high-triangularity QH discharges develop an internal transport barrier in combination with the QH edge barrier. These discharges are known as quiescent, double-barrier discharges (QDB). The H-factor (d) and stored energy (c) rise then saturate at a constant level and the measured axial and minimum safety factors remain above 1.0 for the entire QH duration. During QDB operation the performance of the plasma can be very good, with β N *H 89L product reaching 7 for > 10 energy confinement times. These discharges show promise that a stationary state can be achieved

Operating experience of natural circulation core cooling in boiling water reactors

International Nuclear Information System (INIS)

Kullberg, C.; Jones, K.; Heath, C.

1993-01-01

General Electric (GE) has proposed an advanced boiling water reactor, the Simplified Boiling Water Reactor (SBWR), which will utilize passive, gravity-driven safety systems for emergency core coolant injection. The SBWR design includes no recirculation loops or recirculation pumps. Therefore the SBWR will operate in a natural circulation (NC) mode at full power conditions. This design poses some concerns relative to stability during startup, shutdown, and at power conditions. As a consequence, the NRC has directed personnel at several national labs to help investigate SBWR stability issues. This paper will focus on some of the preliminary findings made at the INEL. Because of the broad range of stability issues this paper will mainly focus on potential geysering instabilities during startup. The two NC designs examined in detail are the US Humboldt Bay Unit 3 BWR-1 plant and Dodewaard plant in the Netherlands. The objective of this paper will be to review operating experience of these two plants and evaluate their relevance to planned SBWR operational procedures. For completeness, experimental work with early natural circulation GE test facilities will also be briefly discussed

Predicting core losses and efficiency of SRM in continuous current mode of operation using improved analytical technique

International Nuclear Information System (INIS)

Parsapour, Amir; Dehkordi, Behzad Mirzaeian; Moallem, Mehdi

2015-01-01

In applications in which the high torque per ampere at low speed and rated power at high speed are required, the continuous current method is the best solution. However, there is no report on calculating the core loss of SRM in continuous current mode of operation. Efficiency and iron loss calculation which are complex tasks in case of conventional mode of operation is even more involved in continuous current mode of operation. In this paper, the Switched Reluctance Motor (SRM) is modeled using finite element method and core loss and copper loss of SRM in discontinuous and continuous current modes of operation are calculated using improved analytical techniques to include the minor loop losses in continuous current mode of operation. Motor efficiency versus speed in both operation modes is obtained and compared. - Highlights: • Continuous current method for Switched Reluctance Motor (SRM) is explained. • An improved analytical technique is presented for SRM core loss calculation. • SRM losses in discontinuous and continuous current operation modes are presented. • Effect of mutual inductances on SRM performance is investigated

Predicting core losses and efficiency of SRM in continuous current mode of operation using improved analytical technique

Energy Technology Data Exchange (ETDEWEB)

Parsapour, Amir, E-mail: amirparsapour@gmail.com [Department of Electrical Engineering, University of Isfahan, Isfahan (Iran, Islamic Republic of); Dehkordi, Behzad Mirzaeian, E-mail: mirzaeian@eng.ui.ac.ir [Department of Electrical Engineering, University of Isfahan, Isfahan (Iran, Islamic Republic of); Moallem, Mehdi, E-mail: moallem@cc.iut.ac.ir [Department of Electrical Engineering, Isfahan University of Technology, Isfahan (Iran, Islamic Republic of)

2015-03-15

In applications in which the high torque per ampere at low speed and rated power at high speed are required, the continuous current method is the best solution. However, there is no report on calculating the core loss of SRM in continuous current mode of operation. Efficiency and iron loss calculation which are complex tasks in case of conventional mode of operation is even more involved in continuous current mode of operation. In this paper, the Switched Reluctance Motor (SRM) is modeled using finite element method and core loss and copper loss of SRM in discontinuous and continuous current modes of operation are calculated using improved analytical techniques to include the minor loop losses in continuous current mode of operation. Motor efficiency versus speed in both operation modes is obtained and compared. - Highlights: • Continuous current method for Switched Reluctance Motor (SRM) is explained. • An improved analytical technique is presented for SRM core loss calculation. • SRM losses in discontinuous and continuous current operation modes are presented. • Effect of mutual inductances on SRM performance is investigated.

Definition, analysis and experimental investigation of operation modes in hydrogen-renewable-based power plants incorporating hybrid energy storage

International Nuclear Information System (INIS)

Valverde, L.; Pino, F.J.; Guerra, J.; Rosa, F.

2016-01-01

Highlights: • A conceptual analysis of operation modes in energy storage plants is presented. • Key Performance Indicators to select operation modes are provided. • The approach has been applied to a laboratory hybrid power plant. • The methodology provides guidance for the operation of hybrid power plants. - Abstract: This paper is concerned with Operating Modes in hybrid renewable energy-based power plants with hydrogen as the intermediate energy storage medium. Six operation modes are defined according to plant topology and the possibility of operating electrolyzer and fuel cell at steady-power or partial load. A methodology for the evaluation of plant performance is presented throughout this paper. The approach includes a set of simulations over a fully validated model, which are run in order to compare the proposed operation modes in various weather conditions. Conclusions are drawn from the simulation stage using a set of Key Performance Indicators defined in this paper. This analysis yields the conclusion that certain modes are more appropriate from technical and practical standpoints when they are implemented in a real plant. From the results of the simulation assessment, selected operating modes are applied to an experimental hydrogen-based pilot plant to illustrate and validate the performance of the proposed operation modes. Experimental results confirmed the simulation study, pointing out the advantages and disadvantages of each operation mode in terms of performance and equipment durability.

Development of Abnormal Operating Strategies for Station Blackout in Shutdown Operating Mode in Pressurized Water Reactor

Energy Technology Data Exchange (ETDEWEB)

Yoon, Duk-Joo; Lee, Seung-Chan; Sung, Je-Joong; Ha, Sang-Jun [KHNP CRI, Daejeon (Korea, Republic of); Hwang, Su-Hyun [FNC Tech. Co., Yongin (Korea, Republic of)

2016-10-15

Loss of all AC power is classified as one of multiple failure accident by regulatory guide of Korean accident management program. Therefore we need develop strategies for the abnormal operating procedure both of power operating and shutdown mode. This paper developed abnormal operating guideline for loss of all AC power by analysis of accident scenario in pressurized water reactor. This paper analyzed the loss of ultimate heat sink (LOUHS) in shutdown operating mode and developed the operating strategy of the abnormal procedure. Also we performed the analysis of limiting scenarios that operator actions are not taken in shutdown LOUHS. Therefore, we verified the plant behavior and decided operator action to taken in time in order to protect the fuel of core with safety. From the analysis results of LOUHS, the fuel of core maintained without core uncovery for 73 minutes respectively for opened RCS states after the SBO occurred. Therefore, operator action for the emergency are required to take in 73 minutes for opened RCS state. Strategy is to cooldown by using spent fuel pool cooling system. This method required to change the plant design in some plant. In RCS boundary closed state, first abnormal operating strategy in shutdown LOUHS is first abnormal operating strategy in shutdown LOUHS is to remove the residual heat of core by steam dump flow and auxiliary feedwater of SG.

Control software architecture and operating modes of the Model M-2 maintenance system

Energy Technology Data Exchange (ETDEWEB)

Satterlee, P.E. Jr.; Martin, H.L.; Herndon, J.N.

1984-04-01

The Model M-2 maintenance system is the first completely digitally controlled servomanipulator. The M-2 system allows dexterous operations to be performed remotely using bilateral force-reflecting master/slave techniques, and its integrated operator interface takes advantage of touch-screen-driven menus to allow selection of all possible operating modes. The control system hardware for this system has been described previously. This paper describes the architecture of the overall control system. The system's various modes of operation are identified, the software implementation of each is described, system diagnostic routines are described, and highlights of the computer-augmented operator interface are discussed. 3 references, 5 figures.

Control software architecture and operating modes of the Model M-2 maintenance system

International Nuclear Information System (INIS)

Satterlee, P.E. Jr.; Martin, H.L.; Herndon, J.N.

1984-04-01

The Model M-2 maintenance system is the first completely digitally controlled servomanipulator. The M-2 system allows dexterous operations to be performed remotely using bilateral force-reflecting master/slave techniques, and its integrated operator interface takes advantage of touch-screen-driven menus to allow selection of all possible operating modes. The control system hardware for this system has been described previously. This paper describes the architecture of the overall control system. The system's various modes of operation are identified, the software implementation of each is described, system diagnostic routines are described, and highlights of the computer-augmented operator interface are discussed. 3 references, 5 figures

Research on Integrated Control of Microgrid Operation Mode

Science.gov (United States)

Cheng, ZhiPing; Gao, JinFeng; Li, HangYu

2018-03-01

The mode switching control of microgrid is the focus of its system control. According to the characteristics of different control, an integrated control system is put forward according to the detecting voltage and frequency deviation after switching of microgrid operating mode. This control system employs master-slave and peer-to-peer control. Wind turbine and photovoltaic(PV) adopt P/Q control, so the maximum power output can be achieved. The energy storage will work under the droop control if the system is grid-connected. When the system is off-grid, whether to employ droop control or P/f control is determined by system status. The simulation has been done and the system performance can meet the requirement.

Avalanche and streamer mode operation of resistive plate chambers

International Nuclear Information System (INIS)

Cardarelli, R.; Makeev, V.; Santonico, R.

1996-01-01

A resistive plate chamber was operated at voltages increasing in steps of 200 V over a 3 kV interval and the transition between the avalanche and streamer modes was studied. The avalanche amplitude was observed to be exponentially dependent on the operating voltage up to a value, characteristic of the gas, where the avalanche saturation occurs and delayed streamer signals start to appear. Signal waveforms, charge and timing distributions are reported. (orig.)

Novel operation mode for eliminating influence of inclination angle and friction in atomic force microscopy

International Nuclear Information System (INIS)

Wang, Fei; Wang, Yueyu; Zhou, Faquan; Zhao, Xuezeng

2010-01-01

The accuracy of topography imaging in contact force mode of atomic force microscopy (AFM) depends on the one-to-one corresponding relationship between the cantilever deflection and the tip-sample distance, whereas such a relationship cannot be always achieved in the presence of friction and incline angle of sample surface. Recently, we have developed a novel operation mode in which we keep the van der Waals force as constant instead of the applied normal force, to eliminate the effect of inclination angle and friction on topography imaging in the contact force mode. We have improved our AFM to enable the new operation mode for validation. Comparative experiments have been performed and the results have shown that the effect of friction and inclination angle on topography imaging in contact mode of AFM can be eliminated or at least decreased effectively by working in the new operation mode we present.

Simulation of operation modes of isochronous cyclotron by a new interactive method

International Nuclear Information System (INIS)

Taraszkiewicz, R.; Talach, M.; Sulikowski, J.; Doruch, H.; Norys, T.; Sroka, A.; Kiyan, I.N.; )

2007-01-01

Operation mode simulation methods are based on selection of trim coil currents in the isochronous cyclotron for formation of the required magnetic field at a certain level of the main coil current. The traditional current selection method is based on finding a solution for all trim coils simultaneously. After setting the calculated operation mode, it is usually necessary to perform a control measurement of the magnetic field map and to repeat the calculation for a more accurate solution. The new current selection method is based on successively finding solutions for each particular trim coil. The trim coils are taken one by one in reverse order from the edge to the center of the isochronous cyclotron. The new operation mode simulation method is based on the new current selection method. The new method, as against the traditional one, includes iterative calculation of the kinetic energy at the extraction radius. A series of experiments on proton beam formation within the range of working acceleration radii at extraction energies from 32 to 59 MeV, which were carried out at the AIC144 multipurpose isochronous cyclotron (designed mainly for the eye melanoma treatment and production of radioisotopes) at the INP PAS (Cracow), showed that the new method makes unnecessary any control measurements of magnetic fields for getting the desired operation mode, which indicates a high accuracy of the calculation. (authors)

Analysis of Sleep-Mode Downlink Scheduling Operations in EPON Systems

OpenAIRE

Yan, Ying; Dittmann, Lars

2011-01-01

Energy management strategy has been considered as an important component in the future Ethernet Passive Optical Networks (EPONs). In this paper, a sleeping mode operation is studied, and a downlink packet scheduling scheme is analyzed to preserve energy consumption and maintain the required QoS. This paper proposes a novel sleep-mode downlink packet scheduling scheme in order to enhance the sleep control function. Simulation results confirm that the proposed approach offers effective power ma...

Single-mode operation of a coiled multimode fiber amplifier

International Nuclear Information System (INIS)

Koplow, Jeffrey P.; Kliner, Dahv A. V.; Goldberg, Lew

2000-01-01

We report a new approach to obtaining single-transverse-mode operation of a multimode fiber amplifier in which the gain fiber is coiled to induce significant bend loss for all but the lowest-order mode. We demonstrated this method by constructing a coiled amplifier using Yb-doped, double-clad fiber with a core diameter of 25 μm and a numerical aperture of ∼0.1 (V≅7.4) . When the amplifier was operated as an amplified-spontaneous-emission source, the output beam had an M 2 value of 1.09±0.09 ; when seeded at 1064 nm, the slope efficiency was similar to that of an uncoiled amplifier. This technique will permit scaling of pulsed fiber lasers and amplifiers to significantly higher pulse energies and peak powers and cw fiber sources to higher average powers while maintaining excellent beam quality. (c) 2000 Optical Society of America

High-power and long-pulse operation of TE{sub 31,11} mode gyrotron

Energy Technology Data Exchange (ETDEWEB)

Ikeda, Ryosuke, E-mail: ikeda.ryosuke@jaea.go.jp; Kajiwara, Ken; Oda, Yasuhisa; Takahashi, Koji; Sakamoto, Keishi

2015-10-15

Highlights: • We are under development of TE{sub 31,11} mode gyrotron to aim ITER specification. • HE{sub 11} mode purity reached 96% of ITER specification. • Mode competition was suppressed in initial phase of oscillation by anode voltage control. • Maximum output power of 1.2 MW was achieved. • Steady state operation of 500 MJ was achieved. - Abstract: The ITER electron cyclotron system is designed to inject a 20 MW RF beam by using twenty-four 170 GHz/1 MW gyrotrons. JAEA is currently developing a gyrotron having a high-order mode (TE{sub 31,11}) to reduce the heat load in the cavity resonator and achieve an output power greater than 1 MW. The measured radiation profile at the front of the diamond window agreed with the results of the calculation. In order to suppress RF loss in the equatorial and upper port launchers, a high-quality HE{sub 11} mode is required at the exit of the matching optics unit (MOU). An HE{sub 11} mode purity of 96% was achieved by finely adjusting the two mirrors in the MOU. During the oscillation start-up phase, mode competition with counter-rotating TE{sub 29,12} mode was observed on the higher magnetic field side which caused arcing and pressure increase in the gyrotron. To avoid the counter-rotating TE{sub 29,12} mode from being excited, a start-up scenario that controls the voltage between the anode and cathode electrodes at the initial phase of operation was introduced, which was able to achieve a stable start-up of TE{sub 31,11} mode. A 1.2 MW output power having a total electric efficiency of 43% was obtained in high-power experiments. In steady-state operation, a 1000 s oscillation length and output power of 0.51 MW was achieved.

A novel ToF-SIMS operation mode for sub 100 nm lateral resolution: Application and performance.

Science.gov (United States)

Kubicek, Markus; Holzlechner, Gerald; Opitz, Alexander K; Larisegger, Silvia; Hutter, Herbert; Fleig, Jürgen

2014-01-15

A novel operation mode for time of flight-secondary ion mass spectrometry (ToF-SIMS) is described for a TOF.SIMS 5 instrument with a Bi-ion gun. It features sub 100 nm lateral resolution, adjustable primary ion currents and the possibility to measure with high lateral resolution as well as high mass resolution. The adjustment and performance of the novel operation mode are described and compared to established ToF-SIMS operation modes. Several examples of application featuring novel scientific results show the capabilities of the operation mode in terms of lateral resolution, accuracy of isotope analysis of oxygen, and combination of high lateral and mass resolution. The relationship between high lateral resolution and operation of SIMS in static mode is discussed.

Investigation of enhancement-mode AlGaN/GaN nanowire channel high-electron-mobility transistor with oxygen-containing plasma treatment

Science.gov (United States)

He, Yunlong; Wang, Chong; Mi, Minhan; Zhang, Meng; Zhu, Qing; Zhang, Peng; Wu, Ji; Zhang, Hengshuang; Zheng, Xuefeng; Yang, Ling; Duan, Xiaoling; Ma, Xiaohua; Hao, Yue

2017-05-01

A novel enhancement-mode (E-mode) AlGaN/GaN high-electron-mobility transistor (HEMT) has been fabricated, by combining nanowire channel (NC) structure fabrication and N2O (or O2) plasma treatment. A comparison of two NC-HEMTs with different plasma treatments has been made. The NC-HEMT with N2O plasma treatment shows an output current of 610 mA/mm and a peak transconductance of 450 mS/mm. The DIBL of the NC-HEMT with N2O plasma treatment is as low as 2 mV/V, and an SS of 70 mV/decade is achieved. The device exhibits an intrinsic current gain cutoff frequency f T of 19 GHz and a maximum oscillation frequency f max of 58 GHz.

N Reactor thermal plume characterization during Pu-only mode of operation

Energy Technology Data Exchange (ETDEWEB)

Ecker, R.M.; Thompson, F.L.; Whelan, G.

1983-04-01

Pacific Northwest Laboratories (PNL) performed field and modeling studies -from March 1982 through June 1983 to characterize the thermal plume from the N Reactor heated water outfall while the N Reactor operated in the Pu-only mode. Part 1 of this report deals with the field studies conducted to characterize the N Reactor thermal plume while in the Pu-only mode of operation. It includes a description of the study area, a description of field tasks and procedures, and data collection results and discussion. Part 2 describes the computer simulation of the thermal plume under different flow conditions and the calibration of the model used. It includes a description of the computer model and the assumptions on which it is based, a presentation of the input data used in this application, and a discussion of modeling results. Because the field studies were restricted by the NPOES permit variance to the spring months when high Columbia River flows prevail the mathematical modeling of the N Reactor thermal plume while the reactor operates in the Pu-only mode is instrumental in characterizing the plume during low Columbia River flows.

Dual-mode operation of 2D material-base hot electron transistors

KAUST Repository

Lan, Yann-Wen; Jr., Carlos M. Torres,; Zhu, Xiaodan; Qasem, Hussam; Adleman, James R.; Lerner, Mitchell B.; Tsai, Shin-Hung; Shi, Yumeng; Li, Lain-Jong; Yeh, Wen-Kuan; Wang, Kang L.

2016-01-01

Vertical hot electron transistors incorporating atomically-thin 2D materials, such as graphene or MoS2, in the base region have been proposed and demonstrated in the development of electronic and optoelectronic applications. To the best of our knowledge, all previous 2D material-base hot electron transistors only considered applying a positive collector-base potential (V-CB > 0) as is necessary for the typical unipolar hot-electron transistor behavior. Here we demonstrate a novel functionality, specifically a dual-mode operation, in our 2D material-base hot electron transistors (e.g. with either graphene or MoS2 in the base region) with the application of a negative collector-base potential (V-CB < 0). That is, our 2D material-base hot electron transistors can operate in either a hot-electron or a reverse-current dominating mode depending upon the particular polarity of VCB. Furthermore, these devices operate at room temperature and their current gains can be dynamically tuned by varying VCB. We anticipate our multi-functional dual-mode transistors will pave the way towards the realization of novel flexible 2D material-based high-density and low-energy hot-carrier electronic applications.

Dual-mode operation of 2D material-base hot electron transistors

KAUST Repository

Lan, Yann-Wen

2016-09-01

Vertical hot electron transistors incorporating atomically-thin 2D materials, such as graphene or MoS2, in the base region have been proposed and demonstrated in the development of electronic and optoelectronic applications. To the best of our knowledge, all previous 2D material-base hot electron transistors only considered applying a positive collector-base potential (V-CB > 0) as is necessary for the typical unipolar hot-electron transistor behavior. Here we demonstrate a novel functionality, specifically a dual-mode operation, in our 2D material-base hot electron transistors (e.g. with either graphene or MoS2 in the base region) with the application of a negative collector-base potential (V-CB < 0). That is, our 2D material-base hot electron transistors can operate in either a hot-electron or a reverse-current dominating mode depending upon the particular polarity of VCB. Furthermore, these devices operate at room temperature and their current gains can be dynamically tuned by varying VCB. We anticipate our multi-functional dual-mode transistors will pave the way towards the realization of novel flexible 2D material-based high-density and low-energy hot-carrier electronic applications.

Dual-mode operation of 2D material-base hot electron transistors.

Science.gov (United States)

Lan, Yann-Wen; Torres, Carlos M; Zhu, Xiaodan; Qasem, Hussam; Adleman, James R; Lerner, Mitchell B; Tsai, Shin-Hung; Shi, Yumeng; Li, Lain-Jong; Yeh, Wen-Kuan; Wang, Kang L

2016-09-01

Vertical hot electron transistors incorporating atomically-thin 2D materials, such as graphene or MoS2, in the base region have been proposed and demonstrated in the development of electronic and optoelectronic applications. To the best of our knowledge, all previous 2D material-base hot electron transistors only considered applying a positive collector-base potential (VCB > 0) as is necessary for the typical unipolar hot-electron transistor behavior. Here we demonstrate a novel functionality, specifically a dual-mode operation, in our 2D material-base hot electron transistors (e.g. with either graphene or MoS2 in the base region) with the application of a negative collector-base potential (VCB transistors can operate in either a hot-electron or a reverse-current dominating mode depending upon the particular polarity of VCB. Furthermore, these devices operate at room temperature and their current gains can be dynamically tuned by varying VCB. We anticipate our multi-functional dual-mode transistors will pave the way towards the realization of novel flexible 2D material-based high-density and low-energy hot-carrier electronic applications.

The Study of Operation Modes and Control Strategies of a Multidirectional MC for Battery Based System

Directory of Open Access Journals (Sweden)

Saman Toosi

2015-01-01

Full Text Available To enhance the performance of stand-alone battery based system and to achieve the continuous power transmission, the behavior of multidirectional matrix converter (MDMC has been analyzed in different operation modes. A systematic method interfacing a renewable source, a storage battery, and a load is proposed for a stand-alone battery based power system (SABBPS to utilize the MDMC as PWM converter, inverter, or PWM converter and inverter in different operation modes. In this study, the Extended Direct Duty Pulse Width Modulation (EDDPWM technique has been applied to control the power flow path between the renewable source, load, and the battery. Corresponding to generator voltage, input frequency, and loads demands, several operating states and control strategies are possible. Therefore, the boundaries and distribution of operation modes are discussed and illustrated to improve the system performance. The mathematical equation of the EDDPWM under different operation modes has been derived to achieve the maximum voltage ratio in each mode. The theoretical and modulation concepts presented have been verified in simulation using MATLAB and experimental testing. Moreover, the THD, ripple, and power flow direction have been analyzed for output current to investigate the behavior of system in each operation mode.

Grid-Forming-Mode Operation of Boost-Power-Stage Converter in PV-Generator-Interfacing Applications

Directory of Open Access Journals (Sweden)

Jukka Viinamäki

2017-07-01

Full Text Available The application of constant power control and inclusion of energy storage in grid-connected photovoltaic (PV energy systems may increase the use of two-stage system structures composed of DC–DC-converter-interfaced PV generator and grid-connected inverter connected in cascade. A typical PV-generator-interfacing DC–DC converter is a boost-power-stage converter. The renewable energy system may operate in three different operation modes—grid-forming, grid-feeding, and grid-supporting modes. In the last two operation modes, the outmost feedback loops are taken from the input terminal of the associated power electronic converters, which usually does not pose stability problems in terms of their input sources. In the grid-forming operation mode, the outmost feedback loops have to be connected to the output terminal of the associated power electronic converters, and hence the input terminal will behave as a negative incremental resistor at low frequencies. This property will limit the operation of the PV interfacing converter in either the constant voltage or constant current region of the PV generator for ensuring stable operation. The boost-power-stage converter can be applied as a voltage or current-fed converter limiting the stable operation region accordingly. The investigations of this paper show explicitly that only the voltage-fed mode would provide feasible dynamic and stability properties as a viable interfacing converter.

Operation of heavily irradiated silicon detectors in non-depletion mode

International Nuclear Information System (INIS)

Verbitskaya, E.; Eremin, V.; Ilyashenko, I.; Li, Z.; Haerkoenen, J.; Tuovinen, E.; Luukka, P.

2006-01-01

The non-depletion detector operation mode has generally been disregarded as an option in high-energy physics experiments. In this paper, the non-depletion operation is examined by detailed analysis of the electric field distribution and the current pulse response of heavily irradiated silicon (Si) detectors. The previously reported model of double junction in heavily irradiated Si detector is further developed and a simulation of the current pulse response has been performed. It is shown that detectors can operate in a non-depletion mode due to the fact that the value of the electric field in a non-depleted region is high enough for efficient carrier drift. This electric field originates from the current flow through the detector and a consequent drop of the potential across high-resistivity bulk of a non-depleted region. It is anticipated that the electric field in a non-depleted region, which is still electrically neutral, increases with fluence that improves the non-depleted detector operation. Consideration of the electric field in a non-depleted region allows the explanation of the recorded double-peak current pulse shape of heavily irradiated Si detectors and definition of the requirements for the detector operational conditions. Detailed reconstruction of the electric field distribution gives new information on radiation effects in Si detectors

Energy-efficient operation of a booster RF system for Taiwan light source operated in top-up mode

International Nuclear Information System (INIS)

Yeh, Meng-Shu; Wang, Chaoen; Chang, Lung-Hai; Chung, Fu-Tsai; Yu, Tsung-Chi; Lin, Ming-Chyuan; Chen, Ling-Jhen; Yang, Tz-Te; Chang, Mei-Hsia; Lin, Yu-Han; Tsai, Ming-Hsun; Lo, Chih-Hung; Liu, Zong-Kai

2015-01-01

Contemporary light sources operate in a top-up mode to maintain their photon intensity quasi-constant so as to improve significantly the thermal stability of the photon beam and to maximize ultimately the average photon flux at a designed maximum operational beam current. Operating in a top-up mode requires frequent beam injection from the synchrotron booster to the storage ring of the light source, but the injection intervals occupy only a tiny portion of the operational time of the integrated machine. To maintain a high operational reliability, the booster RF system practically operates necessarily under injection conditions around the clock and consumes full electric power whether during top-up injection or not. How to decrease the power consumption of the booster RF system during its stand-by time but not to sacrifice the reliability and availability of the RF system is obviously of fundamental interest for routine operation of the light source in a top-up mode. Here, an energy-efficient operation of a booster RF system adaptive to top-up operation of a light source is proposed that has been developed, realized and integrated into the booster RF system of the Taiwan Light Source (TLS), and routinely operated since the end of year 2008. The klystron cathode current and RF gap voltage of the booster's accelerating RF cavity are both periodically modulated to adapt the injection rhythm during top-up operation, which results in decreased consumption of electric power of the booster RF system by more than 78%. The impact on the reliability and availability of the booster RF system has been carefully monitored during the past five operational years, delivering more than 5000 h scheduled user beam time per year. The booster RF system retains its excellent reliability and availability as previously. Neither a decrease of the service time nor an induced reliability issue from the klystron or any high-power high-voltage component of the transmitter has been

77 FR 50376 - Drawbridge Operation Regulation, Atlantic Intracoastal Waterway (AIWW); Wrightsville Beach, NC...

Science.gov (United States)

2012-08-21

... duration that the moveable bridges will be maintained in the closed position. The races have been reserved... of Transportation (NCDOT) bridges: The S.R. 74 Bridge, across the AIWW, mile 283.1 at Wrightsville Beach, NC; the Cape Fear Memorial Bridge across the Cape Fear River, mile 26.8; and the Isabel S. Holmes...

Operation Modes and Control Schemes for Internet-Based Teleoperation System with Time Delay

Institute of Scientific and Technical Information of China (English)

曾庆军; 宋爱国

2003-01-01

Teleoperation system plays an important role in executing task under hazard environment. As the computer networks such as the Internet are being used as the communication channel of teleoperation system, varying time delay causes the overall system unstable and reduces the performance of transparency. This paper proposed twelve operation modes with different control schemes for teleoperation on the Internet with time delay. And an optimal operation mode with control scheme was specified for teleoperation with time delay, based on the tradeoff between passivity and transparency properties. It experimentally confirmed the validity of the proposed optimal mode and control scheme by using a simple one DOF master-slave manipulator system.

Mixed - mode Operating System for Real - time Performance

Directory of Open Access Journals (Sweden)

Hasan M. M.

2017-11-01

Full Text Available The purpose of the mixed-mode system research is to handle devices with the accuracy of real-time systems and at the same time, having all the benefits and facilities of a matured Graphic User Interface(GUIoperating system which is typicallynon-real-time. This mixed-mode operating system comprising of a real-time portion and a non-real-time portion was studied and implemented to identify the feasibilities and performances in practical applications (in the context of scheduled the real-time events. In this research an i8751 microcontroller-based hardware was used to measure the performance of the system in real-time-only as well as non-real-time-only configurations. The real-time portion is an 486DX-40 IBM PC system running under DOS-based real-time kernel and the non-real-time portion is a Pentium IIIbased system running under Windows NT. It was found that mixed-mode systems performed as good as a typical real-time system and in fact, gave many additional benefits such as simplified/modular programming and load tolerance.

DC motor operation controlled from a DC/DC power converter in pulse mode with low duty cycle

OpenAIRE

Stefanov, Goce; Kukuseva, Maja; Citkuseva Dimitrovska, Biljana

2016-01-01

In this paper pulse mode of operation of DC motor controlled by DC/DC power converter is analyzed. DC motor operation with time intervals in which the motor operates without output load is of interest. In this mode it is possible the motor to restore energy. Also, in the paper are represented calculations for the amount of the restored energy in the pulse mode operation of the motor for different duty cycles.

Structural studies of n-type nc-Si-QD thin films for nc-Si solar cells

Science.gov (United States)

Das, Debajyoti; Kar, Debjit

2017-12-01

A wide optical gap nanocrystalline silicon (nc-Si) dielectric material is a basic requirement at the n-type window layer of nc-Si solar cells in thin film n-i-p structure on glass substrates. Taking advantage of the high atomic-H density inherent to the planar inductively coupled low-pressure (SiH4 + CH4)-plasma, development of an analogous material in P-doped nc-Si-QD/a-SiC:H network has been tried. Incorporation of C in the Si-network extracted from the CH4 widens the optical band gap; however, at enhanced PH3-dilution of the plasma spontaneous miniaturization of the nc-Si-QDs below the dimension of Bohr radius (∼4.5 nm) further enhances the band gap by virtue of the quantum size effect. At increased flow rate of PH3, dopant induced continuous amorphization of the intrinsic crystalline network is counterbalanced by the further crystallization promoted by the supplementary atomic-H extracted from PH3 (1% in H2) in the plasma, eventually holding a moderately high degree of crystallinity. The n-type wide band gap (∼1.93 eV) window layer with nc-Si-QDs in adequate volume fraction (∼52%) could furthermore be instrumental as an effective seed layer for advancing sequential crystallization in the i-layer of nc-Si solar cells with n-i-p structure in superstrate configuration.

Demand and supply-based operating modes--a framework for analyzing health care service production.

Science.gov (United States)

Lillrank, Paul; Groop, P Johan; Malmström, Tomi J

2010-12-01

The structure of organizations that provide services should reflect the possibilities of and constraints on production that arise from the market segments they serve. Organizational segmentation in health care is based on urgency and severity as well as disease type, bodily function, principal method, or population subgroup. The result is conflicting priorities, goals, and performance metrics. A managerial perspective is needed to identify activities with similar requirements for integration, coordination, and control. The arguments in this article apply new reasoning to the previous literature. The method used in this article to classify health care provision distinguishes different types of health problems that share generic constraints of production. The analysis leads to seven different demand-supply combinations, each with its own operational logic. These are labeled demand and supply-based operating modes (DSO modes), and constitute the managerial building blocks of health care organizations. The modes are Prevention, Emergency, One visit, Project, Elective, Cure, and Care. As analytical categories the DSO modes can be used to understand current problems. Several operating modes in one unit create managerial problems of conflicting priorities, goals, and performance metrics. The DSO modes are constructed as managerially homogeneous categories or care platforms responding to general types of demand, and supply constraints. The DSO modes bring methods of industrial management to bear on efforts to improve health care. © 2010 Milbank Memorial Fund. Published by Wiley Periodicals Inc.

Research on Group Operation Mode of Once-through Steam Generator

International Nuclear Information System (INIS)

Hao, Cheng Ming; Liu, Xinkai; Peng, Min Jun; Xia, Genglei

2011-01-01

Integrated Pressurized Water Reactor (IPWR) owns more than one once-through steam generators (OTSGs). Flow instability may occur in secondary side of OTSG under certain conditions. Trying to avoid the occurrence of flow instability is of great important for the safe and stable operation of OTSG. Because of the fact that flow instability often occurs in certain regions, so when OTSGs operate with low load, OTSGs can be separated into several groups, which can avoid flow instability. In this paper, operational characteristics of IPWR are analyzed by RELAP5/MOD3.4 code and during the discussion of group operation, a rapid change load operation scheme using OTSG group operation mode which can be used in IPWR is proposed

Research on Group Operation Mode of Once-through Steam Generator

Energy Technology Data Exchange (ETDEWEB)

Hao, Cheng Ming; Liu, Xinkai; Peng, Min Jun; Xia, Genglei [Harbin Engineering University, Harbin (China)

2011-08-15

Integrated Pressurized Water Reactor (IPWR) owns more than one once-through steam generators (OTSGs). Flow instability may occur in secondary side of OTSG under certain conditions. Trying to avoid the occurrence of flow instability is of great important for the safe and stable operation of OTSG. Because of the fact that flow instability often occurs in certain regions, so when OTSGs operate with low load, OTSGs can be separated into several groups, which can avoid flow instability. In this paper, operational characteristics of IPWR are analyzed by RELAP5/MOD3.4 code and during the discussion of group operation, a rapid change load operation scheme using OTSG group operation mode which can be used in IPWR is proposed.

Operation of Ferroelectric Plasma Sources in a Gas Discharge Mode

International Nuclear Information System (INIS)

Dunaevsky, A.; Fisch, N.J.

