Bacterias celulolíticas aisladas del intestino de termitas (Nasutitermes nigriceps con características probióticas y potencial en la degradación del pasto

Directory of Open Access Journals (Sweden)

Cecilia Lara Mantilla

2013-01-01

Abstract: The objective of this research was to isolate cellulolytic bacteria from the gut of termites (Nasutitermes nigriceps to determine their probiotic properties in vitro and its potential in degrading  grass. Termites were treated with antibacterial detergent, then their intestine was separated and macerated in sterile peptone water. Dilutions of this mixture were inoculated in Petri dishes using  Luria Bertani (LB method and carboxymethylcellulose (CMC 2%, incubated at 37 ° C for 24 hours, and then revealed with 1% Congo Red. Bacteria with higher degradation halos were subjected to Gram staining and probiotic temperature tests, pH, salinity and the presence of bile salts, as well as antagonism and degradation of grass tests. The results revealed the presence of 9 Gram (-  cellulolytic bacillifrom which the bacilli BTN7 and BTN8, showed the best degradation halosof 12 and 14 mm in diameter respectively, growing suitably in the different probiotic tests with densities between 106 and 108 CFU / ml, the degradation percentages of dry matter was 39.73% and 36.10% within 48 and 72 hours respectively. Biochemical tests API E showed that (bioMérieux SA bacilli BTN8 and BTN7 belong to the genus Enterobacter sp. The above mentioned results open the possibility of using these organisms as additives for ruminants feeding, in order to contribute to a better use of pasture, and other lignocellulosic vegetal substrates. Key words:Probiotics, Maralfalfa (Pennisetum sp., ruminal microbes, lignocellulose, Enterobacter.

Cuticular hydrocarbons for species determination of tropical termites

Science.gov (United States)

Michael I. Haverty; Lori J. Nelson; Barbara L. Thorne; Margaret S. Collins; Johanna P.E.C. Darlington; Marion Page

1992-01-01

Cuticular hydrocarbons can be used to discriminate species in Coptotermes and Nasutitermes, here discussed for selected species from locations in the Pacific Rim and several Caribbean islands. We recently reexamined the cuticular hydrocarbons of Coptotermes formosanus and identified several dimethylalkanes that...

Phylogeny of not-yet-cultured spirochetes from termite guts

DEFF Research Database (Denmark)

Paster, B.J.; Dewhirst, F.E.; Cooke, S.M.

1996-01-01

Comparisons of 16S rDNA sequences were used to determine the phylogeny of not-yet-cultured spirochetes from hindguts of the African higher termite, Nasutitermes lujae (Wasmann). The 16S rRNA genes were amplified directly from spirochete-rich hindguts by using universal primers, and the amplified...

Degradation of mangrove tissues by arboreal termites (Nasutitermes acajutlae) and their role in the mangrove C cycle (Puerto Rico): Chemical characterization and organic matter provenance using bulk δ13C, C/N, alkaline CuO oxidation-GC/MS, and solid-state 13C NMR

Science.gov (United States)

Vane, Christopher H.; Kim, Alexander W.; Moss-Hayes, Vicky; Snape, Colin E.; Diaz, Miguel Castro; Khan, Nicole S.; Engelhart, Simon E.; Horton, Benjamin P.

2013-08-01

Arboreal termites are wood decaying organisms that play an important role in the first stages of C cycling in mangrove systems. The chemical composition of Rhizophora mangle, Avicennia germinans, and Laguncularia racemosa leaf, stem, and pneumatophore tissues as well as associated sediments was compared to that of nests of the termite Nasutitermes acajutlae. Nests gave δ13C values of -26.1 to -27.2‰ (±0.1) and C/N of 43.3 (±2.0) to 98.6 (±16.2) which were similar to all stem and pneumatophores but distinct from mangrove leaves or sediments. Organic matter processed by termites yielded lignin phenol concentrations (Λ, lambda) that were 2-4 times higher than stem or pneumatophores and 10-20 times higher than that of leaves or sediments, suggesting that the nests were more resistant to biodegradation than the mangrove vegetation source. 13C NMR revealed that polysaccharide content of mangrove tissues (50-69% C) was higher than that of the nests (46-51% C). Conversely, lignin accounted for 16.2-19.6% C of nest material, a threefold increase relative to living mangrove tissues; a similar increase in aromatic methoxyl content was also observed in the nests. Lipids (aliphatic and paraffinic moieties) were also important but rather variable chemical components of all three mangrove species, representing between 13.5 and 28.3% of the C content. Termite nests contained 3.14 Mg C ha-1 which represents approximately 2% of above ground C storage in mangroves, a value that is likely to increase upon burial due to their refractory chemical composition.

Susceptibility of Seven Termite Species (Isoptera) to the Entomopathogenic Fungus Metarhizium anisopliae

OpenAIRE

Chouvenc , Thomas; Su , Nan-Yao; Robert , Alain

2009-01-01

Seven termite species (Isoptera) from five families were tested for disease susceptibility against the entomopathogenic fungus Metarhizium anisopliae using a standard protocol: Mastotermes darwiniensis (Mastotermitidae), Hodotermopsis sjoestedti (Termopsidae), Hodotermes mossambicus (Hodotermitidae), Kalotermes flavicollis (Kalotermitidae), Reticulitermes flavipes and Prorhinotermes canalifrons (Rhinotermitidae), and Nasutitermes voeltzkowi (Termitidae). Our results showed a large diversity i...

Acoustical tree evaluation of Coptotermes Formosanus (Isoptera: Rhinotermitidae) with imidacloprid and noviflumeron in historic Jackson Square, New Orleans, Louisiana

Science.gov (United States)

Nine years of periodic acoustical monitoring of 93 trees active with Formosan subterranean termite, Coptotermes formosanus Shiraki, evaluated imidacloprid tree foam and noviflumuron bait on activity in trees. Long term, imidacloprid suppressed but did not eliminate termite activity in treated trees...

Social interactions in the central nest of Coptotermes formosanus juvenile colonies

Science.gov (United States)

Juvenile colonies of Coptotermes formosanus Shiraki were investigated to determine the social interactions among all individuals near the central nest of a colony. The behavioral repertoire of whole colonies of subterranean termites has yet to be identified because of their cryptic nests. Colonies w...

Effect of Naphthalene, Butylated Hydroxytoluene, Dioctyl Phthalate, and Adipic Dioctyl Ester, Chemicals Found in the Nests of the Formosan Subterranean Termite (Isoptera: Rhinotermitidae) on a Saprophytic Mucor sp.

Science.gov (United States)

Fungi are commonly found associated with termites and their nests. Four chemicals that have been isolated from the nests of the Formosan subterranean termite, Coptotermes formosanus Shiraki, were evaluated to determine their effect on a common nest fungus, a saprophytic Mucor sp. Butylated hydroxyto...

Atmospheric versus biological sources of polycyclic aromatic hydrocarbons (PAHs) in a tropical rain forest environment.

Science.gov (United States)

Krauss, Martin; Wilcke, Wolfgang; Martius, Christopher; Bandeira, Adelmar G; Garcia, Marcos V B; Amelung, Wulf

2005-05-01

To distinguish between pyrogenic and biological sources of PAHs in a tropical rain forest near Manaus, Brazil, we determined the concentrations of 21 PAHs in leaves, bark, twigs, and stem wood of forest trees, dead wood, mineral topsoil, litter layer, air, and Nasutitermes termite nest compartments. Naphthalene (NAPH) was the most abundant PAH with concentrations of 35 ng m(-3) in air (>85% of the sum of 21PAHs concentration), up to 1000 microg kg(-1) in plants (>90%), 477 microg kg(-1) in litter (>90%), 32 microg kg(-1) in topsoil (>90%), and 160 microg kg(-1) (>55%) in termite nests. In plants, the concentrations of PAHs in general decreased in the order leaves > bark > twigs > stem wood. The concentrations of most low-molecular weight PAHs in leaves and bark were near equilibrium with air, but those of NAPH were up to 50 times higher. Thus, the atmosphere seemed to be the major source of all PAHs in plants except for NAPH. Additionally, phenanthrene (PHEN) had elevated concentrations in bark and twigs of Vismia cayennensis trees (12-60 microg kg(-1)), which might have produced PHEN. In the mineral soil, perylene (PERY) was more abundant than in the litter layer, probably because of in situ biological production. Nasutitermes nests had the highest concentrations of most PAHs in exterior compartments (on average 8 and 15 microg kg(-1) compared to atmosphere controls the concentrations of most PAHs. However, the occurrence of NAPH, PHEN, and PERY in plants, termite nests, and soils at elevated concentrations supports the assumption of their biological origin.

Dicty_cDB: Contig-U14355-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available lkiii*iwl *ly*iiivk*ipmklipliqkvihhyimpyslnvlikfsciy*ikrkyvlenviwmvihh fiisvknsnhqnvre*fkp*lkkvqiltnkiim...AQ046505 ) RPCI11-42E14.TJ RPCI-11 Homo sapiens genomic clon... 46 1.5 1 ( EJ349319 ) 1092963571972 Global-Ocean-Sampli...655( CP000236 |pid:none) Ehrlichia chaffeensis str. Arkan... 46 0.001 DQ058898_1( DQ058898 |pid:none) Nasutitermes graveolus reli...041156664 Global-Ocean-Sampling_GS-34-01-01-1... 48 0.37 1 ( EJ247332 ) 1095337027578 Global-Ocean-Sampling_...ry Neovison vison ... 46 1.5 1 ( ER388657 ) 1094428746559 Global-Ocean-Sampling_GS-34-01-01-1... 46 1.5 1 (

Sensitivity of Heterointerfaces on Emission Wavelength in Quantum Cascade Lasers

Science.gov (United States)

2016-10-31

thickness. To correct the composition, a secondary flow of the Al precursor was added during MOVPE growth to increase Al content in QCLs. The resulting...diluted 200 ppm in H2) was used as the n-type dopant. The growth temperature was 625 °C as measured by emissivity corrected optical pyrometrey. AlInAs and...Muraki, S. Fukatsu, Y. Shiraki, and R. Ito , "Surface segregation of In atoms during molecular beam epitaxy and its influence on the energy levels in

Origin and alteration of organic matter in termite mounds from different feeding guilds of the Amazon rainforests.

Directory of Open Access Journals (Sweden)

Nina Siebers

Full Text Available The impact of termites on nutrient cycling and tropical soil formation depends on their feeding habits and related material transformation. The identification of food sources, however, is difficult, because they are variable and changed by termite activity and nest construction. Here, we related the sources and alteration of organic matter in nests from seven different termite genera and feeding habits in the Terra Firme rainforests to the properties of potential food sources soil, wood, and microepiphytes. Chemical analyses comprised isotopic composition of C and N, cellulosic (CPS, non-cellulosic (NCPS, and N-containing saccharides, and molecular composition screening using pyrolysis-field ionization mass spectrometry (Py-FIMS. The isotopic analysis revealed higher soil δ13C (-27.4‰ and δ15N (6.6‰ values in nests of wood feeding Nasutitermes and Cornitermes than in wood samples (δ13C = -29.1‰, δ15N = 3.4‰, reflecting stable-isotope enrichment with organic matter alterations during or after nest construction. This result was confirmed by elevated NCPS:CPS ratios, indicating a preferential cellulose decomposition in the nests. High portions of muramic acid (MurAc pointed to the participation of bacteria in the transformation processes. Non-metric multidimensional scaling (MDS revealed increasing geophagy in the sequence Termes < Embiratermes < Anoplotermes and increasing xylophagy for Cornitermes < Nasutitermes., and that the nest material of Constrictotermes was similar to the microepiphytes sample, confirming the report that Constrictotermes belongs to the microepiphyte-feeders. We therewith document that nest chemistry of rainforest termites shows variations and evidence of modification by microbial processes, but nevertheless it primarily reflects the trophic niches of the constructors.

I. Structural studies of termite defense secretions. II. Structural studies of natural products of marine nudibranchs. [Kempene, tridachione

Energy Technology Data Exchange (ETDEWEB)

Solheim, B.A.

1977-12-01

Three families of termites have the ability to produce a sticky secretion that envelopes and immobilizes the enemy. In the family Termitidae the secretion contains the diterpenoid hydrocarbons, kempene I and kempene II. The molecular structure of kempene II from the termite, Nasutitermes kempae, is described in detail. Another species of termite, Cubitermes umbratus, contained the diterpenoid hydrocarbon biflora-4,10-19,15-triene in the secretion and this compound is described. Studies were also conducted on the mucous secretion of the pedal gland of the marine nudibranch, Tidachiella diomedea. Tridachione, a substituted ..gamma..-pyrone, was isolated in the pure state and its molecular structure is described in detail. (HLW)

Durabilidade natural do estipe de pupunha (Bactris gasipaes Kunth, Arecaceae II: insetos Natural durability of Bactris gasipaes Kunth (peach palm, Arecaceae stipe II: insects

Directory of Open Access Journals (Sweden)

Raimunda Liege Souza de Abreu

2004-09-01

Full Text Available Neste trabalho estão apresentados os resultados da durabilidade natural do estipe (madeira de Bactris gasipaes Kunth (pupunha, quando submetido ao ataque de insetos xilófagos, em ensaios em ambiente florestal e urbano. Foram utilizados dez palmeiras, cinco com espinhos e cinco sem espinhos, de plantios da Fazenda Experimental da Universidade Federal do Amazonas, localizada no km 40 da rodovia Manaus-Boa Vista (BR 174. De cada uma das palmeiras foram cortados três discos de aproximadamente 30 cm de espessura, retirados da base, do meio e do topo. No ambiente florestal, os discos foram distribuídos aleatoriamente, em área próxima ao plantio, no espaçamento de 0,5m, permanecendo durante 18 meses, período no qual foram efetuadas seis inspeções trimestrais para avaliar o grau de deterioração e coleta de insetos. Para o ensaio em condição urbana, os discos foram secionados axialmente para a retirada da medula e distribuídos aleatoriamente, nas posições côncava e convexa, sobre uma estrutura de madeira, localizada no Campus do INPA em Manaus, e inspecionados bimestralmente por um ano. Os resultados do ensaio no ambiente florestal indicaram que a maioria dos discos foi deteriorada por térmitas e a vida útil da base foi em torno de 18 meses, a do meio e do topo em torno de 15. As principais espécies de cupins foram: Heterotermes tenuis (Hagen (Rhinotermitidae responsável pela deterioração da parte basal, mediana e o topo; Nasutitermes similis Emerson (Termitidae que infestou a região da base e do meio; Anoplotermes sp.(Termitidae e Nasutitermes tatarandae (Holmgren (Termitidae responsáveis pela infestação da parte mediana do estipe. No ambiente urbano, o principal responsável pela deterioração das amostras foi o besouro Dinoderus bifoveolatus Wollston (Bostrichidae, e em seguida, o térmita N. similis.The durability of the stipe of Bactris gasipaes Kunth (Peach palm when under attack by xylophage insects, is evaluated in

Efficacy of vetiver oil and nootkatone as soil barriers against Formosan subterranean termite (Isoptera: Rhinotermitidae).

