Effects of extractives and ash on natural resistance of four woods to xylophogous termites

Directory of Open Access Journals (Sweden)

Juarez Benigno Paes

2013-09-01

Full Text Available This study tested the natural resistance of wood of four tree species to Nasutitermes corniger Motsch. xylophogous termite attack and correlate the resistance with the amount of extract and ash in the chemical composition of the tested species. The species evaluated were Anadenanthera colubrina (Vell. Brenan. var. cebil (Gris. Alts., Tabebuia aurea (Mart. Bureau., Amburana cearensis (Allem. A.C.Sm. and Eucalyptus camaldulensis Dehnh. Test samples with dimensions of 2.00 x 10.16 x 0.64 cm (radial x longitudinal x tangential were obtained at two positions (external heartwood and sapwood of each species. The samples were exposed to action of termites for 45 days in food preference assay. The content of wood extractives was obtained through the sawdust that went through sieve of 40 mesh and were retained in the 60 mesh. The natural resistance was not associated with wood extractive contents. The wood more resistant to termite attack was the Anadenanthera colubrina var. cebil in the two positions (external heartwood and sapwood and Eucalyptus camaldulensis wood presented the greatest wear. The biological resistance of wood was correlated with ash content, i.e., the species with the highest levels was the most resistant to termite attack.

Redescription of the types of species of Anastatus Motschulsky, 1859 (Hymenoptera: Chalcidoidea: Eupelmidae described by J.K. Sheng and coauthors

Directory of Open Access Journals (Sweden)

Lingfei Peng

2017-03-01

Full Text Available Six species of Anastatus Motschulsky, 1859 (Hymenoptera: Eupelmidae were described from China in Chinese by J.K. Sheng and coauthors in 1997 and 1998: A. dexingensis, A. flavipes, A. fulloi, A. huangi, A. meilingensis and A. shichengensis. This represents almost half the species of Anastatus recorded from China, but no keys were given to differentiate the species and the original descriptions included only simple line drawings to illustrate the species. Because recognition of these species is critical prior to clarifying the Anastatus fauna of China and of the eastern Palaearctic and Oriental regions, we have redescribed the six species in detail in English based on original type material, illustrating the species through macrophotography of type material and providing a key to differentiate females of the species.

Determination of behaviour of the corn weevil Sitophilus zeamais, Motschulsky, 1855 (Coleoptera, Curculionidae) in corn, rice and wheat grains by using radioactive tracer iodine-131

International Nuclear Information System (INIS)

Pacheco, I.A.

1989-01-01

The dispersion behaviour and distribution pattern of Sitophilus zeamais Motschulsky, 1855 through a bulk of corn, rice and wheat,leaving from a infestation focus, was investigated by means of tracer methodology. Adults insects were labeled with the gamma emitter 131 I, through bath in Na 131 I solution and released onto the top of grain mass deposited in cylinders each 430 mm height and 195 mm in diameter, filled to 20 mm of the top with grains. The cylinders were enclosed with lids. The insects were detected through the bulk of the grain by means of a crystal scintillator, in fourteen sites, zero 3, 6, 12, 24, 48, 72, 96 and 120 hours after releasing. (author)

Elimination of the Mound-Building Termite, Nasutitermes exitiosus (Isoptera: Termitidae) in South-Eastern Australia Using Bistrifluron Bait.

Science.gov (United States)

Webb, Garry A; Mcclintock, Charles

2015-12-01

Bistrifluron, a benzoylphenylurea compound, was evaluated for efficacy against Nasutitermes exitiosus (Hill), a mound-building species in southern Australia. Bistrifluron bait (trade name Xterm) was delivered as containerized pellets inserted into plastic feeding stations implanted in the sides of mounds-60 g for bistrifluron bait-treated mounds and 120 g of blank bait for untreated mounds. Termites actively tunneled in the gaps between pellets and removed bait from the canisters. All five treated mounds were eventually eliminated, and all five untreated mounds remained active at the end of the trial. Four of the five treated mounds were considered dead and excavated after 26 wk, but there were earlier signs of mound distress-reduced repair of experimental casement damage and reduced activity in bait canisters by 22 wk and reduced internal mound temperature after 11 wk. One treated mound showed activity in the bait station right through until almost the end of the trial (47 wk), but excavation at 49 wk showed no further activity in the mound. The five untreated colonies removed on average 97% of blank bait offered, while the five treated colonies removed on average 39.1% of bait offered. There was a wide variation in temperature profiles of mounds (up to 15°C for both minimum and maximum internal temperatures), from the beginning of the trial and even before the effects of baiting were evident. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Digestive beta-glucosidases from the wood-feeding higher termite, Nasutitermes takasagoensis: intestinal distribution, molecular characterization, and alteration in sites of expression.