2004-01-01

Ferroelectric plasma sources in vacuum are known as sources of ablative plasma, formed due to surface discharge. In this paper, observations of a gas discharge mode of operation of the ferroelectric plasma sources (FPS) are reported. The gas discharge appears at pressures between approximately 20 and approximately 80 Torr. At pressures of 1-20 Torr, there is a transition from vacuum surface discharge to the gas discharge, when both modes coexist and the surface discharges sustain the gas discharge. At pressures between 20 and 80 Torr, the surface discharges are suppressed, and FPS operate in pure gas discharge mode, with the formation of almost uniform plasma along the entire surface of the ceramics between strips. The density of the expanding plasma is estimated to be about 1013 cm-3 at a distance of 5.5 mm from the surface. The power consumption of the discharge is comparatively low, making it useful for various applications. This paper also presents direct measurements of the yield of secondary electron emission from ferroelectric ceramics, which, at low energies of primary electrons, is high and dependent on the polarization of the ferroelectric material

Non-leptonic kaon decays at large Nc

Science.gov (United States)

Donini, Andrea; Hernández, Pilar; Pena, Carlos; Romero-López, Fernando

2018-03-01

We study the scaling with the number of colors Nc of the weak amplitudes mediating kaon mixing and decay, in the limit of light charm masses (mu = md = ms = mc). The amplitudes are extracted directly on the lattice for Nc = 3 - 7 (with preliminar results for Nc = 8 and 17) using twisted mass QCD. It is shown that the (sub-leading) 1 /Nc corrections to B\\hatk are small and that the naive Nc → ∞ limit, B\\hatk = 3/4, seems to be recovered. On the other hand, the O (1/Nc) corrections in K → ππ amplitudes (derived from K → π matrix elements) are large and fully anti-correlated in the I = 0 and I = 2 channels. This may have some implications for the understanding of the ΔI = 1/2 rule.

A multi-mode operation control strategy for flexible microgrid based on sliding-mode direct voltage and hierarchical controls.

Science.gov (United States)

Zhang, Qinjin; Liu, Yancheng; Zhao, Youtao; Wang, Ning

2016-03-01

Multi-mode operation and transient stability are two problems that significantly affect flexible microgrid (MG). This paper proposes a multi-mode operation control strategy for flexible MG based on a three-layer hierarchical structure. The proposed structure is composed of autonomous, cooperative, and scheduling controllers. Autonomous controller is utilized to control the performance of the single micro-source inverter. An adaptive sliding-mode direct voltage loop and an improved droop power loop based on virtual negative impedance are presented respectively to enhance the system disturbance-rejection performance and the power sharing accuracy. Cooperative controller, which is composed of secondary voltage/frequency control and phase synchronization control, is designed to eliminate the voltage/frequency deviations produced by the autonomous controller and prepare for grid connection. Scheduling controller manages the power flow between the MG and the grid. The MG with the improved hierarchical control scheme can achieve seamless transitions from islanded to grid-connected mode and have a good transient performance. In addition the presented work can also optimize the power quality issues and improve the load power sharing accuracy between parallel VSIs. Finally, the transient performance and effectiveness of the proposed control scheme are evaluated by theoretical analysis and simulation results. Copyright © 2015 ISA. Published by Elsevier Ltd. All rights reserved.

Quiescent H-mode operation using torque from non-axisymmetric, non-resonant magnetic fields

International Nuclear Information System (INIS)

Burrell, K.H.; Garofalo, A.M.; Osborne, T.H.; Snyder, P.B.; Solomon, W.M.; Park, J.-K.; Fenstermacher, M.E.; Orlov, D.M.

2013-01-01

Quiescent H-mode (QH-mode) sustained by magnetic torque from non-axisymmetric magnetic fields is a promising operating mode for future burning plasmas including ITER. Using magnetic torque from n = 3 fields to replace counter-I p torque from neutral beam injection, we have achieved long duration, counter-rotating QH-mode operation with neutral beam injection (NBI) torque ranging continuously from counter-I p up to co-I p values of about 1 N m. This co-I p torque is about 3 times the scaled torque that ITER will have. This range also includes operation at zero net NBI torque, applicable to rf wave heated plasmas. These n = 3 fields have been created using coils either inside or, most recently, outside the toroidal coils. Experiments utilized an ITER-relevant lower single-null plasma shape and were done with ITER-relevant values ν ped * ∼0.08, β T ped ∼ 1%$ and β N = 2. Discharges have confinement quality H 98y2 = 1.3, exceeding the value required for ITER. Initial work with low q 95 = 3.4 QH-mode plasmas transiently reached fusion gain values of G = β N H 89 /q 95 2 =0.4, which is the desired value for ITER; the limits on G have not yet been established. This paper also includes the most recent results on QH-mode plasmas run without n = 3 fields and with co-I p NBI; these shots exhibit co-I p plasma rotation and require NBI torque ⩾2 N m. The QH-mode work to date has made significant contact with theory. The importance of edge rotational shear is consistent with peeling–ballooning mode theory. We have seen qualitative and quantitative agreement with the predicted torque from neoclassical toroidal viscosity. (paper)

Operating modes of electrochemical H-concentration probes for tritium sensors

International Nuclear Information System (INIS)

Juhera, E.; Colominas, S.; Abellà, J.

2015-01-01

Highlights: • Synthesis and chemical characterization of Sr(Ce_0_._9–Zr_0_._1)_0_._9_5Yb_0_._0_5O_3_−_α proton conductor ceramic. • Evaluation of the sensor performance at different hydrogen concentrations. • Two different operating modes of the sensors: amperometric and potentiometric. • In amperometric mode sensor sensitivity can be tuned by changing the applied voltage. - Abstract: Potentiometric hydrogen sensors using different solid-state electrolytes have been designed and tested at the Electrochemical Methods Lab at Institut Quimic de Sarria (IQS). The most promising element (Sr(Ce_0_._9–Zr_0_._1)_0_._9_5Yb_0_._0_5O_3_−_α) has been selected for this work in order to evaluate the sensor performance at different hydrogen concentrations in two different operating modes: amperometric and potentiometric. In addition, the sensor response has been evaluated at different working temperatures (500, 575 and 650 °C). The experiments performed proved that when the sensor was used in a potentiometric mode, there is a threshold hydrogen concentration that the sensor can detect depending on the working conditions; 15 mbar at 575 °C and 10 mbar 650 °C. At 500 °C the minimum working temperature of this ceramic has not been achieved, so large deviations between experimental data and theoretical calculations has been obtained. When the sensor was used in an amperometric mode the obtained currents increased as a function of the applied voltage. At a fixed potential, the higher the temperature the higher the current was. So the sensor sensitivity can be tuned by changing the applied voltage at a fixed temperature and hydrogen concentration.

Analysis of Sleep-Mode Downlink Scheduling Operations in EPON Systems

DEFF Research Database (Denmark)

Yan, Ying; Dittmann, Lars

2011-01-01

Energy management strategy has been considered as an important component in the future Ethernet Passive Optical Networks (EPONs). In this paper, a sleeping mode operation is studied, and a downlink packet scheduling scheme is analyzed to preserve energy consumption and maintain the required Qo......S. This paper proposes a novel sleep-mode downlink packet scheduling scheme in order to enhance the sleep control function. Simulation results confirm that the proposed approach offers effective power management on the basis of the traffic conditions. The trade-off between network performances and the power...

Single mode operation of a hybrid optically pumped D2O far infrared laser

International Nuclear Information System (INIS)

Yuan, D.C.; Siegrist, M.R.

1990-04-01

We have achieved single mode operation in a hybrid optically pumped D 2 O far infrared laser. The active volume of the resonator was divided into two sections separated by a thin plastic foil. The larger section served as the main gain medium and the shorter section as mode selective element. The vapor pressure in the smaller volume was either very low or alternatively about 3 times higher than the pressure in the main part. In both cases single mode operation was achieved without any reduction of the total output energy. (author) 13 refs., 7 figs

A vaccine formulation combining rhoptry proteins NcROP40 and NcROP2 improves pup survival in a pregnant mouse model of neosporosis.

Science.gov (United States)

Pastor-Fernández, Iván; Arranz-Solís, David; Regidor-Cerrillo, Javier; Álvarez-García, Gema; Hemphill, Andrew; García-Culebras, Alicia; Cuevas-Martín, Carmen; Ortega-Mora, Luis M

2015-01-30

Currently there are no effective vaccines for the control of bovine neosporosis. During the last years several subunit vaccines based on immunodominant antigens and other proteins involved in adhesion, invasion and intracellular proliferation of Neospora caninum have been evaluated as targets for vaccine development in experimental mouse infection models. Among them, the rhoptry antigen NcROP2 and the immunodominant NcGRA7 protein have been assessed with varying results. Recent studies have shown that another rhoptry component, NcROP40, and NcNTPase, a putative dense granule antigen, exhibit higher expression levels in tachyzoites of virulent N. caninum isolates, suggesting that these could be potential vaccine candidates to limit the effects of infection. In the present work, the safety and efficacy of these recombinant antigens formulated in Quil-A adjuvant as monovalent vaccines or pair-wise combinations (rNcROP40+rNcROP2 and rNcGRA7+rNcNTPase) were evaluated in a pregnant mouse model of neosporosis. All the vaccine formulations elicited a specific immune response against their respective native proteins after immunization. Mice vaccinated with rNcROP40 and rNcROP2 alone or in combination produced the highest levels of IFN-γ and exhibited low parasite burdens and low IgG antibody levels after the challenge. In addition, most of the vaccine formulations were able to increase the median survival time in the offspring. However, pup survival only ensued in the groups vaccinated with rNcROP40+rNcROP2 (16.2%) and rNcROP2 (6.3%). Interestingly, vertical transmission was not observed in those survivor pups immunized with rNcROP40+rNcROP2, as shown by PCR analyses. These results show a partial protection against N. caninum infection after vaccination with rNcROP40+rNcROP2, suggesting a synergistic effect of the two recombinant rhoptry antigens. Copyright © 2014 Elsevier B.V. All rights reserved.

Flight Simulator Evaluation of Enhanced Propulsion Control Modes for Emergency Operation

Science.gov (United States)

Litt, Jonathan, S; Sowers, T.; Owen, A., Karl; Fulton, Christopher, E.; Chicatelli, Amy, K.

2012-01-01

This paper describes piloted evaluation of enhanced propulsion control modes for emergency operation of aircraft. Fast Response and Overthrust modes were implemented to assess their ability to help avoid or mitigate potentially catastrophic situations, both on the ground and in flight. Tests were conducted to determine the reduction in takeoff distance achievable using the Overthrust mode. Also, improvements in Dutch roll damping, enabled by using yaw rate feedback to the engines to replace the function of a stuck rudder, were investigated. Finally, pilot workload and ability to handle the impaired aircraft on approach and landing were studied. The results showed that improvement in all aspects is possible with these enhanced propulsion control modes, but the way in which they are initiated and incorporated is important for pilot comfort and perceived benefit.

Operational range and transport barrier of the H-mode in the stellarator W7-AS

International Nuclear Information System (INIS)

Hirsch, M.; Amadeo, P.; Anton, M.; Baldzuhn, J.; Brakel, R.; Bleuel, J.; Fiedler, S.; Geist, T.; Grigull, P.; Hartfuss, H.J.; Jaenicke, R.; Kick, M.; Kisslinger, J.; Koponen, J.; Wagner, F.; Weller, A.; Wobig, H.; Zoletnik, S.; Holzhauer, E.

1998-01-01

In W7-AS the H-mode is characterized by an edge transport barrier localized in the first 3-4 cm inside the separatrix. In the ELMy H-mode preceding the quiescent state ELMs appear as a sudden breakdown of the edge transport barrier in coincidence with bursts of fluctuations. Between ELMs fluctuations are identical to those of the quiescent H-mode. The operational range of the quiescent H-mode is determined by narrow windows of the edge rotational transform and a threshold edge electron density. In contrast, ELM-like events are observed for a variety of plasma conditions by far exceeding the narrow operational windows for the quiescent state. (author)

Qualification of a laser cutting process for nuclear dismantling operations AREVA NC BU Valorisation - CEA/DPAD - IRSN/DSU/SERAC

International Nuclear Information System (INIS)

2008-01-01

A major decommissioning project is under way on the Marcoule French Atomic Site (CEA) at the UP1 reprocessing plant where AREVA plays the role of prime contractor. Due to severe radiological levels on certain cells, these require remote operations. The cutting tools commonly used today are mainly mechanical such as grinders, saws and hydraulic shears. Nowadays, the feed-back shows that the implementation of these mechanical techniques: *?Is the main factor of mechanical failures of the remote arms. *?Requires a lot of spare parts (saw blades, discs...) The future cutting operations to be done in the UP1 reprocessing plant needs to be more industrial and productive. That is why CEA and AREVA NC are evaluating a new cutting process based on a laser set up on a remote arm. The laser cutting is already widely used in none nuclear environment and the goal is to evaluate if this thermal process may be used in nuclear installations with existing remote control arms. (authors)

Qualification of a laser cutting process for nuclear dismantling operations AREVA NC BU Valorisation - CEA/DPAD - IRSN/DSU/SERAC

Energy Technology Data Exchange (ETDEWEB)

NONE

2008-07-01

A major decommissioning project is under way on the Marcoule French Atomic Site (CEA) at the UP1 reprocessing plant where AREVA plays the role of prime contractor. Due to severe radiological levels on certain cells, these require remote operations. The cutting tools commonly used today are mainly mechanical such as grinders, saws and hydraulic shears. Nowadays, the feed-back shows that the implementation of these mechanical techniques: *?Is the main factor of mechanical failures of the remote arms. *?Requires a lot of spare parts (saw blades, discs...) The future cutting operations to be done in the UP1 reprocessing plant needs to be more industrial and productive. That is why CEA and AREVA NC are evaluating a new cutting process based on a laser set up on a remote arm. The laser cutting is already widely used in none nuclear environment and the goal is to evaluate if this thermal process may be used in nuclear installations with existing remote control arms. (authors)

NSLS-II injector commissioning and initial operation

Energy Technology Data Exchange (ETDEWEB)

Bacha, B.; Blum, E.; Bassi, B.; Bengtsson, J.; Blednykh, A.; Buda, S.; Cheng, W.; Choi, J.; Cuppolo, J.; D Alsace, R.; Davidsaver, M.; DeLong, J.; Doom, L.; Durfee, d.; fliller, R.; Fulkerson, M.; Ganetis, G.; Gao, F.; Gardner, C.; Guo, W.; Heese, R.; Hidaka, Y.; Hu, Y.; Johanson, M.; Kosciuk, B.; Kowalski, S.; Dramer, S.; Krinsky, S.; Li, Y.; Louie, W.; Maggipinto, M.; Marino, P.; Mead, J.; Oliva, G.; Padrazo, D.; Pedersen, K.; Podobedov, B.; Rainer, R.; Rose, J.; Santana, M.; Seletskiy, S.; Shaftan, T.; Singh, O.; Singh, P.; Smalyuk, V.; Smith, R.; Summers, T.; Tagger, J.; Tian, Y.; Wahl, W.; Wang, G.; Weiner, G.; Willeke, F.; Yang, L.; Yang, X.; Zeitler, E.; Zitvogel, E.; Zuhoski, P.

2015-05-03

The injector for the National Synchrotron Light Source II (NSLS-II) storage ring consists of a 3 GeV booster synchrotron and a 200 MeV S-band linac. The linac was designed to produce either a single bunch with a charge of 0.5 nC of electrons or a train of bunches up to 300 ns long containing a total charge of 15 nC. The booster was designed to accelerate up to 15 nC each cycle in a train of bunches up to 300 ns long. Linac commissioning was completed in April 2012. Booster commissioning was started in November 2013 and completed in March 2014. All of the significant design goals were satisfied including beam emittance, energy spread, and transport efficiency. While the maximum booster charge accelerated was only 10 nC, this has proven to be more than sufficient for storage ring commissioning and operation. The injector has operated reliably during storage ring operation since then. Results will be presented showing measurements of linac and booster operating parameters achieved during commissioning and initial operation. Operating experience and reliability during the first year of NSLS-II operation will be discussed.

MATHEMATICAL AND EXPERIMENTAL MODELING OF CENTRIFUGAL TURBOMACHINES’ OPERATING MODES WITH A COAXIAL ARRANGEMENT OF IMPELLERS

Directory of Open Access Journals (Sweden)

S. V. Podbolotov

2018-03-01

Full Text Available The relevance of this work is conditioned by the possibility of expanding the range of efficient operation of the turbine by changing the flow pattern of the fluid flow from stage to stage. The purpose of the work is to establish rational modes of operation of turbo machines with coaxially mounted impellers. Research methodology: in this work, we used a systematic approach, which includes the analysis of the results of mathematical modeling and experimental studies. Results. We carried out the analysis of the influence of operating modes on the pressure developed by the turbine. These operating modes include directions of rotation of impellers and the value of their circumferential speeds. The study analyzed the two options of installation: the rotation of the wheels in one direction and the rotation of the wheels in the opposite direction. The theoretical studies were based on a well-known Euler theory under certain assumptions: the cross section averaged for all flow settings; the motion of impellers was made one-dimensional and axisymmetric; the impellers have an infinite number of infinitely thin blades; the flow of fluid does not have viscosity, and the influence of friction forces is absent. The experimental aerodynamic characteristics of the centrifugal turbo machine with coaxial arrangement of driving wheels were obtained on an especially designed aerodynamic stand. Pressure-flow characteristics obtained theoretically and experimentally are presented. Conclusion. The use of coaxial impellers contributes to developing pressure and allows you to extend the range of efficient operation of centrifugal turbo machines. The most rational mode of operation of coaxially mounted impellers is the counter rotation mode. The increase of pressure developed by the Turbo machinery at work in this mode is proven theoretically and confirmed experimentally. Sufficient convergence of mathematical and experimental studies suggests the reliability of the

NC10 bacteria in marine oxygen minimum zones

DEFF Research Database (Denmark)

Padilla, Cory C; Bristow, Laura A; Sarode, Neha

2016-01-01

Bacteria of the NC10 phylum link anaerobic methane oxidation to nitrite denitrification through a unique O2-producing intra-aerobic methanotrophy pathway. A niche for NC10 in the pelagic ocean has not been confirmed. We show that NC10 bacteria are present and transcriptionally active in oceanic....... rRNA and mRNA transcripts assignable to NC10 peaked within the OMZ and included genes of the putative nitrite-dependent intra-aerobic pathway, with high representation of transcripts containing the unique motif structure of the nitric oxide (NO) reductase of NC10 bacteria, hypothesized...

Virtual NC machine model with integrated knowledge data

International Nuclear Information System (INIS)

Sidorenko, Sofija; Dukovski, Vladimir

2002-01-01

The concept of virtual NC machining was established for providing a virtual product that could be compared with an appropriate designed product, in order to make NC program correctness evaluation, without real experiments. This concept is applied in the intelligent CAD/CAM system named VIRTUAL MANUFACTURE. This paper presents the first intelligent module that enables creation of the virtual models of existed NC machines and virtual creation of new ones, applying modular composition. Creation of a virtual NC machine is carried out via automatic knowledge data saving (features of the created NC machine). (Author)

77 FR 25652 - Drawbridge Operation Regulation; Atlantic Intracoastal Waterway (AIWW), at Wrightsville Beach, NC...

Science.gov (United States)

2012-05-01

... are expected to have minimal impacts on mariners due to the short duration that the moveable bridges... North Carolina Department of Transportation (NCDOT) bridges: The S.R. 74 Bridge, across the AIWW, mile 283.1 at Wrightsville Beach, NC; the Cape Fear Memorial Bridge across the Cape Fear River, mile 26.8...

Efficient single-mode operation of a cladding-pumped ytterbium-doped helical-core fiber laser.

Science.gov (United States)

Wang, P; Cooper, L J; Sahu, J K; Clarkson, W A

2006-01-15

A novel approach to achieving robust single-spatial-mode operation of cladding-pumped fiber lasers with multimode cores is reported. The approach is based on the use of a fiber geometry in which the core has a helical trajectory within the inner cladding to suppress laser oscillation on higher-order modes. In a preliminary proof-of-principle study, efficient single-mode operation of a cladding-pumped ytterbium-doped helical-core fiber laser with a 30 microm diameter core and a numerical aperture of 0.087 has been demonstrated. The laser yielded 60.4 W of output at 1043 nm in a beam with M2 clad fiber lasers.

Multi-Mode Operation for On-line Uninterruptible Power Supply System

DEFF Research Database (Denmark)

Lu, Jinghang; Savaghebi, Mehdi; Golestan, Saeed

2018-01-01

To enhance the robustness and disturbance rejection ability of an on-line uninterruptible power supply (UPS) system, an Internal Model Control (IMC)-based DC-link voltage regulation method is proposed in this paper. Furthermore, the multi-mode operations of the on-line UPS system are investigated...

New operational modes for the Ta2O5-based electrolyte conductance cell

NARCIS (Netherlands)

Olthuis, Wouter; Smith, A.; van der Zalm, R.A.J.; Bergveld, Piet

1994-01-01

Based on the recently presented conductance cell, two specific operational modes are proposed. In the oscillator mode, the conductivity of the electrolyte determines the frequency of an oscillator, experimentally obtaining a shift from 10 to 27 kHz for a KCl concentration range from 0.5 to 100 mM.

Operation mode switchable charge-trap memory based on few-layer MoS2

Science.gov (United States)

Hou, Xiang; Yan, Xiao; Liu, Chunsen; Ding, Shijin; Zhang, David Wei; Zhou, Peng

2018-03-01

Ultrathin layered two-dimensional (2D) semiconductors like MoS2 and WSe2 have received a lot of attention because of their excellent electrical properties and potential applications in electronic devices. We demonstrate a charge-trap memory with two different tunable operation modes based on a few-layer MoS2 channel and an Al2O3/HfO2/Al2O3 charge storage stack. Our device shows excellent memory properties under the traditional three-terminal operation mode. More importantly, unlike conventional charge-trap devices, this device can also realize the memory performance with just two terminals (drain and source) because of the unique atomic crystal electrical characteristics. Under the two-terminal operation mode, the erase/program current ratio can reach up to 104 with a stable retention property. Our study indicates that the conventional charge-trap memory cell can also realize the memory performance without the gate terminal based on novel two dimensional materials, which is meaningful for low power consumption and high integration density applications.

Trickle-Charge: a New Operational Mode for PEP-II

International Nuclear Information System (INIS)

Kozanecki, W.; Colocho, W.S.; Decker, F.-J.; Ecklund, S.; Fisher, A.S.; Iverson, R.H.; O'Grady, C.; Seeman, J.; Sullivan, M.K.; Turner, J.L.; Weaver, M.; Wienands, U.; SLAC

2005-01-01

In regular top-up-and-coast operation, PEP-II average luminosity is about 70-75% of the peak luminosity due to detector ramp-down and ramp-up times plus the time it takes to top-up both beams. We recently commissioned a new operational mode where the Low Energy Ring is injected continuously without ramping down the detector. The benefits--increased luminosity lifetime and roughly half the number of top-ups per shift--were expected to give an increase in delivered luminosity of about 15% at the same peak luminosity; this was confirmed in test runs. In routine trickle operation, however, it appears that the increase in delivered luminosity is more than twice that due to an increase in availability credited to the more stable operating conditions during trickle operation. Further gains were made when continuous injection was extended to the high energy ring as well. In this paper we will present our operational experience as well as some of the diagnostics we use to monitor and maintain tuning of the machine in order to control injection background and protect the detector

A fluid-coupled transmitting CMUT operated in collapse mode : Semi-analytic modeling and experiments

NARCIS (Netherlands)

Pekař, Martin; van Nispen, Stephan H.M.; Fey, Rob H.B.; Shulepov, Sergei; Mihajlović, Nenad; Nijmeijer, Henk

2017-01-01

An electro-mechanical, semi-analytic, reduced-order (RO) model of a fluid-loaded transmitting capacitive-micromachined ultrasound transducer (CMUT) operated in collapse mode is developed. Simulation of static deflections, approximated by a linear combination of six mode shapes, are benchmarked

The optimization of nuclear power plants operation modes in emergency situations

Science.gov (United States)

Zagrebayev, A. M.; Trifonenkov, A. V.; Ramazanov, R. N.

2018-01-01

An emergency situations resulting in the necessity for temporary reactor trip may occur at the nuclear power plant while normal operating mode. The paper deals with some of the operation c aspects of nuclear power plant operation in emergency situations and during threatened period. The xenon poisoning causes limitations on the variety of statements of the problem of calculating characteristics of a set of optimal reactor power off controls. The article show a possibility and feasibility of new sets of optimization tasks for the operation of nuclear power plants under conditions of xenon poisoning in emergency circumstances.

Density fluctuation measurements via reflectometry on DIII-D during L- and H-mode operation

International Nuclear Information System (INIS)

Doyle, E.J.; Lehecka, T.; Luhmann, N.C. Jr.; Peebles, W.A.; Philipona, R.

1990-01-01

The unique ability of reflectometers to provide radial density fluctuation measurements with high spatial resolution (of the order of ≤ centimeters, is ideally suited to the study of the edge plasma modifications associated with H-mode operation. Consequently, attention has been focused on the study of these phenomena since an improved understanding of the physics of H-mode plasmas is essential if a predictive capability for machine performance is to be developed. In addition, DIII-D is ideally suited for such studies since it is a major device noted for its robust H-mode operation and excellent basic plasma profile diagnostic information. The reflectometer system normally used for fluctuation studies is an O-mode, homodyne, system utilizing 7 discrete channels spanning 15-75 GHz, with corresponding critical densities of 2.8x10 18 to 7x10 19 m -3 . The Gunn diode sources in this system are only narrowly tunable in frequency, so the critical densities are essentially fixed. An X-mode system, utilizing a frequency tunable BWO source, has also been used to obtain fluctuation data, and in particular, to 'fill in the gaps' between the discrete O-mode channels. (author) 12 refs., 5 figs

Dual fuel mode operation in diesel engines using renewable fuels: Rubber seed oil and coir-pith producer gas

Energy Technology Data Exchange (ETDEWEB)

Ramadhas, A.S.; Jayaraj, S.; Muraleedharan, C. [Department of Mechanical Engineering, National Institute of Technology Calicut, Calicut-673601 (India)

2008-09-15

Partial combustion of biomass in the gasifier generates producer gas that can be used as supplementary or sole fuel for internal combustion engines. Dual fuel mode operation using coir-pith derived producer gas and rubber seed oil as pilot fuel was analyzed for various producer gas-air flow ratios and at different load conditions. The engine is experimentally optimized with respect to maximum pilot fuel savings in the dual fuel mode operation. The performance and emission characteristics of the dual fuel engine are compared with that of diesel engine at different load conditions. Specific energy consumption in the dual-fuel mode of operation with oil-coir-pith operation is found to be in the higher side at all load conditions. Exhaust emission was found to be higher in the case of dual fuel mode of operation as compared to neat diesel/oil operation. Engine performance characteristics are inferior in fully renewable fueled engine operation but it suitable for stationary engine application, particularly power generation. (author)

AIR ATMOSPHERIC-PRESSURE DISCHARGERS FOR OPERATION IN HIGH-FREQUENCY SWITCHING MODE.

Directory of Open Access Journals (Sweden)

L.S. Yevdoshenko

2013-10-01

Full Text Available Operation of two designs of compact multigap dischargers has been investigated in a high-frequency switching mode. It is experimentally revealed that the rational length of single discharge gaps in the designs is 0.3 mm, and the maximum switching frequency is 27000 discharges per second under long-term stable operation of the dischargers. It is shown that in pulsed corona discharge reactors, the pulse front sharpening results in increasing the operating electric field strength by 1.3 – 1.8 times.

Single mode operation of a TEA CO2 laser

International Nuclear Information System (INIS)

Wada, Kazuhiro; Tunawaki, Yoshiaki; Yamanaka, Masanobu.

1993-01-01

Single mode operation of a TEA CO 2 laser was performed by using an optical system of Fox-Smith type. Laser beam was taken out from the cavity by using a beam splitter, and was reflected by a mirror back to the cavity. By inserting a Fabry-Perot etalon between the splitter and the mirror, beat of laser pulses can be removed completly. (author)

Representing Operational Modes for Situation Awareness

International Nuclear Information System (INIS)

Kirchhübel, Denis; Lind, Morten; Ravn, Ole

2017-01-01

Operating complex plants is an increasingly demanding task for human operators. Diagnosis of and reaction to on-line events requires the interpretation of real time data. Vast amounts of sensor data as well as operational knowledge about the state and design of the plant are necessary to deduct reasonable reactions to abnormal situations. Intelligent computational support tools can make the operator’s task easier, but they require knowledge about the overall system in form of some model. While tools used for fault-tolerant control design based on physical principles and relations are valuable tools for designing robust systems, the models become too complex when considering the interactions on a plant-wide level. The alarm systems meant to support human operators in the diagnosis of the plant-wide situation on the other hand fail regularly in situations where these interactions of systems lead to many related alarms overloading the operator with alarm floods. Functional modelling can provide a middle way to reduce the complexity of plant-wide models by abstracting from physical details to more general functions and behaviours. Based on functional models the propagation of failures through the interconnected systems can be inferred and alarm floods can potentially be reduced to their root-cause. However, the desired behaviour of a complex system changes due to operating procedures that require more than one physical and functional configuration. In this paper a consistent representation of possible configurations is deduced from the analysis of an exemplary start-up procedure by functional models. The proposed interpretation of the modelling concepts simplifies the functional modelling of distinct modes. The analysis further reveals relevant links between the quantitative sensor data and the qualitative perspective of the diagnostics tool based on functional models. This will form the basis for the ongoing development of a novel real-time diagnostics system based

Representing Operational Modes for Situation Awareness

Science.gov (United States)

Kirchhübel, Denis; Lind, Morten; Ravn, Ole

2017-01-01

Operating complex plants is an increasingly demanding task for human operators. Diagnosis of and reaction to on-line events requires the interpretation of real time data. Vast amounts of sensor data as well as operational knowledge about the state and design of the plant are necessary to deduct reasonable reactions to abnormal situations. Intelligent computational support tools can make the operator’s task easier, but they require knowledge about the overall system in form of some model. While tools used for fault-tolerant control design based on physical principles and relations are valuable tools for designing robust systems, the models become too complex when considering the interactions on a plant-wide level. The alarm systems meant to support human operators in the diagnosis of the plant-wide situation on the other hand fail regularly in situations where these interactions of systems lead to many related alarms overloading the operator with alarm floods. Functional modelling can provide a middle way to reduce the complexity of plant-wide models by abstracting from physical details to more general functions and behaviours. Based on functional models the propagation of failures through the interconnected systems can be inferred and alarm floods can potentially be reduced to their root-cause. However, the desired behaviour of a complex system changes due to operating procedures that require more than one physical and functional configuration. In this paper a consistent representation of possible configurations is deduced from the analysis of an exemplary start-up procedure by functional models. The proposed interpretation of the modelling concepts simplifies the functional modelling of distinct modes. The analysis further reveals relevant links between the quantitative sensor data and the qualitative perspective of the diagnostics tool based on functional models. This will form the basis for the ongoing development of a novel real-time diagnostics system based

Impurity deposition on surface probes during different operation modes at EXTRAP T1

International Nuclear Information System (INIS)

Gudowska, I.; Bergsaker, H.; Hellblom, G.

1991-01-01

Surface probes were used in the impurity control program during initial operation of the EXTRAP T1 device. The EXTRAP concept, design and operation characteristics are given elsewhere. The dimensions of the device are R/a=0.5m/0.06m. Four different modes of operation were studied: pure EXTRAP, mixed EXTRAP, RFP and ULQ. Briefly, all four are toroidal plasma discharges, with poloidal magnetic field due to the toroidal plasma current. In the ULQ case, a relatively strong external toroidal magnetic field is applied. In the RFP, and in the mixed mode, an external toroidal field is applied early in the discharge, and the plasma subsequently relaxes into a state with self-generated toroidal field. In the EXTRAP and mixed EXTRAP modes, an additional strong external octupole field is applied, breaking the poloidal symmetry. Throughout the initial period of operation of the device, the plasma performance was largely dominated by impurities, in particular fluorine, which was present due to an accidental contamination of the vessel. Probes have been exposed in wall/liner position, and the objective has been to measure erosion and deposition and try to identify which mechanisms are mainly responsible for impurity production. (author) 5 refs., 2 figs., 1 tab

The revised program for measurements in intense operation mode according to AVV-IMIS

International Nuclear Information System (INIS)

Bieringer, J.; Wirth, E.; Buehling, A.; Mueller-Neumann, M.; Haase, G.; Heinrich, T.; Steinkopff, T.; Wiezorek, C.

2007-01-01

The monitoring program for measurements in intense operation mode has been revised recently by a working group at the Federal Ministry for Environment, Nature Conservation and Reactor Safety (BMU). The major issues of the revision are reported in this contribution. Measurements in intense operation must be appropriate for fast assessment of the radiological situation, for estimating the dose to the population and for decisions on countermeasures to minimize the dose. In order to meet these requirements the structure of the measurement program in intense operation mode was divided into three phases when different exposition paths are relevant: before and during dispersion of radioactive material, immediately after dispersion of radioactive material has ended and a late phase when contamination values have decreased in different environmental media. For each of these phases a special measurement program was defined that is tailored to achieve the above mentioned objectives. Minimum detectable activity concentrations were introduced similar to the measurement program in routine operation mode. They follow the intervention levels in the catalogue of countermeasures and maximum permitted values given by the European Union (EU) for food and animal feed. The minimum detectable activity concentrations were defined such that the detection of 1/10 of the intervention levels for countermeasures is ensured. (orig.)

Operating experience with superconducting cavities at the TESLA test facility

International Nuclear Information System (INIS)

Moeller, Wolf-Dietrich

2003-01-01

A description of the TESLA Test Facility, which has been set up at DESY by the TeV Energy Superconducting Accelerator (TESLA) collaboration, will be given as it is now after five years of installation and operation. The experience with the first three modules, each containing 8 superconducting 9-cell cavities, installed and operated in the TTF-linac will be described. The measurements in the vertical and horizontal cryostats as well as in the modules will be compared. Recent results of the operation at the TESLA design current, macropulses of 800 μsec with bunches of 3.2 nC at a rate of 2.25 MHz are given. New measurement results of the higher order modes (HOM) will be presented. The operation and optimisation of the TTF Free Electron Laser (TTF-FEL) will also be covered in this paper. (author)

Design Considerations for CMOS Current Mode Operational Amplifiers and Current Conveyors

DEFF Research Database (Denmark)

Bruun, Erik

implementations of current mode opamps in CMOS technology are described. Also, current conveyor configurations with multiple outputs and flexible feedback connections from outputs to inputs are introduced. The dissertation includes several examples of circuit configurations ranging from simple class A and class......This dissertation is about CMOS current conveyors and current mode operational amplifiers (opamps). They are generic devices for continuous time signal processing in circuits and systems where signals are represented by currents.Substantial advancements are reported in the dissertation, both...... related to circuit implementations and system configurations and to an analysis of the fundamental limitations of the current mode technique.In the field of system configurations and circuit implementations different configurations of high gain current opamps are introduced and some of the first...