Science.gov (United States)

Maistrello, L; Henderson, G; Laine, R A

2001-12-01

Vetiver oil and its components nootkatone and cedrene were assessed as sand treatments for their efficacy to disrupt food recruitment by Coptotermes formosanus Shiraki. Termites were required to tunnel through sand treated with vetiver oil, nootkatone, cedrene, or untreated sand to reach a food source. Results showed that sand treated with vetiver oil or nootkatone disrupted termite tunneling behavior. As a consequence, after 21 d, wood consumption and termite survival were significantly lower compared with cedrene-treated or untreated sand treatments. Sand treated with vetiver oil or nootkatone at 100 microg/g substrate were effective barriers to termites.

Mosquito Surveys Carried out On Green Island, Orchid Island, and Penghu Island, Taiwan, in 2003

Directory of Open Access Journals (Sweden)

Hwa-Jen Teng

2005-02-01

Full Text Available Field surveys of mosquitoes were carried out on Green, Orchid, and Penghu Islands in 2003 to ascertain the status of mosquito vectors. Eighteen species of mosquitoes were collected, including three species of Anopheles, four species of Aedes, eight species of Culex, two species of Armigeres, and one species of Malaya. Seventeen previously recorded species were not collected in this study but 11 species collected had not previously been recorded. Ten newly recorded species, An. maculatus, An. takasagoensis, Ae. alcasidi, Ae. lineatopennis, Ae. vexans vexans, Ar. omissus, Cx. vishnui, Cx. halifaxii, Cx. hayashii, and Cx. neomimulus, were collected on Green Island and one previously unrecorded species, Ar. subalbatus, was collected on Orchid Island. Potential vectors An. maculatus and An. sinensis, malaria vectors in Korea and Mainland China, Ae. albopictus, a vector of dengue in Taiwan and West Nile virus in the USA, Cx. vishnui and Cx. tritaeniorhynchus, Japanese encephalitis vectors in Taiwan, Ae. vexans vexans, an eastern equine encephalitis vector in the USA, and Cx. quinquefasciatus, a vector of filariasis in Taiwan and West Nile virus in the USA, were among the mosquito species collected.

Vertical Distribution of Termites on Trees in Two Forest Landscapes in Taiwan.

Science.gov (United States)

Li, Hou-Feng; Yeh, Hsin-Ting; Chiu, Chun-I; Kuo, Chih-Yu; Tsai, Ming-Jer

2016-03-25

Termites are a key functional group in the forest ecosystem, but they damage trees. To investigate the termite infestation pattern on the whole tree, we cut 108 blackboard trees,Alstonia scholaris(L.) R. Br., and 50 Japanese cedars,Cryptomeria japonica (L. f.) D. Don, into sections. The bark surface and cross sections of the tree trunk were examined along the axes. A high percentage of blackboard trees (92.6%) was infested by fungus-growing termites,Odontotermes formosanus(Shiraki), but damage was limited to the bark surface at a 2-m height. The infestation rate of dampwood termites,Neotermes koshunensis(Shiraki), was only 4.6% (5/108), and all infestations were associated with trunk wounds.N. koshunensiswas found at significantly higher portion of a tree thanO. formosanus Among 50 Japanese cedars, 20 living trees were not infested by any termites, but 26 of the 30 dead trees were infested by subterranean termites,Reticulitermes flaviceps(Oshima), which excavated tunnels in the trunk. The infestation rate at basal sections was higher than that at distal sections. Only one Japanese cedar tree was infested by another dampwood termite,Glyptotermes satsumensis(Matsumura). The two dominant termite species,O. formosanusandR. flaviceps, had subterranean nests and infested trees from bottom up. The two primitive termitesN. koshunensis andG. satsumensishad low infestation rates and are most likely to infest trees by alates from top down. The niche segregation in trees of three termite families, Kalotermitidae, Rhinotermitidae, and Termitidae, was distinct. © The Authors 2016. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Tropidia rostrata (Diptera, Syrphidae, First Recorded Genus and Species in Korea

Directory of Open Access Journals (Sweden)

Suk, Sang-Wook

2014-07-01

Full Text Available We discovered a syrphid species, Tropidia rostrata Shiraki, 1930, for the first time in Korea. This is the first member of the genus Tropidia recorded in Korea. This species can be distinguished from other Palaearctic members of Tropidia by the combination of the following characteristics: lower facial margin strongly protrudes forward; apical 3/4 of hind femur black; and tergites 2 and 3 each with a pair large yellowish brown square spots (not reached hind margin. We here provide a detailed redescription supplemented by the color photographs of external structures including genitalia. We also discussed the status of primary types associated with this taxon.

Atmospheric versus biological sources of polycyclic aromatic hydrocarbons (PAHs) in a tropical rain forest environment

International Nuclear Information System (INIS)

Krauss, Martin; Wilcke, Wolfgang; Martius, Christopher; Bandeira, Adelmar G.; Garcia, Marcos V.B.; Amelung, Wulf

2005-01-01

To distinguish between pyrogenic and biological sources of PAHs in a tropical rain forest near Manaus, Brazil, we determined the concentrations of 21 PAHs in leaves, bark, twigs, and stem wood of forest trees, dead wood, mineral topsoil, litter layer, air, and Nasutitermes termite nest compartments. Naphthalene (NAPH) was the most abundant PAH with concentrations of 35 ng m -3 in air (>85% of the Σ21PAHs concentration), up to 1000 μg kg -1 in plants (>90%), 477 μg kg -1 in litter (>90%), 32 μg kg -1 in topsoil (>90%), and 160 μg kg -1 (>55%) in termite nests. In plants, the concentrations of PAHs in general decreased in the order leaves > bark > twigs > stem wood. The concentrations of most low-molecular weight PAHs in leaves and bark were near equilibrium with air, but those of NAPH were up to 50 times higher. Thus, the atmosphere seemed to be the major source of all PAHs in plants except for NAPH. Additionally, phenanthrene (PHEN) had elevated concentrations in bark and twigs of Vismia cayennensis trees (12-60 μg kg -1 ), which might have produced PHEN. In the mineral soil, perylene (PERY) was more abundant than in the litter layer, probably because of in situ biological production. Nasutitermes nests had the highest concentrations of most PAHs in exterior compartments (on average 8 and 15 μg kg -1 compared to -1 in interior parts) and high PERY concentrations in all compartments (12-86 μg kg -1 ), indicating an in situ production of PERY in the nests. Our results demonstrate that the deposition of pyrolytic PAHs from the atmosphere controls the concentrations of most PAHs. However, the occurrence of NAPH, PHEN, and PERY in plants, termite nests, and soils at elevated concentrations supports the assumption of their biological origin. - Evidence of non-pyrolytic, biogenic production of PAHs is provided

Using termite nests as a source of organic matter in agrosilvicultural production systems in Amazonia Uso de ninhos de cupin como fonte de matéria orgânica em sistemas de produção agrosilviculturais na Amazônia

Directory of Open Access Journals (Sweden)

L. S. Batalha

1995-08-01

Full Text Available The growth of two annual crops, okra (Abelmoschus escutentus and egg-plant (Solatium melongena and one perennial crop, andiroba (Carapa guianensis, a native forest tree of Amazonia under different treatments with organic manure derived from termite nest material of wood-feeding Nasutitermes species was tested (randomized block design. The use of 25-100 g of nest material gave no significant increase in okra productivity, and 25-200 g gave no significant response in andiroba. The combined use of NPK with 200 g of nest material gave a significant higher production in egg-plant (total number and total fresh weight of fruits when compared to the control (without fertilizer and to the treatment with NPK only.The results suggest the possibility to use termite nest material to enhance crop production in Amazonia, particularly in combination with low amounts of mineral fertilizer. Research lines for further investigations are outlined.Foi avaliado crescimento de duas espécies agriculturais anuais, quiabo (Abelmoschus esculentus e berinjela (Solatium melongena, e de uma espécie perene, andiroba (Carapa guianensis, uma árvore nativa da Amazônia sob diferentes tratamentos com matéria orgânica derivada de material de cupinzeiro de espécies xilófagas de Nasutitermes (desenho de bloco randomizado. O uso de 25-100 g de material de termiteiro não levou a um incremento significativo da produtividade em quiabo, e 25-200 g não resultou numa resposta significativa em andiroba. O uso combinado de NPK com 200 g de ninho de cupim resultou numa produção significantemente maior em S. melongena (número total e peso fresco total de frutos se comparado com o controle (sem fertilizante nenhum e com o tratamento de NPK apenas. Os resultados sugerem a possibilidade de usar material de cupinzeiro para melhorara produção agrossilvicultural na Amazônia, especialmente em combinação com pequenas quantidades de fertilizante mineral Linhas de pesquisa para futuras

Development of biological coal gasification (MicGAS process). Final report, May 1, 1990--May 31, 1995

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-12-31

ARCTECH has developed a novel process (MicGAS) for direct, anaerobic biomethanation of coals. Biomethanation potential of coals of different ranks (Anthracite, bitumious, sub-bitumious, and lignites of different types), by various microbial consortia, was investigated. Studies on biogasification of Texas Lignite (TxL) were conducted with a proprietary microbial consortium, Mic-1, isolated from hind guts of soil eating termites (Zootermopsis and Nasutitermes sp.) and further improved at ARCTECH. Various microbial populations of the Mic-1 consortium carry out the multi-step MicGAS Process. First, the primary coal degraders, or hydrolytic microbes, degrade the coal to high molecular weight (MW) compounds. Then acedogens ferment the high MW compounds to low MW volatile fatty acids. The volatile fatty acids are converted to acetate by acetogens, and the methanogens complete the biomethanation by converting acetate and CO{sub 2} to methane.

Structural requirements for repellency: norsesquiterpenes and sesquiterpenoid derivatives of nootkatone against the Formosan subterranean termite (Isoptera: Rhinotermitidae).

Science.gov (United States)

Zhu, Betty C R; Henderson, Gregg; Sauer, Anne M; Crowe, William; Laine, Roger A

2010-08-01

Research has shown that the family of grapefruit flavors called nootkatones have significant repellant and toxic effects to Formosan subterranean termites (Coptotermes formosanus Shiraki). Nineteen synthetic nootkatone derivatives, along with three commercially available nootkatone derivatives, were tested for repellent activity against C. formosanus by a choice assay in a petri dish with a two-step triage procedure. Based on the repellency threshold value, the relationships between structure and activity are discussed. Four derivatives of nootkatone have very high repellency and toxicity to C. formosanus, 9 times the potency of the primary compound nootkatone. Four other compounds have between 2 and 3 times the repellency of nootkatones, and three compounds are equal in their repellency to nootkatone. Copyright (c) 2010 Society of Chemical Industry.

IMPACT OF TROPICAL RAIN FOREST CONVERSION ON THE DIVERSITY AND ABUNDANCE OF TERMITES IN JAMBI PROVINCE (Dampak Konversi Hutan Tropika Basah Terhadap Keragaman Jenis dan Kelimpahan Rayap di Provinsi Jambi

Directory of Open Access Journals (Sweden)

Suryo Hardiwinoto

2010-03-01

Full Text Available ABSTRACT The degradation of tropical rain forest might exert impacts on biodiversity loss and affect the function and stability of the ecosystems. The objective of this study was to clarify the impacts of tropical rain forests conversion into other land-uses on the diversity and abundance of termites in Jambi, Sumatera. Six land use types used in this study were primary forest, secondary forest, rubber plantation, oil-palm plantation, cassava cultivation and Imperata grassland. The result showed that a total of 30 termite species were found in the six land use types, with highest species richness and abundance in the forests. The species richness and the relative abundance of termites decreased significantly when the tropical rain forests were converted to rubber plantation and oil-palm plantation. The loss of species richness was much greater when the forests were changed to cassava cultivation and Imperata grassland, while their abundance greatly decreased when the forests were degraded to Imperata grassland. Termite species which had high relative abundances in primary and secondary forests were Dicuspiditermes nemorosus, Schedorhinotermes medioobscurus, Nasutitermes longinasus and Procapritermes setiger.   ABSTRAK  Kerusakan hutan tropika basah dapat menimbulkan dampak lingkungan berupa penurunan keanekaragaman hayati serta terganggunya fungsi dan stabilitas ekosistem. Tujuan dari penelitian ini adalah untuk mengetahui dampak konversi hutan tropika basah  menjadi bentuk penggunaan lahan lain di Jambi Sumatra terhadap keragaman jenis dan kelimpahan rayap. Enam tipe penggunaan lahan yang digunakan dalam penelitian ini adalah hutan primer, hutan sekunder, tanaman karet, tanaman kelapa sawit, kebun ketela pohon dan padang alang-alang. Hasil penelitian menunjukkan bahwa ditemukan 30 jenis rayap pada 6 tipe penggunaan lahan tersebut, dengan keragaman jenis dan kelimpahan individu rayap tertinggi pada lahan hutan. Kekayaan jenis dan kelimpahan

Structure-activity of valencenoid derivatives and their repellence to the Formosan subterranean termite.

Science.gov (United States)

Zhu, Betty C R; Henderson, Gregg; Sauer, Anne M; Yu, Ying; Crowe, William; Laine, Roger A

2003-12-01

Eight valencenoid derivatives were evaluated for their repelling activity against Formosan subterranean termites, Coptotermes formosanus Shiraki. Among them, 1,10-dihydronootkatone was the strongest repellent, and valencene was the weakest. Results of the structure-repellency relationships indicated (1) reduction of the ketone group to the alcohol on position 2 of nootkatone curtailed the activity; (2) because of the low activity of valencene relative to nootkatone that the ketone group was essential for repellent activity; (3) reduction of the 1,10 double bond (1,10-dihydronootkatone and tetrahydronootkatone) produced compounds more repellent than nootkatone; (4) the isopropenyl group probably does not participate in binding as evidenced by no significant difference in the repellent activity among nootkatone (double bond between position 11 and 12), isonootkatone (double bond between position 7 and 11), and 11,12-dihydronootkatone.

A Taxonomic Review of the Sword-tailed Cricket Subfamily Trigonidiinae (Orthoptera: Ensifera: Gryllidae from Korea

Directory of Open Access Journals (Sweden)

Tae-Woo Kim

2013-01-01

Full Text Available The Korean population of the sword-tailed cricket subfamily Trigonidiinae is reviewed for the first time. Four members of the crickets are confirmed based on the examined material, those are Metioche japonica (Ichikawa, 2001, Svistella bifasciata (Shiraki, 1911, Homoeoxipha obliterata (Caudell, 1927 and Natula matsuurai Sugimoto, 2001, each of them belonging to a different genera. Among them, the former two are reconfirmed since earlier records, and latter two are newly recognized genera and species from the far southern provinces Jeollanam-do and Jeju-do Island in Korea. The type locality of both crickets is Japan, and are also only previously referred to in Japan, but their distributional ranges include neighboring South Korea. A key to the species, descriptions, photographs, figures, and oscillograms of male’s calling sounds are provided to aid their identification.

Selection of arboreal termitaria for nesting by cooperatively breeding Micronesian Kingfishers Todiramphus cinnamominus reichenbachii

Science.gov (United States)

Kesler, Dylan C.; Haig, Susan M.

2005-01-01

Limited nest-site availability appears to be an important factor in the evolution of delayed dispersal and cooperative breeding in some cavity-nesting species. The cooperatively breeding Pohnpei subspecies of Micronesian Kingfisher Todiramphus cinnamominus reichenbachii excavates nest cavities from the nests of arboreal termites Nasutitermes spp., or termitaria. In this first published description of nest-sites for this subspecies, we used surveys, remote sensing and radiotelemetry to evaluate the relationship between nest-site availability and co-operation. Results illustrate that nest termitaria are higher in the forest canopy, larger in volume and occur in areas with more contiguous canopy cover than unused termitaria. Nest termitaria were selected independently of the proximity to forest edges and territory boundaries, and we found no difference in characteristics of termitaria used by cooperative groups and breeding pairs. Logistic regression modelling indicated that termitaria with nest-like characteristics were not limited in abundance, suggesting that neither the prospects of inheriting nesting resources nor limited nest-site abundance are probable explanations for delayed dispersal in the Pohnpei subspecies of Micronesian Kingfisher.

First forensic records of termite activity on non-fossilized human bones in Brazil

Directory of Open Access Journals (Sweden)

R. A. Queiroz

Full Text Available Abstract The aim of this study was to describe the first records of termite activity on non-fossilized human bones in Brazil. The cases reported in this study resulted from forensic analysis of six human skeletons found in northeastern Brazil between 2012 and 2014. Traces of tunnels and nests commonly produced by termites were found on several human bone surfaces as well as the specimens and characteristic signs of osteophagic activity. In four cases, the species were identified: Amitermes amifer Silvestri, 1901, Nasutitermes corniger (Motschulsky, 1855 (on two skeletons, and Microcerotermes indistinctus Mathews, 1977. In two other cases, the activity of termites on bone surfaces was evidenced by remains of nests and tunnels produced by these insects. At least in the samples of human remains available for this report, the number of termites collected was greater on bones found during autumn, the rainy season in the Northeast of Brazil. The human bones examined showed termites like insects with lots of strength at bone degradation, capable of continuing the process of decomposition of human remains even in completely skeletonized bodies.

Influence of the diet components on the symbiotic microorganisms community in hindgut of Coptotermes formosanus Shiraki.

Science.gov (United States)

Tanaka, Hideo; Aoyagi, Hideki; Shiina, Shunsuke; Shina, Syunsuke; Doudou, Yuri; Dodo, Yuri; Yoshimura, Tsuyoshi; Nakamura, Ryosuke; Uchiyama, Hiroo

2006-08-01

Artificial diet was developed for rearing of lower termites (workers) Coptotermes formosanus. C. formosanus was fed with either wood powder of Japanese red pine, cellulose, cellobiose, or glucose for 30 days. The effect of carbon sources in the diet on the structure and function of the symbiotic intestinal microbial community and on the physiological activity of C. formosanus was studied. Three symbiont protozoa, Pseudotrichonympha grassi, Holomastigotoides hartmanni, and Spirotrichonympha leidyi, were found in the hindgut of C. formosanus that fed on the diets containing carbon sources with high molecular weight (MW). However, when artificial diets containing carbohydrate with low MW were used, both P. grassi and H. hartmanni disappeared, and only few S. leidyi were alive. This suggested that both P. grassi and H. hartmanni play important roles in the digestion and utilization of carbohydrate with high MW. The denaturing gradient gel electrophoresis analysis of bacterial community in the hindgut of termites showed that the similarity between intestinal bacteria community in termites fed with diets containing high-MW carbon sources and those with low MW was only about 40%. It was apparent that changes in diets resulted to changes in intestinal microbial community, and this in turn affected cellulase activity in C. formosanus.

Cupins de duas florestas de restinga do nordeste brasileiro Termites from two restinga forests of Northeastern Brazil

Directory of Open Access Journals (Sweden)

Alexandre Vasconcellos

Full Text Available A estrutura da comunidade de cupins foi avaliada em duas florestas de restinga localizadas nos municípios de Mataraca e Cabedelo, Estado da Paraíba. Um protocolo padronizado de amostragem foi aplicado em cada área. Vinte e cinco espécies foram encontradas, sendo 19 em Mataraca e 15 em Cabedelo, com 9 espécies comuns às duas localidades. As espécies de Nasutitermitinae e as do grupo dos comedores de madeira foram dominantes em ambas as áreas. A baixa riqueza de espécies, em comparação com outros ecossistemas do Nordeste, e a baixa freqüência de encontros de humívoros e da subfamília Apicotermitinae podem estar relacionadas com as propriedades do solo das restingas. As espécies construtoras de ninhos conspícuos (todos arborícolas foram Armitermes holmgreni Snyder, 1926, Microcerotermes exiguus (Hagen, 1858, M. strunckii (Sörensen, 1884, Nasutitermes corniger (Motschulsky, 1855, N. ephratae (Holmgren, 1910, e N. macrocephalus (Silvestri, 1903. A fauna mostrou-se composta por espécies características de outras formações vegetais, principalmente Mata Atlântica e Cerrado, neste caso estando de acordo com o padrão geral de distribuição estabelecido pelas comunidades vegetais e pela fauna de vertebrados estudados em outras restingas brasileiras.The structure of termite communities was evaluated at two restinga forests (a characteristic type of vegetation occurring on nutrient-poor sandy soils along the Brazilian coastline, located in the municipalities of Mataraca and Cabedelo, State of Paraíba. A standardised sampling protocol was used in both sites. Twenty-five species were found, 19 of them at Mataraca and 15 at Cabedelo, with just 9 species in common to both sites. Species of Nasutitermitinae and wood-feeding groups were dominant at both study sites. The low species richness and frequency of humus-feeders species, and species of the subfamily Apicotermitinae as well, seem to be related to the restinga soil properties. The

Frequência e riqueza de cupins em áreas de plantio de eucalipto no litoral norte da Bahia

Directory of Open Access Journals (Sweden)

Maria José Dias Sales

2010-12-01

Full Text Available O objetivo deste trabalho foi avaliar a frequência e a riqueza de espécies de cupins que ocorrem em áreas de reflorestamento com eucalipto. As amostras foram coletadas em três áreas de Eucalyptus recém-colhido, em dezembro de 2005, por meio de seis transectos de 100 m de comprimento por 2-m de largura, subdivididos em 20 parcelas (2x5 m contíguas. Cada parcela foi amostrada por uma hora por pessoa, e de cada subdivisão foram retiradas 12 amostras de 20x20x20 cm de profundidade, das quais foram coletadas 21-espécies de cupins, pertencentes a duas famílias e 16 gêneros. Dez espécies foram consideradas dominantes, todas da família Termitidae, das quais as de maior frequência foram Amitermes amifer e Nasutitermes corniger. O grupo funcional xilófago teve o maior número de espécies (11 e a maior frequência. Espécies conhecidas como pragas em eucalipto tiveram frequência abaixo do limite de dominância

Clay preference and particle transport behavior of Formosan subterranean termites (Isoptera: Rhinotermitidae): a laboratory study.

Science.gov (United States)

Wang, Cai; Henderson, Gregg

2014-12-01

Although preference and utilization of clay have been studied in many higher termites, little attention has been paid to lower termites, especially subterranean termites. The Formosan subterranean termite, Coptotermes formosanus Shiraki, can modify its habitat by using clay to fill tree cavities. Here, the biological significance of clay on C. formosanus was investigated. Choice tests showed that significantly more termites aggregated in chambers where clay blocks were provided, regardless of colony group, observation period, or nutritional condition (fed or starved). No-choice tests showed that clay had no observable effect on survivorship, live or dry biomass, water content, and tunneling activity after 33-35 d. However, clay appeared to significantly decrease filter paper consumption (dry weight loss). Active particle (sand, paper, and clay) transport behavior was observed in both choice and no-choice tests. When present, clay was preferentially spread on the substrate, attached to the smooth surfaces of the containers, and used to line sand tunnels. Mechanisms and potential application of clay attraction are discussed. © 2013 Institute of Zoology, Chinese Academy of Sciences.

Differentially expressed genes of Coptotermes formosanus (Isoptera: Rhinotermitidae) challenged by chemical insecticides.

Science.gov (United States)

Zhang, Yi; Zhao, Yuanyuan; Qiu, Xuehong; Han, Richou

2013-08-01

Coptotermes formosanus Shiraki (Isoptera: Rhinotermitidae) termites are harmful social insects to wood constructions. The current control methods heavily depend on the chemical insecticides with increasing resistance. Analysis of the differentially expressed genes mediated by chemical insecticides will contribute to the understanding of the termite resistance to chemicals and to the establishment of alternative control measures. In the present article, a full-length cDNA library was constructed from the termites induced by a mixture of commonly used insecticides (0.01% sulfluramid and 0.01% triflumuron) for 24 h, by using the RNA ligase-mediated Rapid Amplification cDNA End method. Fifty-eight differentially expressed clones were obtained by polymerase chain reaction and confirmed by dot-blot hybridization. Forty-six known sequences were obtained, which clustered into 33 unique sequences grouped in 6 contigs and 27 singlets. Sixty-seven percent (22) of the sequences had counterpart genes from other organisms, whereas 33% (11) were undescribed. A Gene Ontology analysis classified 33 unique sequences into different functional categories. In general, most of the differential expression genes were involved in binding and catalytic activity.

Genetically Engineered Yeast Expressing a Lytic Peptide from Bee Venom (Melittin) Kills Symbiotic Protozoa in the Gut of Formosan Subterranean Termites.

Science.gov (United States)

Husseneder, Claudia; Donaldson, Jennifer R; Foil, Lane D

2016-01-01

The Formosan subterranean termite, Coptotermes formosanus Shiraki, is a costly invasive urban pest in warm and humid regions around the world. Feeding workers of the Formosan subterranean termite genetically engineered yeast strains that express synthetic protozoacidal lytic peptides has been shown to kill the cellulose digesting termite gut protozoa, which results in death of the termite colony. In this study, we tested if Melittin, a natural lytic peptide from bee venom, could be delivered into the termite gut via genetically engineered yeast and if the expressed Melittin killed termites via lysis of symbiotic protozoa in the gut of termite workers and/or destruction of the gut tissue itself. Melittin expressing yeast did kill protozoa in the termite gut within 56 days of exposure. The expressed Melittin weakened the gut but did not add a synergistic effect to the protozoacidal action by gut necrosis. While Melittin could be applied for termite control via killing the cellulose-digesting protozoa in the termite gut, it is unlikely to be useful as a standalone product to control insects that do not rely on symbiotic protozoa for survival.

Determining the Number of Instars in Simulium quinquestriatum (Diptera: Simuliidae) Using k-Means Clustering via the Canberra Distance.