Migration behavior of Cu and Zn in landfill with different operation modes

International Nuclear Information System (INIS)

Long Yuyang; Shen Dongsheng; Wang Hongtao; Lu Wenjing

2010-01-01

Cu and Zn were chosen to study the heavy metal migration behavior and mechanism in three simulated landfills with different operation modes, namely conventional landfill (CL), leachate directly recirculated landfill (RL) and leachate pre-treated bioreactor landfill (BL). It showed that Cu and Zn in refuse experienced periodic migration and retention gradually during decomposition, and the variation of Cu(II) and Zn(II) in leachate correspondingly reflected the releasing behavior of Cu and Zn in landfill refuse at different stabilization stages. Except for their accumulated leaching amounts, Cu(II) and Zn(II) concentrations in leachate from landfills with different operation modes had no significant difference. The accumulated leaching amounts of Cu and Zn from CL showed exponential increase, while those of RL and BL showed exponential decay. The operation of bioreactor landfill with leachate recirculation can obviously attenuate the heavy metal leaching than conventional operation. The introduction of methanogenic reactor (MR) in bioreactor landfill can further promote the immobilization of heavy metal in refuse than leachate recirculation directly.

Early detection of power system disturbances as a condition for safe operation of the Dukovany NPP in the 'Island operation mode'

International Nuclear Information System (INIS)

Petruzela, I.

1997-01-01

The ''Frequency Plan'' worked out for the Czech Power System specifies a set of preventive measures along with the set of the frequency ranges. This problem was solved in details for the Dukovany nuclear power plant. The design changes under preparation support a reliable as well as safe operation in the island-operation mode until a full restoration of the whole power system. The design modifications are based on the following three main innovations: An incorporation of the FREA 16 frequency relay into the protection circuits; large modifications in turbine control loops; installation of software routine for the operator to support the island operation mode. The capability of the island operation has been demanded by relevant regulations both for the operating units and for that under construction. The capability can be tested under the transition to houseloads, as well as through the direct simulation of abnormal grid conditions. 1 fig

Evaluating the operational risks of biomedical waste using failure mode and effects analysis.

Science.gov (United States)

Chen, Ying-Chu; Tsai, Pei-Yi

2017-06-01

The potential problems and risks of biomedical waste generation have become increasingly apparent in recent years. This study applied a failure mode and effects analysis to evaluate the operational problems and risks of biomedical waste. The microbiological contamination of biomedical waste seldom receives the attention of researchers. In this study, the biomedical waste lifecycle was divided into seven processes: Production, classification, packaging, sterilisation, weighing, storage, and transportation. Twenty main failure modes were identified in these phases and risks were assessed based on their risk priority numbers. The failure modes in the production phase accounted for the highest proportion of the risk priority number score (27.7%). In the packaging phase, the failure mode 'sharp articles not placed in solid containers' had the highest risk priority number score, mainly owing to its high severity rating. The sterilisation process is the main difference in the treatment of infectious and non-infectious biomedical waste. The failure modes in the sterilisation phase were mainly owing to human factors (mostly related to operators). This study increases the understanding of the potential problems and risks associated with biomedical waste, thereby increasing awareness of how to improve the management of biomedical waste to better protect workers, the public, and the environment.

Operability test report for rotary mode core sampling system number 3

International Nuclear Information System (INIS)

Corbett, J.E.

1996-01-01

This report documents the successful completion of operability testing for the Rotary Mode Core Sampling (RMCS) system number-sign 3. The Report includes the test procedure (WHC-SD-WM-OTP-174), exception resolutions, data sheets, and a test report summary

Operability test procedure for the Rotary Mode Core Sampling System Exhausters 3 and 4

International Nuclear Information System (INIS)

WSaldo, E.J.

1995-01-01

This document provides a procedure for performing operability testing of the Rotary Mode Core Sampling System Exhausters 3 ampersand 4. Upon completion of testing activities an operability testing report will be issued

Single-Phase Microgrid with Seamless Transition Capabilities between Modes of Operation

DEFF Research Database (Denmark)

Micallef, Alexander; Apap, Maurice; Spiteri-Staines, Cyril

2015-01-01

with the secondary control loops that are used to synchronize the microgrid as a single unit to the grid. Simulation results are given that show the seamless transitions between the two modes without any disconnection times for the CC-VSIs and VC-VSIs connected to the microgrid.......Microgrids are an effective way to increase the penetration of DG into the grid. They are capable of operating either in grid-connected or in islanded mode thereby increasing the supply reliability for the end user. This paper focuses on achieving seamless transitions from islanded to grid-connected...

Single mode operation in a pulsed Ti:sapphire laser oscillator with a grazing-incidence four-mirror cavity

CERN Document Server

Ko, D K; Binks, D J; Gloster, L A W; King, T A

1998-01-01

We demonstrate stable single mode operation in a pulsed Ti:sapphire laser oscillator with a novel grazing-incidence four-mirror coupled cavity. This cavity consists of a grating, a gain medium, and four mirrors and, therefore, has a four-arm interferometer configuration. Through the interferometric effect, we could suppress the adjacent modes and obtain stable single mode operation with a bandwidth of < 200 MHz. We also have developed a general analysis of the laser modes and the threshold conditions for configuration and the experimental results agree well with the theoretical predictions.

Comparative Analysis of Battery Behavior with Different Modes of Discharge for Optimal Capacity Sizing and BMS Operation

Directory of Open Access Journals (Sweden)

Mazhar Abbas

2016-10-01

Full Text Available Battery-operated systems are always concerned about the proper management and sizing of a battery. A Traditional Battery Management System (BMS only includes battery-aware task scheduling based on the discharge characteristics of a whole battery pack and do not take into account the mode of the load being served by the battery. On the other hand, an efficient and intelligent BMS should monitor the battery at a cell level and track the load with significant consideration of the load mode. Depending upon the load modes, the common modes of discharge (MOD of a battery identified so far are Constant Power Mode (CPM, Constant Current Mode (CCM and Constant Impedance Mode (CIM. This paper comparatively analyzes the discharging behavior of batteries at an individual cell level for different load modes. The difference in discharging behavior from mode to mode represents the study of the mode-dependent behavior of the battery before its deployment in some application. Based on simulation results, optimal capacity sizing and BMS operation of battery for an assumed situation in a remote microgrid has been proposed.

The experimental studies of operating modes of a diesel-generator set at variable speed

Science.gov (United States)

Obukhov, S. G.; Plotnikov, I. A.; Surkov, M. A.; Sumarokova, L. P.

2017-02-01

A diesel generator set working at variable speed to save fuel is studied. The results of experimental studies of the operating modes of an autonomous diesel generator set are presented. Areas for regulating operating modes are determined. It is demonstrated that the transfer of the diesel generator set to variable speed of the diesel engine makes it possible to improve the energy efficiency of the autonomous generator source, as well as the environmental and ergonomic performance of the equipment as compared with general industrial analogues.

Reactor-relevant quiescent H-mode operation using torque from non-axisymmetric, non-resonant magnetic fields

International Nuclear Information System (INIS)

Burrell, K. H.; Garofalo, A. M; Osborne, T. H.; Schaffer, M. J.; Snyder, P. B.; Solomon, W. M.; Park, J.-K.; Fenstermacher, M. E.

2012-01-01

Results from recent experiments demonstrate that quiescent H-mode (QH-mode) sustained by magnetic torque from non-axisymmetric magnetic fields is a promising operating mode for future burning plasmas. Using magnetic torque from n=3 fields to replace counter-I p torque from neutral beam injection (NBI), we have achieved long duration, counter-rotating QH-mode operation with NBI torque ranging from counter-I p to up to co-I p values of 1-1.3 Nm. This co-I p torque is 3 to 4 times the scaled torque that ITER will have. These experiments utilized an ITER-relevant lower single-null plasma shape and were done with ITER-relevant values of ν ped * and β N ped . These discharges exhibited confinement quality H 98y2 =1.3, in the range required for ITER. In preliminary experiments using n=3 fields only from a coil outside the toroidal coil, QH-mode plasmas with low q 95 =3.4 have reached fusion gain values of G=β N H 89 /q 95 2 =0.4, which is the desired value for ITER. Shots with the same coil configuration also operated with net zero NBI torque. The limits on G and co-I p torque have not yet been established for this coil configuration. QH-mode work to has made significant contact with theory. The importance of edge rotational shear is consistent with peeling-ballooning mode theory. Qualitative and quantitative agreements with the predicted neoclassical toroidal viscosity torque is seen.

Task Analytic Models to Guide Analysis and Design: Use of the Operator Function Model to Represent Pilot-Autoflight System Mode Problems

Science.gov (United States)

Degani, Asaf; Mitchell, Christine M.; Chappell, Alan R.; Shafto, Mike (Technical Monitor)

1995-01-01

Task-analytic models structure essential information about operator interaction with complex systems, in this case pilot interaction with the autoflight system. Such models serve two purposes: (1) they allow researchers and practitioners to understand pilots' actions; and (2) they provide a compact, computational representation needed to design 'intelligent' aids, e.g., displays, assistants, and training systems. This paper demonstrates the use of the operator function model to trace the process of mode engagements while a pilot is controlling an aircraft via the, autoflight system. The operator function model is a normative and nondeterministic model of how a well-trained, well-motivated operator manages multiple concurrent activities for effective real-time control. For each function, the model links the pilot's actions with the required information. Using the operator function model, this paper describes several mode engagement scenarios. These scenarios were observed and documented during a field study that focused on mode engagements and mode transitions during normal line operations. Data including time, ATC clearances, altitude, system states, and active modes and sub-modes, engagement of modes, were recorded during sixty-six flights. Using these data, seven prototypical mode engagement scenarios were extracted. One scenario details the decision of the crew to disengage a fully automatic mode in favor of a semi-automatic mode, and the consequences of this action. Another describes a mode error involving updating aircraft speed following the engagement of a speed submode. Other scenarios detail mode confusion at various phases of the flight. This analysis uses the operator function model to identify three aspects of mode engagement: (1) the progress of pilot-aircraft-autoflight system interaction; (2) control/display information required to perform mode management activities; and (3) the potential cause(s) of mode confusion. The goal of this paper is twofold

Active pixel image sensor with a winner-take-all mode of operation

Science.gov (United States)

Yadid-Pecht, Orly (Inventor); Fossum, Eric R. (Inventor); Mead, Carver (Inventor)

2003-01-01

An integrated CMOS semiconductor imaging device having two modes of operation that can be performed simultaneously to produce an output image and provide information of a brightest or darkest pixel in the image.

Low-bending loss and single-mode operation in few-mode optical fiber

Science.gov (United States)

Yin, Ping; Wang, Hua; Chen, Ming-Yang; Wei, Jin; Cai, Zhi-Min; Li, Lu-Ming; Yang, Ji-Hai; Zhu, Yuan-Feng

2016-10-01

The technique of eliminating the higher-order modes in a few-mode optical fiber is proposed. The fiber is designed with a group of defect modes in the cladding. The higher-order modes in the fiber can be eliminated by bending the fiber to induce strong coupling between the defect modes and the higher-order modes. Numerical simulation shows the bending losses of the LP01 mode are lower than 1.5×10-4 dB/turn for the wavelength shorter than 1.625 μm. The proposed fiber can be bent multiple turns at small bending radius which are preferable for FTTH related applications.

Performance comparison for modes of operation and suppression cases of the clover detector

International Nuclear Information System (INIS)

Kshetri, R

2014-01-01

Peak-to-total ratios have been extracted for a segmented clover detector for various modes of operation and suppression cases. Based on absorption and scattering of gamma-rays, a formalism has been presented for quantifying the advantages of using addback mode and active suppression. Further investigations have been performed to find if the reduction of background counts is caused more by active suppression or by addback process

Tunable single and dual mode operation of an external cavity quantum-dot injection laser

International Nuclear Information System (INIS)

Biebersdorf, A; Lingk, C; De Giorgi, M; Feldmann, J; Sacher, J; Arzberger, M; Ulbrich, C; Boehm, G; Amann, M-C; Abstreiter, G

2003-01-01

We investigate quantum-dot (QD) lasers in an external cavity using Littrow and Littman configurations. Here, we report on a continuously tunable QD laser with a broad tuning range from 1047 to 1130 nm with high stability and efficient side mode suppression. The full-width at half-maximum of the laser line is 0.85 nm determined mainly by the quality of the external grating. This laser can be operated in a dual-mode modus, where the mode-spacing can be tuned continuously between 1.1 and 34 nm. Simultaneous emission of the two laser modes is shown by sum frequency generation experiments

ncRNA consensus secondary structure derivation using grammar strings.

Science.gov (United States)

Achawanantakun, Rujira; Sun, Yanni; Takyar, Seyedeh Shohreh

2011-04-01

Many noncoding RNAs (ncRNAs) function through both their sequences and secondary structures. Thus, secondary structure derivation is an important issue in today's RNA research. The state-of-the-art structure annotation tools are based on comparative analysis, which derives consensus structure of homologous ncRNAs. Despite promising results from existing ncRNA aligning and consensus structure derivation tools, there is a need for more efficient and accurate ncRNA secondary structure modeling and alignment methods. In this work, we introduce a consensus structure derivation approach based on grammar string, a novel ncRNA secondary structure representation that encodes an ncRNA's sequence and secondary structure in the parameter space of a context-free grammar (CFG) and a full RNA grammar including pseudoknots. Being a string defined on a special alphabet constructed from a grammar, grammar string converts ncRNA alignment into sequence alignment. We derive consensus secondary structures from hundreds of ncRNA families from BraliBase 2.1 and 25 families containing pseudoknots using grammar string alignment. Our experiments have shown that grammar string-based structure derivation competes favorably in consensus structure quality with Murlet and RNASampler. Source code and experimental data are available at http://www.cse.msu.edu/~yannisun/grammar-string.

Inherent and antigen-induced airway hyperreactivity in NC mice

Directory of Open Access Journals (Sweden)

Tetsuto Kobayashi

1999-01-01

Full Text Available In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those strains in vivo. NC mice again showed comparable airway reactivity to that seen in A/J mice and a significantly greater reactivity than that seen in BALB/c and C57BL/6 mice. To investigate the effects of airway inflammation on airway reactivity to acetylcholine in vivo, NC and BALB/c mice were sensitized to and challenged with antigen. Sensitization to and challenge with antigen induced accumulation of inflammatory cells, especially eosinophils, in lung and increased airway reactivity in NC and BALB/c mice. These results indicate that NC mice exhibit inherent and antigen-induced airway hyperreactivity. Therefore, NC mice are a suitable strain to use in investigating the mechanisms underlying airway hyperreactivity and such studies will provide beneficial information for understanding the pathophysiology of asthma.

Two-coordinate mini drift chamber operating in a self-quenching streamer mode

International Nuclear Information System (INIS)

Chernenko, S.P.; Smykov, L.P.; Zanevskij, Yu.V.

1993-01-01

Two-coordinate mini drift chambers operating in a self-quenching streamer mode have been developed. The tests have demonstrated these chambers to possess an extended counting plateau, a high operating stability and a high uniformity of efficiency over detecting area. The space resolution along anode wires is not worse than 250μm; the expected space resolution for the second coordinate is about 100 μm

Self-mode-locking operation of a diode-end-pumped Tm:YAP laser with watt-level output power

Science.gov (United States)

Zhang, Su; Zhang, Xinlu; Huang, Jinjer; Wang, Tianhan; Dai, Junfeng; Dong, Guangzong

2018-03-01

We report on a high power continuous wave (CW) self-mode-locked Tm:YAP laser pumped by a 792 nm laser diode. Without any additional mode-locking elements in the cavity, stable and self-starting mode-locking operation has been realized. The threshold pump power of the CW self-mode-locked Tm:YAP laser is only 5.4 W. The maximum average output power is as high as 1.65 W at the pump power of 12 W, with the repetition frequency of 468 MHz and the center wavelength of 1943 nm. To the best of our knowledge, this is the first CW self-mode-locked Tm:YAP laser. The experiment results show that the Tm:YAP crystal is a promising gain medium for realizing the high power self-mode-locking operation at 2 µm.

Guidance system operations plan for manned CM earth orbital missions using program SKYLARK 1. Section 4: Operational modes

Science.gov (United States)

Dunbar, J. C.

1972-01-01

The operational modes for the guidance system operations plan for Program SKYLARK 1 are presented. The procedures control the guidance and navigation system interfaces with the flight crew and the mission control center. The guidance operational concept is designed to comprise a set of manually initiated programs and functions which may be arranged by the flight crew to implement a large class of flight plans. This concept will permit both a late flight plan definition and a capability for real time flight plan changes.

Analysis and Improvement of Control Algorithm for Operation Mode Transition due to Input Channel Trouble in Control Systems

International Nuclear Information System (INIS)

Ahn, Myunghoon; Kim, Woogoon; Yim, Hyeongsoon

2016-01-01

The PI (Proportional plus Integral) controller, which is the essential functional block in control systems, can automatically perform the stable control of an important plant process while reducing the steady state error and improving the transient response. However, if the received input PV (Process Variable) is not normal due to input channel trouble, it will be difficult to control the system automatically. For this reason, many control systems are implemented to change the operation mode from automatic to manual mode in the PI controller when the failed input PV is detected. If the PI controller is in automatic mode for all the time, the control signal varies as the change of the input PV is continuously reflected in the control algorithm. In the other cases, since the controller changes into the manual mode at t=0, the control signal is fixed at the last PI controller output and thus the feedback control is not performed anymore until the operator takes an action such as the operation mode change. As a result of analysis and simulations for the controller’s operation modes in all the cases of input channel trouble, we discovered that it is more appropriate to maintain the automatic mode despite the bad quality in the PV. Therefore, we improved the control system algorithm reflecting the analysis results for the operator’s convenience and the stability of a control system

Analysis and Improvement of Control Algorithm for Operation Mode Transition due to Input Channel Trouble in Control Systems

Energy Technology Data Exchange (ETDEWEB)

Ahn, Myunghoon; Kim, Woogoon; Yim, Hyeongsoon [KEPCO Engineering and Construction Co., Deajeon (Korea, Republic of)

2016-10-15

The PI (Proportional plus Integral) controller, which is the essential functional block in control systems, can automatically perform the stable control of an important plant process while reducing the steady state error and improving the transient response. However, if the received input PV (Process Variable) is not normal due to input channel trouble, it will be difficult to control the system automatically. For this reason, many control systems are implemented to change the operation mode from automatic to manual mode in the PI controller when the failed input PV is detected. If the PI controller is in automatic mode for all the time, the control signal varies as the change of the input PV is continuously reflected in the control algorithm. In the other cases, since the controller changes into the manual mode at t=0, the control signal is fixed at the last PI controller output and thus the feedback control is not performed anymore until the operator takes an action such as the operation mode change. As a result of analysis and simulations for the controller’s operation modes in all the cases of input channel trouble, we discovered that it is more appropriate to maintain the automatic mode despite the bad quality in the PV. Therefore, we improved the control system algorithm reflecting the analysis results for the operator’s convenience and the stability of a control system.

Improving Earth Science Metadata: Modernizing ncISO

Science.gov (United States)

O'Brien, K.; Schweitzer, R.; Neufeld, D.; Burger, E. F.; Signell, R. P.; Arms, S. C.; Wilcox, K.

2016-12-01

ncISO is a package of tools developed at NOAA's National Center for Environmental Information (NCEI) that facilitates the generation of ISO 19115-2 metadata from NetCDF data sources. The tool currently exists in two iterations: a command line utility and a web-accessible service within the THREDDS Data Server (TDS). Several projects, including NOAA's Unified Access Framework (UAF), depend upon ncISO to generate the ISO-compliant metadata from their data holdings and use the resulting information to populate discovery tools such as NCEI's ESRI Geoportal and NOAA's data.noaa.gov CKAN system. In addition to generating ISO 19115-2 metadata, the tool calculates a rubric score based on how well the dataset follows the Attribute Conventions for Dataset Discovery (ACDD). The result of this rubric calculation, along with information about what has been included and what is missing is displayed in an HTML document generated by the ncISO software package. Recently ncISO has fallen behind in terms of supporting updates to conventions such updates to the ACDD. With the blessing of the original programmer, NOAA's UAF has been working to modernize the ncISO software base. In addition to upgrading ncISO to utilize version1.3 of the ACDD, we have been working with partners at Unidata and IOOS to unify the tool's code base. In essence, we are merging the command line capabilities into the same software that will now be used by the TDS service, allowing easier updates when conventions such as ACDD are updated in the future. In this presentation, we will discuss the work the UAF project has done to support updated conventions within ncISO, as well as describe how the updated tool is helping to improve metadata throughout the earth and ocean sciences.

Research on operation mode of abrasive grain during grinding

Science.gov (United States)

Ivanova, T. N.; Dement’ev, V. B.; Nikitina, O. V.

2018-03-01

The processing of materials by cutting with an abrasive tool is carried out by means of thousands of grains bonded together as a single whole. The quality of the abrasive tool is defined by cutting properties of abrasive grains and depends on features of spreading the temperature field in time and in the abrasive grain volume. Grains are exposed to heating and cooling during work. It leads to undesired effects such as a decrease of durability of grain retention in the binder, hardness, intensification of diffusion and oxidation processes between the binder and the grain, the occurrence of considerable temperature stresses in the grain itself. The obtained equation which allows calculation of temperature field of grain for one rotation of grinding wheel shows that the temperature of the wheel depends on grinding modes and thermophysical properties of abrasive material. Thus, as the time of contact of grain with processed material increases, the temperature in the cutting area rises. As thermophysical properties increase, the temperature in cutting area decreases. Thermal working conditions are determined to be different from each other depending on contact time of the grain and the material. For example, in case of creep-feed grinding, the peak value of temperature is higher than during multistep grinding; the depth of expansion is greater. While the speed of the thermal process in creep-feed grinding is 2-3 times lower than in multistep grinding, the gradient reduces 3-4 times. The analysis of machining methods shows that creep-feed grinding ensures greater depth of grain heating, a smaller heating rate and a reduced velocity gradient. It causes a decrease of probable allotropic modifications and prevents from occurring of heat strokes - cracking of grains due to high temperature falls. Consequently, it is necessary to employ creep-feed grinding to increase the efficiency of abrasive tool employing. Three operation modes of grinding wheel including blunting, full

Explorations of the extended ncKP hierarchy

International Nuclear Information System (INIS)

Dimakis, Aristophanes; Mueller-Hoissen, Folkert

2004-01-01

A recently obtained extension (xncKP) of the Moyal-deformed KP hierarchy (ncKP hierarchy) by a set of evolution equations in the Moyal-deformation parameters is further explored. Formulae are derived to compute these equations efficiently. Reductions of the xncKP hierarchy are treated, in particular to the extended ncKdV and ncBoussinesq hierarchies. Furthermore, a good part of the Sato formalism for the KP hierarchy is carried over to the generalized framework. In particular, the well-known bilinear identity theorem for the KP hierarchy, expressed in terms of the (formal) Baker-Akhiezer function, extends to the xncKP hierarchy. Moreover, it is demonstrated that N-soliton solutions of the ncKP equation are also solutions of the first few deformation equations. This is shown to be related to the existence of certain families of algebraic identities

High beta tokamak operation in DIII-D limited at low density/collisionality by resistive tearing modes

International Nuclear Information System (INIS)

La Haye, R.J.; Lao, L.L.; Strait, E.J.; Taylor, T.S.

1997-01-01

The maximum operational high beta in single-null divertor (SND) long pulse tokamak discharges in the DIII-D tokamak with a cross-sectional shape similar to the proposed International Thermonuclear Experimental Reactor (ITER) device is found to be limited by the onset of resistive instabilities that have the characteristics of neoclassically destabilized tearing modes. There is a soft limit due to the onset of an m/n=3/2 rotating tearing mode that saturates at low amplitude and a hard limit at slightly higher beta due to the onset of an m/n=2/1 rotating tearing mode that grows, slows down and locks. By operating at higher density and thus collisionality, the practical beta limit due to resistive tearing modes approaches the ideal magnetohydrodynamic (MHD) limit. (author). 15 refs, 4 figs

Two-Dimensional Simulation of Mass Transfer in Unitized Regenerative Fuel Cells under Operation Mode Switching

Directory of Open Access Journals (Sweden)

Lulu Wang

2016-01-01

Full Text Available A two-dimensional, single-phase, isothermal, multicomponent, transient model is built to investigate the transport phenomena in unitized regenerative fuel cells (URFCs under the condition of switching from the fuel cell (FC mode to the water electrolysis (WE mode. The model is coupled with an electrochemical reaction. The proton exchange membrane (PEM is selected as the solid electrolyte of the URFC. The work is motivated by the need to elucidate the complex mass transfer and electrochemical process under operation mode switching in order to improve the performance of PEM URFC. A set of governing equations, including conservation of mass, momentum, species, and charge, are considered. These equations are solved by the finite element method. The simulation results indicate the distributions of hydrogen, oxygen, water mass fraction, and electrolyte potential response to the transient phenomena via saltation under operation mode switching. The hydrogen mass fraction gradients are smaller than the oxygen mass fraction gradients. The average mass fractions of the reactants (oxygen and hydrogen and product (water exhibit evident differences between each layer in the steady state of the FC mode. By contrast, the average mass fractions of the reactant (water and products (oxygen and hydrogen exhibit only slight differences between each layer in the steady state of the WE mode. Under either the FC mode or the WE mode, the duration of the transient state is only approximately 0.2 s.

A dual-mode operation overmoded coaxial millimeter-wave generator with high power capacity and pure transverse electric and magnetic mode output

Science.gov (United States)

Bai, Zhen; Zhang, Jun; Zhong, Huihuang

2016-04-01

An overmoded coaxial millimeter-wave generator with high power capacity and pure transverse electric and magnetic (TEM) mode output is designed and presented, by using a kind of coaxial slow wave structure (SWS) with large transversal dimension and small distance between inner and outer conductors. The generator works in dual-mode operation mechanism. The electron beam synchronously interacts with 7π/8 mode of quasi-TEM, at the meanwhile exchanges energy with 3π/8 mode of TM01. The existence of TM01 mode, which is traveling wave, not only increases the beam-wave interaction efficiency but also improves the extraction efficiency. The large transversal dimension of coaxial SWS makes its power capacity higher than that of other reported millimeter-wave devices and the small distance between inner and outer conductors allows only two azimuthally symmetric modes to coexist. The converter after the SWS guarantees the mode purity of output power. Particle-in-cell simulation shows that when the diode voltage is 400 kV and beam current is 3.8 kA, the generation of microwave at 32.26 GHz with an output power of 611 MW and a conversion efficiency of 40% is obtained. The power percentage carried by TEM mode reaches 99.7% in the output power.

Operating modes and practical power flow analysis of bidirectional isolated power interface for distributed power systems

International Nuclear Information System (INIS)

Wen, Huiqing; Su, Bin

2016-01-01

Highlights: • Four operating modes of Dual-Phase-Shift control for Dual Active Bridge converter are presented. • Effects of “minor parameters” such as the deadtime and power device voltage drops are analyzed. • Accurate power flow models with Dual-Phase-Shift control are developed and verified with experimental results. • Optimal operating mode is determined with respect to the efficiency improvement. • Measured efficiency of the Dual Active Bridge converter is improved up to 14%. - Abstract: Due to the intermittent nature of the renewable energy sources including photovoltaic and wind energy, the energy storage systems are essential to stabilize dc bus voltage. Considering the discharge depth of super-capacitors and energy-storage batteries, the bidirectional isolated power interface will operate for a wide range of voltage and power. This study focuses on in-depth analysis of the dual-active-bridge dc–dc converter that is controlled by the dual-phase-shift scheme to improve the conversion efficiency in distributed power system. The power flow of each operating mode with dual-phase-shift control is characterized based on a detailed analysis of the effects of “minor parameters”, including the deadtime and power device voltage drops. The complete output power plane of the dual-active-bridge converter with dual-phase-shift control is obtained and compared with experimental results. The optimal operating mode is determined according to the practical output power range and the power flow characteristics. Experimental evaluation shows the effectiveness of the proposed power flow model with dual-phase-shift control and significant efficiency improvement using the optimal mode of dual-phase-shift compared with the conventional phase shift control.

Features of Synchronous Electronically Commutated Motors in Servomotor Operation Modes

Directory of Open Access Journals (Sweden)

Dirba J.

2017-04-01

Full Text Available The authors consider the features and operation specifics of the synchronous permanent magnet motors and the synchronous reluctance motors with electronic commutation in servomotor operation modes. Calculation results show that mechanical and control characteristics of studied motors are close to a linear shape. The studied motor control is proposed to implement similar to phase control of induction servomotor; it means that angle θ (angle between vectors of the supply voltage and non-load electromotive force or angle ε (angle between rotor direct axis and armature magnetomotive force axis is changed. The analysis results show that synchronous electronically commutated motors could be used as servomotors.

Features of Synchronous Electronically Commutated Motors in Servomotor Operation Modes

Science.gov (United States)

Dirba, J.; Lavrinovicha, L.; Dobriyan, R.

2017-04-01

The authors consider the features and operation specifics of the synchronous permanent magnet motors and the synchronous reluctance motors with electronic commutation in servomotor operation modes. Calculation results show that mechanical and control characteristics of studied motors are close to a linear shape. The studied motor control is proposed to implement similar to phase control of induction servomotor; it means that angle θ (angle between vectors of the supply voltage and non-load electromotive force) or angle ɛ (angle between rotor direct axis and armature magnetomotive force axis) is changed. The analysis results show that synchronous electronically commutated motors could be used as servomotors.

Harmonic voltage excess problem test and analysis in UHV and EHV grid particular operation mode

Science.gov (United States)

Lv, Zhenhua; Shi, Mingming; Fei, Juntao

2018-02-01

The test and analysis of the power quality of some 1000kV UHV transmission lines and 500kV EHV transmission lines is carried out. It is found that there is harmonic voltage excess problems when the power supply of the UHV and EHV voltage line is single-ended or single-loop, the problem basically disappeared after the operation mode change, different operating conditions, the harmonic current has not been greatly affected, indicating that the harmonic voltage changes mainly caused by the system harmonic impedance. With the analysis of MATLAB Simulink system model, it can be seen that there are specific harmonic voltage excess in the system under the specific operating mode, which results in serious distortion of the specific harmonic voltage. Since such phenomena are found in 500kV and 1000kV systems, it is suggested that the test evaluation work should be done under the typical mode of operation in 500kV, 1000kV Planning and construction process to prevent the occurrence of serious distortion and the regional harmonic current monitoring and suppression work should be done.

Communication: Effects of thermionic-gun parameters on operating modes in ultrafast electron microscopy

Directory of Open Access Journals (Sweden)

Erik Kieft

2015-09-01

Full Text Available Ultrafast electron microscopes with thermionic guns and LaB6 sources can be operated in both the nanosecond, single-shot and femtosecond, single-electron modes. This has been demonstrated with conventional Wehnelt electrodes and absent any applied bias. Here, by conducting simulations using the General Particle Tracer code, we define the electron-gun parameter space within which various modes may be optimized. The properties of interest include electron collection efficiency, temporal and energy spreads, and effects of laser-pulse duration incident on the LaB6 source. We find that collection efficiencies can reach 100% for all modes, despite there being no bias applied to the electrode.

A Frequency-Weighted Energy Operator and complementary ensemble empirical mode decomposition for bearing fault detection

Science.gov (United States)

Imaouchen, Yacine; Kedadouche, Mourad; Alkama, Rezak; Thomas, Marc

2017-01-01

Signal processing techniques for non-stationary and noisy signals have recently attracted considerable attentions. Among them, the empirical mode decomposition (EMD) which is an adaptive and efficient method for decomposing signals from high to low frequencies into intrinsic mode functions (IMFs). Ensemble EMD (EEMD) is proposed to overcome the mode mixing problem of the EMD. In the present paper, the Complementary EEMD (CEEMD) is used for bearing fault detection. As a noise-improved method, the CEEMD not only overcomes the mode mixing, but also eliminates the residual of added white noise persisting into the IMFs and enhance the calculation efficiency of the EEMD method. Afterward, a selection method is developed to choose relevant IMFs containing information about defects. Subsequently, a signal is reconstructed from the sum of relevant IMFs and a Frequency-Weighted Energy Operator is tailored to extract both the amplitude and frequency modulations from the selected IMFs. This operator outperforms the conventional energy operator and the enveloping methods, especially in the presence of strong noise and multiple vibration interferences. Furthermore, simulation and experimental results showed that the proposed method improves performances for detecting the bearing faults. The method has also high computational efficiency and is able to detect the fault at an early stage of degradation.

Passively mode-locked Nd:YVO4 laser operating at 1073 nm and 1085 nm

Science.gov (United States)

Waritanant, Tanant; Major, Arkady

2018-02-01

A passively mode-locked Nd:YVO4 laser operating at 1073 nm and 1085 nm was demonstrated with an intracavity birefringent filter as the wavelength selecting element. The average output powers achieved were 2.17 W and 2.18 W with optical-to-optical efficiency of 19.6% and 19.7%, respectively. The slope efficiencies were more than 31% at both output wavelengths. The pulse durations at the highest average output power were 10.3 ps and 8.4 ps, respectively. We believe that this is the first report of mode locking of a Nd:YVO4 laser operating at 1073 nm or 1085 nm lines.

Study of the zero modes of the Faddeev–Popov operator in the maximal Abelian gauge

International Nuclear Information System (INIS)

Capri, M.A.L.; Guimaraes, M.S.; Lemes, V.E.R.; Sorella, S.P.; Tedesco, D.G.