Science.gov (United States)

Yang, Yao Ming; Jia, Ruo; Xun, Hui; Yang, Jie; Chen, Qiang; Zeng, Xiang Guang; Yang, Ming

2018-02-21

Simulium quinquestriatum Shiraki (Diptera: Simuliidae), a human-biting fly that is distributed widely across Asia, is a vector for multiple pathogens. However, the larval development of this species is poorly understood. In this study, we determined the number of instars in this pest using three batches of field-collected larvae from Guiyang, Guizhou, China. The postgenal length, head capsule width, mandibular phragma length, and body length of 773 individuals were measured, and k-means clustering was used for instar grouping. Four distance measures-Manhattan, Euclidean, Chebyshev, and Canberra-were determined. The reported instar numbers, ranging from 4 to 11, were set as initial cluster centers for k-means clustering. The Canberra distance yielded reliable instar grouping, which was consistent with the first instar, as characterized by egg bursters and prepupae with dark histoblasts. Females and males of the last cluster of larvae were identified using Feulgen-stained gonads. Morphometric differences between the two sexes were not significant. Validation was performed using the Brooks-Dyar and Crosby rules, revealing that the larval stage of S. quinquestriatum is composed of eight instars.

Termite Resistance of MDF Panels Treated with Various Boron Compounds

Directory of Open Access Journals (Sweden)

Sedat Ondaral

2009-06-01

Full Text Available In this study, the effects of various boron compounds on the termite resistance of MDF panels were evaluated. Either borax (BX, boric acid (BA, zinc borate (ZB, or sodium perborate tetrahydrate (SPT were added to urea-formaldehyde (UF resin at target contents of 1%, 1.5%, 2% and 2.5% based on dry fiber weight. The panels were then manufactured using 12% urea-formaldehyde resin and 1% NH4Cl. MDF samples from the panels were tested against the subterranean termites, Coptotermes formosanus Shiraki. Laboratory termite resistance tests showed that all samples containing boron compounds had greater resistance against termite attack compared to untreated MDF samples. At the second and third weeks of exposure, nearly 100% termite mortalities were recorded in all boron compound treated samples. The highest termite mortalities were determined in the samples with either BA or BX. Also, it was found that SPT showed notable performance on the termite mortality. As chemical loadings increased, termite mortalities increased, and at the same time the weight losses of the samples decreased.

Termite feeding preference to four wood species after gamma irradiation

International Nuclear Information System (INIS)

Katsumata, N.; Yoshimura, T.; Tsunoda, K.; Imamura, Y.

2007-01-01

The effect of gamma irradiation at 100 kGy and at lower levels on termite resistance was examined in the laboratory by no-choice and choice feeding termite tests (Coptotermes formosanus Shiraki) using four wood species: sapwood of Cryptomeria japonica D. Don, and heartwoods of Pseudotsuga menziesii (Mirbel) Franco, Larix kaempferi (Lambert) Carriere, and Chamaecyparis obtusa Endl. The wood consumption rates in C. japonica and P. menziesii specimens were likely to increase with increases in gamma-irradiation levels, whereas little effect of gamma irradiation was seen in L. kaempferi and C. obtusa. Similar results were obtained in the two-choice test. The current results indicated that in the two-choice test with C. formosanus, 100-kGy-irradiated C. japonica and P. menziesii, which are not rich in antitermite substances, were eaten more than other wood samples with or without gamma irradiation. However, only C. japonica showed significant difference in termite feeding activity. The mass loss in 100-kGy-irradiated C. japonica was significantly higher in the multichoice test

Comparative analysis of carbohydrate active enzymes in Clostridium termitidis CT1112 reveals complex carbohydrate degradation ability.

Directory of Open Access Journals (Sweden)

Riffat I Munir

Full Text Available Clostridium termitidis strain CT1112 is an anaerobic, gram positive, mesophilic, cellulolytic bacillus isolated from the gut of the wood-feeding termite, Nasutitermes lujae. It produces biofuels such as hydrogen and ethanol from cellulose, cellobiose, xylan, xylose, glucose, and other sugars, and therefore could be used for biofuel production from biomass through consolidated bioprocessing. The first step in the production of biofuel from biomass by microorganisms is the hydrolysis of complex carbohydrates present in biomass. This is achieved through the presence of a repertoire of secreted or complexed carbohydrate active enzymes (CAZymes, sometimes organized in an extracellular organelle called cellulosome. To assess the ability and understand the mechanism of polysaccharide hydrolysis in C. termitidis, the recently sequenced strain CT1112 of C. termitidis was analyzed for both CAZymes and cellulosomal components, and compared to other cellulolytic bacteria. A total of 355 CAZyme sequences were identified in C. termitidis, significantly higher than other Clostridial species. Of these, high numbers of glycoside hydrolases (199 and carbohydrate binding modules (95 were identified. The presence of a variety of CAZymes involved with polysaccharide utilization/degradation ability suggests hydrolysis potential for a wide range of polysaccharides. In addition, dockerin-bearing enzymes, cohesion domains and a cellulosomal gene cluster were identified, indicating the presence of potential cellulosome assembly.

NATURAL RESISTANCE OF SEVEN WOODS TO XYLOPHOGOUS FUNGI AND TERMITES UNDER LABORATORY CONDITION

Directory of Open Access Journals (Sweden)

Juarez Benigno Paes

2007-06-01

Full Text Available This research aimed at evaluating the natural resistance of seven woods to xylophogous fungi and subterranean termites under laboratory assay. The studied woods were Leucaena leucocephala, Cordia trichotoma, Mimosa tenuiflora, Croton sonderianus, Mimosa caesalpiniifolia, Azadirachta indica and Tectona grandis. Test samples measuring 2.54 x 2.00 x 1.00 cm (fungi and 2.54 x 2.00 x 0.64 cm (termites, with larger dimensions in fiber direction were obtained in four positions in pith-to-bark direction. The samples were submitted by 98 days to action of Postia placenta and Polyporus fumosus fungi or 28 days to the termite Nasutitermes corniger action. To fungi, the Mimosa tenuiflora and Mimosa caesalpiniifolia woods were the more resistant and those of Azadirachta indica and Croton sonderianus the less resistant. The fungus Postia placenta attacked more severely the tested woods. To termites, the Mimosa tenuiflora, Cordia trichotoma, and Mimosa caesalpiniifolia were the most resistant and the Leucaena leucocephala the less resistant. The coming wood of external section of log were the more attacked. To fungi, there was an inverse relationship between the density and the loss of mass. Already for the termites, there was not relationship between the resistance and the density of the wood.

Microclimate and nest-site selection in Micronesian Kingfishers

Science.gov (United States)

Kesler, Dylan C.; Haig, Susan M.

2005-01-01

We studied the relationship between microclimate and nest-site selection in the Pohnpei Micronesian Kingfisher (Todiramphus cinnamominus reichenbachii) which excavates nest cavities from the mudlike nest structures of arboreal termites (Nasutitermes sp.) or termitaria. Mean daily high temperatures at termitaria were cooler and daily low temperatures were warmer than at random sites in the forest. Results also indicate that termitaria provided insulation from temperature extremes, and that temperatures inside termitaria were within the thermoneutral zone of Micronesian Kingfishers more often than those outside. No differences were identified in temperatures at sites where nest termitaria and nonnest termitaria occurred or among the insulation properties of used and unused termitaria. These results suggest that although termitaria provide insulation from thermal extremes and a metabolically less stressful microclimate, king-fishers did not select from among available termitaria based on their thermal properties. Our findings are relevant to conservation efforts for the critically endangered Guam Micronesian Kingfisher (T. c. cinnamominus) which is extinct in the wild and exists only as a captive population. Captive breeding facilities should provide aviaries with daily ambient temperatures ranging from 22.06 A?C to 28.05 A?C to reduce microclimate-associated metabolic stress and to replicate microclimates used by wild Micronesian Kingfishers.

Metagenomic and functional analysis of hindgut microbiota of a wood-feeding higher termite

Energy Technology Data Exchange (ETDEWEB)

Warnecke, Falk; Warnecke, Falk; Luginbuhl, Peter; Ivanova, Natalia; Ghassemian, Majid; Richardson, Toby H.; Stege, Justin T.; Cayouette, Michelle; McHardy, Alice C.; Djordjevic, Gordana; Aboushadi, Nahla; Sorek, Rotem; Tringe, Susannah G.; Podar, Mircea; Martin, Hector Garcia; Kunin, Victor; Dalevi, Daniel; Madejska, Julita; Kirton, Edward; Platt, Darren; Szeto, Ernest; Salamov, Asaf; Barry, Kerrie; Mikhailova, Natalia; Kyrpides, Nikos C.; Matson, Eric G.; Ottesen, Elizabeth A.; Zhang, Xinning; Hernandez, Myriam; Murillo, Catalina; Acosta, Luis G.; Rigoutsos, Isidore; Tamayo, Giselle; Green, Brian D.; Chang, Cathy; Rubin, Edward M.; Mathur, Eric J.; Robertson, Dan E.; Hugenholtz, Philip; Leadbetter, Jared R.

2007-10-01

From the standpoints of both basic research and biotechnology, there is considerable interest in reaching a clearer understanding of the diversity of biological mechanisms employed during lignocellulose degradation. Globally, termites are an extremely successful group of wood-degrading organisms and are therefore important both for their roles in carbon turnover in the environment and as potential sources of biochemical catalysts for efforts aimed at converting wood into biofuels. Only recently have data supported any direct role for the symbiotic bacteria in the gut of the termite in cellulose and xylan hydrolysis. Here we use a metagenomic analysis of the bacterial community resident in the hindgut paunch of a wood-feeding Nasutitermes species to show the presence of a large, diverse set of bacterial genes for cellulose and xylan hydrolysis. Many of these genes were expressed in vivo or had cellulase activity in vitro, and further analyses implicate spirochete and fibrobacter species in gut lignocellulose degradation. New insights into other important symbiotic functions including H{sub 2} metabolism, CO{sub 2}-reductive acetogenesis and N{sub 2} fixation are also provided by this first system-wide gene analysis of a microbial community specialized towards plant lignocellulose degradation. Our results underscore how complex even a 1-{micro}l environment can be.

Effects of extractives and ash on natural resistance of four woods to xylophogous termites

Directory of Open Access Journals (Sweden)

Juarez Benigno Paes

2013-09-01

Full Text Available This study tested the natural resistance of wood of four tree species to Nasutitermes corniger Motsch. xylophogous termite attack and correlate the resistance with the amount of extract and ash in the chemical composition of the tested species. The species evaluated were Anadenanthera colubrina (Vell. Brenan. var. cebil (Gris. Alts., Tabebuia aurea (Mart. Bureau., Amburana cearensis (Allem. A.C.Sm. and Eucalyptus camaldulensis Dehnh. Test samples with dimensions of 2.00 x 10.16 x 0.64 cm (radial x longitudinal x tangential were obtained at two positions (external heartwood and sapwood of each species. The samples were exposed to action of termites for 45 days in food preference assay. The content of wood extractives was obtained through the sawdust that went through sieve of 40 mesh and were retained in the 60 mesh. The natural resistance was not associated with wood extractive contents. The wood more resistant to termite attack was the Anadenanthera colubrina var. cebil in the two positions (external heartwood and sapwood and Eucalyptus camaldulensis wood presented the greatest wear. The biological resistance of wood was correlated with ash content, i.e., the species with the highest levels was the most resistant to termite attack.

Effects of modified penoplasty for concealed penis in children.

Science.gov (United States)

Chen, Chao; Li, Ning; Luo, Yi-Ge; Wang, Hong; Tang, Xian-Ming; Chen, Jia-Bo; Dong, Chun-Qiang; Liu, Qiang; Dong, Kun; Su, Cheng; Yang, Ti-Quan

2016-10-01

To evaluate the effect of modified penoplasty in the management of concealed penis. We retrospectively reviewed 96 consecutive patients with concealed penis, which had been surgically corrected between July 2013 and July 2015. All patients underwent modified Shiraki phalloplasty. All patients were scheduled for regular follow-up at 1, 3, and 6 months after the surgery. Data on the patients' age, operative time, postoperative complications, and parents' satisfaction grade were collected and analyzed. The mean follow-up period was 17.4 months (range 7-31 months). The mean operative time was 63.2 ± 8.7 min. The mean perpendicular penile length was 1.89 ± 0.77 cm preoperatively and 4.42 ± 0.87 cm postoperatively, with an improved mean length of 2.5 ± 0.68 cm in the flaccid state postoperatively (p penis can achieve maximum utilization of prepuce to assure coverage of the exposed penile shaft. It has fewer complications, achieving marked asthetics, and functional improvement. It is a relatively ideal means for treating concealed penis.

Laboratory Study of the Influence of Substrate Type and Temperature on the Exploratory Tunneling by Formosan Subterranean Termite

Directory of Open Access Journals (Sweden)

Bal K. Gautam

2012-06-01

Full Text Available Using two-dimensional foraging arenas, laboratory tests were conducted to investigate the effect of soil type, soil moisture level and ambient temperature on the exploratory tunneling by Coptotermes formosanus Shiraki. In choice arenas consisting of two substrate types having two moisture levels each, and conducted at a constant temperature of 22 °C, a significantly greater proportion of termites aggregated in sand than in sandy loam. Similarly, the length of excavated tunnels was also increased in sand. In a given substrate, termite aggregation or tunnel length did not differ between 5% and 15% moisture levels. In no-choice tests, where three different substrates (sand, sandy loam and silt loam were tested at two temperatures (22 °C and 28 °C, excavations were significantly greater in sand than either sandy loam or silt loam at 22 °C. Fewer primary tunnels were constructed in sandy loam than in sand and fewer branched tunnels than either in sand or silt loam. No significant difference in either tunnel length or number of primary or branched tunnels was found between these two temperatures.

Trace elements in termites by PIXE analysis

Energy Technology Data Exchange (ETDEWEB)

Yoshimura, T. E-mail: tsuyoshi@termite.kuwri.kyoto-u.ac.jp; Kagemori, N.; Kawai, S.; Sera, K.; Futatsugawa, S

2002-04-01

Trace elements in a Japanese subterranean xylophagous termite, Coptotermes formosanus Shiraki, were analyzed by the PIXE method. The total amount of the 14 predominant elements out of 27 detected in an intact termite was higher in a soldier termite (23 000 {mu}g/g) than in a worker termite (10 000 {mu}g/g). A block of wood (Pinus densiflora Sieb. et Zucc.) for termite feed had a much lower concentration (3600 {mu}g/g) compared with that in an intact termite. This probably relates the functional bio-condensation and/or bio-recycling of trace elements in C. formosanus. When a termite was separated into three anatomical parts, head, degutted body and gut, the worker gut contained the highest total amount of the 14 predominant measured elements (31 000 {mu}g/g). This might be correlated with the higher activity of food digestion and energy production in the worker gut. Moreover, the mandible of the soldier head, with an exoskeleton that is intensely hardened, showed a preferential distribution of Mn and Fe. These results suggest that the characteristic localization of elements will be closely related to the functional role of the individual anatomical part of C. formosanus.

The first report of gynandromorphy in termites (Isoptera; Kalotermitidae; Neotermes koshunensis)

Science.gov (United States)

Miyaguni, Yasushi; Nozaki, Tomonari; Yashiro, Toshihisa

2017-08-01

This is the first report of gynandromorphy in Isoptera. An Asian dry-wood termite, Neotermes koshunensis (Shiraki) [Kalotermitidae], possessing both male and female phenotypic characteristics, was found on Okinawa Island, Japan. This deformed individual showed morphological and anatomical hermaphroditism in the abdomen. The right side of the seventh sternite was the female form and contained an ovary, while the left side was the male form and contained a testis. Genotypic analysis revealed that this individual was a genotypic bilateral chimera. These results suggested that the termite was a bilateral gynandromorph with a male left side and a female right side. As reported previously in other insects, double fertilization (by two sperms, one with an X and one with a Y chromosome) of a binucleate egg is the most likely mechanism that generated this genotypic bilateral chimera. N. koshunensis has the ability to reproduce through parthenogenesis, in which the secondary polar body is likely to be used for nuclear phase recovery. If the second polar body in this mechanism has high fertility and healthy embryogenic potential, like an egg nucleus, some of gynandromorphs might be produced by a side effect of parthenogenetic ability.

RESISTÊNCIA DE DUAS ESPÉCIES DE BAMBU TRATADAS COM CCB CONTRA CUPINS E COLEÓPTEROS XILÓFAGOS

Directory of Open Access Journals (Sweden)

Rogy Frigeri Tiburtino

2015-01-01

Full Text Available ABSTRACTThe research aimed to evaluate the effectiveness of CCB preservative in improving the resistance of twobamboo species (Bambusa vulgarisandDendrocalamus giganteus the action of termites and xylophagousbeetles. The bamboo stems collected in the vicinity of Alegre and Jerônimo Monteiro, towns of southernEspírito Santo state, Brazil, were transformed into culms of 2.0 m long and treated in a solution of 1 or 3%active ingredient (a.i. of the commercial product “MOQ OX 50”, based on copper, chromium and boron (CCB.The treatment methods used were the sap displacement (intact and ruptured diaphragm, long-termimmersion and Boucherie modified. In the methods by sap displacement and the long-term immersion thestems were exposed in solutions for periods of 5, 10 or 15 days, and in Boucherie’s modified method oftreatment there was no segregation between treatment times. To assess the efficiency of the methods, testsamples were taken at the position of 50 cm from the base of the stems. In the tests, the termite speciesNasutitermes cornigerand the beetleDinoderus minutuswere used. Based on the analysis of the resultsobtained, it was found that the two species of bamboo treated showed high resistance to attack by termitesand beetles, and including untreated samples showed low mass loss when subjected to the tests.

Origin and alteration of organic matter in termite mounds from different feeding guilds of the Amazon rainforests.

Science.gov (United States)

Siebers, Nina; Martius, Christopher; Eckhardt, Kai-Uwe; Garcia, Marcos V B; Leinweber, Peter; Amelung, Wulf

2015-01-01

The impact of termites on nutrient cycling and tropical soil formation depends on their feeding habits and related material transformation. The identification of food sources, however, is difficult, because they are variable and changed by termite activity and nest construction. Here, we related the sources and alteration of organic matter in nests from seven different termite genera and feeding habits in the Terra Firme rainforests to the properties of potential food sources soil, wood, and microepiphytes. Chemical analyses comprised isotopic composition of C and N, cellulosic (CPS), non-cellulosic (NCPS), and N-containing saccharides, and molecular composition screening using pyrolysis-field ionization mass spectrometry (Py-FIMS). The isotopic analysis revealed higher soil δ13C (-27.4‰) and δ15N (6.6‰) values in nests of wood feeding Nasutitermes and Cornitermes than in wood samples (δ13C = -29.1‰, δ15N = 3.4‰), reflecting stable-isotope enrichment with organic matter alterations during or after nest construction. This result was confirmed by elevated NCPS:CPS ratios, indicating a preferential cellulose decomposition in the nests. High portions of muramic acid (MurAc) pointed to the participation of bacteria in the transformation processes. Non-metric multidimensional scaling (MDS) revealed increasing geophagy in the sequence Termes rainforest termites shows variations and evidence of modification by microbial processes, but nevertheless it primarily reflects the trophic niches of the constructors.

Predicting the geographical distribution of two invasive termite species from occurrence data.

Science.gov (United States)

Tonini, Francesco; Divino, Fabio; Lasinio, Giovanna Jona; Hochmair, Hartwig H; Scheffrahn, Rudolf H

2014-10-01

Predicting the potential habitat of species under both current and future climate change scenarios is crucial for monitoring invasive species and understanding a species' response to different environmental conditions. Frequently, the only data available on a species is the location of its occurrence (presence-only data). Using occurrence records only, two models were used to predict the geographical distribution of two destructive invasive termite species, Coptotermes gestroi (Wasmann) and Coptotermes formosanus Shiraki. The first model uses a Bayesian linear logistic regression approach adjusted for presence-only data while the second one is the widely used maximum entropy approach (Maxent). Results show that the predicted distributions of both C. gestroi and C. formosanus are strongly linked to urban development. The impact of future scenarios such as climate warming and population growth on the biotic distribution of both termite species was also assessed. Future climate warming seems to affect their projected probability of presence to a lesser extent than population growth. The Bayesian logistic approach outperformed Maxent consistently in all models according to evaluation criteria such as model sensitivity and ecological realism. The importance of further studies for an explicit treatment of residual spatial autocorrelation and a more comprehensive comparison between both statistical approaches is suggested.

Toxicity and behavioral effects of nootkatone, 1,10-dihydronootkatone, and tetrahydronootkatone to the formosan subterranean termite (Isoptera: Rhinotermitidae).

Science.gov (United States)

Ibrahim, Sanaa A; Henderson, Gregg; Zhu, Betty C R; Fei, Huixin; Laine, Roger A

2004-02-01

Toxicity and behavioral effects of nootkatone and two of its derivatives, 1,10-dihydronootkatone and tetrahydronootkatone, to Coptotermes formosanus Shiraki were investigated on workers from two different colonies by using topical application assays, repellency assays, and sand barrier assays. The acute toxicity of the nootkatones on workers from both colonies increased as the saturation of the molecule increased, but the difference was significant for only one colony. The results of the repellency assays showed a similar trend of efficiency; the threshold concentration for significant repellency was four-fold higher in nootkatone treatments (50 ppm) than in the reduced derivatives 1,10-dihydronootkatone or tetrahydronootkatone (12.5 ppm). In sand barrier assays, a concentration of 100 ppm of any of the three chemicals significantly reduced termite survival, tunnel building, and food consumption after a 12-d exposure. Termites preexposed to 100 ppm nootkatone-treated sand and placed in containers without nootkatone for 15 d continued to exhibit abnormal feeding and digging behaviors; survivorship, tunneling, and feeding activities were significantly reduced by 83.5, 63.2, and 95.4%, respectively. Termites pretreated for 12 d at concentrations of 50 and 75 ppm nootkatone and tetrahydronootkatone returned to normal digging activity after they were removed from the treatments, but their feeding activity was significantly reduced.

Outline of nuclear power plant project of fast breeder reactor (FBR) 'Monju'

International Nuclear Information System (INIS)

Suzuki, Fumio; Higashide, Noboru

1982-01-01

The first step of the construction of the fast breeder prototype reactor ''Monju'' in Japan was taken by the declaration of agreement of Fukui Prefecture governor in May, 1982, and the succeeding approval by the cabinet council. In this paper, the outline of the project is described. The paper first introduces the development status of FBRs in the world, and next, describes the progress of planning the ''Monju'' project. Initially, ''Monju'' was invited by Shiraki region of Tsuruga City, but the move of village was not agreed. Thus, the center of the site was moved to ''Haseda'' about 1 km north-east. In addition, there were some limitations, and the layout of the facility and the design of public work structures including harbour construction were done under many limiting conditions. However, the site is rather in good conditions, and the design rationalization was attempted as far as possible within a range which does not affect the safety of the nuclear power plant. The outline of the examination related to public works and the siting conditions are reported, dividing them into topographic features, geology, meteorology, sea conditions, and natural environment. As the public works plan, site preparation, roads, harbour installations and water intake and discharge facility are also described. (Wakatsuki, Y.)

Termites community as environmental bioindicators in highlands: a case study in eastern slopes of Mount Slamet, Central Java

Directory of Open Access Journals (Sweden)

IDHAM SAKTI HARAHAP

2011-10-01

Full Text Available Pribadi T,Raffiudin R,HarahapIS (2011Termites community as environmental bioindicators in highlands: a case study in eastern slopes of Mount Slamet, Central Java. Biodiversitas 12: 235-240. Termites ecological behaviour is much affected by land use change and disturbance level. Their variation in diversity can be used as bioindicator of environmental quality. However, termite community response to land use changes and habitat disturbance in highland ecosystems remains poorly understood. This study was conducted to investigate the response of termite community to land use intensification and to explore their role as environmental bioindicator in Mount Slamet. A standard survey protocol was used to collect termites in five land use typesof various disturbance levels,i.e. protected forest, recreation forest, production forest,agroforestry, and urban area. It was found two termite families i.e. Rhinotermitidae and Termitidae with seven species, i.e Schedorhinotermes javanicus, Procapritermes sp, Pericapritermes semarangi, Macrotermes gilvus, Microtermes insperatus, Nasutitermes javanicus, and N. matanganensis. Termite species’ richness and evenness, Shannon-Wiener index, relative abundance, and biomass of termite were declined along with the land use types and disturbance level from protected forest to urban area. Habitat disturbance was the main declining factor of termite diversity. Termite composition changed along with the land use disturbance level. Soil feeding termites were sensitive to the disturbance – they were not found in urban area. Hence, their presence or absence can be used as environmental bioindicator to detect habitat disturbance.

Origin and Alteration of Organic Matter in Termite Mounds from Different Feeding Guilds of the Amazon Rainforests

Science.gov (United States)

Siebers, Nina; Martius, Christopher; Eckhardt, Kai-Uwe; Garcia, Marcos V. B.; Leinweber, Peter; Amelung, Wulf

2015-01-01

The impact of termites on nutrient cycling and tropical soil formation depends on their feeding habits and related material transformation. The identification of food sources, however, is difficult, because they are variable and changed by termite activity and nest construction. Here, we related the sources and alteration of organic matter in nests from seven different termite genera and feeding habits in the Terra Firme rainforests to the properties of potential food sources soil, wood, and microepiphytes. Chemical analyses comprised isotopic composition of C and N, cellulosic (CPS), non-cellulosic (NCPS), and N-containing saccharides, and molecular composition screening using pyrolysis-field ionization mass spectrometry (Py-FIMS). The isotopic analysis revealed higher soil δ13C (-27.4‰) and δ15N (6.6‰) values in nests of wood feeding Nasutitermes and Cornitermes than in wood samples (δ13C = -29.1‰, δ15N = 3.4‰), reflecting stable-isotope enrichment with organic matter alterations during or after nest construction. This result was confirmed by elevated NCPS:CPS ratios, indicating a preferential cellulose decomposition in the nests. High portions of muramic acid (MurAc) pointed to the participation of bacteria in the transformation processes. Non-metric multidimensional scaling (NMDS) revealed increasing geophagy in the sequence Termes termites shows variations and evidence of modification by microbial processes, but nevertheless it primarily reflects the trophic niches of the constructors. PMID:25909987

Metagenomic insights into metabolic capacities of the gut microbiota in a fungus-cultivating termite (Odontotermes yunnanensis.

Directory of Open Access Journals (Sweden)

Ning Liu

Full Text Available Macrotermitinae (fungus-cultivating termites are major decomposers in tropical and subtropical areas of Asia and Africa. They have specifically evolved mutualistic associations with both a Termitomyces fungi on the nest and a gut microbiota, providing a model system for probing host-microbe interactions. Yet the symbiotic roles of gut microbes residing in its major feeding caste remain largely undefined. Here, by pyrosequencing the whole gut metagenome of adult workers of a fungus-cultivating termite (Odontotermes yunnanensis, we showed that it did harbor a broad set of genes or gene modules encoding carbohydrate-active enzymes (CAZymes relevant to plant fiber degradation, particularly debranching enzymes and oligosaccharide-processing enzymes. Besides, it also contained a considerable number of genes encoding chitinases and glycoprotein oligosaccharide-processing enzymes for fungal cell wall degradation. To investigate the metabolic divergence of higher termites of different feeding guilds, a SEED subsystem-based gene-centric comparative analysis of the data with that of a previously sequenced wood-feeding Nasutitermes hindgut microbiome was also attempted, revealing that SEED classifications of nitrogen metabolism, and motility and chemotaxis were significantly overrepresented in the wood-feeder hindgut metagenome, while Bacteroidales conjugative transposons and subsystems related to central aromatic compounds metabolism were apparently overrepresented here. This work fills up our gaps in understanding the functional capacities of fungus-cultivating termite gut microbiota, especially their roles in the symbiotic digestion of lignocelluloses and utilization of fungal biomass, both of which greatly add to existing understandings of this peculiar symbiosis.