2014-01-01

A study of the zero modes of the Faddeev–Popov operator in the maximal Abelian gauge is presented in the case of the gauge group SU(2) and for different Euclidean space–time dimensions. Explicit examples of classes of normalizable zero modes and corresponding gauge field configurations are constructed by taking into account two boundary conditions, namely: (i) the finite Euclidean Yang–Mills action, (ii) the finite Hilbert norm. -- Highlights: •We study the zero modes of the Faddeev–Popov operator in the maximal Abelian gauge. •For d=2 we obtain solutions with finite action but not finite Hilbert norm. •For d=3,4 we obtain solutions with finite action and finite Hilbert norm. •These results can be compared with those previously obtained in the Landau gauge

Edge localized mode physics and operational aspects in tokamaks

Energy Technology Data Exchange (ETDEWEB)

Becoulet, M [Association Euratom-CEA, CEA Cadarache, F-13108 St Paul-lez-Durance (France); Huysmans, G [Association Euratom-CEA, CEA Cadarache, F-13108 St Paul-lez-Durance (France); Sarazin, Y [Association Euratom-CEA, CEA Cadarache, F-13108 St Paul-lez-Durance (France); Garbet, X [Association Euratom-CEA, CEA Cadarache, F-13108 St Paul-lez-Durance (France); Ghendrih, Ph [Association Euratom-CEA, CEA Cadarache, F-13108 St Paul-lez-Durance (France); Rimini, F [Association Euratom-CEA, CEA Cadarache, F-13108 St Paul-lez-Durance (France); Joffrin, E [Association Euratom-CEA, CEA Cadarache, F-13108 St Paul-lez-Durance (France); Litaudon, X [Association Euratom-CEA, CEA Cadarache, F-13108 St Paul-lez-Durance (France); Monier-Garbet, P [Association Euratom-CEA, CEA Cadarache, F-13108 St Paul-lez-Durance (France); Ane, J-M [Association Euratom-CEA, CEA Cadarache, F-13108 St Paul-lez-Durance (France); Thomas, P [Association Euratom-CEA, CEA Cadarache, F-13108 St Paul-lez-Durance (France); Grosman, A [Association Euratom-CEA, CEA Cadarache, F-13108 St Paul-lez-Durance (France); Parail, V [Euratom/UKAEA Association, Fusion Culham Science Centre, Abingdon, OX14 3EA (United Kingdom); Wilson, H [Euratom/UKAEA Association, Fusion Culham Science Centre, Abingdon, OX14 3EA (United Kingdom); Lomas, P [Euratom/UKAEA Association, Fusion Culham Science Centre, Abingdon, OX14 3EA (United Kingdom); Vries, P de[Euratom/UKAEA Association, Fusion Culham Science Centre, Abingdon, OX14 3EA (United Kingdom); Zastrow, K-D [Euratom/UKAEA Association, Fusion Culham Science Centre, Abingdon, OX14 3EA (United Kingdom); Matthews, G F [Euratom/UKAEA Association, Fusion Culham Science Centre, Abingdon, OX14 3EA (United Kingdom); Lonnroth, J [Euratom/UKAEA Association, Fusion Culham Science Centre, Abingdon, OX14 3EA (United Kingdom); Gerasimov, S [Euratom/UKAEA Association, Fusion Culham Science Centre, Abingdon, OX14 3EA (United Kingdom)] [and others

2003-12-01

Recent progress in experimental and theoretical studies of edge localized mode (ELM) physics is reviewed for the reactor relevant plasma regimes, namely the high confinement regimes, that is, H-modes and advanced scenarios. Theoretical approaches to ELM physics, from a linear ideal magnetohydrodynamic (MHD) stability analysis to non-linear transport models with ELMs are discussed with respect to experimental observations, in particular the fast collapse of pedestal pressure profiles, magnetic measurements and scrape-off layer transport during ELMs. High confinement regimes with different types of ELMs are addressed in this paper in the context of development of operational scenarios for ITER. The key parameters that have been identified at present to reduce the energy losses in Type I ELMs are operation at high density, high edge magnetic shear and high triangularity. However, according to the present experimental scaling for the energy losses in Type I ELMs, the extrapolation of such regimes for ITER leads to unacceptably large heat loads on the divertor target plates exceeding the material limits. High confinement H-mode scenarios at high triangularity and high density with small ELMs (Type II), mixed regimes (Type II and Type I) and combined advanced regimes at high beta{sub p} are discussed for present-day tokamaks. The optimum combination of high confinement and small MHD activity at the edge in Type II ELM scenarios is of interest to ITER. However, to date, these regimes have been achieved in a rather narrow operational window and far from ITER parameters in terms of collisionality, edge safety factor and beta{sub p}. The compatibility of the alternative internal transport barrier (ITB) scenario with edge pedestal formation and ELMs is also addressed. Edge physics issues related to the possible combination of small benign ELMs (Type III, Type II ELMs, quiescent double barrier) and high performance ITBs are discussed for present-day experiments (JET, JT-60U

Edge localized mode physics and operational aspects in tokamaks

International Nuclear Information System (INIS)

Becoulet, M; Huysmans, G; Sarazin, Y; Garbet, X; Ghendrih, Ph; Rimini, F; Joffrin, E; Litaudon, X; Monier-Garbet, P; Ane, J-M; Thomas, P; Grosman, A; Parail, V; Wilson, H; Lomas, P; Vries, P de; Zastrow, K-D; Matthews, G F; Lonnroth, J; Gerasimov, S; Sharapov, S; Gryaznevich, M; Counsell, G; Kirk, A; Valovic, M; Buttery, R; Loarte, A; Saibene, G; Sartori, R; Leonard, A; Snyder, P; Lao, L L; Gohil, P; Evans, T E; Moyer, R A; Kamada, Y; Chankin, A; Oyama, N; Hatae, T; Asakura, N; Tudisco, O; Giovannozzi, E; Crisanti, F; Perez, C P; Koslowski, H R; Eich, T; Sips, A; Horton, L; Hermann, A; Lang, P; Stober, J; Suttrop, W; Beyer, P; Saarelma, S

2003-01-01

Recent progress in experimental and theoretical studies of edge localized mode (ELM) physics is reviewed for the reactor relevant plasma regimes, namely the high confinement regimes, that is, H-modes and advanced scenarios. Theoretical approaches to ELM physics, from a linear ideal magnetohydrodynamic (MHD) stability analysis to non-linear transport models with ELMs are discussed with respect to experimental observations, in particular the fast collapse of pedestal pressure profiles, magnetic measurements and scrape-off layer transport during ELMs. High confinement regimes with different types of ELMs are addressed in this paper in the context of development of operational scenarios for ITER. The key parameters that have been identified at present to reduce the energy losses in Type I ELMs are operation at high density, high edge magnetic shear and high triangularity. However, according to the present experimental scaling for the energy losses in Type I ELMs, the extrapolation of such regimes for ITER leads to unacceptably large heat loads on the divertor target plates exceeding the material limits. High confinement H-mode scenarios at high triangularity and high density with small ELMs (Type II), mixed regimes (Type II and Type I) and combined advanced regimes at high beta p are discussed for present-day tokamaks. The optimum combination of high confinement and small MHD activity at the edge in Type II ELM scenarios is of interest to ITER. However, to date, these regimes have been achieved in a rather narrow operational window and far from ITER parameters in terms of collisionality, edge safety factor and beta p . The compatibility of the alternative internal transport barrier (ITB) scenario with edge pedestal formation and ELMs is also addressed. Edge physics issues related to the possible combination of small benign ELMs (Type III, Type II ELMs, quiescent double barrier) and high performance ITBs are discussed for present-day experiments (JET, JT-60U, DIII-D) in

75 FR 18253 - R.J. Corman Railroad Property, LLC-Acquisition Exemption-NC Railroad, Inc.

Science.gov (United States)

2010-04-09

... DEPARTMENT OF TRANSPORTATION Surface Transportation Board [STB Finance Docket No. 35363] R.J. Corman Railroad Property, LLC--Acquisition Exemption--NC Railroad, Inc. R.J. Corman Railroad Property... exemption in STB Finance Docket No. 35364, R.J. Corman Railroad Company/Bardstown Line--Lease and Operation...

A dual-mode operation overmoded coaxial millimeter-wave generator with high power capacity and pure transverse electric and magnetic mode output

Energy Technology Data Exchange (ETDEWEB)

Bai, Zhen; Zhang, Jun, E-mail: zhangjun@nudt.edu.cn; Zhong, Huihuang [College of Optoelectric Science and Engineering, National University of Defense Technology, Changsha 410073 (China)

2016-04-15

An overmoded coaxial millimeter-wave generator with high power capacity and pure transverse electric and magnetic (TEM) mode output is designed and presented, by using a kind of coaxial slow wave structure (SWS) with large transversal dimension and small distance between inner and outer conductors. The generator works in dual-mode operation mechanism. The electron beam synchronously interacts with 7π/8 mode of quasi-TEM, at the meanwhile exchanges energy with 3π/8 mode of TM{sub 01}. The existence of TM{sub 01} mode, which is traveling wave, not only increases the beam-wave interaction efficiency but also improves the extraction efficiency. The large transversal dimension of coaxial SWS makes its power capacity higher than that of other reported millimeter-wave devices and the small distance between inner and outer conductors allows only two azimuthally symmetric modes to coexist. The converter after the SWS guarantees the mode purity of output power. Particle-in-cell simulation shows that when the diode voltage is 400 kV and beam current is 3.8 kA, the generation of microwave at 32.26 GHz with an output power of 611 MW and a conversion efficiency of 40% is obtained. The power percentage carried by TEM mode reaches 99.7% in the output power.

Modes of mechanical ventilation for the operating room.

Science.gov (United States)

Ball, Lorenzo; Dameri, Maddalena; Pelosi, Paolo

2015-09-01

Most patients undergoing surgical procedures need to be mechanically ventilated, because of the impact of several drugs administered at induction and during maintenance of general anaesthesia on respiratory function. Optimization of intraoperative mechanical ventilation can reduce the incidence of post-operative pulmonary complications and improve the patient's outcome. Preoxygenation at induction of general anaesthesia prolongs the time window for safe intubation, reducing the risk of hypoxia and overweighs the potential risk of reabsorption atelectasis. Non-invasive positive pressure ventilation delivered through different interfaces should be considered at the induction of anaesthesia morbidly obese patients. Anaesthesia ventilators are becoming increasingly sophisticated, integrating many functions that were once exclusive to intensive care. Modern anaesthesia machines provide high performances in delivering the desired volumes and pressures accurately and precisely, including assisted ventilation modes. Therefore, the physicians should be familiar with the potential and pitfalls of the most commonly used intraoperative ventilation modes: volume-controlled, pressure-controlled, dual-controlled and assisted ventilation. Although there is no clear evidence to support the advantage of any one of these ventilation modes over the others, protective mechanical ventilation with low tidal volume and low levels of positive end-expiratory pressure (PEEP) should be considered in patients undergoing surgery. The target tidal volume should be calculated based on the predicted or ideal body weight rather than on the actual body weight. To optimize ventilation monitoring, anaesthesia machines should include end-inspiratory and end-expiratory pause as well as flow-volume loop curves. The routine administration of high PEEP levels should be avoided, as this may lead to haemodynamic impairment and fluid overload. Higher PEEP might be considered during surgery longer than 3 h

Harmonics Suppression for Single-Phase Grid-Connected Photovoltaic Systems in Different Operation Modes

DEFF Research Database (Denmark)

Yang, Yongheng; Zhou, Keliang; Blaabjerg, Frede

2013-01-01

-connected PV inverters may be severely affected in different operation modes. In this paper, a detailed analysis is conducted to reveal the relationship between the harmonics level with the power factor and the current level in the PV systems. A current control solution which employs an Internal Model...... Principle (IMP) is proposed to suppress the harmonic currents injected into the grid. Experiments are carried out to verify the analysis and the performance of the proposed control method. It is demonstrated that the proposed method presents an effective solution to harmonics suppression for single......-phase grid-connected PV systems in different operation modes. Especially, it can remove higher order harmonics effectively leading to a better power quality compared to the Proportional plus Multi-Resonant Controller, and it has less computational burden....

Development of a numerical tool to study the mixing phenomenon occurring during mode one operation of a multi-mode ejector-augmented pulsed detonation rocket engine

Science.gov (United States)

Dawson, Joshua

A novel multi-mode implementation of a pulsed detonation engine, put forth by Wilson et al., consists of four modes; each specifically designed to capitalize on flow features unique to the various flow regimes. This design enables the propulsion system to generate thrust through the entire flow regime. The Multi-Mode Ejector-Augmented Pulsed Detonation Rocket Engine operates in mode one during take-off conditions through the acceleration to supersonic speeds. Once the mixing chamber internal flow exceeds supersonic speed, the propulsion system transitions to mode two. While operating in mode two, supersonic air is compressed in the mixing chamber by an upstream propagating detonation wave and then exhausted through the convergent-divergent nozzle. Once the velocity of the air flow within the mixing chamber exceeds the Chapman-Jouguet Mach number, the upstream propagating detonation wave no longer has sufficient energy to propagate upstream and consequently the propulsive system shifts to mode three. As a result of the inability of the detonation wave to propagate upstream, a steady oblique shock system is established just upstream of the convergent-divergent nozzle to initiate combustion. And finally, the propulsion system progresses on to mode four operation, consisting purely of a pulsed detonation rocket for high Mach number flight and use in the upper atmosphere as is needed for orbital insertion. Modes three and four appear to be a fairly significant challenge to implement, while the challenge of implementing modes one and two may prove to be a more practical goal in the near future. A vast number of potential applications exist for a propulsion system that would utilize modes one and two, namely a high Mach number hypersonic cruise vehicle. There is particular interest in the dynamics of mode one operation, which is the subject of this research paper. Several advantages can be obtained by use of this technology. Geometrically the propulsion system is fairly

An overview on STEP-NC compliant controller development

Science.gov (United States)

Othman, M. A.; Minhat, M.; Jamaludin, Z.

2017-10-01

The capabilities of conventional Computer Numerical Control (CNC) machine tools as termination organiser to fabricate high-quality parts promptly, economically and precisely are undeniable. To date, most CNCs follow the programming standard of ISO 6983, also called G & M code. However, in fluctuating shop floor environment, flexibility and interoperability of current CNC system to react dynamically and adaptively are believed still limited. This outdated programming language does not explicitly relate to each other to have control of arbitrary locations other than the motion of the block-by-block. To address this limitation, new standard known as STEP-NC was developed in late 1990s and is formalized as an ISO 14649. It adds intelligence to the CNC in term of interoperability, flexibility, adaptability and openness. This paper presents an overview of the research work that have been done in developing a STEP-NC controller standard and the capabilities of STEP-NC to overcome modern manufacturing demands. Reviews stated that most existing STEP-NC controller prototypes are based on type 1 and type 2 implementation levels. There are still lack of effort being done to develop type 3 and type 4 STEP-NC compliant controller.

Experimental study and performance analysis of a thermoelectric cooling and heating system driven by a photovoltaic/thermal system in summer and winter operation modes

International Nuclear Information System (INIS)

He, Wei; Zhou, JinZhi; Chen, Chi; Ji, Jie

2014-01-01

Highlights: • Thermoelectric heating system driven by heat pipe PV/T system was built and test. • Theoretical analysis has been done and simulation results have been validated by experiments. • The energetic efficiency and exergetic efficiency in summer and winter operation mode was analyzed and compared. - Abstract: This paper presents theoretical and experimental investigations of the winter operation mode of a thermoelectric cooling and heating system driven by a heat pipe photovoltaic/thermal (PV/T) panel. And the energy and exergy analysis of this system in summer and winter operation modes are also done. The winter operation mode of this system is tested in an experimental room which temperature is controlled at 18 °C. The results indicate the average coefficient of performance (COP) of thermoelectric module of this system can be about 1.7, the electrical efficiency of the PV/T panel can reach 16.7%, and the thermal efficiency of this system can reach 23.5%. The energy and exergy analysis show the energetic efficiency of the system in summer operation mode is higher than that of it in winter operation mode, but the exergetic efficiency in summer operation mode is lower than that in winter operation mode, on the contrary

78 FR 72009 - Establishment of Class E Airspace; Star, NC

Science.gov (United States)

2013-12-02

...-0440; Airspace Docket No. 13-ASO-10] Establishment of Class E Airspace; Star, NC AGENCY: Federal... at Star, NC, to accommodate a new Area Navigation (RNAV) Global Positioning System (GPS) Standard... Federal Register a notice of proposed rulemaking to establish Class E airspace at Star, NC (78 FR 54413...

Multiple-bunch-length operating mode design for a storage ring using hybrid low alpha and harmonic cavity method

Energy Technology Data Exchange (ETDEWEB)

Gao, Weiwei, E-mail: gaomqr@mail.ustc.edu.cn [College of Mathematics and Physics, Fujian University of Technology, Fuzhou 350118 (China); Wang, Lin; Li, Heting [National Synchrotron Radiation Laboratory, University of Science and Technology of China, Hefei 230029 (China)

2017-03-11

In this paper we design a simultaneous three bunch length operating mode at the HLS-II (Hefei Light Source II) storage ring by installing two harmonic cavities and minimizing the momentum compaction factor. The short bunches (2.6 mm) presented in this work will meet the requirement of coherent millimeter-wave and sub-THz radiation experiments, while the long bunches (20 mm) will efficiently increase the total beam current. Therefore, this multiple-bunch-length operating mode allows present synchrotron users and coherent millimeter-wave users (or sub THz users) to carry out their experiments simultaneously. Since the relatively low energy characteristic of HLS-II we achieve the multiple-bunch-length operating mode without multicell superconducting RF cavities, which is technically feasible.

Hybrid Systems of Distributed Generation with Renewable Sources: Modeling and Analysis of Their Operational Modes in Electric Power System

Directory of Open Access Journals (Sweden)

A. M. Gashimov

2013-01-01

Full Text Available The paper considers problems pertaining to modeling and simulation of operational hybrid system modes of the distributed generation comprising conventional sources – modular diesel generators, gas-turbine power units; and renewable sources – wind and solar power plants. Operational modes of the hybrid system have been investigated under conditions of electrical connection with electric power system and in case of its isolated operation. As a consequence

Operation modes research of liquefied natural gas storages as a part of the ground complexes equipment

Directory of Open Access Journals (Sweden)

N. S. Korolev

2014-01-01

Full Text Available The use of the Liquefied Natural Gas (LNG in the space-rocket equipment is motivated by some advantages. That is why a lot of tests and works are actively carried out now on rocket engines using liquefied natural gas.To provide the engine tests and subsequent rocket complex operation a creation of LNG storages is demanded as a part of ground processing equipment and support for their safe operation conditions.One of LNG danger factor is its low boiling temperature, and also changing the condition, density and LNG boiling temperature at storage due to evaporation of light component, namely methane. At refill of the storages having fuel remains with a new LNG portion these factors can lead to formation of the stratified macro-layers and cause a mode of the intensive mixing that is called "rollover", with almost instant evaporation of LNG big mass and sharp pressure boost, capable to result in the storage distraction with catastrophic effects.The work objectives are formulated such as a technique development for forecasting of the LNG parameters in operating storages including the rollover mode, a comparison of calculated results of the LNG parameters with the experimental data, and a definition of possible recommendations for safe operation of LNG storages as a part of the ground complexes equipment.The paper reviews 12 publications concerning the issues and proceeding processes at operation of LNG storages, including the rollover mode.To verify the reliability of process simulation results in the LNG, represented in models by the binary methane-ethane mixture the calculated values have been compared with the experimental data for a LNG storage mode in the reservoir of a ground test complex.The reliability of developed models of the heat-mass-exchange processes in stratified on density and temperature in LNG storage with emergence of conditions for the rollover mode has been verified by comparing the settlement characteristics to the published

Characteristics of switched reluctance motor operating in continuous and discontinuous conduction mode

Directory of Open Access Journals (Sweden)

Ćalasan Martin P.

2013-01-01

Full Text Available This paper presents mechanical characteristics of Switched Reluctance Motor (SRM when it operates in Discontinuous Conduction Mode (DCM or in Continuous Conduction Mode (CCM, i.e. when the current through the phase coils (windings flows discontinuously or continuously. Firstly, in order to maximize the output power of SRM optimization of its control parameters was performed, such that the peak and RMS values of the current do not exceed the predefined values. The optimal control parameters vs. rotation speed, as well as the corresponding characteristics of torque, power and efficiency. It is shown that with CCM the machine torque (power, at high speed, can be increased.

78 FR 24071 - Safety Zone; Pasquotank River; Elizabeth City, NC

Science.gov (United States)

2013-04-24

... 1625-AA00 Safety Zone; Pasquotank River; Elizabeth City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary... Pasquotank River in Elizabeth City, NC in support of the Fireworks display for the Potato Festival. This... Guard is establishing a safety zone on the navigable waters of Pasquotank River in Elizabeth City, NC...

Detectors for alpha particles and X-rays operating in ambient air in pulse counting mode and/or with gas amplification

CERN Document Server

Charpak, Georges; Breuil, P; Peskov, Vladimir

2008-01-01

Ionization chambers working in ambient air in current detection mode are widely used in several applications such as smoke detection, dosimetry, therapeutic beam monitoring and cetera. The aim of this work was to investigate if gaseous detectors can operate in ambient air in pulse counting mode as well as with gas amplification. . To investigate the feasibility of this method two types of open- end gaseous detectors were build and successfully tested. The first one was a single wire or multiwire cylindrical geometry detector operating in pulse mode at a gas gain of 1. The second type alpha detector was an innovative GEM-like detector with resistive electrodes operating in air in avalanche mode at high gas gains (up to 10E4). A detailed comparison between these two detectors is given as well as comparison with the commercially available alpha detectors. The main advantages of gaseous detectors operating in air in a pulse detection mode are their simplicity, low cost and high sensitivity. One of the possible ap...

Single longitudinal mode operation of a solid-state dye laser oscillator

CERN Document Server

Lim, G; Kim, H S; Cha, B H; Lee, J M

2000-01-01

We have operated a single longitudinal mode of a solid-state dye laser oscillator in a Littman configuration. The host material of the solid-state gain medium was rhodamine dye-doped poly (methyl methacrylate). The pumping source was the second harmonic of a Nd:YAG laser with a repetition rate of 10 Hz. The measured linewidth of the laser output was about 1.5 GHz.

Software module for geometric product modeling and NC tool path generation

International Nuclear Information System (INIS)

Sidorenko, Sofija; Dukovski, Vladimir

2003-01-01

The intelligent CAD/CAM system named VIRTUAL MANUFACTURE is created. It is consisted of four intelligent software modules: the module for virtual NC machine creation, the module for geometric product modeling and automatic NC path generation, the module for virtual NC machining and the module for virtual product evaluation. In this paper the second intelligent software module is presented. This module enables feature-based product modeling carried out via automatic saving of the designed product geometric features as knowledge data. The knowledge data are afterwards applied for automatic NC program generation for the designed product NC machining. (Author)

Path planning during combustion mode switch

Science.gov (United States)

Jiang, Li; Ravi, Nikhil

2015-12-29

Systems and methods are provided for transitioning between a first combustion mode and a second combustion mode in an internal combustion engine. A current operating point of the engine is identified and a target operating point for the internal combustion engine in the second combustion mode is also determined. A predefined optimized transition operating point is selected from memory. While operating in the first combustion mode, one or more engine actuator settings are adjusted to cause the operating point of the internal combustion engine to approach the selected optimized transition operating point. When the engine is operating at the selected optimized transition operating point, the combustion mode is switched from the first combustion mode to the second combustion mode. While operating in the second combustion mode, one or more engine actuator settings are adjusted to cause the operating point of the internal combustion to approach the target operating point.

Voltage Harmonic Compensation of a Microgrid Operating in Islanded and Grid-Connected Modes

DEFF Research Database (Denmark)

Savaghebi, Mehdi; Jalilian, Alireza; Vasquez, Juan C.

2011-01-01

In this paper, a method for voltage harmonic compensation in a microgrid operating in islanded and gridconnected modes is presented. Harmonic compensation is done through proper control of distributed generators (DGs) interface converters. In order to achieve proper sharing of the compensation...

Current distribution measurements inside an electromagnetic plasma gun operated in a gas-puff mode

OpenAIRE

Poehlmann, Flavio R.; Cappelli, Mark A.; Rieker, Gregory B.

2010-01-01

Measurements are presented of the time-dependent current distribution inside a coaxial electromagnetic plasma gun. The measurements are carried out using an array of six axially distributed dual-Rogowski coils in a balanced circuit configuration. The radial current distributions indicate that operation in the gas-puff mode, i.e., the mode in which the electrode voltage is applied before injection of the gas, results in a stationary ionization front consistent with the presence of a plasma def...

MOF derived Ni/Co/NC catalysts with enhanced properties for oxygen evolution reaction

Science.gov (United States)

Hu, Jiapeng; Chen, Juan; Lin, Hao; Liu, Ruilai; Yang, Xiaobing

2018-03-01

Designing efficient electrocatalysts for oxygen evolution reaction (OER) is very important for renewable energy storage and conversion devices. In this paper, we introduced a new strategy to synthesize Ni doped Co/NC catalysts (NC is the abbreviation of nitrogen-doped graphitic carbon), which were derived from ZIF-67. All catalysts were characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscope (TEM) and oxygen evolution reaction (OER). The results show that Ni was well doped in the Ni/Co/NC catalysts and the doping of Ni has great influence on the OER activity of Ni/Co/NC catalysts. Among these catalysts, 0.50Ni/Co/NC exhibits the highest OER activity. The onset potential of 0.50Ni/Co/NC is 1.47 V, which is superior than the onset potential of Co/NC (1.54 V), 0.25Ni/Co/NC (1.48 V), 1.00Ni/Co/NC (1.53 V). The excellent OER activity of 0.50Ni/Co/NC catalyst makes its potential to be used on renewable energy storage.

Operating modes of superconducting tunnel junction device

Energy Technology Data Exchange (ETDEWEB)

Maehata, Keisuke [Kyushu Univ., Fukuoka (Japan). Faculty of Engineering

1998-07-01

In the Electrotechnical Laboratory, an Nb type superconducting tunnel junction (STJ) device with 200 x 200 sq. micron in area and super high quality was manufactured. By using 55-fe source, response of this large area STJ to X-ray was measured. In this measurement, two action modes with different output wave height from front amplifier were observed. Then, in this study, current-voltage feature of the element in each action mode was analyzed to elucidate a mechanism to form such two action modes. The feature was analyzed by using first order approximate solution on cavity resonance mode of Sine-Gordon equation. From the analytical results, it could be supposed that direction and magnitude of effective magnetic field penetrating into jointed area changed by an induction current effect owing to impressing speed of the magnetic field, which brings two different current-voltage features to make possible to observe two action modes with different pulse wave height. (G.K.)

Overview of long pulse H-mode operation on EAST

Science.gov (United States)

Gong, X.; Garofalo, A. M.; Wan, B.; Li, J.; Qian, J.; Li, E.; Liu, F.; Zhao, Y.; Wang, M.; Xu, H.; EAST Team

2017-10-01

The EAST research program aims to demonstrate steady-state long-pulse high-performance H-mode operations with ITER-like poloidal configuration and RF-dominated heating schemes. In the recent experimental campaign, a long pulse fully non-inductive H-mode discharge lasting over 100 seconds using the upper ITER-like tungsten divertor has been achieved in EAST. This scenario used only RF heating and current drive, but also benefitted from an integrated control of the wall conditioning, plasma configuration, divertor heat flux, particle exhaust, impurity management and superconducting coils safety. Maintaining effective coupling of multiple RF heating and current drive sources on EAST is a critical ingredient. This long pulse discharge had good energy confinement, H98,y2 1.1-1.2, and all of the plasma parameters reach a true steady-state. Power balance indicates that the confinement improvement is due partly to a significantly reduced core electron transport inside minor radius rho<0.4. This work was supported by the National Magnetic Confinement Fusion Program of China Contract No. 2015GB10200 and the US Department of Energy Contract No. DE-SC0010685.

Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

International Nuclear Information System (INIS)

Guerra, A.S.; Laitano, R.F.; Petrocchi, A.

1997-01-01

An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

Water calorimetry with thermistor bridge operated in DC and AC mode: comparative results

Energy Technology Data Exchange (ETDEWEB)

Guerra, A S; Laitano, R F; Petrocchi, A [Ist. Nazionale di Metrologia delle Radiazioni Ionizzanti, ENEA, Roma (Italy)

1997-09-01

An experimental study was carried out to find out the optimal conditions for measuring the output signal in a water calorimeter. To this end the thermistor bridge of the calorimeter was operated in AC and in DC mode, respectively. A comparative analysis of these two alternative methods was the made. In the AC mode measurement a lock-in amplifier based experimental assembly was used and compared to the more conventional system based on a high-sensitivty DC amplifier. The AC system resulted to be preferable as far as the short term and long term reproducibility is concerned. (orig.)

Performance enhancement of high-field asymmetric waveform ion mobility spectrometry by applying differential-RF-driven operation mode.

Science.gov (United States)

Zeng, Yue; Tang, Fei; Zhai, Yadong; Wang, Xiaohao

2017-09-01

The traditional operation mode of high-field Asymmetric Waveform Ion Mobility Spectrometry (FAIMS) uses a one-way radio frequency (RF) voltage input as the dispersion voltage. This requires a high voltage input and limits power consumption reduction and miniaturization of instruments. With higher dispersion voltages or larger compensation voltages, there also exist problems such as low signal intensity or the fact that the dispersion voltage is no longer much larger than the compensation voltage. In this paper, a differential-RF-driven operation mode of FAIMS is proposed. The two-way RF is used to generate the dispersion field, and a phase difference is added between the two RFs to generate a single step waveform field. Theoretical analysis, and experimental results from an ethanol sample, showed that the peak positions of the ion spectra changed linearly (R 2 = 0.9992) with the phase difference of the two RFs in the differential-RF-driven mode and that the peak intensity of the ion spectrum could be enhanced by more than eight times for ethanol ions. In this way, it is possible to convert the ion spectrum peaks outside the separation or compensation voltage range into a detectable range, by changing the phase difference. To produce the same separation electric field, the high-voltage direct current input voltage can be maximally reduced to half of that in the traditional operation mode. Without changing the drift region size or drift condition, the differential-RF-driven operation mode can reduce power consumption, increase signal-to-noise ratio, extend the application range of the dispersion voltage and compensation voltage, and improve FAIMS detection performance.

Optimization of TW accelerating structures for SLED type modes of operation

International Nuclear Information System (INIS)

Le Duff, J.

1984-02-01

The SLED method was invented at SLAC in order to produce more electron (and positron) energy from the existing klystrons. The LEP injector LINAC, also now is supposed to operate in the SLED-2 mode. At DESY similar developments have been undertaken too, to improve the linac performances. However in all cases the accelerating sections were not initially optimized for such a mode of operation, and in most cases the designers ended with long accelerating sections making a more efficient use of the klystron power, with rectangular pulses, sometimes at the expense of a longer linac. The present study deals with new approaches for designing linacs, and in particular compact linacs, considering from the beginning a pulse compression scheme, where the main feature consists of having an exponential pulse shape instead of rectangular. Moreover a detailed comparison is made between constant impedance and constant gradient travelling wave (TW) accelerating structures. As a matter of fact the constant impedance structure when optimized looks sligthy better than the second one. In addition short structures appear to be more efficient for a given number of RF sources. Consequently linear accelerators can be made more simple and less expensive, and if one allows for higher tolerable accelerating gradients they can be made even compact

Methods on TLD management be applicable in nuclear power plantsunder the multi-reactor operational mode

International Nuclear Information System (INIS)

Luo Huiyong; Wen Qinghua; Li Ruirong; Yu Enjian

2006-01-01

This paper discusses the methods on management of TLD dosimeters adopted in DNMC and other NPPs, analyzes and evaluates their both defects and advantages. Facing the coming of the multi-reactor operational mode applied in NPPs, a new method intelligent management mode is put forward, this optimized method not only assures the accuracy of TLD's measurement but also reduces the cost of production and improves the efficiency of management greatly. (authors)

Dual mode operation, highly selective nanohole array-based plasmonic colour filters

Science.gov (United States)

Fouladi Mahani, Fatemeh; Mokhtari, Arash; Mehran, Mahdiyeh

2017-09-01

Taking advantage of nanostructured metal films as plasmonic colour filters (PCFs) has been evolved remarkably as an alternative to the conventional technologies of chemical colour filtering. However, most of the proposed PCFs depict a poor colour purity focusing on generating either the additive or subtractive colours. In this paper, we present dual mode operation PCFs employing an opaque aluminium film patterned with sub-wavelength holes. Subtractive colours like cyan, magenta, and yellow are the results of reflection mode of these filters yielding optical efficiencies as high as 70%-80% and full width at half maximum of the stop-bands up to 40-50 nm. The colour selectivity of the transmission mode for the additive colours is also significant due to their enhanced performance through the utilization of a relatively thick aluminium film in contact with a modified dielectric environment. These filters provide a simple design with one-step lithography in addition to compatibility with the conventional CMOS processes. Moreover, they are polarization insensitive due to their symmetric geometry. A complete palette of pure subtractive and additive colours has been realized with potential applications, such as multispectral imaging, CMOS image sensors, displays, and colour printing.

A square-plate ultrasonic linear motor operating in two orthogonal first bending modes.

Science.gov (United States)

Chen, Zhijiang; Li, Xiaotian; Chen, Jianguo; Dong, Shuxiang

2013-01-01

A novel square-plate piezoelectric ultrasonic linear motor operated in two orthogonal first bending vibration modes (B₁) is proposed. The piezoelectric vibrator of the linear motor is simply made of a single PZT ceramic plate (sizes: 15 x 15 x 2 mm) and poled in its thickness direction. The top surface electrode of the square ceramic plate was divided into four active areas along its two diagonal lines for exciting two orthogonal B₁ modes. The achieved driving force and speed from the linear motor are 1.8 N and 230 mm/s, respectively, under one pair orthogonal voltage drive of 150 V(p-p) at the resonance frequency of 92 kHz. The proposed linear motor has advantages over conventional ultrasonic linear motors, such as relatively larger driving force, very simple working mode and structure, and low fabrication cost.

Thermo-mechanical and damage analyses of EAST carbon divertor under type-I ELMy H-mode operation

Energy Technology Data Exchange (ETDEWEB)

Li, W.X. [School of Nuclear Science and Technology, University of Science and Technology of China, Hefei 230026 (China); Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Song, Y.T. [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); School of Nuclear Science and Technology, University of Science and Technology of China, Hefei 230026 (China); Ye, M.Y. [School of Nuclear Science and Technology, University of Science and Technology of China, Hefei 230026 (China); Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Peng, X.B., E-mail: pengxb@ipp.ac.cn [Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Wu, S.T. [School of Nuclear Science and Technology, University of Science and Technology of China, Hefei 230026 (China); Institute of Plasma Physics, Chinese Academy of Sciences, Hefei 230031 (China); Qian, X.Y.; Zhu, C.C. [School of Nuclear Science and Technology, University of Science and Technology of China, Hefei 230026 (China)

2016-04-15

Highlights: • Type-I ELMy H-mode is one of the most severe operating environment in tokamak. • An actual time-history heat load has been used in thermo-mechanical analysis. • The analysis results are time-dependent during the whole discharge process. • The analysis could be very useful in evaluating the operational capability of the divertor. - Abstract: The lower carbon divertor has been used since 2008 in EAST, and many significant physical results, like the 410 s long pulse discharge and the 32 s H-mode operation, have been achieved. As the carbon divertor will still be used in the next few years while the injected auxiliary heating power would be increased gradually, it’s necessary to evaluate the operational capability of the carbon divertor under the heat loads during future operation. In this paper, an actual time-history heat load during type-I ELMy H-mode from EAST experiment, as one of the most severe operating environment in tokamak, has been used in the calculation and analysis. The finite element (FE) thermal and mechanical calculations have been carried out to analysis the stress and deformation of the carbon divertor during the heat loads. According to the results, the main impact on the overall temperature comes from the relative stable phase before and after the type-I ELMs and local peak load, and the transient thermal load such as type-I ELMy only has a significant effect on the surface temperature of the graphite tiles. The carbon divertor would work with high stress near the screw bolts in the current operational conditions, because of high preload and conservative frictional coefficient between the bolts and heatsink. For the future operation, new plasma facing materials (PFM) and divertor technology should be developed.

Inherent and antigen-induced airway hyperreactivity in NC mice

OpenAIRE

Tetsuto Kobayashi; Toru Miura; Tomoko Haba; Miyuki Sato; Masao Takei; Isao Serizawa

1999-01-01

In order to clarify the airway physiology of NC mice, the following experiments were carried out. To investigate inherent airway reactivity, we compared tracheal reactivity to various chemical mediators in NC, BALB/c, C57BL/6 and A/J mice in vitro. NC mice showed significantly greater reactivity to acetylcholine than BALB/c and C57BL/6 mice and a reactivity comparable to that of A/J mice, which are known as high responders. Then, airway reactivity to acetylcholine was investigated in those st...