Resistência natural da madeira de Corymbia maculata (Hook. K.D.Hill & L.A.S. Johnson a fungos e cupins xilófagos, em condições de laboratório Wood natural resistance of Corymbia maculata (Hook. K.D.Hill & L.A.S Johnson to wood destroying fungi and termites, under laboratory tests

Directory of Open Access Journals (Sweden)

Juarez Benigno Paes

2002-11-01

Full Text Available A pesquisa teve o objetivo de avaliar a resistência natural da madeira de Corymbia maculata a fungos e a cupins xilófagos, em condições de laboratório. De peças radiais (tábuas que continham o cerne e o alburno intactos foram retirados corpos-de-prova de 2,00 x 2,00 x 1,00 cm, com a menor dimensão na direção tangencial (ensaio com fungos, e de 2,54 x 2,00 x 0,64 cm, com a maior dimensão na direção das fibras (ensaio com cupins, em quatro posições na direção medula-casca. As amostras foram submetidas à ação dos fungos Postia placenta, Neolentinus lepideus e Polyporus fumosus por 12 semanas, ou à ação de cupins do gênero Nasutitermes por 30 dias. Constatou-se que a resistência da madeira ao apodrecimento foi dependente da posição na direção medula-casca e dos fungos utilizados. As amostras retiradas nas posições mais externas do tronco foram mais deterioradas que as internas. Dentro de cada posição, os fungos causaram deterioração semelhante à madeira, exceto para a posição mais externa (alburno, em que o fungo P. fumosus causou menos deterioração que os demais. De modo geral, a madeira de C. maculata foi altamente resistente (posições internas ou resistente (posições externas aos fungos ensaiados. Somente para o fungo N. lepideus a posição mais externa foi moderadamente resistente. Quanto aos cupins, a resistência da madeira não foi afetada pela posição na direção medula-casca e apresentou uma baixa perda de massa para as posições analisadas. Além disto, os cupins causaram somente desgaste superficial à madeira, e morreram durante o ensaio, o que permitiu classificar a madeira de C.maculata como resistente aos cupins ensaiados.This research evaluated the natural resistance of Corymbia maculata wood to wood-destroying fungi and termites, under laboratory tests. Radial pieces (boards, containing intact heartwood and sapwood were transformed into test samples measuring 2.00 x 2.00 x 1.00 cm

Seasonal Changes in the Caste Distribution of Foraging Populations of Formosan Subterranean Termite in New Orleans, Louisiana.

Science.gov (United States)

Cornelius, Mary L; Osbrink, Weste L A; Gallatin, Erin M

2015-01-01

This study examined the relationship between temperature, precipitation, soil composition, levels of feeding damage, and the caste distribution (workers, soldiers, nymphs) of the Formosan subterranean termite, Coptotermes formosanus Shiraki, collected in underground monitoring stations over a 12 mo period. Because nymphs are the caste that develops into alates, the seasonal abundance of nymphs was examined over a 5 yr period. Numbers of workers, soldiers, and soldier/worker ratio were significantly affected by month. Recruitment and retention of foraging termites in stations was significantly affected by the level of feeding damage. The number of nymphs collected in monitoring stations was highly variable. In the 12 mo test, there was a significant correlation between numbers of nymphs and level of feeding damage, temperature, precipitation, and soil composition. Over a 5 yr period, significantly more nymphs were collected in 2011 than in 2007 and 2008. Peak nymph collections varied from year to year. Overall, peak nymph collections were more likely to occur in Mar., Sept., and Oct. Increasing our knowledge of the environmental factors that influence recruitment and retention of foraging termites in monitoring stations could influence termite bait placement and improve baiting strategies for termite control. Identifying the key factors that cause aggregations of nymphs in underground stations could increase our ability to predict the intensity and location of alate swarms. © Crown copyright 2015.

Potential of kaolin-based particle film barriers for Formosan subterranean termite (Isoptera: Rhinotermitidae) control

Science.gov (United States)

Wiltz, B.A.; Woodson, W.D.; Puterka, G.J.

2010-01-01

Effects of three particle film products on Formosan subterranean termites, Coptotermes formosanus Shiraki, were evaluated in feeding, tunneling, and contact assays. The particle films, hydrophobic M96-018 and hydrophilic Surround and Surround WP are based on the inert clay mineral kaolin. In 2-week long no-choice feeding tests, significant mortality occurred only with M96-018-coated wood. When a choice was provided, M96-018 and Surround were consumed at higher rates than untreated wood. Surround WP did not differ from controls in either test. In the tunneling assay termites were given the option of crossing a kaolin-sand mixture to reach an alternate food source. After 3-weeks, rates of 1% and 5% M96-018 provided an effective barrier to Formosan termite tunneling, while termites were not stopped by rates as high as 20% Surround and Surround WP. Dust treatments of all three formulations caused significant increases in mortality within 24 h, with mortality rates ranging from 72.0 - 97.3% within 72 h of treatment. The particle films were most effective when moisture levels were low, suggesting that desiccation was the mechanism for mortality. All particle films showed potential for use in above ground applications while hydrophobic M06-018 has the most potential as a soil barrier to subterranean termites.

Escaping and repairing behaviors of the termite Odontotermes formosanus (Blattodea: Termitidae in response to disturbance

Directory of Open Access Journals (Sweden)

Hongpeng Xiong

2018-03-01

Full Text Available The escaping behavior of termites has been documented under laboratory conditions; however, no study has been conducted in a field setting due to the difficulty of observing natural behaviors inside wood or structures (e.g., nests, tunnels, etc.. The black-winged termite, Odontotermes formosanus (Shiraki, is a subterranean macrotermitine species which builds extensive mud tubes on tree trunks. In the present study, 41 videos (totaling ∼2,700 min were taken on 22 colonies/subcolonies of O. formosanus after their mud tubes were partially damaged by hand. In general, termites consistently demonstrated three phases of escape, including initiation (wandering near the mud-tube breach, individual escaping (single termites moving downward, and massive, unidirectional escaping flows (groups of termites moving downward. Downward moving and repairing were the dominant behavioral activities of individuals and were significantly more frequent than upward moving, turning/backward moving, or wandering. Interestingly, termites in escaping flows moved significantly faster than escaping individuals. Repairing behavior was observed shortly after the disturbance, and new mud tubes were preferentially constructed from the bottom up. When predators (i.e., ants were present, however, termites stopped moving and quickly sealed the mud-tube openings by capping the broken ends. Our study provides an interesting example that documents an animal (besides humans simultaneously carrying out pathway repairs and emergency evacuation without congestion.

Escaping and repairing behaviors of the termite Odontotermes formosanus (Blattodea: Termitidae) in response to disturbance.

Science.gov (United States)

Xiong, Hongpeng; Chen, Xuan; Wen, Yuzhen; Layne, Michael; Sun, Zhaohui; Ma, Tao; Wen, Xiujun; Wang, Cai

2018-01-01

The escaping behavior of termites has been documented under laboratory conditions; however, no study has been conducted in a field setting due to the difficulty of observing natural behaviors inside wood or structures (e.g., nests, tunnels, etc.). The black-winged termite, Odontotermes formosanus (Shiraki), is a subterranean macrotermitine species which builds extensive mud tubes on tree trunks. In the present study, 41 videos (totaling ∼2,700 min) were taken on 22 colonies/subcolonies of O. formosanus after their mud tubes were partially damaged by hand. In general, termites consistently demonstrated three phases of escape, including initiation (wandering near the mud-tube breach), individual escaping (single termites moving downward), and massive, unidirectional escaping flows (groups of termites moving downward). Downward moving and repairing were the dominant behavioral activities of individuals and were significantly more frequent than upward moving, turning/backward moving, or wandering. Interestingly, termites in escaping flows moved significantly faster than escaping individuals. Repairing behavior was observed shortly after the disturbance, and new mud tubes were preferentially constructed from the bottom up. When predators (i.e., ants) were present, however, termites stopped moving and quickly sealed the mud-tube openings by capping the broken ends. Our study provides an interesting example that documents an animal (besides humans) simultaneously carrying out pathway repairs and emergency evacuation without congestion.

Borate protection of softwood from Coptotermes acinaciformis (Isoptera: Rhinotermitidae) damage: variation in protection thresholds explained.

Science.gov (United States)

Peters, Brenton C; Fitzgerald, Christopher J

2006-10-01

Laboratory and field data reported in the literature are confusing with regard to "adequate" protection thresholds for borate timber preservatives. The confusion is compounded by differences in termite species, timber species and test methodology. Laboratory data indicate a borate retention of 0.5% mass/mass (m/m) boric acid equivalent (BAE) would cause > 90% termite mortality and restrict mass loss in test specimens to 0.5% m/m BAE are required. We report two field experiments with varying amounts of untreated feeder material in which Coptotermes acinaciformis (Froggatt) (Isoptera: Rhinotermitidae) responses to borate-treated radiata (Monterey) pine, Pinus radiata D. Don, were measured. The apparently conflicting results between laboratory and field data are explained by the presence or absence of untreated feeder material in the test environment. In the absence of untreated feeder material, wood containing 0.5% BAE provided adequate protection from Coptotermes sp., whereas in the presence of untreated feeder material, increased retentions were required. Furthermore, the retentions required increased with increased amounts of susceptible material present. Some termites, Nasutitermes sp. and Mastotermes darwiniensis Froggatt, for example, are borate-tolerant and borate timber preservatives are not a viable management option with these species. The lack of uniform standards for termite test methodology and assessment criteria for efficacy across the world is recognized as a difficulty with research into the performance of timber preservatives with termites. The many variables in laboratory and field assays make "prescriptive" standards difficult to recommend. The use of "performance" standards to define efficacy criteria ("adequate" protection) is discussed.

Ability of field populations of Coptotermes spp., Reticulitermes flavipes, and Mastotermes darwiniensis (Isoptera: Rhinotermitidae; Mastotermitidae) to damage plastic cable sheathings.

Science.gov (United States)

Lenz, Michael; Kard, Brad; Creffield, James W; Evans, Theodore A; Brown, Kenneth S; Freytag, Edward D; Zhong, Jun-Hong; Lee, Chow-Yang; Yeoh, Boon-Hoi; Yoshimura, Tsuyoshi; Tsunoda, Kunio; Vongkaluang, Charunee; Sornnuwat, Yupaporn; Roland, Ted A; de Santi, Marie Pommier

2013-06-01

A comparative field study was conducted to evaluate the ability of subterranean termites to damage a set of four different plastic materials (cable sheathings) exposed below- and above-ground. Eight pest species from six countries were included, viz., Coptotermes formosanus (Shiraki) in China, Japan, and the United States; Coptotermes gestroi (Wasmann) in Thailand and Malaysia; Coptotermes curvignathus (Holmgren) and Coptotermes kalshoveni (Kemner) in Malaysia; Coptotermes acinaciformis (Froggatt) with two forms of the species complex and Mastotermes darwiniensis (Froggatt) in Australia; and Reticulitermes flavipes (Kollar) in the United States. Termite species were separated into four tiers relative to decreasing ability to damage plastics. The first tier, most damaging, included C. acinaciformis, mound-building form, and M. darwiniensis, both from tropical Australia. The second tier included C. acinaciformis, tree-nesting form, from temperate Australia and C. kalshoveni from Southeast Asia. The third tier included C. curcignathus and C. gestroi from Southeast Asia and C. formosanus from China, Japan, and the United States, whereas the fourth tier included only R. flavipes, which caused no damage. A consequence of these results is that plastics considered resistant to termite damage in some locations will not be so in others because of differences in the termite fauna, for example, resistant plastics from the United States and Japan will require further testing in Southeast Asia and Australia. However, plastics considered resistant in Australia will be resistant in all other locations.

Nutritional ecology of the formosan subterranean termite (Isoptera: Rhinotermitidae): feeding response to commercial wood species.

Science.gov (United States)

Morales-Ramos, J A; Rojas, M G

2001-04-01

The feeding preferences of the Formosan subterranean termite, Coptotermes formosanus Shiraki, were tested in three separate experiments on 28 different wood species. Experiment 1 was a multiple-choice test designed to test relative preferences among 24 wood species commercially available in New Orleans, LA. Experiment 2 was a similar study designed to test relative preferences among 21 wood species shown or reported to be unpalatable to the Formosan subterranean termite. Experiment 3 was a no-choice test to examine the feeding deterrence of the 10 least preferred wood species. Preference was determined by consumption rates. Birch (Betula alleghaniensis Britton), red gum (Liquidambar styraciflua L.), Parana pine [Araucaria angustifolia (Bert.) 1, sugar maple (Acer saccharum Marsh.), pecan (Carya illinoensis Wangenh.), and northern red oak (Quercus rubra L.) were the most preferred species by C. formosanus in order of consumption rate. All of these species were significantly more preferred than southern yellow pine (Pinus taeda L.), widely used for monitoring. Sinker cypress [ = old growth bald cypress, Taxodium distichum (L.)], western red cedar (Thuja plicata Donn), Alaskan yellow cedar (Chamaecyparis nootkatensis D. Don), eastern red cedar (Juniperus virginiana L.), sassafras [Sassafras albidum (Nutt.)], Spanish cedar (Cedrella odorata L.), Honduras mahogany (Swietenia macrophyla King), Indian rosewood (Dalbergia latifolia Roxb.), Honduras rosewood (D. stevensonii Standl.), and morado (Machaerium sp.) induced significant feeding deterrence and mortality to C. formosanus. The last eight species produced 100% mortality after 3 mo.

EFEITO DO TEOR DE EXTRATIVOS NA RESISTÊNCIA NATURAL DE CINCO MADEIRAS AO ATAQUE DE CUPINS XILÓFAGOS

Directory of Open Access Journals (Sweden)

Juarez Benigno Paes

2016-01-01

Full Text Available When man stopped being nomadic, he had to adapt to new conditions, and started employing wood for energy, hunting and defense instruments and miscellaneous constructive elements. Since then, in the light of usages and rapid growth, the importance of wood has been increasing, primarily by their exploitation assaults less the environment when compared to other non-renewable materials. Although there are several researches about Eucalyptus and Pinus, but studies with other species are incipient mainly about the extractive effects on the wood natural resistance. Thus, this research aimed to assess the influence of extractive contents with the natural resistance of Acacia mangium, Casuarina sp. Eucalyptus cloeziana, Corymbia torelliana and Tectona grandis woods to Nasutitermes corniger xylophagous termite, species of frequent occurrence in several regions in Brazil. From each species, test samples were taken, with dimensions of 2.00 x 10.16 x 0.64 (radial x longitudinal x tangential in four positions in the medulla-sapwood direction (internal core, intermediate core, outer core and sapwood. The woods were exposed to the action of termites for 45 days in a food preference assay. The samples not selected for the test with termites were turned into sawdust and the extractive contents were obtained by using the fraction which passed through the sieve 40 and was retained in 60 mesh. The natural resistance has not been linked to extractive levels present in the wood. The resistance of wood varied in medulla-sapwood direction, with default variable for each species. The more resistant timbers were Tectona grandis and Corymbia torelliana and the most deteriorated was Acacia mangium.

Eficiência de um composto de iodo orgânico contra fungos apodrecedores de madeiras e térmitas

Directory of Open Access Journals (Sweden)

Alexandre da Costa Florian

2003-01-01

Full Text Available The effectiveness of a low toxicity organic compound as fungicide and insecticide was studied by a accelerated laboratory bioassay according to the japanese standard. The compound was evaluated at concentrations of 0,5, 0,75 and 1,0% using ethanol as solvent. The subterraneous termites Coptotermes formosanus Shiraki and the decay fungi Coriolus versicolor (white rot and Tyromyces palustris (brown rot were used in the trials to evaluate the insecticide and fungicide action respectively. The wood specimens with dimensions of 40 x 20 x 5mm were treated by surface coating (brushing method at a rate of 110±10g/m2. The percentage weight loss of the wood blocks and the termite mortality (insecticide action and the weight loss of the wood blocks before and after the fungi attack (fungicide action were determined. The efficiency of the formulations were evaluated according to the Value of Efficiency. Results showed that the compound was of little or no efficient as insecticide against Coptotermes formosanus in the three concentrations analysed. The compound showed a good performance as fungicide against Coriolus versicolor and Tyromyces palustris with a Value of Efficiency higher than 90 in the three concentrations analysed. The best results were obtained with the product at 1,0% concentration in the treated and unleached wood specimens. Tyromyces palustris caused a larger damage in the wood blocks than Coriolus versicolor. The product showed a low capacity of fixation in the wood; therefore, it is not indicated for treating wood that will be in direct contact with the soil or under outdoor conditions.

Colony social organization and population genetic structure of an introduced population of formosan subterranean termite from New Orleans, Louisiana.

Science.gov (United States)

Husseneder, Claudia; Messenger, Matthew T; Su, Nan-Yao; Grace, J Kenneth; Vargo, Edward L

2005-10-01

The Formosan subterranean termite, Coptotermes formosanus Shiraki, is an invasive species in many parts of the world, including the U.S. mainland. The reasons for its invasive success may have to do with the flexible social and spatial organization of colonies. We investigated the population and breeding structure of 14 C. formosanus colonies in Louis Armstrong Park, New Orleans, LA. This population has been the focus of extensive study for many years, providing the opportunity to relate aspects of colony breeding structure to previous findings on colony characteristics such as body weight and number of workers, wood consumption, and intercolony aggression. Eight colonies were headed by a single pair of outbred reproductives (simple families), whereas six colonies were headed by low numbers of multiple kings and/or queens that were likely the neotenic descendants of the original colony (extended families). Within the foraging area of one large extended family colony, we found genetic differentiation among different collection sites, suggesting the presence of separate reproductive centers. No significant difference between simple family colonies and extended family colonies was found in worker body weight, soldier body weight, foraging area, population size, or wood consumption. However, level of inbreeding within colonies was negatively correlated with worker body weight and positively correlated with wood consumption. Also, genetic distance between colonies was positively correlated with aggression levels, suggesting a genetic basis to nestmate discrimination cues in this termite population. No obvious trait associated with colony reproductive structure was found that could account for the invasion success of this species.

Nutritional ecology of the Formosan subterranean termite (Isoptera: Rhinotermitidae): growth and survival of incipient colonies feeding on preferred wood species.

Science.gov (United States)

Morales-Ramos, Juan A; Rojas, M Guadalupe

2003-02-01

The wood of 11 plant species was evaluated as a food source significantly impacting the growth and survival of incipient colonies of the Formosan subterranean termite, Coptotermes formosanus Shiraki (Isoptera: Rhinotermitidae). Colonies of C. formosanus feeding on pecan, Carya illinoensis (Wangenh.), and red gum, Liquidambar styraciflua L., produced significantly more progeny than colonies feeding on other wood species tested. Progeny of colonies feeding on pecan and American ash, Fraxinus americana L., had significantly greater survival than progeny of colonies feeding on other wood species. Colonies feeding on a nutritionally supplemented cellulose based matrix showed similar fitness characteristics as colonies feeding on the best wood treatments. These results indicate that differences observed in colony fitness can be partially explained by nutritional value of the food treatment, raising the possibility that wood from different tree species have different nutritional values to the Formosan subterranean termites. Colonies feeding on loblolly pine, Pinus taeda L., and ponderosa pine, Pinus ponderosa Laws., had significantly lower survival and produced significantly fewer workers and soldiers than colonies feeding on other wood species. Colony survival from 90 to 180 d of age and from 90 to 360 d of age was significantly correlated with the number of workers present at 90 d of colony age, indicating that colony survival depends on the presence of workers. Wood consumption in a multiple-choice study was significantly correlated with colony fitness value. This suggests that feeding preference of C. formosanus is at least partially influenced by the nutritional value of the food source.

Comparative effects of vetiver oil, nootkatone and disodium octaborate tetrahydrate on Coptotermes formosanus and its symbiotic fauna.

Science.gov (United States)

Maistrello, Lara; Henderson, Gregg; Laine, Roger A

2003-01-01

The potential of vetiver oil and nootkatone as wood treatments against Coptotermes formosanus Shiraki was examined by assessing the effects on termite tunneling, feeding activity and survival, and the consequences on the symbiont protozoa responsible for wood digestion. Comparisons were made with non-treated wood (control), wood treated with the borate compound Tim-Bor (a commonly used lumber preservative) and absence of a food source (starved termites), using choice and no-choice tests. All wood slices were prepared at the same time using a 10 g liter(-1) solution of each substance and were tested in four different sessions over one year to investigate longevity of the effects. Termites had to tunnel through sand to exploit the food sources, consisting of two wood slices, placed on opposite sides of the experimental enclosure. No-choice tests showed that in the presence of vetiver oil or nootkatone, tunneling activity was always the lowest; wood consumption, termite survival and flagellate numbers and species distribution were significantly different from the control and similar to the results obtained for starved termites and with Tim-Bor-treated wood. Nootkatone negatively affected termites for 12 months and was longer lasting than vetiver oil. In choice tests, when vetiver oil or nootkatone were present, termites exhibited a significant preference for non-treated wood. Our results confirmed both the toxicity and absence of repellency of Tim-Bor. Vetiver oil and especially nootkatone affected Formosan subterranean termites and their protozoa, acting as arrestants, repellents and feeding deterrents, and represent a promising natural alternative for the control of this invasive pest.

Mortality and repellent effects of microbial pathogens on Coptotermes formosanus (Isoptera: Rhinotermitidae

Directory of Open Access Journals (Sweden)

Wright Maureen S

2012-12-01

Full Text Available Abstract Background Two entomopathogenic fungi, Isaria fumosorosea and Metarhizium anisopliae, and one bacterium, Bacillus thuringiensis, were tested for their ability to cause mortality of Formosan subterranean termites (FST, Coptotermes formosanus (Shiraki, after liquid exposure, and for their lack of propensity to repel FST. Results The fungus Isaria fumosorosea at 108 spores/ml caused 72.5% mortality on day 7, significantly higher than the control and 106 spores/ml treatment. On day 14, the 106 and 108 concentrations caused 38.8% and 92.5% mortality, respectively, significantly higher than the control. On day 21, 82.5% and 100% of the termites were killed by the 106 and 108 treatments, respectively. I. fumosorosea did not repel termites at 106 nor 108 spores/g in sand, soil or sawdust. The fungus Metarhizium anisopliae at 108 spores/ml caused 57.5% mortality on day 7, 77.5% mortality on day 14 and 100% mortality on day 21. Conclusions On all three days the rate of mortality was significantly higher than that of the control and 106 spores/ml treatment with I. fumosorosea. Neither I. fumosorosea nor M. anisopliae caused repellency of FST in sand, soil or sawdust. The bacterium Bacillus thuringiensis did not cause significant mortality on days 7, 14 or 21. When termites were exposed to cells of B. thuringiensis in sawdust and when termites were exposed to a mixture of spores and cells in sand, a significantly higher number remained in the control tubes. Repellency was not seen with B. thuringiensis spores alone, nor with the above treatments in the other substrates.

Avaliação de danos por insetos em toras estocadas em indústrias madeireiras de Manaus, Amazonas, Brasil

Directory of Open Access Journals (Sweden)

Abreu Raimunda Liége Souza de

2002-01-01

Full Text Available Em seis indústrias madeireiras de Manaus, Amazonas, foi realizado um trabalho de pesquisa, com a utilização de um questionário,para averiguar as condições de uso e processamento da madeira e as medidas preventivas contra o ataque de insetos. Foram realizados, também,um levantamento da ocorrência de insetos em 19 espécies de madeiras utilizadas por essas indústrias e a avaliação do dano provocado pelas principais espécies de Coleoptera (besouros e Isoptera (cupins. Das respostas apuradas, constatou-se que nenhuma das empresas visitadas emprega qualquer produto para prevenir o ataque de insetos às toras, assim como a secagem e a estocagem das toras são feitas de forma incorreta, contribuindo para aumentar a intensidade de ataque de insetos. Foram encontradas uma família de cupins e 16 de besouros, ressaltando que destas apenas cinco causam danos à madeira. Do total de 13 espécies de insetos coletados, destacam-se Xyleborus affinis Eichhoff e Platypus parallelus (Fabricius, encontradas em 18 espécies madeireiras, sendo conseqüentemente responsáveis pela maioria dos danos nas toras X. volvulus (Fabricius e Platypus sp. foram encontradas em cinco espécies; X. ferrugineus (Fabricius em três espécies; Minthea rugicolis Walk, Minthea sp. e Nasutitermes corniger (Motschulsky em duas, e Dinoderus bifoveolatus Wollaston, Anoplotermes sp.; e Cnesinus sp. em uma. As espécies de madeiras que sofreram maior grau de deterioração, causada principalmente por coleópteros, foram Ceiba pentandra (L. Gaertn. e Copaifera multijuga Hayne, seguidas por Couroupitaguianensis Aubl., Calophyllum brasiliense Cambess., Cedrela odorata L., Hevea brasiliensis Müll. Arg., Hura crepitans L., Hymenolobium sp., Maquira coriacea (Karsten C.C. Berg, Nectandra sp., Virolasurinamensis Warb. e Vochysia sp.

Effect of travoprost on 24-hour intraocular pressure in normal tension glaucoma

Directory of Open Access Journals (Sweden)

Yuya Nomura

2010-07-01

Full Text Available Yuya Nomura1, Shunsuke Nakakura2, Mitsuyasu Moriwaki1, Yasuhiro Takahashi1, Kunihiko Shiraki11Department of Ophthalmology and Visual Sciences, Graduate School of Medicine, Osaka City University, Japan; 2Department of Ophthalmology, Saiseikai Gose Hospital, JapanPurpose: The effect of travoprost 0.004% on 24-hour intraocular pressure (IOP was examined in patients with normal tension glaucoma (NTG.Subjects and methods: This study included 17 patients with newly diagnosed unilateral NTG. IOP was measured at three-hour intervals over 24 hours by Goldman applanation tonometer in patients taking topical travoprost 0.004% and was compared retrospectively with 24-hour IOP data in untreated eyes.Results: IOP values were significantly reduced at individual time points after treatment (P < 0.01. Mean 24-hour IOP, maximum 24-hour IOP, minimum 24-hour IOP, and 24-hour IOP fluctuations at baseline (mean ± SD were 12.9 ± 2.2 mmHg, 15.4 ± 2.7 mmHg, 10.5 ± 2.2 mmHg, and 4.9 ± 1.2 mmHg, respectively, and were significantly reduced to 10.3 ± 2.0 mmHg, 12.4 ± 2.5 mmHg, 8.5 ± 1.9 mmHg (all P < 0.001, and 3.9 ± 1.5 mmHg (P < 0.05, respectively, after treatment. The rate of IOP reduction greater than 20% was 58.8% (10 eyes for maximum 24-hour IOP and 53.0% (nine eyes for mean 24-hour IOP.Conclusion: Travoprost reduced IOP throughout the 24-hour study period, with over half of the eyes examined showing IOP reduction exceeding 20%.Keywords: 24-hour intraocular pressure, fluctuation, normal tension glaucoma, travoprost, Travatan Z

Transcriptome analysis of the digestive system of a wood-feeding termite (Coptotermes formosanus) revealed a unique mechanism for effective biomass degradation.