On pseudorandom generators in NC⁰

DEFF Research Database (Denmark)

Cryan, Mary; Miltersen, Peter Bro

2001-01-01

In this paper we consider the question of whether NC 0 circuits can generate pseudorandom distributions. While we leave the general question unanswered, we show – • Generators computed by NC 0 circuits where each output bit depends on at most 3 input bits (i.e, DNC 3 0 circuits) and with stretch ...

Prediction to natural circulation in semiscale SBLOCA test, S-NC-8B

International Nuclear Information System (INIS)

Bang, Young Seok; Seul, Kwang Won; Lee, Sukho; Kim, Hho Jung

1995-01-01

Natural circulation and the associated thermal-hydraulic behavior are predicted by RELAP5/MOD3.1 code against the test S-NC-8B, which simulated 0.1% equivalent SBLOCA in PWR. The Semiscale Mod-2A facility and the test-specific initial/boundary condition are modeled. The calculation result is compared with the experiment data in terms of natural circulation characteristic and the code predictability is evaluated on natural circulation. As a result, flow rate during single-and two-phase natural circulation modes is well predicted and slightly overpredicted with oscillation in transition and reflux regimes. Additional sensitivity calculations are attempted with different discharge coefficient and break modeling to investigate the break flow effect

78 FR 54413 - Proposed Establishment of Class E Airspace; Star, NC

Science.gov (United States)

2013-09-04

...-0440; Airspace Docket No. 13-ASO-10] Proposed Establishment of Class E Airspace; Star, NC AGENCY... action proposes to establish Class E Airspace at Star, NC, to accommodate a new Area Navigation (RNAV... establish Class E airspace at Star, NC, providing the controlled airspace required to support the new RNAV...

Passive mode-locking dynamics in a 3.1GHz quantum dot laser diode operating around 1.5μm

NARCIS (Netherlands)

Tahvili, M.S.; Heck, M.J.R.; Nötzel, R.; Smit, M.K.; Bente, E.A.J.M.

2010-01-01

We report on passive mode-locking in a 3.1GHz InAs/InP(100) quantum dot laser diode operating around 1.5µm. The range of stable passive mode-locking, detailed measurements of the linewidth of the optical modes and the phase modulation in output pulses are presented.

New VCSEL technology with scalability for single mode operation and densely integrated arrays

Science.gov (United States)

Zhao, Guowei; Demir, Abdullah; Freisem, Sabine; Zhang, Yu; Liu, Xiaohang; Deppe, Dennis G.

2011-06-01

Data are presented demonstrating a new lithographic vertical-cavity surface-emitting laser (VCSEL) technology, which produces simultaneous mode- and current-confinement only by lithography and epitaxial crystal growth. The devices are grown by solid source molecular beam epitaxy, and have lithographically defined sizes that vary from 3 μm to 20 μm. The lithographic process allows the devices to have high uniformity throughout the wafer and scalability to very small size. The 3 μm device shows a threshold current of 310 μA, the slope efficiency of 0.81 W/A, and the maximum output power of more than 5 mW. The 3 μm device also shows single-mode single-polarization operation without the use of surface grating, and has over 25 dB side-mode-suppression-ratio up to 1 mW of output power. The devices have low thermal resistance due to the elimination of oxide aperture. High reliability is achieved by removal of internal strain caused by the oxide, stress test shows no degradation for the 3 μm device operating at very high injection current level of 142 kA/cm2 for 1000 hours, while at this dive level commercial VCSELs fail rapidly. The lithographic VCSEL technology can lead to manufacture of reliable small size laser diode, which will have application in large area 2-D arrays and low power sensors.

Development of Abnormal Operating Strategies for Loss of Ultimate Heat Sink (LOUHS) at Shutdown Mode in Westinghouse Type Nuclear Power Plant

Energy Technology Data Exchange (ETDEWEB)

Yoon, Duk-Joo; Lee, Seung-Chan; Sung, Je-Joong; Ha, Sang Jun [KHNP CRI, Daejeon (Korea, Republic of); Hwang, Su-Hyun [FNC Tech. Co., Yongin (Korea, Republic of)

2016-10-15

Loss of all AC power is classified as one of multiple failure accident by regulatory guide of Korean accident management program. Therefore we need develop strategies for the abnormal operating procedure both of power operating and shutdown mode. This paper developed abnormal operating guideline for loss of all AC power by analysis of accident scenario in pressurized water reactor. This paper analyzed the extended SBO in shutdown operating mode and developed the operating strategy of the abnormal operation procedure. Operator action for the emergency are not required to take in 500 minutes and 60 minutes in intact and opened RCS state respectively.

Possibilities and testing of CPRNG in block cipher mode of operation PM-DC-LM

Energy Technology Data Exchange (ETDEWEB)

Zacek, Petr; Jasek, Roman; Malanik, David [Faculty of applied Informatics, Tomas Bata University in Zlin, Zlin, Czech Republic zacek@fai.utb.cz, jasek@fai.utb.cz, dmalanik@fai.utb.cz (Czech Republic)

2016-06-08

This paper discusses the chaotic pseudo-random number generator (CPRNG), which is used in block cipher mode of operation called PM-DC-LM. PM-DC-LM is one of possible subversions of general PM mode. In this paper is not discussed the design of PM-DC-LM, but only CPRNG as a part of it because designing is written in other papers. Possibilities, how to change or to improve CPRNG are mentioned. The final part is devoted for a little testing of CPRNG and some testing data are shown.

Possibilities and testing of CPRNG in block cipher mode of operation PM-DC-LM

Science.gov (United States)

Zacek, Petr; Jasek, Roman; Malanik, David

2016-06-01

This paper discusses the chaotic pseudo-random number generator (CPRNG), which is used in block cipher mode of operation called PM-DC-LM. PM-DC-LM is one of possible subversions of general PM mode. In this paper is not discussed the design of PM-DC-LM, but only CPRNG as a part of it because designing is written in other papers. Possibilities, how to change or to improve CPRNG are mentioned. The final part is devoted for a little testing of CPRNG and some testing data are shown.

Possibilities and testing of CPRNG in block cipher mode of operation PM-DC-LM

International Nuclear Information System (INIS)

Zacek, Petr; Jasek, Roman; Malanik, David

2016-01-01

This paper discusses the chaotic pseudo-random number generator (CPRNG), which is used in block cipher mode of operation called PM-DC-LM. PM-DC-LM is one of possible subversions of general PM mode. In this paper is not discussed the design of PM-DC-LM, but only CPRNG as a part of it because designing is written in other papers. Possibilities, how to change or to improve CPRNG are mentioned. The final part is devoted for a little testing of CPRNG and some testing data are shown.

Potential Hazards Relating to Pyrolysis of c-C4F8O, n-C4F10 and c-C4F8 in selected gaseous diffusion plant operations

International Nuclear Information System (INIS)

Trowbridge, L.D.

2000-01-01

As part of a program intended to replace the present evaporative coolant at the gaseous diffusion plants (GDPs) with a non-ozone-depleting alternate, a series of investigations of the suitability of candidate substitutes is under way. This report summarizes studies directed at estimating the chemical and thermal stability of three candidate coolants, c-C 4 F 8 O, n-C 4 F 10 and c-C 4 4F 8 , in a few specific environments to be found in gaseous diffusion plant operations

Noncontact AFM Imaging of Atomic Defects on the Rutile TiO2 (110) Surface

DEFF Research Database (Denmark)

Lauritsen, Jeppe Vang

2015-01-01

The atomic force microscope (AFM) operated in the noncontact mode (nc-AFM) offers a unique tool for real space, atomic-scale characterisation of point defects and molecules on surfaces, irrespective of the substrate being electrically conducting or non-conducting. The nc-AFM has therefore in rece...

Characterizing ncRNAs in human pathogenic protists using high-throughput sequencing technology

Directory of Open Access Journals (Sweden)

Lesley Joan Collins

2011-12-01

Full Text Available ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, snoRNAs and long ncRNAs on a genomic scale making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases.

Characterizing ncRNAs in Human Pathogenic Protists Using High-Throughput Sequencing Technology

Science.gov (United States)

Collins, Lesley Joan

2011-01-01

ncRNAs are key genes in many human diseases including cancer and viral infection, as well as providing critical functions in pathogenic organisms such as fungi, bacteria, viruses, and protists. Until now the identification and characterization of ncRNAs associated with disease has been slow or inaccurate requiring many years of testing to understand complicated RNA and protein gene relationships. High-throughput sequencing now offers the opportunity to characterize miRNAs, siRNAs, small nucleolar RNAs (snoRNAs), and long ncRNAs on a genomic scale, making it faster and easier to clarify how these ncRNAs contribute to the disease state. However, this technology is still relatively new, and ncRNA discovery is not an application of high priority for streamlined bioinformatics. Here we summarize background concepts and practical approaches for ncRNA analysis using high-throughput sequencing, and how it relates to understanding human disease. As a case study, we focus on the parasitic protists Giardia lamblia and Trichomonas vaginalis, where large evolutionary distance has meant difficulties in comparing ncRNAs with those from model eukaryotes. A combination of biological, computational, and sequencing approaches has enabled easier classification of ncRNA classes such as snoRNAs, but has also aided the identification of novel classes. It is hoped that a higher level of understanding of ncRNA expression and interaction may aid in the development of less harsh treatment for protist-based diseases. PMID:22303390

Modified Adaptive Control for Region 3 Operation in the Presence of Wind Turbine Structural Modes

Science.gov (United States)

Frost, Susan Alane; Balas, Mark J.; Wright, Alan D.

2010-01-01

Many challenges exist for the operation of wind turbines in an efficient manner that is reliable and avoids component fatigue and failure. Turbines operate in highly turbulent environments resulting in aerodynamic loads that can easily excite turbine structural modes, possibly causing component fatigue and failure. Wind turbine manufacturers are highly motivated to reduce component fatigue and failure that can lead to loss of revenue due to turbine down time and maintenance costs. The trend in wind turbine design is toward larger, more flexible turbines that are ideally suited to adaptive control methods due to the complexity and expense required to create accurate models of their dynamic characteristics. In this paper, we design an adaptive collective pitch controller for a high-fidelity simulation of a utility-scale, variable-speed horizontal axis wind turbine operating in Region 3. The objective of the adaptive pitch controller is to regulate generator speed, accommodate wind gusts, and reduce the excitation of structural modes in the wind turbine. The control objective is accomplished by collectively pitching the turbine blades. The adaptive collective pitch controller for Region 3 was compared in simulations with a baseline classical Proportional Integrator (PI) collective pitch controller. The adaptive controller will demonstrate the ability to regulate generator speed in Region 3, while accommodating gusts, and reducing the excitation of certain structural modes in the wind turbine.

Assessment of body mapping sportswear using a manikin operated in constant temperature mode and thermoregulatory model control mode

Science.gov (United States)

Wang, Faming; Del Ferraro, Simona; Molinaro, Vincenzo; Morrissey, Matthew; Rossi, René

2014-09-01

Regional sweating patterns and body surface temperature differences exist between genders. Traditional sportswear made from one material and/or one fabric structure has a limited ability to provide athletes sufficient local wear comfort. Body mapping sportswear consists of one piece of multiple knit structure fabric or of different fabric pieces that may provide athletes better wear comfort. In this study, the `modular' body mapping sportswear was designed and subsequently assessed on a `Newton' type sweating manikin that operated in both constant temperature mode and thermophysiological model control mode. The performance of the modular body mapping sportswear kit and commercial products were also compared. The results demonstrated that such a modular body mapping sportswear kit can meet multiple wear/thermal comfort requirements in various environmental conditions. All body mapping clothing (BMC) presented limited global thermophysiological benefits for the wearers. Nevertheless, BMC showed evident improvements in adjusting local body heat exchanges and local thermal sensations.

H-mode pedestal and threshold studies over an expanded operating space on Alcator C-Moda)

Science.gov (United States)

Hubbard, A. E.; Hughes, J. W.; Bespamyatnov, I. O.; Biewer, T.; Cziegler, I.; LaBombard, B.; Lin, Y.; McDermott, R.; Rice, J. E.; Rowan, W. L.; Snipes, J. A.; Terry, J. L.; Wolfe, S. M.; Wukitch, S.

2007-05-01

This paper reports on studies of the edge transport barrier and transition threshold of the high confinement (H) mode of operation on the Alcator C-Mod tokamak [I. H. Hutchinson et al., Phys. Plasmas 1, 1511 (1994)], over a wide range of toroidal field (2.6-7.86T) and plasma current (0.4-1.7MA). The H-mode power threshold and edge temperature at the transition increase with field. Barrier widths, pressure limits, and confinement are nearly independent of field at constant current, but the operational space at high B shifts toward higher temperature and lower density and collisionality. Experiments with reversed field and current show that scrape-off-layer flows in the high-field side depend primarily on configuration. In configurations with the B ×∇B drift away from the active X-point, these flows lead to more countercurrent core rotation, which apparently contributes to higher H-mode thresholds. In the unfavorable case, edge temperature thresholds are higher, and slow evolution of profiles indicates a reduction in thermal transport prior to the transition in particle confinement. Pedestal temperatures in this case are also higher than in the favorable configuration. Both high-field and reversed-field results suggest that parameters at the L-H transition are influencing the evolution and parameters of the H-mode pedestal.

Research on NC motion controller based on SOPC technology

Science.gov (United States)

Jiang, Tingbiao; Meng, Biao

2006-11-01

With the rapid development of the digitization and informationization, the application of numerical control technology in the manufacturing industry becomes more and more important. However, the conventional numerical control system usually has some shortcomings such as the poor in system openness, character of real-time, cutability and reconfiguration. In order to solve these problems, this paper investigates the development prospect and advantage of the application in numerical control area with system-on-a-Programmable-Chip (SOPC) technology, and puts forward to a research program approach to the NC controller based on SOPC technology. Utilizing the characteristic of SOPC technology, we integrate high density logic device FPGA, memory SRAM, and embedded processor ARM into a single programmable logic device. We also combine the 32-bit RISC processor with high computing capability of the complicated algorithm with the FPGA device with strong motivable reconfiguration logic control ability. With these steps, we can greatly resolve the defect described in above existing numerical control systems. For the concrete implementation method, we use FPGA chip embedded with ARM hard nuclear processor to construct the control core of the motion controller. We also design the peripheral circuit of the controller according to the requirements of actual control functions, transplant real-time operating system into ARM, design the driver of the peripheral assisted chip, develop the application program to control and configuration of FPGA, design IP core of logic algorithm for various NC motion control to configured it into FPGA. The whole control system uses the concept of modular and structured design to develop hardware and software system. Thus the NC motion controller with the advantage of easily tailoring, highly opening, reconfigurable, and expandable can be implemented.

Calibration and fluctuation of the secular frequency peak amplitude versus initial condition distribution of the ion cloud confined into a three-dimensional quadrupole ion trap using a fourier transform operating mode and a steady ion flow injection mode

International Nuclear Information System (INIS)

Janulyte, A.; Andre, J.; Carette, M.; Mercury, M.; Reynard, C; Zerega, Y.

2009-01-01

A specific Fourier transform operating mode is applied to a 3-dimensional quadrupolar ion trap for mass analysis (Fourier Transform Quadrupolar Ion Trap (FTQIT) Operating Mode or Mass Spectrometer). With this operating mode, an image signal, which is representative of the collective motion of simultaneously confined ions, is made up from a set of recorded time-of-flight histograms. In an ion trap, the secular frequency of ion motion depends on m/Z ratio of the ion. By Fourier transformation of the image signal, one observes the frequency peak of each confined ionic species. When only one ionic species is confined, the peak amplitude is proportional to the maximal amplitude of the image signal. The maximal amplitude of the image signal is expressed according to the operating parameters, the initial conditions of the ions and the number of ions. Simulation tools lead to fluctuation calculation of the maximal amplitude of the image signal. Two origins are explored: (1) the fluctuation of the numbers of ions according to the steady ion flow injection mode (SIFIM) used with this operating mode and (2) the distribution fluctuation of the initial positions and velocities. Initial confinement conditions, obtained with SIFIM injection mode, lead to optimal detection with small fluctuations of the peak amplitude for Fourier transform operating mode applied to an ion trap. (authors)

Physics of increased edge electron temperature and density turbulence during ELM-free QH-mode operation on DIII-D

Science.gov (United States)

Sung, C.; Rhodes, T. L.; Staebler, G. M.; Yan, Z.; McKee, G. R.; Smith, S. P.; Osborne, T. H.; Peebles, W. A.

2018-05-01

For the first time, we report increased edge electron temperature and density turbulence levels ( T˜ e and n˜ e) in Edge Localized Mode free Quiescent H-mode (ELM-free QH-mode) plasmas as compared to the ELMing time period. ELMs can severely damage plasma facing components in fusion plasma devices due to their large transient energy transport, making ELM-free operation a highly sought after goal. The QH-mode is a candidate for this goal as it is ELM-free for times limited only by hardware constraints. It is found that the driving gradients decrease during the QH-mode compared to the ELMing phase, however, a significant decrease in the ExB shearing rate is also observed that taken together is consistent with the increased turbulence. These results are significant as the prediction and control of ELM-free H-mode regimes are crucial for the operation of future fusion devices such as ITER. The changes in the linear growth rates calculated by CGYRO [Candy et al., J. Comput. Phys. 324, 73 (2016)] and the measured ExB shearing rate between ELMing and QH-mode phases are qualitatively consistent with these turbulence changes. Comparison with ELMing and 3D fields ELM suppressed H-mode finds a similar increase in T˜ e and n˜ e, however, with distinctly different origins, the increased driving gradients rather than the changes in the ExB shearing rate in 3D fields ELM suppressed the H-mode. However, linear gyrokinetic calculation results are generally consistent with the increased turbulence in both ELM-controlled discharges.

Gravitationally induced zero modes of the Faddeev-Popov operator in the Coulomb gauge for Abelian gauge theories

Science.gov (United States)

Canfora, Fabrizio; Giacomini, Alex; Oliva, Julio

2010-08-01

It is shown that on curved backgrounds, the Coulomb gauge Faddeev-Popov operator can have zero modes even in the Abelian case. These zero modes cannot be eliminated by restricting the path integral over a certain region in the space of gauge potentials. The conditions for the existence of these zero modes are studied for static spherically symmetric spacetimes in arbitrary dimensions. For this class of metrics, the general analytic expression of the metric components in terms of the zero modes is constructed. Such expression allows one to find the asymptotic behavior of background metrics, which induce zero modes in the Coulomb gauge, an interesting example being the three-dimensional anti-de Sitter spacetime. Some of the implications for quantum field theory on curved spacetimes are discussed.

The baryon vector current in the combined chiral and 1/Nc expansions

Energy Technology Data Exchange (ETDEWEB)

Flores-Mendieta, Ruben; Goity, Jose L [JLAB

2014-12-01

The baryon vector current is computed at one-loop order in large-Nc baryon chiral perturbation theory, where Nc is the number of colors. Loop graphs with octet and decuplet intermediate states are systematically incorporated into the analysis and the effects of the decuplet-octet mass difference and SU(3) flavor symmetry breaking are accounted for. There are large-Nc cancellations between different one-loop graphs as a consequence of the large-Nc spin-flavor symmetry of QCD baryons. The results are compared against the available experimental data through several fits in order to extract information about the unknown parameters. The large-Nc baryon chiral perturbation theory predictions are in very good agreement both with the expectations from the 1/Nc expansion and with the experimental data. The effect of SU(3) flavor symmetry breaking for the |Delta S|=1 vector current form factors f1(0) results in a reduction by a few percent with respect to the corresponding SU(3) symmetric values.

33 CFR 110.170 - Lockwoods Folly Inlet, N.C.

Science.gov (United States)

2010-07-01

... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Lockwoods Folly Inlet, N.C. 110.170 Section 110.170 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY ANCHORAGES ANCHORAGE REGULATIONS Anchorage Grounds § 110.170 Lockwoods Folly Inlet, N.C. (a) Explosives...

Acquisition performance of LAPAN-A3/IPB multispectral imager in real-time mode of operation

Science.gov (United States)

Hakim, P. R.; Permala, R.; Jayani, A. P. S.

2018-05-01

LAPAN-A3/IPB satellite was launched in June 2016 and its multispectral imager has been producing Indonesian coverage images. In order to improve its support for remote sensing application, the imager should produce images with high quality and quantity. To improve the quantity of LAPAN-A3/IPB multispectral image captured, image acquisition could be executed in real-time mode from LAPAN ground station in Bogor when the satellite passes west Indonesia region. This research analyses the performance of LAPAN-A3/IPB multispectral imager acquisition in real-time mode, in terms of image quality and quantity, under assumption of several on-board and ground segment limitations. Results show that with real-time operation mode, LAPAN-A3/IPB multispectral imager could produce twice as much as image coverage compare to recorded mode. However, the images produced in real-time mode will have slightly degraded quality due to image compression process involved. Based on several analyses that have been done in this research, it is recommended to use real-time acquisition mode whenever it possible, unless for some circumstances that strictly not allow any quality degradation of the images produced.

A possible way for conservatism reduction at the modelling of WWER operational modes

International Nuclear Information System (INIS)

Shishkov, L. K.

2010-01-01

The paper discusses the way to ensure safety operation of the WWER by meet ing the technological Safety Criteria that are defined in the documents of the state level. That Safety Criteria are ensured by-turn by implementation of the design limits for the number of core parameters at normal operation. Verification of the Safety Criteria adherences for all design modes of NPP operation is conducted in assumption that all (if possible) core parameters that have the design limits reach these limiting values. Additionally, to take into account possible error of modeling, a reactor operates in conditions for the core parameters to not reach the limits with probability greater than 95%. This method is deliberately conservative and it may be substituted with 'probabilistic method'. Probabilistic method supposes the operational parameters are defined with accounting of the possible random deviation to ensure the probability of technological Safety Criteria to be met. (Author)

Comparison of collision operators for drift and MHD-interchange modes in unsheared slab geometry

International Nuclear Information System (INIS)

Rewoldt, G.; Tang, W.M.; Hastie, R.J.

1986-02-01

The general procedure for the kinetic analysis of low-frequency electrostatic and electromagnetic modes in toroidal geometry is now well known. In the collisionless limit, the relevant dynamics (e.g., trapped particles, resonances, etc.) can be treated appropriately. However, with the introduction of collisional effects, it is customary, for tractability, to employ model collision operators which do not rigorously satisfy all conservation properties of more exact collision operators. Insight into the essential required features of such operators can be gained by studying models with increasing levels of completeness for a simpler, unsheared slab geometry. The results presented here for this simpler geometry can provide guidance in choosing model collision operators for toroidal-geometry kinetic calculations. 6 refs., 3 figs

Near-roadway monitoring of vehicle emissions as a function of mode of operation for light-duty vehicles.

Science.gov (United States)

Wen, Dongqi; Zhai, Wenjuan; Xiang, Sheng; Hu, Zhice; Wei, Tongchuan; Noll, Kenneth E

2017-11-01

Determination of the effect of vehicle emissions on air quality near roadways is important because vehicles are a major source of air pollution. A near-roadway monitoring program was undertaken in Chicago between August 4 and October 30, 2014, to measure ultrafine particles, carbon dioxide, carbon monoxide, traffic volume and speed, and wind direction and speed. The objective of this study was to develop a method to relate short-term changes in traffic mode of operation to air quality near roadways using data averaged over 5-min intervals to provide a better understanding of the processes controlling air pollution concentrations near roadways. Three different types of data analysis are provided to demonstrate the type of results that can be obtained from a near-roadway sampling program based on 5-min measurements: (1) development of vehicle emission factors (EFs) for ultrafine particles as a function of vehicle mode of operation, (2) comparison of measured and modeled CO 2 concentrations, and (3) application of dispersion models to determine concentrations near roadways. EFs for ultrafine particles are developed that are a function of traffic volume and mode of operation (free flow and congestion) for light-duty vehicles (LDVs) under real-world conditions. Two air quality models-CALINE4 (California Line Source Dispersion Model, version 4) and AERMOD (American Meteorological Society/U.S. Environmental Protection Agency Regulatory Model)-are used to predict the ultrafine particulate concentrations near roadways for comparison with measured concentrations. When using CALINE4 to predict air quality levels in the mixing cell, changes in surface roughness and stability class have no effect on the predicted concentrations. However, when using AERMOD to predict air quality in the mixing cell, changes in surface roughness have a significant impact on the predicted concentrations. The paper provides emission factors (EFs) that are a function of traffic volume and mode of

Sulphur and oxygen sequestration of n-C 37 and n-C 38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

Science.gov (United States)

Koopmans, Martin P.; Schaeffer-Reiss, Christine; de Leeuw, Jan W.; Lewan, Michael D.; Maxwell, James R.; Schaeffer, Philippe; Sinninghe Damsté, Jaap S.

1997-06-01

Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature ( Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330°C for 72 h to study the diagenetic fate of n-C 37 and n-C 38 di- and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260°C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S- and O-bound n-C 37 and n-C 38 skeletons, saturated n-C 37 and n-C38 methyl, ethyl, and mid-chain ketones, C 37 and C 38 mid-chain 2,5-di- n-alkylthiophenes, C 37 and C 38 1,2-di- n-alkylbenzenes, and C 37 and C 38n-alkanes. With increasing thermal maturation, three forms of the n-C 37 and n-C 38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di- n-alkylbenzenes and saturated ketones), whereas the S- and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C 37 and n-C 38 skeleton can be expected as well as the corresponding hydrocarbons.

Sulphur and oxygen sequestration of n-C37 and n-C38 unsaturated ketones in an immature kerogen and the release of their carbon skeletons during early stages of thermal maturation

Science.gov (United States)

Koopmans, M.P.; Schaeffer-Reiss, C.; De Leeuw, J. W.; Lewan, M.D.; Maxwell, J.R.; Schaeffer, P.; Sinninghe, Damste J.S.

1997-01-01

Sedimentary rock from the Gessoso-solfifera Formation (Messinian) in the Vena del Gesso Basin (northern Italy) containing immature (Ro = 0.25%) S-rich organic matter was artificially matured by hydrous pyrolysis at temperatures from 160 to 330??C for 72 h to study the diagenetic fate of n-C37 and n-C38 di-and tri-unsaturated methyl and ethyl ketones (alkenones) biosynthesised by several prymnesiophyte algae. During early diagenesis, the alkenones are incorporated into the kerogen by both sulphur and oxygen cross-linking as indicated by chemical degradation experiments with the kerogen of the unheated sample. Heating at temperatures between 160 and 260??C, which still represents early stages of thermal maturation, produces large amounts (up to 1 mg/g TOC) of S-bound, O-bound, and both S-and O-bound n-C37 and n-C38 skeletons, saturated n-C37 and n-C38 methyl, ethyl, and mid-chain ketones, C37 and C38 mid-chain 2,5-di-n-alkylthiophenes, C37 and C38 1,2-di-n-alkylbenzenes, and C37 and C38 n-alkanes. With increasing thermal maturation, three forms of the n-C37 and n-C38 skeletons are relatively stable (saturated hydrocarbons, 1,2-di-n-alkylbenzenes and saturated ketones), whereas the S-and O-bound skeletons are relatively labile. These results suggest that in natural situations saturated ketones with an n-C37 and n-C38 skeleton can be expected as well as the corresponding hydrocarbons. Copyright ?? 1997 Elsevier Science Ltd.

Potential profiles in the central core of the cathode in the star mode operation in an inertial-electrostatic fusion neutron source

International Nuclear Information System (INIS)

Yoshikawa, K.; Masuda, K.; Toku, H.

2003-01-01

After the successful measurements of the localized electric fields in the center-spot mode operation with relatively large space-charge effects by the laser-induced fluorescence (LIF) method, measurements of potential profiles in the star mode operation with small space-charge effects on helium gas are made in the central cathode core region of an Inertial-Electrostatic Confinement Fusion (IECF) neutron source, which is most suitable to neutron calibration in the fusion devices. Since the high-voltage is required to the star mode operation on deuterium gas, it is predicted to bring about very small beam space charge-related potential. To increase accuracy, we adopted n=4 (2 1 S to 4 1 D:HeI) transition, instead of previous n=3, which is most sensitive to the local electric fields in the Stark transition, and verified using the well-known U-shaped hollow cathode potential. The localized electric fields thus measured by LIF method using n=4 transition show negligible electric fields in the star mode compared with the center-spot mode. (author)

Operational conditions and characteristics of ELM-events during H-mode plasmas in the stellarator W7-AS

International Nuclear Information System (INIS)

Hirsch, M.; Grigull, P.; Wobig, H.; Kisslinger, J.; McCormick, K.; Anton, M.; Baldzuhn, J.; Fiedler, S.; Fuchs, Ch.; Geiger, J.; Giannone, L.; Hartfuss, H.-J.; Holzhauer, E.; Hirsch, M.; Jaenicke, R.; Kick, M.; Maassberg, H.; Wagner, F.; Weller, A.

2000-01-01

H-mode operation in the low-shear stellarator W7-AS is achieved for specific plasma edge topologies characterized by three 'operational windows' of the edge rotational transform. An explanation for this strong influence of the magnetic configuration could be the increase of viscous damping if rational surfaces and thus island structures occur within the relevant plasma edge layer, thereby impeding the development of an edge transport barrier. Prior to the final transition to a quiescent state, the plasma edge passes a rich phenomenology of dynamic behaviour such as dithering and ELMs. Plasma edge parameters indicate that a quiescent H-mode occurs if a certain edge pressure is achieved. (author)

Research on a Novel Exciting Method for a Sandwich Transducer Operating in Longitudinal-Bending Hybrid Modes

Directory of Open Access Journals (Sweden)

Yingxiang Liu

2017-06-01

Full Text Available A novel exciting method for a sandwich type piezoelectric transducer operating in longitudinal-bending hybrid vibration modes is proposed and discussed, in which the piezoelectric elements for the excitations of the longitudinal and bending vibrations share the same axial location, but correspond to different partitions. Whole-piece type piezoelectric plates with three separated partitions are used, in which the center partitions generate the first longitudinal vibration, while the upper and lower partitions produce the second bending vibration. Detailed comparisons between the proposed exciting method and the traditional one were accomplished by finite element method (FEM calculations, which were further verified by experiments. Compared with the traditional exciting method using independent longitudinal ceramics and bending ceramics, the proposed method achieves higher electromechanical coupling factors and larger vibration amplitudes, especially for the bending vibration mode. This novel exciting method for longitudinal-bending hybrid vibrations has not changed the structural dimensions of the sandwich transducer, but markedly improves the mechanical output ability, which makes it very helpful and meaningful in designing new piezoelectric actuators operated in longitudinal-bending hybrid vibration modes.

Damage classification of pipelines under water flow operation using multi-mode actuated sensing technology

International Nuclear Information System (INIS)

Lee, Changgil; Park, Seunghee

2011-01-01

In a structure, several types of damage can occur, ranging from micro-cracking to corrosion or loose bolts. This makes identifying the damage difficult with a single mode of sensing. Therefore, a multi-mode actuated sensing system is proposed based on a self-sensing circuit using a piezoelectric sensor. In self-sensing-based multi-mode actuated sensing, one mode provides a wide frequency-band structural response from the self-sensed impedance measurement and the other mode provides a specific frequency-induced structural wavelet response from the self-sensed guided wave measurement. In this experimental study, a pipeline system under water flow operation was examined to verify the effectiveness and robustness of the proposed structural health monitoring approach. Different types of structural damage were inflicted artificially on the pipeline system. To classify the multiple types of structural damage, supervised learning-based statistical pattern recognition was implemented by composing a three-dimensional space using the damage indices extracted from the impedance and guided wave features as well as temperature variations. For a more systematic damage classification, several control parameters were optimized to determine an optimal decision boundary for the supervised learning-based pattern recognition. Further research issues are also discussed for real-world implementations of the proposed approach

Improving Reliability of High Power Quasi-CW Laser Diode Arrays Operating in Long Pulse Mode

Science.gov (United States)

Amzajerdian, Farzin; Meadows, Byron L.; Barnes, Bruce W.; Lockard, George E.; Singh, Upendra N.; Kavaya, Michael J.; Baker, Nathaniel R.

2006-01-01

Operating high power laser diode arrays in long pulse regime of about 1 msec, which is required for pumping 2-micron thulium and holmium-based lasers, greatly limits their useful lifetime. This paper describes performance of laser diode arrays operating in long pulse mode and presents experimental data of the active region temperature and pulse-to-pulse thermal cycling that are the primary cause of their premature failure and rapid degradation. This paper will then offer a viable approach for determining the optimum design and operational parameters leading to the maximum attainable lifetime.

Experimental Investigation of Operation of VVER Steam Generator in Condensation Mode in the Event of the Severe Accident

Energy Technology Data Exchange (ETDEWEB)

Morozov, Andrey [Institute for Physics and Power Engineering by A.I. Leypunsky, 1 Bondarenko sq. Obninsk, 249033 (Russian Federation)

2008-07-01

For new Russian nuclear power plants with VVER-1200 reactor in the event of a beyond design basis accident, provision is made for the use of passive safety systems for necessary core cooling. These safety systems include the passive heat removal system (PHRS). In the case of leakage in the primary circuit this system assures the transition of steam generators (SG) to operation in the mode of condensation of the primary circuit steam. As a result, the condensate from SG arrives at the core providing its additional cooling. To investigate the condensation mode of VVER SG operation, a large scale HA2M-SG test facility was constructed. The rig incorporates: buffer tank, SG model with scale is 1:46, PHRS heat exchanger. Experiments at the test facility have been performed to investigate condensation mode of operation of SG model at the pressure 0.4 MPa, correspond to VVER reactor pressure at the last stage of the beyond design basis accident. The report presents the test procedure and the basic obtained test results. (authors)

Development and validation of an LC–MS/MS method for quantification of NC-8 in rat plasma and its application to pharmacokinetic studies

Directory of Open Access Journals (Sweden)

Baxter Hepburn Kachingwe

2018-01-01

Full Text Available ent-16-Oxobeyeran-19-N-methylureido (NC-8 is a recently synthesized derivative of isosteviol that showed anti-hepatitis B virus (HBV activity by disturbing replication and gene expression of the HBV and by inhibiting the host toll-like receptor 2/nuclear factor-κB signaling pathway. To study its pharmacokinetics as a part of the drug development process, a highly sensitive, rapid, and reliable liquid chromatography tandem mass spectrometry (LC–MS/MS method was developed and validated for determining NC-8 in rat plasma. After protein precipitation extraction, the chromatographic separation of the analyte and internal standard (IS; diclofenac sodium was performed on a reverse-phase Luna C18 column coupled with a Quattro Ultima triple quadruple mass spectrometer in the multiple-reaction monitoring mode using the transitions, m/z 347.31 → 75.09 for NC-8 and m/z 295.89 → 214.06 for the IS. The lower limit of quantitation was 0.5 ng/mL. The linear scope of the standard curve was between 0.5 and 500 ng/mL. Both the precision (coefficient of variation; % and accuracy (relative error; % were within acceptable criteria of <15%. Recoveries ranged from 104% to 113.4%, and the matrix effects (absolute were non-significant (CV ≤ 6%. The validated method was successfully applied to investigate the pharmacokinetics of NC-8 in male Sprague–Dawley rats. The present methodology provides an analytical means to better understand the preliminary pharmacokinetics of NC-8 for investigations on further drug development.