Science.gov (United States)

Geng, Alei; Cheng, Yanbing; Wang, Yongli; Zhu, Daochen; Le, Yilin; Wu, Jian; Xie, Rongrong; Yuan, Joshua S; Sun, Jianzhong

2018-01-01

Wood-feeding termite, Coptotermes formosanus Shiraki, represents a highly efficient system for biomass deconstruction and utilization. However, the detailed mechanisms of lignin modification and carbohydrate degradation in this system are still largely elusive. In order to reveal the inherent mechanisms for efficient biomass degradation, four different organs (salivary glands, foregut, midgut, and hindgut) within a complete digestive system of a lower termite, C. formosanus , were dissected and collected. Comparative transcriptomics was carried out to analyze these organs using high-throughput RNA sequencing. A total of 71,117 unigenes were successfully assembled, and the comparative transcriptome analyses revealed significant differential distributions of GH (glycosyl hydrolase) genes and auxiliary redox enzyme genes in different digestive organs. Among the GH genes in the salivary glands, the most abundant were GH9, GH22, and GH1 genes. The corresponding enzymes may have secreted into the foregut and midgut to initiate the hydrolysis of biomass and to achieve a lignin-carbohydrate co-deconstruction system. As the most diverse GH families, GH7 and GH5 were primarily identified from the symbiotic protists in the hindgut. These enzymes could play a synergistic role with the endogenous enzymes from the host termite for biomass degradation. Moreover, twelve out of fourteen genes coding auxiliary redox enzymes from the host termite origin were induced by the feeding of lignin-rich diets. This indicated that these genes may be involved in lignin component deconstruction with its redox network during biomass pretreatment. These findings demonstrate that the termite digestive system synergized the hydrolysis and redox reactions in a programmatic process, through different parts of its gut system, to achieve a maximized utilization of carbohydrates. The detailed unique mechanisms identified from the termite digestive system may provide new insights for advanced design of

Do termites avoid carcasses? Behavioral responses depend on the nature of the carcasses.

Directory of Open Access Journals (Sweden)

Kok-Boon Neoh

Full Text Available BACKGROUND: Undertaking behavior is a significant adaptation to social life in enclosed nests. Workers are known to remove dead colony members from the nest. Such behavior prevents the spread of pathogens that may be detrimental to a colony. To date, little is known about the ethological aspects of how termites deal with carcasses. METHODOLOGY AND PRINCIPAL FINDINGS: In this study, we tested the responses to carcasses of four species from different subterranean termite taxa: Coptotermes formosanus Shiraki and Reticulitermes speratus (Kolbe (lower termites and Microcerotermes crassus Snyder and Globitermes sulphureus Haviland (higher termites. We also used different types of carcasses (freshly killed, 1-, 3-, and 7-day-old, and oven-killed carcasses and mutilated nestmates to investigate whether the termites exhibited any behavioral responses that were specific to carcasses in certain conditions. Some behavioral responses were performed specifically on certain types of carcasses or mutilated termites. C. formosanus and R. speratus exhibited the following behaviors: (1 the frequency and time spent in antennating, grooming, and carcass removal of freshly killed, 1-day-old, and oven-killed carcasses were high, but these behaviors decreased as the carcasses aged; (2 the termites repeatedly crawled under the aging carcass piles; and (3 only newly dead termites were consumed as a food source. In contrast, M. crassus and G. sulphureus workers performed relatively few behavioral acts. Our results cast a new light on the previous notion that termites are necrophobic in nature. CONCLUSION: We conclude that the behavioral response towards carcasses depends largely on the nature of the carcasses and termite species, and the response is more complex than was previously thought. Such behavioral responses likely are associated with the threat posed to the colony by the carcasses and the feeding habits and nesting ecology of a given species.

The effects of wind turbines on white-tailed eagles (Haliaeetus Albicilla) in Hokkaido, Japan

Energy Technology Data Exchange (ETDEWEB)

Shiraki, Saiko; Kitano, Masato

2011-07-01

Full text: The recent growth of wind facilities in Japan has raised concerns about bird collisions, especially for white-tailed eagles in Hokkaido, northern part of Japan. Approx. 150 pairs of white-tailed eagles breed in Hokkaido in the latest survey (Shiraki unpub. data) and these pairs are considered as residents. On the other hand, ca.500-700 white-tailed eagles including migrants from the breeding areas in Russia winter in Hokkaido. The major objectives of this study are to (1) examine the impacts of wind turbines on white-tailed eagles by information analysis in the previous accident reports of the collisions and by field investigations at the wind facilities, and (2) explore the possible factors which relate to the collisions of the eagles with wind turbines A total of 24 collisions of sea eagles (Haliaeetus spp.) have been reported by both incidental discoveries and fatality searching since 2004 in Hokkaido. 22 of the 24 fatalities were white-tailed eagles and 23 of the 24 were immature birds. Field surveys to estimate of fatality rate of white-tailed eagles and observations of the flight behaviours were carried out at the wind facilities including a total of 42 turbines for one and half years. Annual mortality for white-tailed eagles was estimated at 0.08 fatalities / yr / MW and the Risk Index (Smallwood et Thelander 2004) was calculated at 0.058, the second highest value after common buzzards (Buteo buteo) in this survey. In addition, white-tailed eagles and common buzzards flew at the altitudes of rotor zones of the wind turbines more frequently than the other raptors. The effects of the collisions at wind turbines on white-tailed eagles in Hokkaido based on the results of this study, and on the ecological and the genetically information of the population will be considered in the presentation. (Author)

USO DE PLANTAS EM PÓ SECO COM PROPRIEDADES TERMITICIDA SOBRE A MORTALIDADE DE CUPINS ARBÓREOS

Directory of Open Access Journals (Sweden)

Chistopher Stallone Cruz

2012-09-01

Full Text Available 1024x768 Normal 0 21 false false false PT-BR X-NONE X-NONE Os térmitas são insetos de grande importância ecológica, com mais de 2.750 espécies catalogadas em todo o mundo. Pequeno número de espécies são conhecidos por provocarem grandes danos econômicos ao homem, sendo considerado como praga urbana ou agrícola, são destruidores de madeira seca, pastagens e outros materiais composto de celulose. A vasta gama de uso indiscriminado de produtos químicos contra o controle deste inseto vem trazendo ao longo do tempo resultados negativos, por apresentarem sérios riscos a saúde humana e dar surgimento a cupins com resistência. Avaliou-se nove espécies vegetais que possivelmente apresentem poder cupinicida em substituição aos tratamentos convencionais, de modo a preservar o meio ambiente. Foram avaliados os seguintes vegetais: caule e folha de Aspidosperma pyrifolium, raiz de Mimosa tenuiflora, raiz de Cnidoscolus urens, gema apical de Syzygium aromaticum, semente de Azadirachta indica, fruto de Piper nigrum, folhas de Eucalyptus sp., raiz de Zingiber officinale e fruto de Punica granatum. Foram coletados 550 espécimes de cupins, 275 operários e 275 soldados, logo em seguida foram distribuídos 10 indivíduos dentro de um cativeiro de polipropileno com capacidade de 250mL, juntamente com 3g do pó seco, 5g de fragmentos de cupinzeiro macerado, verificando a viabilidade dos pós secos durante 5 dias consecutivos, sendo realizado uma leitura de mortalidade a cada 24 horas. O delineamento utilizado foi o inteiramente casualizado e os dados foram avaliados pelos testes Student e Henderson & Tilton. Verificou-se que a utilização dos pós vegetais é  alternativa eficaz e barata no controle de Nasutitermes sp., destacando-se como mais letais folhas e galhos de A. indica,Eucalyptus sp., S. aromaticum, Z. officinale, C. urens e P. nigrum.

A global checklist of the 932 fruit fly species in the tribe Dacini (Diptera, Tephritidae

Directory of Open Access Journals (Sweden)

Camiel Doorenweerd

2018-01-01

Full Text Available The correct application of the scientific names of species is neither easy nor trivial. Mistakes can lead to the wrong interpretation of research results or, when pest species are involved, inappropriate regulations and limits on trade, and possibly quarantine failures that permit the invasion of new pest species. Names are particularly challenging to manage when groups of organisms encompass a large number of species, when different workers employ different philosophical views, or when species are in a state of taxonomic flux. The fruit fly tribe Dacini is a species-rich taxon within Tephritidae and contains around a fifth of all known species in the family. About 10% of the 932 currently recognized species are pests of commercial fruits and vegetables, precipitating quarantines and trade embargos. Authoritative species lists consist largely of scattered regional treatments and outdated online resources. The checklist presented here is the first global overview of valid species names for the Dacini in almost two decades, and includes new lure records. By publishing this list both in paper and digitally, we aim to provide a resource for those studying fruit flies as well as researchers studying components of their impact on agriculture. The list is largely a consolidation of previous works, but following the results from recent phylogenetic work, we transfer one subgenus and eight species to different genera: members of the Bactrocera subgenus Javadacus Hardy, considered to belong to the Zeugodacus group of subgenera, are transferred to genus Zeugodacus; Bactrocera pseudocucurbitae White, 1999, stat. rev., is transferred back to Bactrocera from Zeugodacus; Zeugodacus arisanicus Shiraki, 1933, stat. rev., is transferred back to Zeugodacus from Bactrocera; and Z. brevipunctatus (David & Hancock, 2017, comb. n.; Z. javanensis (Perkins, 1938, comb. n.; Z. montanus (Hardy, 1983, comb. n.; Z. papuaensis (Malloch, 1939, comb. n.; Z. scutellarius (Bezzi

A global checklist of the 932 fruit fly species in the tribe Dacini (Diptera, Tephritidae).

Science.gov (United States)

Doorenweerd, Camiel; Leblanc, Luc; Norrbom, Allen L; Jose, Michael San; Rubinoff, Daniel

2018-01-01

The correct application of the scientific names of species is neither easy nor trivial. Mistakes can lead to the wrong interpretation of research results or, when pest species are involved, inappropriate regulations and limits on trade, and possibly quarantine failures that permit the invasion of new pest species. Names are particularly challenging to manage when groups of organisms encompass a large number of species, when different workers employ different philosophical views, or when species are in a state of taxonomic flux. The fruit fly tribe Dacini is a species-rich taxon within Tephritidae and contains around a fifth of all known species in the family. About 10% of the 932 currently recognized species are pests of commercial fruits and vegetables, precipitating quarantines and trade embargos. Authoritative species lists consist largely of scattered regional treatments and outdated online resources. The checklist presented here is the first global overview of valid species names for the Dacini in almost two decades, and includes new lure records. By publishing this list both in paper and digitally, we aim to provide a resource for those studying fruit flies as well as researchers studying components of their impact on agriculture. The list is largely a consolidation of previous works, but following the results from recent phylogenetic work, we transfer one subgenus and eight species to different genera: members of the Bactrocera subgenus Javadacus Hardy, considered to belong to the Zeugodacus group of subgenera, are transferred to genus Zeugodacus ; Bactrocera pseudocucurbitae White, 1999, stat. rev. , is transferred back to Bactrocera from Zeugodacus ; Zeugodacus arisanicus Shiraki, 1933, stat. rev. , is transferred back to Zeugodacus from Bactrocera ; and Z. brevipunctatus (David & Hancock, 2017), comb. n. ; Z. javanensis (Perkins, 1938), comb. n. ; Z. montanus (Hardy, 1983), comb. n. ; Z. papuaensis (Malloch, 1939), comb. n. ; Z. scutellarius (Bezzi, 1916

Generic revision and species classification of the Microdontinae (Diptera, Syrphidae

Directory of Open Access Journals (Sweden)

Menno Reemer

2013-04-01

and secondary junior homonyms: Microdon shirakii nom. n. (= Microdon tuberculatus Shiraki, 1968, primary homonym of Microdon tuberculatus de Meijere, 1913, Paramixogaster brunettii nom. n. (= Mixogaster vespiformis Brunetti, 1913, secondary homonym of Microdon vespiformis de Meijere, 1908, Paramixogaster sacki nom. n. (= Myxogaster variegata Sack, 1922, secondary homonym of Ceratophya variegata Walker, 1852. An attempt is made to classify all available species names into (subgenera and species groups. The resulting classification comprises 454 valid species and 98 synonyms (excluding misspellings, of which 17 valid names and three synonyms are left unplaced. The paper concludes with a discussion on diagnostic characters of Microdontinae.

JAEA FBR Plant Engineering Center annual report 2011

International Nuclear Information System (INIS)

2012-11-01

The FBR Plant Engineering Center was established on April 1, 2009 located in a research building, of which care is taken by the International Nuclear Information Training Center, Tsuruga Head Office, at Shiraki in Tsuruga. The mission of the center is to perform R and D (research and development) works both for analysis of operational experiences at the prototype fast breeder reactor “Monju” and for technology development concerning design and operation of “Monju”. Moreover it is also required to apply the results to next generation fast breeder reactors, which is an important role of Advanced Nuclear System Research and Development Directorate. And in these R and D activities, it is expected to conduct the works in cooperation with domestic or foreign research organizations or universities by a joint-study or a collaborative-work manner. The R and D activities have been carried out specifically on the “demonstration of the reliability as a power generation plant” and “establishment of sodium handling technology”, which are originally intended missions of “Monju”. And the other R and Ds have been promoted both for the plant engineering, such as plant maintenance, to effectively use an existing reactor in order to apply the R and D results to a future demonstration reactor, and for the irradiation test study, such as advanced fuel irradiation, to use “Monju” as an irradiation test bed. In order to perform these R and D activities, five R and D groups have been set up in the center. They are operation-and-maintenance engineering, sodium engineering, reactor-core-and-fuel engineering, plant engineering, and safety engineering groups. However, the Japanese atomic energy policy is being reviewed after the accident of the Fukushima Daiichi nuclear power station caused by a tsunami generated by the Tohoku-district-off-the-Pacific-Ocean Earthquake on March 11, 2011, and all the R and D activities using “Monju” have been suspended since late 2011