A 9.61-W, b-cut Tm,Ho:YAP laser in Q-switched mode operation

Science.gov (United States)

Li, Guoxing; Yang, Xining; Zhang, Ziqiu; Zhang, Hongda; Zhang, Liang

2018-02-01

A high energy of b-cut Tm, Ho:YAlO3 laser is reported in the paper. The laser operated in acousto-optical Qswitched mode at 2.12 μm. The output average power of 9.61 W was achieved at the pulse repetition frequency of 10 kHz ,and the power of 11.6 W was acquired in continuous wave mode. Moreover, the energy per pulse of 0.961 mJ in 64.4 ns was acquired at 10 kHz with a 14.92-kW peak power.

A Closed-Loop Model of Operator Visual Attention, Situation Awareness, and Performance Across Automation Mode Transitions.

Science.gov (United States)

Johnson, Aaron W; Duda, Kevin R; Sheridan, Thomas B; Oman, Charles M

2017-03-01

This article describes a closed-loop, integrated human-vehicle model designed to help understand the underlying cognitive processes that influenced changes in subject visual attention, mental workload, and situation awareness across control mode transitions in a simulated human-in-the-loop lunar landing experiment. Control mode transitions from autopilot to manual flight may cause total attentional demands to exceed operator capacity. Attentional resources must be reallocated and reprioritized, which can increase the average uncertainty in the operator's estimates of low-priority system states. We define this increase in uncertainty as a reduction in situation awareness. We present a model built upon the optimal control model for state estimation, the crossover model for manual control, and the SEEV (salience, effort, expectancy, value) model for visual attention. We modify the SEEV attention executive to direct visual attention based, in part, on the uncertainty in the operator's estimates of system states. The model was validated using the simulated lunar landing experimental data, demonstrating an average difference in the percentage of attention ≤3.6% for all simulator instruments. The model's predictions of mental workload and situation awareness, measured by task performance and system state uncertainty, also mimicked the experimental data. Our model supports the hypothesis that visual attention is influenced by the uncertainty in system state estimates. Conceptualizing situation awareness around the metric of system state uncertainty is a valuable way for system designers to understand and predict how reallocations in the operator's visual attention during control mode transitions can produce reallocations in situation awareness of certain states.

Palladium-catalyzed Suzuki-Miyaura coupling of amides by carbon-nitrogen cleavage: general strategy for amide N-C bond activation.

Science.gov (United States)

Meng, Guangrong; Szostak, Michal

2016-06-15

The first palladium-catalyzed Suzuki-Miyaura cross-coupling of amides with boronic acids for the synthesis of ketones by sterically-controlled N-C bond activation is reported. The transformation is characterized by operational simplicity using bench-stable, commercial reagents and catalysts, and a broad substrate scope, including substrates with electron-donating and withdrawing groups on both coupling partners, steric-hindrance, heterocycles, halides, esters and ketones. The scope and limitations are presented in the synthesis of >60 functionalized ketones. Mechanistic studies provide insight into the catalytic cycle of the cross-coupling, including the first experimental evidence for Pd insertion into the amide N-C bond. The synthetic utility is showcased by a gram-scale cross-coupling and cross-coupling at room temperature. Most importantly, this process provides a blueprint for the development of a plethora of metal catalyzed reactions of typically inert amide bonds via acyl-metal intermediates. A unified strategy for amide bond activation to enable metal insertion into N-C amide bond is outlined ().

Single-mode fiber laser based on core-cladding mode conversion.

Science.gov (United States)

Suzuki, Shigeru; Schülzgen, Axel; Peyghambarian, N

2008-02-15

A single-mode fiber laser based on an intracavity core-cladding mode conversion is demonstrated. The fiber laser consists of an Er-doped active fiber and two fiber Bragg gratings. One Bragg grating is a core-cladding mode converter, and the other Bragg grating is a narrowband high reflector that selects the lasing wavelength. Coupling a single core mode and a single cladding mode by the grating mode converter, the laser operates as a hybrid single-mode laser. This approach for designing a laser cavity provides a much larger mode area than conventional large-mode-area step-index fibers.

On Convergence of Extended Dynamic Mode Decomposition to the Koopman Operator

Science.gov (United States)

Korda, Milan; Mezić, Igor

2018-04-01

Extended dynamic mode decomposition (EDMD) (Williams et al. in J Nonlinear Sci 25(6):1307-1346, 2015) is an algorithm that approximates the action of the Koopman operator on an N-dimensional subspace of the space of observables by sampling at M points in the state space. Assuming that the samples are drawn either independently or ergodically from some measure μ , it was shown in Klus et al. (J Comput Dyn 3(1):51-79, 2016) that, in the limit as M→ ∞, the EDMD operator K_{N,M} converges to K_N, where K_N is the L_2(μ )-orthogonal projection of the action of the Koopman operator on the finite-dimensional subspace of observables. We show that, as N → ∞, the operator K_N converges in the strong operator topology to the Koopman operator. This in particular implies convergence of the predictions of future values of a given observable over any finite time horizon, a fact important for practical applications such as forecasting, estimation and control. In addition, we show that accumulation points of the spectra of K_N correspond to the eigenvalues of the Koopman operator with the associated eigenfunctions converging weakly to an eigenfunction of the Koopman operator, provided that the weak limit of the eigenfunctions is nonzero. As a by-product, we propose an analytic version of the EDMD algorithm which, under some assumptions, allows one to construct K_N directly, without the use of sampling. Finally, under additional assumptions, we analyze convergence of K_{N,N} (i.e., M=N), proving convergence, along a subsequence, to weak eigenfunctions (or eigendistributions) related to the eigenmeasures of the Perron-Frobenius operator. No assumptions on the observables belonging to a finite-dimensional invariant subspace of the Koopman operator are required throughout.

Noise in NC-AFM measurements with significant tip–sample interaction

Directory of Open Access Journals (Sweden)

Jannis Lübbe

2016-12-01

Full Text Available The frequency shift noise in non-contact atomic force microscopy (NC-AFM imaging and spectroscopy consists of thermal noise and detection system noise with an additional contribution from amplitude noise if there are significant tip–sample interactions. The total noise power spectral density DΔf(fm is, however, not just the sum of these noise contributions. Instead its magnitude and spectral characteristics are determined by the strongly non-linear tip–sample interaction, by the coupling between the amplitude and tip–sample distance control loops of the NC-AFM system as well as by the characteristics of the phase locked loop (PLL detector used for frequency demodulation. Here, we measure DΔf(fm for various NC-AFM parameter settings representing realistic measurement conditions and compare experimental data to simulations based on a model of the NC-AFM system that includes the tip–sample interaction. The good agreement between predicted and measured noise spectra confirms that the model covers the relevant noise contributions and interactions. Results yield a general understanding of noise generation and propagation in the NC-AFM and provide a quantitative prediction of noise for given experimental parameters. We derive strategies for noise-optimised imaging and spectroscopy and outline a full optimisation procedure for the instrumentation and control loops.

ORF Sequence: NC_002695 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002695 gi|15830145 >gi|15830145|ref|NP_308918.1| putative transmembrane subunit...IFVPIGALQAGEALWHWSVIPLGLAVAILSTALPYSLEMIALTRLPTRTFGTLMSMEPALAAVSGMIFLGETLTPIQLLALGAIIAASMGSTLTVRKESKIKELDIN

ORF Sequence: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23464690 >gi|23464690|ref|NP_695293.1| hypothetical transmembrane pro...LVQLCAMGFIIGYVIRSNNVWMVFSLMAVMLVAAVQIVMSRARGIPKGLAGPIFLSLVITMLLMLALVTELIVRPHPWYAPQLVVPLTGMLLGNTVSALAVGLSRFYESME

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32471017 >gi|32471017|ref|NP_864010.1| hypothetical protein-transmemb...HALISRLRIWGRETLTEMPSWLVSMVVHLTLLLVLALIGRSTSKVGQIELLFRQSSESSSMELAEFTIAAAAPLESFERSMEEERIATTQLVSIDVIDAEAEMFSLVP

ORF Sequence: NC_002942 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002942 gi|52840424 >gi|52840424|ref|YP_094223.1| probable transmembrane protein...EYKRAQKQTFVMFFKGSLKGLVTTAPVTYRGVKIGEVKVIEITENKEHSKVLIPVYVQFFVERTYGFSQDPIHLLIDNGYVANITKPNLLTGVAEIELIKPTPAVKYKQTYYHSYPVFPTHNSAEKYTSME

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32476407 >gi|32476407|ref|NP_869401.1| hypothetical protein-transmemb...IYPDDRPGWIDQPIVNDGKDYSLVVTAGPSGSMEEADELIGVYARGAVQSYVDELVSEQEWATEPEMIPLDIDWIRDELVVRRYEGVVQVGDEQQFEKAILIRIEPEDKKVFETAIADMKLKERLAATGIVILGGFSLLVGGSIVLGGLASRQKQPTAAA

Information needs in nuclear power plants during low power operation modes

Energy Technology Data Exchange (ETDEWEB)

Tommila, Teemu; Fantoni, Paolo F.; Zander, Ralf M.

1998-02-01

During the past few years an increasing attention has been paid to the safety of shutdown and refuelling operations. It has turned out that the risks during shutdown may be comparable to the risks of power operation. The goal of this report is to identify information requirements related to low power operating modes of nuclear power plants. These include, for example, warm and cold shutdowns, refuelling and maintenance, as well as related state transitions such as start-up and shut-down. The focus of the report is on planned refuelling outages and the role of the control room in managing the outage activities. As a starting point, the basic terminology and characteristics of low power operation are discussed. The current situation at nuclear power plants and some recent developments in information technology are reviewed. End-users' requirements and enabling technologies are combined in order to identify the opportunities for new information technology tools in low power operation. The required features of process control systems and maintenance information systems are described. Common plant modelling techniques, open software architectures and functional structuring of the process control system are suggested to be the key issues in the long-term development of operator support systems. On a shorter time scale, new tools solving limited practical problems should be developed and evaluated. This would provide a basis for the features needed for low power operation, including for example, outage planning, on-line risk monitoring, management of outage tasks, adaptive alarm handling, computerised procedures and task-oriented human interfaces. (author)

All-fiber optical mode switching based on cascaded mode selective couplers for short-reach MDM networks

Science.gov (United States)

Ren, Fang; Li, Juhao; Wu, Zhongying; Yu, Jinyi; Mo, Qi; Wang, Jianping; He, Yongqi; Chen, Zhangyuan; Li, Zhengbin

2017-04-01

We propose and experimentally demonstrate an all-fiber optical mode switching structure supporting independent switching, exchanging, adding, and dropping functionalities in which each mode can be switched individually. The mode switching structure consists of cascaded mode selective couplers (MSCs) capable of exciting and selecting specific higher order modes in few-mode fibers with high efficiency and one multiport optical switch routing the independent spatial modes to their destinations. The data carried on three different spatial modes can be switched, exchanged, added, and dropped through this all-fiber structure. For this experimental demonstration, optical on-off-keying (OOK) signals at 10-Gb/s carried on three spatial modes are successfully processed with open and clear eye diagrams. The mode switch exhibits power penalties of less than 3.1 dB after through operation, less than 2.7 dB after exchange operation, less than 2.8 dB after switching operation, and less than 1.6 dB after mode adding and dropping operations at the bit-error rate (BER) of 10-3, while all three channels carried on three spatial modes are simultaneously routed. The proposed structure, compatible with current optical switching networks based on single-mode fibers, can potentially be used to expand the switching scalability in advanced and flexible short-reach mode-division multiplexing-based networks.

Detectors for alpha particles and X-rays operating in ambient air in pulse counting mode or/and with gas amplification

International Nuclear Information System (INIS)

Charpak, G; Benaben, P; Breuil, P; Peskov, V

2008-01-01

Ionization chambers working in ambient air in current detection mode are attractive due to their simplicity and low cost and are widely used in several applications such as smoke detection, dosimetry, therapeutic beam monitoring and so on. The aim of this work was to investigate if gaseous detectors can operate in ambient air in pulse counting mode as well as with gas amplification which potentially offers the highest possible sensitivity in applications like alpha particle detection or high energy X-ray photon or electron detection. To investigate the feasibility of this method two types of open- end gaseous detectors were build and successfully tested. The first one was a single wire or multiwire cylindrical geometry detector operating in pulse mode at a gas gain of one (pulse ionization chamber). This detector was readout by a custom made wide -band charge sensitive amplifier able to deal with slow induced signals generated by slow motion of negative and positive ions. The multiwire detector was able to detect alpha particles with an efficiency close to 22%. The second type of an alpha detector was an innovative GEM-like detector with resistive electrodes operating in air in avalanche mode at high gas gains (up to 10 4 ). This detector can also operate in a cascaded mode or being combined with other detectors, for example with MICROMEGAS. This detector was readout by a conventional charge -sensitive amplifier and was able to detect alpha particles with 100% efficiency. This detector could also detect X-ray photons or fast electrons. A detailed comparison between these two detectors is given as well as a comparison with commercially available alpha detectors. The main advantages of gaseous detectors operating in air in a pulse detection mode are their simplicity, low cost and high sensitivity. One of the possible applications of these new detectors is alpha particle background monitors which, due to their low cost can find wide application not only in houses, but

Optimal hysteretic control for a BMAP/SM/1/N queue with two operation modes

Directory of Open Access Journals (Sweden)

Alexander N. Dudin

2000-01-01

Full Text Available We consider BMAP/SM/1 type queueing system with finite buffer of size N. The system has two operation modes, which are characterized by the matrix generating function of BMAP-input, the kernel of the semi-Markovian service process, and utilization cost. An algorithm for determining the optimal hysteresis strategy is presented.

Dual-cavity mode converter for a fundamental mode output in an over-moded relativistic backward-wave oscillator

Energy Technology Data Exchange (ETDEWEB)

Li, Jiawei; Huang, Wenhua [Department of Electronic Engineering and Information Science, University of Science and Technology of China, Hefei 230027 (China); Science and Technology on High Power Microwave Laboratory, Northwest Institute of Nuclear Technology, Xi' an 710024 (China); Xiao, Renzhen; Bai, Xianchen; Zhang, Yuchuan; Zhang, Xiaowei; Shao, Hao; Chen, Changhua [Science and Technology on High Power Microwave Laboratory, Northwest Institute of Nuclear Technology, Xi' an 710024 (China); Zhu, Qi [Department of Electronic Engineering and Information Science, University of Science and Technology of China, Hefei 230027 (China)

2015-03-16

A dual-cavity TM{sub 02}–TM{sub 01} mode converter is designed for a dual-mode operation over-moded relativistic backward-wave oscillator. With the converter, the fundamental mode output is achieved. Particle-in-cell simulation shows that the efficiency of beam-wave conversion was over 46% and a pureTM{sub 01} mode output was obtained. Effects of end reflection provided by the mode converter were studied. Adequate TM{sub 01} mode feedback provided by the converter enhances conversion efficiency. The distance between the mode converter and extraction cavity critically affect the generation of microwaves depending on the reflection phase of TM{sub 01} mode feedback.

Dual-cavity mode converter for a fundamental mode output in an over-moded relativistic backward-wave oscillator

International Nuclear Information System (INIS)

Li, Jiawei; Huang, Wenhua; Xiao, Renzhen; Bai, Xianchen; Zhang, Yuchuan; Zhang, Xiaowei; Shao, Hao; Chen, Changhua; Zhu, Qi

2015-01-01

A dual-cavity TM 02 –TM 01 mode converter is designed for a dual-mode operation over-moded relativistic backward-wave oscillator. With the converter, the fundamental mode output is achieved. Particle-in-cell simulation shows that the efficiency of beam-wave conversion was over 46% and a pureTM 01 mode output was obtained. Effects of end reflection provided by the mode converter were studied. Adequate TM 01 mode feedback provided by the converter enhances conversion efficiency. The distance between the mode converter and extraction cavity critically affect the generation of microwaves depending on the reflection phase of TM 01 mode feedback

Correlation between the physical parameters of the i-nc-Si absorber layer grown by 27.12 MHz plasma with the nc-Si solar cell parameters

Science.gov (United States)

Das, Debajyoti; Mondal, Praloy

2017-09-01

Growth of highly conducting nanocrystalline silicon (nc-Si) thin films of optimum crystalline volume fraction, involving dominant crystallographic preferred orientation with simultaneous low fraction of microstructures at a low substrate temperature and high growth rate, is a challenging task for its promising utilization in nc-Si solar cells. Utilizing enhanced electron density and superior ion flux densities of the high frequency (∼27.12 MHz) SiH4 plasma, improved nc-Si films have been produced by simple optimization of H2-dilution, controlling the ion damage and enhancing supply of atomic-hydrogen onto the growing surface. Single junction nc-Si p-i-n solar cells have been prepared with i-nc-Si absorber layer and optimized. The physical parameters of the absorber layer have been systematically correlated to variations of the solar cell parameters. The preferred alignment of crystallites, its contribution to the low recombination losses for conduction of charge carriers along the vertical direction, its spectroscopic correlation with the dominant growth of ultra-nanocrystalline silicon (unc-Si) component and corresponding longer wavelength absorption, especially in the neighborhood of i/n-interface region recognize scientific and technological key issues that pave the ground for imminent advancement of multi-junction silicon solar cells.

ORF Sequence: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933242 >gi|39933242|ref|NP_945518.1| possible nicotinate-nucleotide adn...WWLVSPGNPLKDISSLREIDARVAAAQAIADDPRIQVSRLEAVIGTRYTADTLRYLRRHCPGARFVWIMGADNLAQFHRWQQWQQIAAEIPIAVIDRPPTSFRALAAPAAQRLMRMRIPNNKAATLADREPPAWVYLTGLKSLVSSTALRNPDGSWKT

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358092 >gi|13358092|ref|NP_078366.1| cytosine-specific methyltransferase [Ureap...RILFDLQKLNQLPQFLLLENVNNMLSKQHKLDYDMWTKSLKQLGYSTCTFQLNALDYGSAQRRKRVYAISILNYDGLIDSNGNILDLEAPIFDGKQKQLKDVLKTNYK

Constant-frequency, clamped-mode resonant converters

Science.gov (United States)

Tsai, Fu-Sheng; Materu, Peter; Lee, Fred C.

1987-01-01

Two novel clamped-mode resonant converters are proposed which operate at a constant frequency while retaining many desired features of conventional series- and parallel-resonant converters. State-plane analysis techniques are used to identify all possible operating modes and define their mode boundaries. Control-to-output characteristics are derived that specify the regions for natural and forced commutation. The predicted operating modes are verified using a prototype circuit.

PF-KO system for single bunch mode operation of a storage ring

International Nuclear Information System (INIS)

Ohgaki, H.; Sugiyama, S.; Mikado, T.; Chiwaki, M.; Yamada, K.; Suzuki, R.; Sei, N.; Noguchi, T.; Yamazaki, T.

1994-01-01

A new RF-KO (RF knockout) system for the single bunch mode operation of a storage ring has been developed. The knockout signal is modulated by the sum signal of the RF acceleration frequency of the storage ring and a bunch selection signal. We do not need any special device or a timing unit with this method. We obtain a high purity of bunch structure in a short knock out time. The single bunch impurity of 0.2% has been achieved. (author)

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358063 >gi|13358063|ref|NP_078337.1| hypothetical protein UU500 [Ureap...MGNHTWDHPDIFEILTTKTNIIRPYNIINTHQYHLVGSGSRVFYCNKKMIRVTNLLGNSIDMKGLQTNPFESLDKIIAFNEAPIHIVDFHAETTSEKNALFLDFKSKL

Current distribution measurements inside an electromagnetic plasma gun operated in a gas-puff mode.

Science.gov (United States)

Poehlmann, Flavio R; Cappelli, Mark A; Rieker, Gregory B

2010-12-01

Measurements are presented of the time-dependent current distribution inside a coaxial electromagnetic plasma gun. The measurements are carried out using an array of six axially distributed dual-Rogowski coils in a balanced circuit configuration. The radial current distributions indicate that operation in the gas-puff mode, i.e., the mode in which the electrode voltage is applied before injection of the gas, results in a stationary ionization front consistent with the presence of a plasma deflagration. The effects of varying the bank capacitance, transmission line inductance, and applied electrode voltage were studied over the range from 14 to 112 μF, 50 to 200 nH, and 1 to 3 kV, respectively.

Adaptive Droop Control Applied to Voltage-Source Inverters Operating in Grid-Connected and Islanded Modes

DEFF Research Database (Denmark)

Vasquez, J. C.; Guerrero, J. M.; Luna, A.

2009-01-01

This paper proposes a novel control for voltagesource inverters with the capability to flexibly operate in gridconnected and islanded modes. The control scheme is based on the droop method, which uses some estimated grid parameters such as the voltage and frequency and the magnitude and angle of ...

The formation of liquid bridge in different operating modes of AFM

Science.gov (United States)

Wei, Zheng; Sun, Yan; Ding, WenXuan; Wang, ZaiRan

2016-09-01

The liquid bridge is one of the principal factors that cause artifacts in ambient-pressure atomic force microscope (AFM) images. Additionally, it is the main component of the adhesion force in ambient conditions. To understand the AFM imaging mechanism and the sample characteristics, it is essential to study the liquid bridge. This study interprets the physical mechanism involved in liquid bridge formation, which is composed of three different physical processes: the squeezing process, capillary condensation, and liquid film flow. We discuss the contributions of these three mechanisms to the volume and the capillary force of the liquid bridge in different AFM operation modes.

Binding modes and functional surface of anti-mammalian scorpion α-toxins to sodium channels.

Science.gov (United States)

Chen, Rong; Chung, Shin-Ho

2012-10-02

Scorpion α-toxins bind to the voltage-sensing domains of voltage-gated sodium (Na(V)) channels and interfere with the inactivation mechanisms. The functional surface of α-toxins has been shown to contain an NC-domain consisting of the five-residue turn (positions 8-12) and the C-terminus (positions 56-64) and a core-domain centered on the residue 18. The NC- and core-domains are interconnected by the linker-domain (positions 8-18). Here with atomistic molecular dynamics simulations, we examine the binding modes between two α-toxins, the anti-mammalian AahII and the anti-insect LqhαIT, and the voltage-sensing domain of rat Na(V)1.2, a subtype of Na(V) channels expressed in nerve cells. Both toxins are docked to the extracellular side of the voltage-sensing domain of Na(V)1.2 using molecular dynamics simulations, with the linker-domain assumed to wedge into the binding pocket. Several salt bridges and hydrophobic clusters are observed to form between the NC- and core-domains of the toxins and Na(V)1.2 and stabilize the toxin-channel complexes. The binding modes predicted are consistent with available mutagenesis data and can readily explain the relative affinities of AahII and LqhαIT for Na(V)1.2. The dissociation constants for the two toxin-channel complexes are derived, which compare favorably with experiment. Our models demonstrate that the functional surface of anti-mammalian scorpion α-toxins is centered on the linker-domain, similar to that of β-toxins.

ORF Sequence: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32475512 >gi|32475512|ref|NP_868506.1| hypothetical protein-signal peptide and transme...VLVGLLLPAVQAAREAARRMSCSNNIAQLTLATHNYEFSMEHLPPGTTNPTGPIVNTPNGEHISFLVRLLPYIEQQGTADDFDLTASVYAPANAKVRAYQISAFLCPS

ORF Sequence: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|17533935 >gi|17533935|ref|NP_496777.1| ZYXin (zyx-1) [Caenorhabditis elegans] MNQIFHVDC...FAPRCALCSKPIVPQDGEKESVRVVAMDKSFHVDCYKCEDCGMQLSSKLEGQGCYPIDNHLLCKTCNGNRLRVVSST

A Novel Type of Non-coding RNA, nc886, Implicated in Tumor Sensing and Suppression

Directory of Open Access Journals (Sweden)

Yong Sun Lee

2015-06-01

Full Text Available nc886 (=vtRNA2-1, pre-miR-886, or CBL3 is a newly identified non-coding RNA (ncRNA that represses the activity of protein kinase R (PKR. nc886 is transcribed by RNA polymerase III (Pol III and is intriguingly the first case of a Pol III gene whose expression is silenced by CpG DNA hypermethylation in several types of cancer. PKR is a sensor protein that recognizes evading viruses and induces apoptosis to eliminate infected cells. Like viral infection, nc886 silencing activates PKR and induces apoptosis. Thus, the significance of the nc886:PKR pathway in cancer is to sense and eliminate pre-malignant cells, which is analogous to PKR's role in cellular innate immunity. Beyond this tumor sensing role, nc886 plays a putative tumor suppressor role as supported by experimental evidence. Collectively, nc886 provides a novel example how epigenetic silencing of a ncRNA contributes to tumorigenesis by controlling the activity of its protein ligand.

76 FR 29645 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-05-23

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC. This safety... Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We received no...

76 FR 18669 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-04-05

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

76 FR 38018 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-06-29

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Temporary final... the main span US 70/Morehead City-Newport River high rise bridge in Carteret County, NC. This safety...) entitled Safety Zone, Newport River; Morehead City, North Carolina in the Federal Register (33 FR 165). We...

76 FR 23227 - Safety Zone, Newport River; Morehead City, NC

Science.gov (United States)

2011-04-26

...-AA00 Safety Zone, Newport River; Morehead City, NC AGENCY: Coast Guard, DHS. ACTION: Notice of proposed... River under the main span US 70/Morehead City--Newport River high rise bridge in Carteret County, NC... Newport River at Morehead City, North Carolina. The contract provides for cleaning, painting, and steel...

TAO2000 V2 computer-assisted force feedback tele-manipulators used as maintenance and production tools at the AREVA NC-La Hague fuel recycling plant

International Nuclear Information System (INIS)

Geffard, Franck; Garrec, Philippe; Piolain, Gerard; Brudieu, Marie-Anne; Thro, Jean-Francois; Coudray, Alain; Lelann, Eric

2012-01-01

During a 15-year joint research program, French Atomic Energy Agency Interactive Robotics Laboratory (CEA LIST) and AREVA have developed several remote operation devices, also called tele-robots. Some of them are now commonly used for maintenance operations at the AREVA NC (Nuclear Cycle) La Hague reprocessing plant. Since the first maintenance operation in 2005, several other successful interventions have been realized using the industrial MA23/RX170 tele-manipulation system. Moreover, since 2010, the through-the-wall tele-robot named MT200 TAO based on the slave arm of the MSM MT200 (La Calhene TM ), has been evaluated in an active production cell at the AREVA NC La Hague fuel recycling plant. Although these evaluations are ongoing, the positive results obtained have led to an update and industrialization program. All these developments are based on the same generic control platform, called TAO2000 V2. TAO2000 V2 is the second release of the CEA LIST core software platform dedicated to computer aided force-feedback tele-operation (TAO is the French acronym for computer aided tele-operation). This paper presents all these developments resulting from the joint research program CEA LIST/AREVA. The TAO2000 V2 controller is first detailed, and then two maintenance operations using the industrial robot RX170 are presented: the removal of the nuclear fuel dissolver wheel rollers and the cleanup of the dissolver wheel inter-bucket spaces. Finally, the new MT200 TAO system and its evaluations at the AREVA NC La Hague facilities are discussed. (authors)

ORF Sequence: NC_003279 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003279 gi|17507795 >gi|17507795|ref|NP_493043.1| putative protein, with at least 2 transme...YLNIQIADETTDLPVSIDRANVDMRIYRAFEMSMEKDIISLSTSNTSHAEISTPKSRKKKSRKLGLKNLEEVINSKYNSCQKQDNSMSIQ

Experimental investigation of limit space charge accumulation mode operation in a semi-insulating GaAs photoconductive semiconductor switch

International Nuclear Information System (INIS)

Ma Xiangrong; Shi Wei; Xiang Mei

2013-01-01

Experiments with the limited space-charge accumulation (LSA) mode of oscillation in a large gap semi-insulating (SI) GaAs photoconductive semiconductor switch (PCSS) are discussed. It has been observed that growth and drift of a photo-activated charge domain (PACD) are quenched only when the bias voltage is more than twice the threshold voltage. The original negative resistance characteristics are directly utilized in the LSA mode; during LSA operation the spatial average of the electric field varies over a large portion of the negative differential mobility region of the velocity—electric field characteristic. The work efficiency of an SI GaAs PCSS is remarkably enhanced by electric field excursions into the positive resistance region when the total electric field is only below the threshold part of the time. The LSA mode can only operate in the certain conditions that satisfy the quenching of the accumulation layer and the smaller initial domain voltage. (semiconductor devices)

PLC-based mode multi/demultiplexers for mode division multiplexing

Science.gov (United States)

Saitoh, Kunimasa; Hanzawa, Nobutomo; Sakamoto, Taiji; Fujisawa, Takeshi; Yamashita, Yoko; Matsui, Takashi; Tsujikawa, Kyozo; Nakajima, Kazuhide

2017-02-01

Recently developed PLC-based mode multi/demultiplexers (MUX/DEMUXs) for mode division multiplexing (MDM) transmission are reviewed. We firstly show the operation principle and basic characteristics of PLC-based MUX/DEMUXs with an asymmetric directional coupler (ADC). We then demonstrate the 3-mode (2LP-mode) multiplexing of the LP01, LP11a, and LP11b modes by using fabricated PLC-based mode MUX/DEMUX on one chip. In order to excite LP11b mode in the same plane, a PLC-based LP11 mode rotator is introduced. Finally, we show the PLC-based 6-mode (4LP-mode) MUX/DEMUX with a uniform height by using ADCs, LP11 mode rotators, and tapered waveguides. It is shown that the LP21a mode can be excited from the LP11b mode by using ADC, and the two nearly degenerated LP21b and LP02 modes can be (de)multiplexed separately by using tapered mode converter from E13 (E31) mode to LP21b (LP02) mode.

Effect of low density H-mode operation on edge and divertor plasma parameters

International Nuclear Information System (INIS)

Maingi, R.; Mioduszewski, P.K.; Cuthbertson, J.W.

1994-07-01

We present a study of the impact of H-mode operation at low density on divertor plasma parameters on the DIII-D tokamak. The line-average density in H-mode was scanned by variation of the particle exhaust rate, using the recently installed divertor cryo-condensation pump. The maximum decrease (50%) in line-average electron density was accompanied by a factor of 2 increase in the edge electron temperature, and 10% and 20% reductions in the measured core and divertor radiated power, respectively. The measured total power to the inboard divertor target increased by a factor of 3, with the major contribution coming from a factor of 5 increase in the peak heat flux very close to the inner strike point. The measured increase in power at the inboard divertor target was approximately equal to the measured decrease in core and divertor radiation

Dual-Mode Scramjet Flameholding Operability Measurements

Science.gov (United States)

Donohue, James M.

2012-01-01

Flameholding measurements were made in two different direct connect combustor facilities that were designed to simulate a cavity flameholder in the flowfield of a hydrocarbon fueled dual-mode scramjet combustor. The presence of a shocktrain upstream of the flameholder has a significant impact on the inlet flow to the combustor and on the flameholding limits. A throttle was installed in the downstream end of the test rigs to provide the needed back-pressurization and decouple the operation of the flameholder from the backpressure formed by heat release and thermal choking, as in a flight engine. Measurements were made primarily with ethylene fuel but a limited number of tests were also performed with heated gaseous JP-7 fuel injection. The flameholding limits were measured by ramping inlet air temperature down until blowout was observed. The tests performed in the United Technologies Research Center (UTRC) facility used a hydrogen fueled vitiated air heater, Mach 2.2 and 3.3 inlet nozzles, a scramjet combustor rig with a 1.666 by 6 inch inlet and a 0.65 inch deep cavity. Mean blowout temperature measured at the baseline condition with ethylene fuel, the Mach 2.2 inlet and a cavity pressure of 21 psia was 1502 oR. Flameholding sensitivity to a variety of parameters was assessed. Blowout temperature was found to be most sensitive to fuel injection location and fuel flowrates and surprisingly insensitive to operating pressure (by varying both back-pressurization and inlet flowrate) and inlet Mach number. Video imaging through both the bottom and side wall windows was collected simultaneously and showed that the flame structure was quite unsteady with significant lateral movements as well as movement upstream of the flameholder. Experiments in the University of Virginia (UVa) test facility used a Mach 2 inlet nozzle with a 1 inch by 1.5 inch exit cross section, an aspect ratio of 1.5 versus 3.6 in the UTRC facility. The UVa facility tests were designed to measure the

Effects of carboxylic acids on nC60 aggregate formation

International Nuclear Information System (INIS)

Chang Xiaojun; Vikesland, Peter J.

2009-01-01

The discovery that negatively charged aggregates of C 60 fullerene (nC 60 ) are stable in water has raised concerns regarding the potential environmental and health effects of these aggregates. In this work, we show that nC 60 aggregates produced by extended mixing in the presence of environmentally relevant carboxylic acids (acetic acid, tartaric acid, citric acid) have surface charge and morphologic properties that differ from those produced by extended mixing in water alone. In general, aggregates formed in the presence of these acids have a more negative surface charge and are more homogeneous than those produced in water alone. Carboxylic acid identity, solution pH, and sodium ion concentration, which are all intricately coupled, play an important role in setting the measured surface charge. Comparisons between particle sizes determined by analysis of TEM images and those obtained by dynamic light scattering (DLS) indicate that DLS results require careful evaluation when used to describe nC 60 aggregates. - The effects of carboxylic acids on the formation of nC 60 aggregates are discussed

ORF Sequence: NC_003909 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003909 gi|42782207 >gi|42782207|ref|NP_979454.1| BclA protein [Bacillus cereus ATCC 10987] MANRLNFTGP...LGCCGISGKTGPTGPTGPTGVTGSTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGPTGPTGATGFTGPTGPTGATGPTGATGPTGATGP...TGATGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGFTGPTGPTGATGPTGATGPTGATGPTGATGPTGATGPTGATGSTGP

ORF Sequence: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

Characterization and properties of acetylated nanocrystalline cellulose (aNC) reinforced polylactic acid (PLA) polymer

Science.gov (United States)

Kasa, Siti Norbaya; Omar, Mohd Firdaus; Ismail, Ismarul Nizam

2017-12-01

Nanocrystalline cellulose (NCC) was synthesized from banana stem through strong acid hydrolysis with measured length of approximately 287.0 ± 56.4 nm and diameter of 26.6 ± 4.8 nm. Modification of NCC was carried by acetylation reaction in order to increase the compatibility during reinforcement with polylactic acid (PLA) polymer. The reinforcing effect towards morphology, crystallinity, mechanical and thermal properties of bio-nanocomposites was investigated. Scanning Electron Microscope (SEM) micrograph reveals the uniform dispersion achieved at 1 %, 3 % and 5% aNC loading while agglomeration was found at 7 % aNC loading. Disappearance of crystallinity peak at 2θ = 22.7⁰ for low aNC loading during elemental analysis using X-Ray Diffraction (XRD) indicates the proper dispersion of aNC in PLA polymer. From the tensile test, 1 % aNC loading gives the highest mechanical properties of bio-nanocomposite film with 82.71 %, 118.7 % and 24.18 % increment in tensile strength, tensile modulus and elongation at break. However, 7 % aNC loading gives the highest increment in TGA of aNC-PLA nanocomposites which is from 310 °C to 320 °C.

Passively mode-locked 4.6 and 10.5 GHz quantum dot laser diodes around 1.55 μm with large operating regime

NARCIS (Netherlands)

Heck, M.J.R.; Renault, A.; Bente, E.A.J.M.; Oei, Y.S.; Smit, M.K.; Eikema, K.S.E.; Ubachs, W.; Anantathanasarn, S.; Nötzel, R.

2009-01-01

Passive mode-locking in two-section InAs/InP quantum dot laser diodes operating at wavelengths around 1.55 µm is reported. For a 4.6-GHz laser, a large operating regime of stable mode-locking, with RF-peak heights of over 40 dB, is found for injection currents of 750 mA up to 1.0 A and for values of

Occurrence of Mycobacterium avium subspecies paratuberculosis and Neospora caninum in Alberta cow-calf operations.

Science.gov (United States)

Pruvot, M; Kutz, S; Barkema, H W; De Buck, J; Orsel, K

2014-11-01

Mycobacterium avium subsp. paratuberculosis (MAP) and Neospora caninum (NC) are two pathogens causing important production limiting diseases in the cattle industry. Significant impacts of MAP and NC have been reported on dairy cattle herds, but little is known about the importance, risk factors and transmission patterns in western Canadian cow-calf herds. In this cross-sectional study, the prevalence of MAP and NC infection in southwest Alberta cow-calf herds was estimated, risk factors for NC were identified, and the reproductive impacts of the two pathogens were assessed. Blood and fecal samples were collected from 840 cows on 28 cow-calf operations. Individual cow and herd management information was collected by self-administered questionnaires and one-on-one interviews. Bayesian estimates of the true prevalence of MAP and NC were computed, and bivariable and multivariable statistical analysis were done to assess the association between the NC serological status and ranch management risk factors, and the clinical effects of the two pathogens. Bayesian estimates of true prevalence indicated that 20% (95% probability interval: 8-38%) of herds had at least one MAP-positive cow, with a within-herd prevalence in positive herds of 22% (8-45%). From the Bayesian posterior distributions of NC prevalence, the median herd-level prevalence was 66% (33-95%) with 10% (4-21%) cow-level prevalence in positive herds. Multivariable analysis indicated that introducing purchased animals in the herd might increase the risk of NC. The negative association of NC with proper carcass disposal and presence of horses on ranch (possibly in relation to herd monitoring and guarding activities), may suggest the importance of wild carnivores in the dynamics of this pathogen in the study area. We also observed an association between MAP and NC serological status and the number of abortions. Additional studies should be done to further examine specific risk factors for MAP and NC, assess the

Attack Helicopter Operations: Art or Science

Science.gov (United States)

1991-05-13

ATTACK HELICOPTER OPERATIONS: ART OR SCIENCE ? BY LIEUTENANT COLONEL JAN CALLEN United States Army DISTRIBUTION STATEMENT A: Approved for public release...TASK IWORK UNIT ELEMENT NO. NO. NO. ACCESSION NC 11. TITLE (Include Socurity Classification) Attack Helicopter Operations: Art or Science ? 12. PERSONAL...OPERATIONS: ART OR SCIENCE ? AN INDIVIDUAL STUDY PROJECT by Lieutenant Colonel Jan Callen United States Army Colonel Greg Snelgrove Project Adviser U.S

Design and Investigation of SST/nc-Si:H/M (M = Ag, Au, Ni and M/nc-Si:H/M Multifunctional Devices

Directory of Open Access Journals (Sweden)

A. F. Qasrawi

2013-01-01

Full Text Available Hydrogenated nanocrystalline Silicon thin films prepared by the very high frequency chemical vapor deposition technique (VHF-CVD on stainless steel (SST substrates are used to design Schottky point contact barriers for the purpose of solar energy conversion and passive electronic component applications. In this process, the contact performance between SST and M (M = Ag, Au, and Ni and between Ag, Au, and Ni electrodes was characterized by means of current-voltage, capacitance-voltage, and light intensity dependence of short circuit ( current and open circuit voltage ( of the contacts. Particularly, the devices ideality factors, barrier heights were evaluated by the Schottky method and compared to the Cheung's. Best Schottky device performance with lowest ideality factor suitable for electronic applications was observed in the SST/nc-Si:H/Ag structure. This device reflects a of 229 mV with an of 1.6 mA/cm2 under an illumination intensity of ~40 klux. On the other hand, the highest being 9.0 mA/cm2 and the of 53.1 mV were observed for Ni/nc-Si:H/Au structure. As these voltages represent the maximum biasing voltage for some of the designed devices, the SST/nc-Si:H/M and M/nc-Si:H/M can be regarded as multifunctional self-energy that provided electronic devices suitable for active or passive applications.

EnviroAtlas - Durham, NC - Demo (Parent)

Data.gov (United States)

U.S. Environmental Protection Agency — This EnviroAtlas dataset is the base layer for the Durham, NC EnviroAtlas Area. The block groups are from the US Census Bureau and are included/excluded based on...

ORF Sequence: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available se/invertase); possible inulinase [Bifidobacterium longum NCC2705] MTDFTPETPVLTPIHDHAAELAKAEAGVAEMAANRNNRWYP... NC_004307 gi|23464731 >gi|23464731|ref|NP_695334.1| beta-fructofuranosidase (sucra

ORF Sequence: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42523756 >gi|42523756|ref|NP_969136.1| membrane protein necessary for nodulation/competitivene...ss [Bdellovibrio bacteriovorus HD100] MKSLMLILFVSLLSVVAKADCTTAITINEAISASTSDYLERAEKR

ORF Sequence: NC_003078 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available etitiveness [Sinorhizobium meliloti 1021] MQLSACARRREAVRYRRRMARILILLFSLLSAFAFPVTPVP... NC_003078 gi|16264863 >gi|16264863|ref|NP_437655.1| probable membrane protein necessary for nodulation comp

ORF Sequence: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13471138 >gi|13471138|ref|NP_102707.1| transcriptional regulatory protein, nodulation competit...iveness determinant [Mesorhizobium loti MAFF303099] MTNESDTRSAELAELTADIVSAYVSNNPLPV

ORF Sequence: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15964332 >gi|15964332|ref|NP_384685.1| PROBABLE PYRAZINAMIDASE/NICOTINAMIDAS...E (INCLUDES: PYRAZINAMIDASE, NICOTINAMIDASE) PROTEIN [Sinorhizobium meliloti 1021] MADAARPDLREAMADEAL

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13358146 >gi|13358146|ref|NP_078420.1| transcription antitermination factor [Ureap...lasma parvum serovar 3 str. ATCC 700970] MAYKIKDLDSKLLSDLKIDFNHRHQWYIVTVVSGNEQKVIENIKDKLNGYGYGDKLSDLKIIKEKIKEVKIYEPSEAP

Comparative Analysis of Battery Behavior with Different Modes of Discharge for Optimal Capacity Sizing and BMS Operation

OpenAIRE

Mazhar Abbas; Eung-sang Kim; Seul-ki Kim; Yun-su Kim

2016-01-01

Battery-operated systems are always concerned about the proper management and sizing of a battery. A Traditional Battery Management System (BMS) only includes battery-aware task scheduling based on the discharge characteristics of a whole battery pack and do not take into account the mode of the load being served by the battery. On the other hand, an efficient and intelligent BMS should monitor the battery at a cell level and track the load with significant consideration of the load mode. Dep...

An analysis of the binding of repressor protein ModE to modABCD (molybdate transport) operator/promoter DNA of Escherichia coli.

Science.gov (United States)

Grunden, A M; Self, W T; Villain, M; Blalock, J E; Shanmugam, K T

1999-08-20

Expression of the modABCD operon in Escherichia coli, which codes for a molybdate-specific transporter, is repressed by ModE in vivo in a molybdate-dependent fashion. In vitro DNase I-footprinting experiments identified three distinct regions of protection by ModE-molybdate on the modA operator/promoter DNA, GTTATATT (-15 to -8; region 1), GCCTACAT (-4 to +4; region 2), and GTTACAT (+8 to +14; region 3). Within the three regions of the protected DNA, a pentamer sequence, TAYAT (Y = C or T), can be identified. DNA-electrophoretic mobility experiments showed that the protected regions 1 and 2 are essential for binding of ModE-molybdate to DNA, whereas the protected region 3 increases the affinity of the DNA to the repressor. The stoichiometry of this interaction was found to be two ModE-molybdate per modA operator DNA. ModE-molybdate at 5 nM completely protected the modABCD operator/promoter DNA from DNase I-catalyzed hydrolysis, whereas ModE alone failed to protect the DNA even at 100 nM. The apparent K(d) for the interaction between the modA operator DNA and ModE-molybdate was 0.3 nM, and the K(d) increased to 8 nM in the absence of molybdate. Among the various oxyanions tested, only tungstate replaced molybdate in the repression of modA by ModE, but the affinity of ModE-tungstate for modABCD operator DNA was 6 times lower than with ModE-molybdate. A mutant ModE(T125I) protein, which repressed modA-lac even in the absence of molybdate, protected the same region of modA operator DNA in the absence of molybdate. The apparent K(d) for the interaction between modA operator DNA and ModE(T125I) was 3 nM in the presence of molybdate and 4 nM without molybdate. The binding of molybdate to ModE resulted in a decrease in fluorescence emission, indicating a conformational change of the protein upon molybdate binding. The fluorescence emission spectra of mutant ModE proteins, ModE(T125I) and ModE(Q216*), were unaffected by molybdate. The molybdate-independent mutant ModE

77 FR 57063 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC

Science.gov (United States)

2012-09-17

... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...

77 FR 64906 - Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC

Science.gov (United States)

2012-10-24

... 1625-AA00 Safety Zone, Atlantic Intracoastal Waterway; Emerald Isle, NC AGENCY: Coast Guard, DHS... zone on the waters of the Atlantic Intracoastal Waterway at Emerald Isle, North Carolina. The safety... NC 58 Fixed Bridge crossing the Atlantic Intracoastal Waterway, mile 226, at Emerald Isle, North...

ORF Sequence: NC_006155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available g protein (involved in environmental [Yersinia pseudotuberculosis IP 32953] MTKTDYLMRLRKCTTIDTLERVIEKNKYELSDDELELFYSAADHRLAELTMNKLYDKIPPTVWQHVK ... NC_006155 gi|51595328 >gi|51595328|ref|YP_069519.1| hemolysin expression modulatin

ORF Sequence: NC_002162 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002162 gi|13357802 >gi|13357802|ref|NP_078076.1| ribosomal protein L24 [Ureapla...sma parvum serovar 3 str. ATCC 700970] MNRIKKGDTVVVISGKNKNKSGVVIQVNPKEQTALVEGVNKIKRHQKKDQTHEQSGIIEKEAPIRLCKLALVDPKGKDKGKATKVKYLLKDNKKVRVARKSGSELDVNKK

CAI System with Multi-Media Text Through Web Browser for NC Lathe Programming

Science.gov (United States)

Mizugaki, Yoshio; Kikkawa, Koichi; Mizui, Masahiko; Kamijo, Keisuke

A new Computer Aided Instruction (CAI) system for NC lathe programming has been developed with use of multi-media texts including movies, animations, pictures, sound and texts through Web browser. Although many CAI systems developed previously for NC programming consist of text-based instructions, it is difficult for beginners to learn NC programming with use of them. In the developed CAI system, multi-media texts are adopted for the help of users' understanding, and it is available through Web browser anytime and anywhere. Also the error log is automatically recorded for the future references. According to the NC programming coded by a user, the movement of the NC lathe is animated and shown in the monitor screen in front of the user. If its movement causes the collision between a cutting tool and the lathe, some sound and the caution remark are generated. If the user makes mistakes some times at a certain stage in learning NC, the corresponding suggestion is shown in the form of movies, animations, and so forth. By using the multimedia texts, users' attention is kept concentrated during a training course. In this paper, the configuration of the CAI system is explained and the actual procedures for users to learn the NC programming are also explained too. Some beginners tested this CAI system and their results are illustrated and discussed from the viewpoint of the efficiency and usefulness of this CAI system. A brief conclusion is also mentioned.

NSDNA: a manually curated database of experimentally supported ncRNAs associated with nervous system diseases.

Science.gov (United States)

Wang, Jianjian; Cao, Yuze; Zhang, Huixue; Wang, Tianfeng; Tian, Qinghua; Lu, Xiaoyu; Lu, Xiaoyan; Kong, Xiaotong; Liu, Zhaojun; Wang, Ning; Zhang, Shuai; Ma, Heping; Ning, Shangwei; Wang, Lihua

2017-01-04

The Nervous System Disease NcRNAome Atlas (NSDNA) (http://www.bio-bigdata.net/nsdna/) is a manually curated database that provides comprehensive experimentally supported associations about nervous system diseases (NSDs) and noncoding RNAs (ncRNAs). NSDs represent a common group of disorders, some of which are characterized by high morbidity and disabilities. The pathogenesis of NSDs at the molecular level remains poorly understood. ncRNAs are a large family of functionally important RNA molecules. Increasing evidence shows that diverse ncRNAs play a critical role in various NSDs. Mining and summarizing NSD-ncRNA association data can help researchers discover useful information. Hence, we developed an NSDNA database that documents 24 713 associations between 142 NSDs and 8593 ncRNAs in 11 species, curated from more than 1300 articles. This database provides a user-friendly interface for browsing and searching and allows for data downloading flexibility. In addition, NSDNA offers a submission page for researchers to submit novel NSD-ncRNA associations. It represents an extremely useful and valuable resource for researchers who seek to understand the functions and molecular mechanisms of ncRNA involved in NSDs. © The Author(s) 2016. Published by Oxford University Press on behalf of Nucleic Acids Research.

The acetone bandpass detector for inverse photoemission: operation in proportional and Geiger–Müller modes

Science.gov (United States)

Thiede, Christian; Niehues, Iris; Schmidt, Anke B.; Donath, Markus

2018-06-01

Inverse photoemission is the most versatile experimental tool to study the unoccupied electronic structure at surfaces of solids. Typically, the experiments are performed in the isochromat mode with bandpass photon detectors. For gas-filled counters, the bandpass behavior is realized by the combination of the photoionization threshold of the counting gas as the high-pass filter and the ultraviolet transmission cutoff of an alkaline earth fluoride entrance window as the low-pass filter. The transmission characteristics of the entrance window determine the optical bandpass. The performance of the counter depends on the composition of the detection gas and the fill-gas pressure, the readout electronics and the counter geometry. For the well-known combination of acetone and CaF2, the detector can be operated in proportional and Geiger–Müller modes. In this work, we review aspects concerning the working principles, the counter construction and the read-out electronics. We identify optimum working parameters and provide a step-by-step recipe how to build, install and operate the device.

Selection of stirling engine parameter and modes of joint operation with the Topaz II

International Nuclear Information System (INIS)

Kirillov, E.Y.; Ogloblin, B.G.; Shalaev, A.I.

1996-01-01

In addition to a high-temperature thermionic conversion cycle, application of a low-temperature machine cycle, such as the Stirling engine, is being considered. To select the optimum mode for joint operation of the Topaz II system and Stirling engine, output electric parameters are obtained as a function of thermal power released in the TFE fuel cores. The hydraulic diagram used for joint operation of the Topaz II and the Stirling engine is considered. Requirements to hydraulic characteristics of the Stirling engine heat exchanges are formulated. Scope of necessary modifications to mount the Stirling Engine on the Topaz II is estimated. copyright 1996 American Institute of Physics

precision deburring using NC and robot equipment. Final report

Energy Technology Data Exchange (ETDEWEB)

Gillespie, L.K.

1980-05-01

Deburring precision miniature components is often time consuming and inconsistent. Although robots are available for deburring parts, they are not precise enough for precision miniature parts. Numerical control (NC) machining can provide edge break consistencies to meet requirements such as 76.2-..mu..m maximum edge break (chamfer). Although NC machining has a number of technical limitations which prohibits its use on many geometries, it can be an effective approach to features that are particularly difficult to deburr.

Compressed modes for variational problems in mathematical physics and compactly supported multiresolution basis for the Laplace operator

Science.gov (United States)

Ozolins, Vidvuds; Lai, Rongjie; Caflisch, Russel; Osher, Stanley

2014-03-01

We will describe a general formalism for obtaining spatially localized (``sparse'') solutions to a class of problems in mathematical physics, which can be recast as variational optimization problems, such as the important case of Schrödinger's equation in quantum mechanics. Sparsity is achieved by adding an L1 regularization term to the variational principle, which is shown to yield solutions with compact support (``compressed modes''). Linear combinations of these modes approximate the eigenvalue spectrum and eigenfunctions in a systematically improvable manner, and the localization properties of compressed modes make them an attractive choice for use with efficient numerical algorithms that scale linearly with the problem size. In addition, we introduce an L1 regularized variational framework for developing a spatially localized basis, compressed plane waves (CPWs), that spans the eigenspace of a differential operator, for instance, the Laplace operator. Our approach generalizes the concept of plane waves to an orthogonal real-space basis with multiresolution capabilities. Supported by NSF Award DMR-1106024 (VO), DOE Contract No. DE-FG02-05ER25710 (RC) and ONR Grant No. N00014-11-1-719 (SO).

ORF Sequence: NC_003283 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003283 gi|17563066 >gi|17563066|ref|NP_506462.1| putative protein family member, with a transme...mbrane domain (5O433) [Caenorhabditis elegans] MWNLVSPIHISSKFSMEMAEVNVVAVPEENRQTYLETDNDRLVMAIIWLIMPPMAVFFKCRGCTKHVFINFLLYLLLVLPAYKHATWFCFVKGREFEAEDGFVRAR

ORF Sequence: NC_003280 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003280 gi|17535455 >gi|17535455|ref|NP_495314.1| putative endoplasmic reticulum protein, with a transme...mbrane domain (2G788) [Caenorhabditis elegans] MTDVRFIIWNCIALLVALMMALTSIIILSDAPHNSME

Squeeze strengthening of magnetorheological fluids using mixed mode operation

Science.gov (United States)

Becnel, A. C.; Sherman, S. G.; Hu, W.; Wereley, N. M.

2015-05-01

This research details a novel method of increasing the shear yield stress of magnetorheological fluids by combining shear and squeeze modes of operation to manipulate particle chain structures, so-called squeeze strengthening. Using a custom built Searle cell magnetorheometer, which is a model device emulating a rotary magnetorheological energy absorber (MREA), the contribution of squeeze strengthening to the total controllable yield force is experimentally investigated. Using an eccentric rotating inner cylinder, characterization data from large (1 mm) and small (0.25 mm) nominal gap geometries are compared to investigate the squeeze strengthening effect. Details of the experimental setup and method are presented, and a hybrid model is used to explain experimental trends. This study demonstrates that it is feasible, utilizing squeeze strengthening to increase yield stress, to either (1) design a rotary MREA of a given volume to achieve higher energy absorption density (energy absorbed normalized by active fluid volume), or (2) reduce the volume of a given rotary MREA to achieve the same energy absorption density.

ORF Sequence: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15965329 >gi|15965329|ref|NP_385682.1| PROBABLE CARBAMOYL-PHOSPHATE SYNTHASE LARGE CHAIN (AMMO...NIA CHAIN ARGININE BIOSYNTHESIS) PROTEIN [Sinorhizobium meliloti 1021] MPKRQDIKSILI

Mode-locking operation of a flash-lamp-pumped Nd:YAG laser at 1.064 μm with Zakharov-Manakov solitons

International Nuclear Information System (INIS)

Andreana, M; Tonello, A; Couderc, V; Baronio, F; Conforti, M; De Angelis, C

2011-01-01

We report experimental results on the mode-locked operation of a flash-lamp-pumped Nd:YAG laser at 1.064 μm. The KTP crystal, which induces passive mode-locking, exploits the existence and properties of spatial Zakharov-Manakov soliton dynamics. A train of pulses with duration close to 100 ps, repetition rate of 136 MHz and modulation depth almost 100% has been produced. The mode-locked pulses are modulated with a longer 180 ns pulse envelope with repetition rate of 10 Hz

ORF Sequence: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available protein) (involved in swarmer cell regulation) [Vibrio parahaemolyticus RIMD 2210633] MKKAVKKISSKKIITISAIIV... NC_004605 gi|28901366 >gi|28901366|ref|NP_801021.1| ScrC (sensory box/GGDEF family

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available g protein (involved in environmental regulation of virulence factors) [Salmonella enterica subsp. enterica s... NC_006905 gi|62179085 >gi|62179085|ref|YP_215502.1| hemolysin expression modulatin

A comparison of co-current and counter-current modes of operation for a novel hydrogen-permselective membrane dual-type FTS reactor in GTL technology

Energy Technology Data Exchange (ETDEWEB)

Rahimpour, M.R.; Forghani, A.A.; Mostafazadeh, A. Khosravanipour; Shariati, A. [Chemical Engineering Department, School of Chemical and Petroleum Engineering, Shiraz University, Shiraz 71345 (Iran)

2010-01-15

In this work, a comparison of co-current and counter-current modes of operation for a novel hydrogen-permselective membrane reactor for Fischer-Tropsch Synthesis (FTS) has been carried out. In both modes of operations, a system with two-catalyst bed instead of one single catalyst bed is developed for FTS reactions. In the first catalytic reactor, the synthesis gas is partly converted to products in a conventional water-cooled fixed-bed reactor, while in the second reactor which is a membrane fixed-bed reactor, the FTS reactions are completed and heat of reaction is used to preheat the feed synthesis gas to the first reactor. In the co-current mode, feed gas is entered into the tubes of the second reactor in the same direction with the reacting gas stream in shell side while in the counter-current mode the gas streams are in the opposite direction. Simulation results for both co-current and counter-current modes have been compared in terms of temperature, gasoline and CO{sub 2} yields, H{sub 2} and CO conversion, selectivity of components as well as permeation rate of hydrogen through the membrane. The results showed that the reactor in the co-current configuration operates with lower conversion and lower permeation rate of hydrogen, but it has more favorable profile of temperature. The counter-current mode of operation decreases undesired products such as CO{sub 2} and CH{sub 4} and also produces more gasoline. (author)

De Novo Discovery of Structured ncRNA Motifs in Genomic Sequences

DEFF Research Database (Denmark)

Ruzzo, Walter L; Gorodkin, Jan

2014-01-01

De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphas...... on an approach based on the CMfinder CMfinder program as a case study. Applications to genomic screens for novel de novo structured ncRNA ncRNA s, including structured RNA elements in untranslated portions of protein-coding genes, are presented.......De novo discovery of "motifs" capturing the commonalities among related noncoding ncRNA structured RNAs is among the most difficult problems in computational biology. This chapter outlines the challenges presented by this problem, together with some approaches towards solving them, with an emphasis...

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available erobacterial common antigen (ECA) [Escherichia coli K12] MKVLTVFGTRPEAIKMAPLVHALAKD... NC_000913 gi|49176409 >gi|49176409|ref|YP_026253.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

ORF Sequence: NC_003282 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003282 gi|17540144 >gi|17540144|ref|NP_500824.1| feminization 1 homolog a, FEMinization of XX and XO ani...mals FEM-1 (fem-1) [Caenorhabditis elegans] MTPNGHHFRTVIYNAAAVGNLQRIKVFTINSRNDRQWII

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16128606 >gi|16128606|ref|NP_415156.1| RNA chaperone, transcription antiterm...inator, affects expression of rpoS and uspA [Escherichia coli K12] MSKIKGNVKWFNESKGFGFITPEDGSKDVFVHFSAIQTNGFKTLAEGQRVEFEITNGAKGPSAANVIAL

ORF Sequence: NC_001137 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ull mutation has global effects on transcription; Yer064cp [Saccharomyces cerevisiae] MIDDTENSKIHLEGSHKTGKYT... NC_001137 gi|6320907 >gi|6320907|ref|NP_010986.1| Non-essential nuclear protein; n

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16128858 >gi|16128858|ref|NP_415411.1| periplasmic chaperone effects translocation of lipoprot...eins from inner membrane to outer membrane [Escherichia coli K12] MMKKIAITCALLSSLVA

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62179485 >gi|62179485|ref|YP_215902.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer membrane [Salmonella enterica subsp. enterica serov

Discovery of multiple, ionization-created CS2 anions and a new mode of operation for drift chambers

International Nuclear Information System (INIS)

Snowden-Ifft, Daniel P.

2014-01-01

This paper focuses on the surprising discovery of multiple species of ionization-created CS 2 anions in gas mixtures containing electronegative CS 2 and O 2 , identified by their slightly different drift velocities. Data are presented to understand the formation mechanism and identity of these new anions. Regardless of the micro-physics, however, this discovery offers a new, trigger-less mode of operation for the drift chambers. A demonstration of trigger-less operation is presented

Study on the operation mode for indigenization and standardization of AP1000 technology

International Nuclear Information System (INIS)

Gao Zhihu; Cheng Huiping

2014-01-01

This paper describes the importance and necessity of developing standardized AP1000 technology, and analyzes the problems faced and measures to be taken. The operation mode, known as the Committee of AP1000 Standardized Design and Innovation Management, was first put forward in China. And the paper also discusses how to arouse the enthusiasm of the owners, designers, manufactures, as well as construction, installation, regulation and other parties, how to exploit the advantage of whole industry to promote the localization and standardization of AP1000 technology. (authors)

Year 2005. GRNC's appreciation of the dose estimates presented in the annual environmental monitoring report of Areva-NC La Hague facility. Third GRNC viewpoint. Detailed report; Annee 2005. Appreciation par le GRNC de l'estimation des doses presentee dans le rapport annuel de surveillance de l'environnement d'Areva-NC La Hague. Troisieme avis du GRNC. Rapport detaille

Energy Technology Data Exchange (ETDEWEB)

NONE

2006-07-01

The 'Groupe Radioecologie Nord Cotentin' (GRNC) has carried out a very thorough evaluation of the assessment of doses due to discharges from the Cap de la Hague nuclear site carried out by Areva NC, the site operators. The group has looked at all aspects of the assessment methods and data to ensure that they agree with the results presented in the 2005 annual environmental report of the operator. The computer tool, ACADIE, developed to assess the doses, has been used by the GRNC members to carry out their own calculations. This document comprises the detailed report of the GRNC and its synthesis. The detailed report includes: 1 - critical analysis of the 2005 source term, the data transmitted by Areva NC (status of atmospheric effluents, status of liquid effluents at sea, fuel data, presentation of the work progress of the Areva NC working group), the history of liquid and gaseous effluents between 1966 and 2005; 2 - detailed comparison between model and 2005 measurements; 3 - detail of the 2005 efficient dose calculations. (J.S.)

VH mode accessibility and global H-mode properties in previous and present JET configurations

Energy Technology Data Exchange (ETDEWEB)

Jones, T T.C.; Ali-Arshad, S; Bures, M; Christiansen, J P; Esch, H P.L. de; Fishpool, G; Jarvis, O N; Koenig, R; Lawson, K D; Lomas, P J; Marcus, F B; Sartori, R; Schunke, B; Smeulders, P; Stork, D; Taroni, A; Thomas, P R; Thomsen, K [Commission of the European Communities, Abingdon (United Kingdom). JET Joint Undertaking

1994-07-01

In JET VH modes, there is a distinct confinement transition following the cessation of ELMs, observed in a wide variety of tokamak operating conditions, using both NBI and ICRF heating methods. Important factors which influence VH mode accessibility such as magnetic configuration and vessel conditions have been identified. The new JET pumped divertor configuration has much improved plasma shaping control and power and particle exhaust capability and should permit exploitation of plasmas with VH confinement properties over an even wider range of operating regimes, particularly at high plasma current; first H-modes have been obtained in the 1994 JET operating period and initial results are reported. (authors). 7 refs., 6 figs.

Testing the QCD string at large Nc from the thermodynamics of the hadronic phase

Science.gov (United States)

Cohen, Thomas D.

2007-02-01

It is generally believed that in the limit of a large number of colors (Nc) the description of confinement via flux tubes becomes valid and QCD can be modeled accurately via a hadronic string theory—at least for highly excited states. QCD at large Nc also has a well-defined deconfinement transition at a temperature Tc. In this talk it is shown how the thermodyanmics of the metastable hadronic phase of QCD (above Tc) at large NC can be related directly to properties of the effective QCD string. The key points in the derivation is the weakly interacting nature of hadrons at large Nc and the existence of a Hagedorn temperature TH for the effective string theory. From this it can be seen at large Nc and near TH, the energy density and pressure of the hadronic phase scale as E ˜ (TH - T)-(D⊥-6)/2 (for D⊥ TH - T)-(D⊥-4)/2 (for D⊥ TH > Tc this behavior is of relevance only to the metastable phase. The prospect of using this result to extract D⊥ via lattice simulations of the metastable hadronic phase at moderately large Nc is discussed.

A square-plate piezoelectric linear motor operating in two orthogonal and isomorphic face-diagonal-bending modes.

Science.gov (United States)

Ci, Penghong; Chen, Zhijiang; Liu, Guoxi; Dong, Shuxiang

2014-01-01

We report a piezoelectric linear motor made of a single Pb(Zr,Ti)O3 square-plate, which operates in two orthogonal and isomorphic face-diagonal-bending modes to produce precision linear motion. A 15 × 15 × 2 mm prototype was fabricated, and the motor generated a driving force of up to 1.8 N and a speed of 170 mm/s under an applied voltage of 100 Vpp at the resonance frequency of 136.5 kHz. The motor shows such advantages as large driving force under relatively low driving voltage, simple structure, and stable motion because of its isomorphic face-diagonal-bending mode.

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MFYWILL... NC_006905 gi|62180070 >gi|62180070|ref|YP_216487.1| putative membrane transporter

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available of cations and cationic drugs [Salmonella enterica subsp. enterica serovar Choleraesuis str. SC-B67] MQQFEWI... NC_006905 gi|62180071 >gi|62180071|ref|YP_216488.1| putative membrane transporter

ORF Sequence: NC_000913 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000913 gi|16131649 >gi|16131649|ref|NP_418241.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli K12] MSLLQFSGLFVVWLLCTLFIATLTWFEFRRVR

ORF Sequence: NC_001147 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001147 gi|6324442 >gi|6324442|ref|NP_014511.1| Plasma membrane Mg(2+) transporter, expression and turnov...er are regulated by Mg(2+) concentration; overexpression confers increased toleranc

ORF Sequence: NC_001134 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ivery of heterogeneous nuclear ribonucleoproteins to the nucleoplasm, binds rg-nucl... NC_001134 gi|6319491 >gi|6319491|ref|NP_009573.1| Transportin, cytosolic karyopherin beta 2 involved in del

Local and global performance of double-gap resistive plate chambers operated in avalanche mode

Energy Technology Data Exchange (ETDEWEB)

Abbrescia, M.; Colaleo, A.; Iaselli, G.; Loddo, F.; Maggi, M.; Marangelli, B.; Natali, S.; Nuzzo, S.; Pugliese, G.; Ranieri, A.; Romano, F.; Altieri, S.; Belli, G.; Bruno, G.; Gianini, G.; Ratti, S.P.; Viola, L.; Vitulo, P.; Sergueev, S

1999-09-21

Two large double-gap resistive plate chambers, with 2 and 3 mm gap widths, were tested to study their response uniformity when operated in avalanche mode. The effects of mechanical tolerances and the presence of the spacers is thoroughly examined. Results on efficiency and time resolution are presented. We find that average performance and response uniformity over the whole chamber surface are fully adequate to the requirements of future collider experiments. (author)

The Effects of 10 Communication Modes on the Behavior of Teams During Co-Operative Problem-Solving

Science.gov (United States)

Ochsman, Richard B.; Chapanis, Alphonse

1974-01-01

Sixty teams of two college students each solved credible "real world" problems co-operatively. Conversations were carried on in one of 10 modes of communication: (1) typewriting only, (2) handwriting only, (3) handwriting and typewriting, (4) typewriting and video, (5) handwriting and video, (6) voice only, (7) voice and typewriting, (8) voice and…

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002977 gi|53804693 >1fgjA 20 492 48 517 e-179 ... gb|AAU92745.1| hydroxylamine oxy...doreductase [Methylococcus capsulatus str. Bath] ... ref|YP_113436.1| hydroxylamine oxydoreductase ...

ORF Alignment: NC_006569 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006569 gi|56708985 >1fgjA 5 498 32 521 0.0 ... ref|YP_165030.1| hydroxylamine oxid...oreductase [Silicibacter pomeroyi DSS-3] ... gb|AAV97335.1| hydroxylamine oxidoreductase ... [

ORF Alignment: NC_004307 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004307 gi|23465117 >1g5aA 80 628 2 589 5e-59 ... gb|AAL05573.1| alpha-glucosidase [Bifidobacterium adolesce...ntis] ... Length = 588 ... Query: 1 ... MTANNLNDDWWKQAVVYQIYPRSFKDVNGDGLGDIAGVTEK

ORF Sequence: NC_002945 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002945 gi|31792282 >gi|31792282|ref|NP_854775.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium bovis AF2122/97] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

ORF Sequence: NC_000962 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000962 gi|57116825 >gi|57116825|ref|YP_177638.1| PROBABLE CELLULASE CELA2A (ENDO-1,4-BETA-GLUCA...NASE) (ENDOGLUCANASE) (CARBOXYMETHYL CELLULASE) [Mycobacterium tuberculosis H37Rv] MNGAAPTNGAPLSYPSICEGVHWGHLVGGHQPAY

ORF Sequence: NC_006905 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006905 gi|62181272 >gi|62181272|ref|YP_217689.1| H inversion: regulation of fla...gellar gene expression by site-specific inversion of DNA [Salmonella enterica subsp. enterica serovar Choler

The Thermal State Computational Research of the Low-Thrust Oxygen-Methane Gaseous-Propellant Rocket Engine in the Pulse Mode of Operation

Directory of Open Access Journals (Sweden)

O. A. Vorozheeva

2014-01-01

Full Text Available Currently promising development direction of space propulsion engineering is to use, as spacecraft controls, low-thrust rocket engines (RDTM on clean fuels, such as oxygen-methane. Modern RDTM are characterized by a lack regenerative cooling and pulse mode of operation, during which there is accumulation of heat energy to lead to the high thermal stress of RDTM structural elements. To get an idea about the thermal state of its elements, which further will reduce the number of fire tests is therefore necessary in the development phase of a new product. Accordingly, the aim of this work is the mathematical modeling and computational study of the thermal state of gaseous oxygen-methane propellant RDMT operating in pulse mode.In this paper we consider a model RDTM working on gaseous propellants oxygen-methane in pulse mode.To calculate the temperature field of the chamber wall of model RDMT under consideration is used the mathematical model of non-stationary heat conduction in a two-dimensional axisymmetric formulation that takes into account both the axial heat leakages and the nonstationary processes occurring inside the chamber during pulse operation of RDMT.As a result of numerical study of the thermal state of model RDMT, are obtained the temperature fields during engine operation based on convective, conductive, and radiative mechanisms of heat transfer from the combustion products to the wall.It is shown that the elements of flanges of combustion chamber of model RDMT act as heat sinks structural elements. Temperatures in the wall of the combustion chamber during the engine mode of operation are considered relatively low.Raised temperatures can also occur in the mixing head in the feeding area of the oxidant into the combustion chamber.During engine operation in the area forming the critical section, there is an intensive heating of a wall, which can result in its melting, which in turn will increase the minimum nozzle throat area and hence

Improvement of the reliability graph with general gates to analyze the reliability of dynamic systems that have various operation modes

Energy Technology Data Exchange (ETDEWEB)

Shin, Seung Ki [Div. of Research Reactor System Design, Korea Atomic Energy Research Institute, Daejeon (Korea, Republic of); No, Young Gyu; Seong, Poong Hyun [Dept. of Nuclear and Quantum Engineering, Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of)

2016-04-15

The safety of nuclear power plants is analyzed by a probabilistic risk assessment, and the fault tree analysis is the most widely used method for a risk assessment with the event tree analysis. One of the well-known disadvantages of the fault tree is that drawing a fault tree for a complex system is a very cumbersome task. Thus, several graphical modeling methods have been proposed for the convenient and intuitive modeling of complex systems. In this paper, the reliability graph with general gates (RGGG) method, one of the intuitive graphical modeling methods based on Bayesian networks, is improved for the reliability analyses of dynamic systems that have various operation modes with time. A reliability matrix is proposed and it is explained how to utilize the reliability matrix in the RGGG for various cases of operation mode changes. The proposed RGGG with a reliability matrix provides a convenient and intuitive modeling of various operation modes of complex systems, and can also be utilized with dynamic nodes that analyze the failure sequences of subcomponents. The combinatorial use of a reliability matrix with dynamic nodes is illustrated through an application to a shutdown cooling system in a nuclear power plant.

Improvement of the reliability graph with general gates to analyze the reliability of dynamic systems that have various operation modes

International Nuclear Information System (INIS)

Shin, Seung Ki; No, Young Gyu; Seong, Poong Hyun

2016-01-01

The safety of nuclear power plants is analyzed by a probabilistic risk assessment, and the fault tree analysis is the most widely used method for a risk assessment with the event tree analysis. One of the well-known disadvantages of the fault tree is that drawing a fault tree for a complex system is a very cumbersome task. Thus, several graphical modeling methods have been proposed for the convenient and intuitive modeling of complex systems. In this paper, the reliability graph with general gates (RGGG) method, one of the intuitive graphical modeling methods based on Bayesian networks, is improved for the reliability analyses of dynamic systems that have various operation modes with time. A reliability matrix is proposed and it is explained how to utilize the reliability matrix in the RGGG for various cases of operation mode changes. The proposed RGGG with a reliability matrix provides a convenient and intuitive modeling of various operation modes of complex systems, and can also be utilized with dynamic nodes that analyze the failure sequences of subcomponents. The combinatorial use of a reliability matrix with dynamic nodes is illustrated through an application to a shutdown cooling system in a nuclear power plant

Comparative economic efficiency, operating costs and fuel consumption rates of freight transport modes between the largest industrial cities and seaports in South Africa

Directory of Open Access Journals (Sweden)

W J (Wessel Pienaar

2013-09-01

Full Text Available The paper deals with aspects of efficiency within the five modes of freight transport, with special reference to the operating cost and fuel consumption rates between South Africa’s largest industrial cities and seaports. In particular, the paper deals with (a the opportunities that exist for the achievement of efficiency in freight transport; (b the subgroups of economies that can enhance efficiency attainment in the freight transport industry; (c prevailing cost structures, operating cost and fuel consumption rates within the five modes of freight transport; and (d the salient economic features of the freight transport market. The research approach and methodology combine (a a literature survey; (b empiric research, (c an analysis of the cost structures of freight transport operators from different modes of transport; and (d interviews conducted with specialists in the freight transport industry.

Testing to expand the rotary-mode core sampling system operating envelope

International Nuclear Information System (INIS)

Witwer, K.S.

1998-01-01

Rotary sampling using the Rotary Mode Core Sampling System (RMCSS) is constrained by what is referred to as the ''Operating Envelope''. The Operating Envelop defines the maximum downward force, maximum rotational speed and minimum purge gas flow allowed during operation of the RMCSS. The original values of 1170 lb. down force, 55 RPM rotational speed, and 30 SCFM nitrogen purge gas were determined during original envelope testing. This envelope was determined by observing the temperature rise on the bitface while drilling into waste simulants. The maximum temperature in single-shell tanks (SSTS) is considered to be approximately 9O C and the critical drill bit temperature, which is the temperature at which an exothermic reaction could be initiated in the tank waste, was previously determined to be 150 C. Thus, the drill bit temperature increase was limited to 60 C. Thermal properties of these simulants approximated typical properties of waste tank saltcake. Later, more detailed envelope testing which used a pumice block simulant, showed a notably higher temperature rise while drilling. This pumice material, which simulated a ''worst case'' foreign object embedded in the waste, has lower thermal conductivity and lower thermal diffusivity than earlier simulants. These properties caused a slower heat transfer in the pumice than in the previous simulants and consequently a higher temperature rise. The maximum downward force was subsequently reduced to 750 lb (at a maximum 55 RPM and minimum 30 SCFM purge gas flow) which was the maximum value at which the drill bit could be operated and still remain below the 60 C temperature rise

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546028 >1fjgR 2 71 22 91 5e-16 ... emb|CAD15011.1| PROBABLE PRIMOSOMAL REPLICATION... PROTEIN [Ralstonia solanacearum] ... ref|NP_519430.1| PROBABLE PRIMOSOMAL REPLICATION ...

ORF Alignment: NC_003228 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003228 gi|60681683 >1gntA 1 551 3 543 0.0 ... emb|CAH07898.1| hydroxylamine reduct...ase [Bacteroides fragilis NCTC 9343] ... ref|YP_211827.1| hydroxylamine reductase [Bacteroides ...

ORF Sequence: NC_003281 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003281 gi|25151987 >gi|25151987|ref|NP_499440.2| TRAnsformer : XX animals trans...formed into males TRA-1, HERmaphrodization of XO animals HER-2, sex determination zinc-finger protein, alter

ORF Sequence: NC_003282 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available inization of XX and XO animals FEM-3 (46.2 kD) (fem-3) [Caenorhabditis elegans] MEVDPGSDDVEADRETRAQKLKLKRNVK... NC_003282 gi|17540880 >gi|17540880|ref|NP_501587.1| sex determination protein, FEM

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39936477 >1kmoA 7 661 92 753 2e-72 ... emb|CAE28855.1| putative hydroxamate-type ferris... ... putative hydroxamate-type ferrisiderophore receptor ... [Rhodopseudomonas palustris CGA009] ...

ORF Alignment: NC_006155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006155 gi|51597538 >1kmoA 5 661 59 714 9e-71 ... ref|YP_071729.1| putative hydroxamate-type ferris...ive ... hydroxamate-type ferrisiderophore receptor. [Yersinia ... pseudotuberculosis IP 32953

ORF Alignment: NC_006274 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006274 gi|52142162 >1gpuA 4 663 4 663 0.0 ... ref|YP_084669.1| transketolase (glycoal...dehyde transferase) [Bacillus cereus ZK] ... gb|AAU17181.1| transketolase (glycoaldehyde transfera

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21219041 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Alignment: NC_003306 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003306 gi|17938860 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Alignment: NC_003064 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003064 gi|16119505 >1pv1A 14 282 20 256 6e-05 ... emb|CAE53384.1| hypothetical protein [Actinoplanes... teichomyceticus] emb|CAG15045.1| ... hypothetical protein [Actinoplanes teichomyce

ORF Sequence: NC_001145 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001145 gi|6323710 >gi|6323710|ref|NP_013781.1| Protein required for nuclear mem...brane fusion during karyogamy, localizes to the membrane with a soluble portion in the endoplasmic reticulum

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003919 gi|21242752 >1iwlA 2 180 23 207 3e-47 ... gb|AAM36870.1| outer-membrane lipoproteins... ... outer-membrane lipoproteins carrier protein precursor ... [Xanthomonas axonopodis pv. citr

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006370 gi|54308356 >1iwlA 4 181 22 199 2e-52 ... ref|YP_129376.1| hypothetical outer membrane lipoproteins... ... hypothetical outer membrane lipoproteins carrier protein ... [Photobacterium profundum] ... L

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002655 gi|15800754 >gi|15800754|ref|NP_286768.1| periplasmic protein effects translocation of lipoprotei...ns from inner membrane to outer [Escherichia coli O157:H7 EDL933] MMKKIAITCALLSSLVA

INTEGRAL INDEX OF OPERATION QUALITY FOR EVALUATION OF IMPACT OF DISTRIBUTIVE GENERATION SOURCES ON ELECTRIC NETWORK MODES

Directory of Open Access Journals (Sweden)

Petro D. Lezhniuk

2017-06-01

Full Text Available Method of operation quality evaluation of electric network, comprising renewable sources of energy (RSE is considered. Integral index that enables to evaluate the impact of RSE on energy losses and its quality as well as balance reliability in electric network is suggested. Mathematical model is constructed, taking into account the assumption that electric network with RSE may be in various operation modes, characterized by different technical economic indices. To determine the integral index of operation quality of electric network with RSE in all possible states tools of Markov processes theory and criterial method are used.

An evaluation of effects of large-scale introduction of renewable power on capacities and operation modes of power generation systems in Japan

International Nuclear Information System (INIS)

Yamamoto, Hiromi; Yabe, Kuniaki; Bando, Shigeru; Nagai, Yu

2014-01-01

This study aims to establish a methodology to adequately evaluate an optimal power generation mix in Japan taking into account load frequency control (LFC) capacity and operation modes of power plants in case of a large-scale introduction of photovoltaic and wind power. For this purpose, the authors gave such an improvement to the MM-OPG model, a power generation mix optimization model, which it can deal with different operation modes of pumped hydro power in addition to those of thermal power sources. Using the model, the authors calculated the optimal power generation mix and its corresponding operation modes of Japan's power systems in 2030 with additional insights to 2020, and obtained the following results. (1) Introduction of photovoltaic and wind can be substituted for a limited capacity of conventional power sources. The introduction of 150 GW that consists of 108GW of photovoltaic and 42GW of wind in 2030 can replace no greater than 0.5 GW of conventional power sources. (2) The introduction of the renewables will affect the operation patterns of thermal and pumped hydro power generation. The capacity factor of variable speed pumped hydro will be much greater than that of fixed speed pumped hydro since the former can supply LFC at pump modes as well as generation modes. The capacity factor of LNG combined cycle plants decreases from 43% to 29% in the case with the introduction of 150GW of renewables in 2030. On the same assumption, the average cost of power generation excluding the renewables increases by up to 0.55 JPY/kWh in 2030. (author)

46 CFR 7.55 - Cape Henry, VA to Cape Fear, NC.

Science.gov (United States)

2010-10-01

... 46 Shipping 1 2010-10-01 2010-10-01 false Cape Henry, VA to Cape Fear, NC. 7.55 Section 7.55 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY PROCEDURES APPLICABLE TO THE PUBLIC BOUNDARY LINES Atlantic Coast § 7.55 Cape Henry, VA to Cape Fear, NC. (a) A line drawn from Rudee Inlet Jetty Light “2” to...

Low-timing-jitter, stretched-pulse passively mode-locked fiber laser with tunable repetition rate and high operation stability

International Nuclear Information System (INIS)

Liu, Yuanshan; Zhang, Jian-Guo; Chen, Guofu; Zhao, Wei; Bai, Jing

2010-01-01

We design a low-timing-jitter, repetition-rate-tunable, stretched-pulse passively mode-locked fiber laser by using a nonlinear amplifying loop mirror (NALM), a semiconductor saturable absorber mirror (SESAM), and a tunable optical delay line in the laser configuration. Low-timing-jitter optical pulses are stably produced when a SESAM and a 0.16 m dispersion compensation fiber are employed in the laser cavity. By inserting a tunable optical delay line between NALM and SESAM, the variable repetition-rate operation of a self-starting, passively mode-locked fiber laser is successfully demonstrated over a range from 49.65 to 50.47 MHz. The experimental results show that the newly designed fiber laser can maintain the mode locking at the pumping power of 160 mW to stably generate periodic optical pulses with width less than 170 fs and timing jitter lower than 75 fs in the 1.55 µm wavelength region, when the fundamental repetition rate of the laser is continuously tuned between 49.65 and 50.47 MHz. Moreover, this fiber laser has a feature of turn-key operation with high repeatability of its fundamental repetition rate in practice

Production of structured lipids by acidolysis of an EPA-enriched fish oil and caprylic acid in a packed bed reactor: analysis of three different operation modes.

Science.gov (United States)

González Moreno, P A; Robles Medina, A; Camacho Rubio, F; Camacho Páez, B; Molina Grima, E

2004-01-01

Structured triacylglycerols (ST) enriched in eicosapentaenoic acid (EPA) in position 2 of the triacylglycerol (TAG) backbone were synthesized by acidolysis of a commercially available EPA-rich oil (EPAX4510, 40% EPA) and caprylic acid (CA), catalyzed by the 1,3-specific immobilized lipase Lipozyme IM. The reaction was carried out in a packed bed reactor (PBR) operating in two ways: (1) by recirculating the reaction mixture from the exit of the bed to the substrate reservoir (discontinuous mode) and (2) in continuous mode, directing the product mixture leaving the PBR to a product reservoir. By operating in these two ways and using a simple kinetic model, representative values for the apparent kinetic constants (kX) for each fatty acid (native, Li or odd, M) were obtained. The kinetic model assumes that the rate of incorporation of a fatty acid into TAG per amount of enzyme, rX (mole/(h g lipase)) is proportional to the extent of the deviation from the equilibrium for each fatty acid (i.e., the difference of concentration between the fatty acid in the triacylglycerol and the concentration of the same fatty acid in the triacylglycerol once the equilibrium of the acidolysis reaction is reached). The model allows comparing the two operating modes through the processing intensity, defined as mLt/(V[TG]0) and mL/(q[TG]0), for the discontinuous and continuous operation modes, respectively. In discontinuous mode, ST with 59.5% CA and 9.6% EPA were obtained. In contrast, a ST with 51% CA and 19.6% EPA were obtained when using the continuous operation mode. To enhance the CA incorporation when operating in continuous mode, a two-step acidolysis reaction was performed (third operation mode). This continuous two-step process yields a ST with a 64% CA and a 15% EPA. Finally, after purifying the above ST in a preparative silica gel column, impregnated with boric acid, a ST with 66.9% CA and 19.6% EPA was obtained. The analysis by reverse phase and Ag+ liquid chromatography of

ORF Alignment: NC_006371 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006371 gi|54302237 >1r690 2 63 15 79 7e-05 ... ref|YP_132230.1| hypotethical trans...criptional regulator [Photobacterium profundum ... SS9] emb|CAG22430.1| hypotethical transcriptional ...

ORF Alignment: NC_002947 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002947 gi|26988182 >1rwrA 1 265 36 293 1e-50 ... ref|NP_743607.1| surface colonization... ... gb|AAN67071.1| surface colonization protein, putative ... [Pseudomonas putida KT2440] ...

ORF Sequence: NC_001139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001139 gi|6321518 >gi|6321518|ref|NP_011595.1| Protein of unknown function; deletion... mutant has synthetic fitness defect with an sgs1 deletion mutant; Slx9p [Saccharomyces cerevisiae] MVA

ORF Alignment: NC_004461 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004461 gi|27467238 >1kolA 35 391 30 342 2e-04 ... ref|NP_763875.1| xylitol dehydro...genase [Staphylococcus epidermidis ATCC 12228] ... gb|AAO03917.1| xylitol dehydrogenase [Staphylococc

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available erobacterial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSAKALAAYSKRIDV... NC_002655 gi|15804377 >gi|15804377|ref|NP_290417.1| UDP-N-acetyl glucosamine -2-epimerase; synthesis of ent

ORF Alignment: NC_003075 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003075 gi|42566272 >1ogqA 3 270 31 261 6e-05 ... ref|NP_192248.2| leucine-rich repeat transme...ery: 151 XXXXXXXGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 210 ... GELPDVFQNLVGLINLDISSNNISGTLPPSME...NLLTLTTLRVQNNQLSGTLDV Sbjct: 121 LNDNLLSGELPDVFQNLVGLINLDISSNNISGTLPPSMENLLTLTTLRVQNNQLSGTLDV 180 ...

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546366 >1bxdA 1 144 297 447 7e-18 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...PROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546366 >1joyA 1 67 230 295 9e-16 ... emb|CAD15349.1| PROBABLE OXIDATIVE STRESS...ROTEIN ... [Ralstonia solanacearum] ref|NP_519768.1| PROBABLE ... OXIDATIVE STRESS RESISTANCE

ORF Alignment: NC_002928 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002928 gi|33596933 >1kmoA 7 661 65 702 8e-60 ... ref|NP_884576.1| putative ferrisi...derophore receptor [Bordetella parapertussis 12822] ... emb|CAE37631.1| putative ferrisiderophore rec

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29832733 >1chkA 1 236 48 283 9e-87 ... dbj|BAC73902.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_827367.1| putative chitosanase [Streptomyces ...

ORF Alignment: NC_003155 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003155 gi|29828557 >1chkA 1 236 35 270 4e-95 ... dbj|BAC69726.1| putative chitosan...ase [Streptomyces avermitilis MA-4680] ... ref|NP_823191.1| putative chitosanase [Streptomyces ...

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available tide synthetase [Actinoplanes teichomyceticus] ... Length = 427 ... Query: 12 ... LSPLQEGMLFHNLFDEEELDAYNVQ... NC_003888 gi|32141196 >1l5aA 1 423 12 438 2e-57 ... emb|CAE53352.1| non-ribosomal pep

ORF Alignment: NC_005363 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005363 gi|42523916 >1a12A 35 375 64 376 3e-39 ... emb|CAE53335.1| putative RCC1 repeats protein [Actinoplan...es teichomyceticus] ... Length = 313 ... Query: 425 GVGFACALYDNNDLKCFGANDYGQLGD

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34558174 >1wcv1 4 239 4 244 2e-25 ... ref|NP_907989.1| SEPTUM SITE-DETERMINING...| SEPTUM ... SITE-DETERMINING PROTEIN MIND CELL DIVISION INHIBITOR ... MIND [Wolinella succino

ORF Alignment: NC_005090 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005090 gi|34557077 >1vdkA 1 459 5 463 e-135 ... ref|NP_906892.1| ASPARTATE AMMONIA...-LYASE [Wolinella succinogenes DSM 1740] ... emb|CAE09792.1| ASPARTATE AMMONIA-LYASE [Wolinella ...

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003450 gi|19553429 >1v4aA 22 435 620 1034 4e-69 ... ref|YP_226470.1| GLUTAMATE-AMMONIA...mb|CAF20569.1| ... GLUTAMATE-AMMONIA-LIGASE ADENYLYLTRANSFERASE ... [Corynebacterium glutami

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17547365 >1gkmA 3 497 10 504 e-143 ... emb|CAD16353.1| PROBABLE HISTIDINE AMMONIA...-LYASE (HISTIDASE) PROTEIN [Ralstonia ... solanacearum] ref|NP_520767.1| PROBABLE HISTIDINE ... AMMONIA

ORF Alignment: NC_003047 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003047 gi|15966456 >1gkmA 2 501 3 499 e-107 ... emb|CAC47282.1| PUTATIVE HISTIDINE AMMONIA...-LYASE PROTEIN [Sinorhizobium meliloti] ... ref|NP_386809.1| PUTATIVE HISTIDINE AMMONIA-LYASE

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003450 gi|19552717 >1vdkA 1 459 57 516 e-127 ... ref|YP_225787.1| ASPARTATE AMMONIA...ynebacterium glutamicum ATCC 13032] emb|CAF21511.1| ... ASPARTATE AMMONIA-LYASE (ASPARTASE) [Coryneba

High-power LED light sources for optical measurement systems operated in continuous and overdriven pulsed modes

Science.gov (United States)

Stasicki, Bolesław; Schröder, Andreas; Boden, Fritz; Ludwikowski, Krzysztof

2017-06-01

The rapid progress of light emitting diode (LED) technology has recently resulted in the availability of high power devices with unprecedented light emission intensities comparable to those of visible laser light sources. On this basis two versatile devices have been developed, constructed and tested. The first one is a high-power, single-LED illuminator equipped with exchangeable projection lenses providing a homogenous light spot of defined diameter. The second device is a multi-LED illuminator array consisting of a number of high-power LEDs, each integrated with a separate collimating lens. These devices can emit R, G, CG, B, UV or white light and can be operated in pulsed or continuous wave (CW) mode. Using an external trigger signal they can be easily synchronized with cameras or other devices. The mode of operation and all parameters can be controlled by software. Various experiments have shown that these devices have become a versatile and competitive alternative to laser and xenon lamp based light sources. The principle, design, achieved performances and application examples are given in this paper.

Sloshing motion dynamics of a free surface in the draft tube cone of a Francis turbine operating in synchronous condenser mode

Science.gov (United States)

Vagnoni, Elena; Andolfatto, Loïc; Favrel, Arthur; Avellan, François

2016-11-01

The penetration of the electrical grid by intermittent renewable energy sources induces grid fluctuations which must be compensated in order to guarantee the stability of the grid. Hydropower plants can supply reactive power to ensure the grid stabilization by operating in condenser mode. In this operating mode, the turbine operates with the tail water depressed to let the runner spin in air to reduce the power consumption. Pressurized air is injected in the draft tube cone to maintain the water level below the runner and this induces air-water interaction phenomena which cause important power losses. Flow visualization and pressure fluctuation measurements are performed in a reduced scale physical model of a Francis turbine operating in condenser mode to investigate the dynamics of the air-water interaction in the draft tube cone which causes the sloshing motion of the free surface. An image post-processing method is developed, enabling a quantitative description of the sloshing motion. The latter depends on the Froude number. By increasing the value of the Froude number, the amplitude of the sloshing motion decreases, as well as the amplitude of the pressure fluctuations. The frequency of the sloshing motion corresponds to the first natural frequency of the water volume.

Safety analysis for push-mode and rotary-mode core sampling

International Nuclear Information System (INIS)

Milliken, N.J.; Geschke, G.R.

1995-01-01

This safety analysis analyzes using the push-mode core sampling truck in the push-mode and the rotary-mode core sampling trucks in both the push- and rotary-modes to retrieve core samples that, once taken and analyzed, will yield waste characterization data for the hazardous waste tanks at the Hanford Site. Operation of the core sampling trucks in both the push- and rotary-modes was reviewed to determine whether the release of radioactive materials could occur during operation. It was concluded that there are three credible scenarios: a sample spill outside of the tank, a steam release event, and an unfiltered release to the environment during continuous exhauster operation. The probability of a sample spill was found to be 10 -4 /event, the probability of a steam release event was determined to fall in the unlikely range (10 -2 /event to 10 -4 /event), and the probability of an unfiltered release was calculated to be 5 x 10 -3 /year. Typically, events with probabilities of 10 -6 /event or less are not considered to be risk significant, and the consequences usually are not analyzed. The three accident scenarios were analyzed to calculate the dose consequences. It was determined that the steam release event is the bounding accident. The onsite and offsite dose consequences for this event are calculated to be 0.24 Sv (24 rem) and 3.2 x 10 -4 Sv (32 mrem), respectively. These consequences are below the risk acceptance guidelines for an unlikely event, as established in WHC-CM-4-46, Nonreactor Facility Safety Analysis Manual. With the design features and the use of the controls presented in Section 8.0, this operation represents a minimal risk

A standing wave linear ultrasonic motor operating in in-plane expanding and bending modes.

Science.gov (United States)

Chen, Zhijiang; Li, Xiaotian; Ci, Penghong; Liu, Guoxi; Dong, Shuxiang

2015-03-01

A novel standing wave linear ultrasonic motor operating in in-plane expanding and bending modes was proposed in this study. The stator (or actuator) of the linear motor was made of a simple single Lead Zirconate Titanate (PZT) ceramic square plate (15 × 15 × 2 mm(3)) with a circular hole (D = 6.7 mm) in the center. The geometric parameters of the stator were computed with the finite element analysis to produce in-plane bi-mode standing wave vibration. The calculated results predicted that a driving tip attached at midpoint of one edge of the stator can produce two orthogonal, approximate straight-line trajectories, which can be used to move a slider in linear motion via frictional forces in forward or reverse direction. The investigations showed that the proposed linear motor can produce a six times higher power density than that of a previously reported square plate motor.

ORF Alignment: NC_005085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005085 gi|34497787 >1f39A 3 98 107 198 1e-23 ... gb|AAQ60004.1| SOS mutagenesis [C...hromobacterium violaceum ATCC 12472] ... ref|NP_902002.1| SOS mutagenesis [Chromobacterium ...

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006840 gi|59712585 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

ORF Alignment: NC_004605 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004605 gi|28900550 >1bxwA 8 170 21 215 9e-07 ... ref|NP_800205.1| accessory colonization... factor AcfA [Vibrio parahaemolyticus RIMD ... 2210633] dbj|BAC62038.1| accessory colonization

ORF Alignment: NC_006085 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006085 gi|50842772 >1qr0A 1 205 2 202 3e-27 ... ref|YP_055999.1| biosurfactants pr...oduction protein [Propionibacterium acnes ... KPA171202] gb|AAT83041.1| biosurfactants production ...

ORF Sequence: NC_002655 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002655 gi|15804385 >gi|15804385|ref|NP_290425.1| TDP-Fuc4NAc:lipidII transferase; synthesis of enterobac...terial common antigen (ECA) [Escherichia coli O157:H7 EDL933] MSLLQFSGLFVVWLLCTLFIA

ORF Alignment: NC_002678 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002678 gi|13474471 >1gkpA 2 454 5 422 3e-10 ... ref|NP_106039.1| creatinine deamin...ase [Mesorhizobium loti MAFF303099] ... dbj|BAB51825.1| creatinine deaminase [Mesorhizobium loti ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27381528 >1uzbA 40 515 6 475 3e-74 ... ref|NP_773057.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC51682.1| vanillin: NAD oxidoreductase ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27377799 >1uzbA 40 515 5 474 3e-69 ... ref|NP_769328.1| vanillin: NAD ox...idoreductase [Bradyrhizobium japonicum USDA 110] ... dbj|BAC47953.1| vanillin: NAD oxidoreductase ...

ORF Alignment: NC_006361 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006361 gi|54024866 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

ORF Alignment: NC_003450 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003450 gi|19554128 >1jmvA 2 140 154 297 6e-16 ... ref|YP_227183.1| UNIVERSAL STRESS...icum ATCC 13032] ... emb|CAF20967.1| UNIVERSAL STRESS PROTEIN FAMILY ... [Corynebacterium glut

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003295 gi|17546367 >1kgsA 3 221 7 234 1e-40 ... emb|CAD15350.1| PROBABLE OXIDATIVE STRESS... ... solanacearum] ref|NP_519769.1| PROBABLE OXIDATIVE STRESS ... RESISTANCE TWO-COMPONENT RESPON

ORF Alignment: NC_005027 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005027 gi|32475765 >1zrn0 11 219 5 254 2e-04 ... ref|NP_868759.1| N-acetylglucosamine-6-phosha... ... N-acetylglucosamine-6-phoshatase or p-nitrophenyl ... phosphatase [Pirellula sp.] ... Len

ORF Alignment: NC_002939 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002939 gi|39996821 >1v7zA 3 252 1 232 3e-42 ... ref|NP_952772.1| creatinine amidoh...ydrolase [Geobacter sulfurreducens PCA] ... gb|AAR35099.1| creatinine amidohydrolase [Geobacter ...

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21225320 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21225300 >1k12A 3 151 580 722 8e-15 ... dbj|BAC69434.1| putative mycodextrana...se [Streptomyces avermitilis MA-4680] ... ref|NP_822899.1| putative mycodextranase [Streptomyces

ORF Alignment: NC_002929 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002929 gi|33592999 >1kmoA 7 661 65 702 1e-60 ... ref|NP_880643.1| putative ferrisi...derophore receptor [Bordetella pertussis Tohama I] ... emb|CAE42244.1| putative ferrisiderophore rece

ORF Alignment: NC_002927 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002927 gi|33600770 >1kmoA 7 661 65 702 2e-60 ... ref|NP_888330.1| putative ferrisi...derophore receptor [Bordetella bronchiseptica RB50] ... emb|CAE32282.1| putative ferrisiderophore rec

ORF Alignment: NC_003888 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003888 gi|21219207 >1chkA 2 236 45 279 3e-87 ... ref|NP_624986.1| secreted chitosan...ase [Streptomyces coelicolor A3(2)] ... emb|CAB61194.1| secreted chitosanase [Streptomyces ...

ORF Alignment: NC_003911 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003911 gi|56696447 >1dlwA 19 115 21 125 4e-12 ... gb|AAV94850.1| protozoan/cyanoba...cterial globin family protein [Silicibacter ... pomeroyi DSS-3] ref|YP_166804.1| ... protozoan

ORF Alignment: NC_002977 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002977 gi|53804116 >1dlwA 19 113 26 120 5e-13 ... gb|AAU92168.1| protozoan/cyanoba...cterial globin family protein [Methylococcus ... capsulatus str. Bath] ref|YP_114018.1| ... protozoa

ORF Alignment: NC_005296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_005296 gi|39933534 >1rkd0 3 296 29 346 6e-36 ... emb|CAE25901.1| possible cabohydr...ate kinases [Rhodopseudomonas palustris CGA009] ... ref|NP_945810.1| possible cabohydrate kinases ...

ORF Alignment: NC_003296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003296 gi|17548586 >1gkmA 10 504 26 526 e-118 ... ref|NP_521926.1| PROBABLE HISTIDINE AMMONIA...-LYASE PROTEIN [Ralstonia solanacearum ... GMI1000] emb|CAD17516.1| PROBABLE HISTIDINE ... AMMONIA

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003902 gi|21231422 >1iwlA 2 180 23 207 3e-47 ... ref|NP_637339.1| outer-membrane lipoproteins... ... gb|AAM41263.1| outer-membrane lipoproteins carrier ... protein precursor [Xanthomonas campest

STOMP Sparse Vegetation Evapotranspiration Model for the Water-Air-Energy Operational Mode

Energy Technology Data Exchange (ETDEWEB)

Ward, Anderson L.; White, Mark D.; Freeman, Eugene J.; Zhang, Z. F.

2005-09-15

The Water-Air-Energy (WAE) Operational Mode of the Subsurface Transport Over Multiple Phases (STOMP) numerical simulator solves the coupled conservation equations for water mass, air mass, and thermal energy in multiple dimensions. This addendum describes the theory, input file formatting, and application of a soil-vegetation-atmosphere transfer (SVAT) scheme for STOMP that is based on a sparse vegetation evapotranspiration model. The SVAT scheme is implemented as a boundary condition on the upper surface of the computational domain and has capabilities for simulating evaporation from bare surfaces as well as evapotranspiration from sparsely vegetated surfaces populated with single or multiple plant species in response to meteorological forcings. With this extension, the model calculates water mass, air mass and thermal energy across a boundary surface in addition to root-water transport between the subsurface and atmosphere. This mode represents the barrier extension of the WAE mode and is designated as STOMP-WAE-B. Input for STOMP-WAE-B is specified via three input cards and include: atmospheric conditions through the Atmospheric Conditions Card; time-invariant plant species data through the Plant Properties Card; and time varying plant species data through the Boundary Conditions Card. Two optional cards, the Observed Data and UCODE Control Cards allow use of STOMP-WAE with UCODE in an inverse mode to estimate model parameters. STOMP-WAE was validated by solving a number of test problems from the literature that included experimental observations as well as analytical or numerical solutions. Several of the UNSAT-H verification problems are included along with a benchmark simulation derived from a recently published intercode comparison for barrier design tools. Results show that STOMP is able to meet, and in most cases, exceed performance of other commonly used simulation codes without having to resort to may of their simplifying assumptions. Use of the fully

ORF Alignment: NC_003902 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003902 gi|21232942 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21242877 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004663 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004663 gi|29348666 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004578 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004578 gi|28867366 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_005139 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_005139 gi|37678876 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21241391 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006177 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006177 gi|51892124 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006349 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006349 gi|53716793 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006840 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006840 gi|59711756 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006370 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006370 gi|54310137 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003919 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003919 gi|21243399 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_003869 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_003869 gi|20807352 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_006351 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006351 gi|53722013 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004459 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_004459 gi|27363966 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Alignment: NC_004461 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004461 gi|27467672 >1pwgA 4 344 72 389 1e-36 ... ref|NP_764309.1| autolysis and me...thicillin resistant-related protein [Staphylococcus ... epidermidis ATCC 12228] gb|AAO04351.1| autolysis

ORF Alignment: NC_006834 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ative regulator of cell autolysis [Desulfitobacterium ... hafniense DCB-2] ... Length = 127 ... Q... NC_006834 gi|58583632 >1i58A 23 189 289 415 6e-06 ... ref|ZP_00097900.1| COG3275: Put

ORF Sequence: NC_001136 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_001136 gi|6320573 >gi|6320573|ref|NP_010653.1| Nucleolar protein involved in pre-rRNA processing; deplet...ion causes severely decreased 18S rRNA levels; Esf1p [Saccharomyces cerevisiae] MAG

ORF Alignment: NC_000964 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_000964 gi|16078891 >1jmkC 6 230 1056 1270 2e-59 ... ref|NP_389712.1| plipastatin s...ynthetase [Bacillus subtilis subsp. subtilis str. 168] ... emb|CAB13713.1| plipastatin synthetase [B

ORF Alignment: NC_006841 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006841 gi|59714046 >1gntA 1 552 1 553 0.0 ... ref|YP_206821.1| hydroxylamine reduc...tase [Vibrio fischeri ES114] gb|AAW87933.1| ... hydroxylamine reductase [Vibrio fischeri ES114] ...

ORF Alignment: NC_006677 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_006677 gi|58039331 >1hxhA 1 247 2 262 8e-39 ... pir||JC7939 xylitol dehydrogenase ...(EC 1.1.1.-) - Gluconobacter oxydans (Strain ... ATCC621) dbj|BAC16227.1| xylitol dehydrogenase ...

ORF Alignment: NC_002570 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_002570 gi|15612789 >1v7zA 3 254 1 238 1e-53 ... dbj|BAB03945.1| creatinine amidohy...drolase [Bacillus halodurans C-125] ... ref|NP_241092.1| creatinine amidohydrolase [Bacillus ...

ORF Alignment: NC_004463 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_004463 gi|27377041 >1xewY 1 130 1026 1153 2e-37 ... ref|NP_248653.1| chromosome segreta...tion protein (smc1) [Methanocaldococcus ... jannaschii DSM 2661] gb|AAB99663.1| chromosome ... segreta

ORF Alignment: NC_000909 [GENIUS II[Archive

Lifescience Database Archive (English)