Science.gov (United States)

Tokuda, Gaku; Miyagi, Mio; Makiya, Hiromi; Watanabe, Hirofumi; Arakawa, Gaku

2009-12-01

beta-Glucosidase [EC 3.2.1.21] hydrolyzes cellobiose or cello-oligosaccharides into glucose during cellulose digestion in termites. SDS-PAGE and zymogram analyses of the digestive system in the higher termite Nasutitermes takasagoensis revealed that beta-glucosidase activity is localized in the salivary glands and midgut as dimeric glycoproteins. Degenerate PCR using primers based on the N-terminal amino acid sequences of the salivary beta-glucosidase resulted in cDNA fragments of 1.7 kb, encoding 489 amino acids with a sequence similar to glycosyl hydrolase family 1. Moreover, these primers amplified cDNA fragments from the midgut, and the deduced amino acid sequences are 87-91% identical to those of the salivary beta-glucosidases. Successful expression of the cDNAs in Escherichia coli implies that these sequences also encode functional beta-glucosidases. These results indicate that beta-glucosidases that primarily contribute to the digestive process of N. takasagoensis are produced in the midgut. Reverse transcription-PCR analysis indicated the site-specific expression of beta-glucosidase mRNAs in the salivary glands and midgut. These results suggest that termites have developed the ability to produce beta-glucosidases in the midgut, as is the case for endo-beta-1,4-glucanase, in which the site of expression has shifted from the salivary glands of lower termites to the midgut of higher termites. Copyright 2009 Elsevier Ltd. All rights reserved.

EFEITO DO TEOR DE EXTRATIVOS NA RESISTÊNCIA NATURAL DE CINCO MADEIRAS AO ATAQUE DE CUPINS XILÓFAGOS

Directory of Open Access Journals (Sweden)

Juarez Benigno Paes

2016-01-01

Full Text Available When man stopped being nomadic, he had to adapt to new conditions, and started employing wood for energy, hunting and defense instruments and miscellaneous constructive elements. Since then, in the light of usages and rapid growth, the importance of wood has been increasing, primarily by their exploitation assaults less the environment when compared to other non-renewable materials. Although there are several researches about Eucalyptus and Pinus, but studies with other species are incipient mainly about the extractive effects on the wood natural resistance. Thus, this research aimed to assess the influence of extractive contents with the natural resistance of Acacia mangium, Casuarina sp. Eucalyptus cloeziana, Corymbia torelliana and Tectona grandis woods to Nasutitermes corniger xylophagous termite, species of frequent occurrence in several regions in Brazil. From each species, test samples were taken, with dimensions of 2.00 x 10.16 x 0.64 (radial x longitudinal x tangential in four positions in the medulla-sapwood direction (internal core, intermediate core, outer core and sapwood. The woods were exposed to the action of termites for 45 days in a food preference assay. The samples not selected for the test with termites were turned into sawdust and the extractive contents were obtained by using the fraction which passed through the sieve 40 and was retained in 60 mesh. The natural resistance has not been linked to extractive levels present in the wood. The resistance of wood varied in medulla-sapwood direction, with default variable for each species. The more resistant timbers were Tectona grandis and Corymbia torelliana and the most deteriorated was Acacia mangium.

Bioactivity of Peumus boldus Molina, Laurelia sempervirens (Ruiz & Pav. Tul. and Laureliopsis philippiana (Looser Schodde (Monimiacea essential oils against Sitophilus zeamais Motschulsky

Directory of Open Access Journals (Sweden)

Carmen Herrera-Rodríguez

2015-09-01

Full Text Available The maize weevil (Sitophilus zeamais Motschulsky is one of most important pest of stored seeds worldwide, but its current control method is based on the use of synthetic insecticides, usually leading to undesirable problems such as insecticide residues on treated food, human intoxications, and insect resistance development. Therefore the search of friendly alternative methods is required. The aim of this study was to assess, under laboratory conditions, the insecticidal properties of Peumus boldus Molina, Laurelia sempervirens (Ruiz & Pav. Tul., and Laureliopsis philippiana (Looser Schodde essential oils against S. zeamais. The phytochemical analysis of the three essential oils showed 1,8-cineole, safrole and methyleugenol as the common components; all of them documented with insecticidal activity from essential oils from other plant species. The highest toxicity (100% mortality of these three oils acting as a contact insecticide was observed at 24 h exposure at 4% concentration. The estimated LC50 values for P. boldus, L. sempervirens, and L. philippiana were 0.37, 1.02, and 0.28 μL g-1, respectively. Peumus boldus exhibited the highest fumigant activity with 100% adult mortality at 30 μL oil L-1 air. At ≥ 0.5% (v/w concentration, all essential oils showed repellent activity. These three essential oils showed a promissory insecticidal activity against the maize weevil.

Profiling the Succession of Bacterial Communities throughout the Life Stages of a Higher Termite Nasutitermes arborum (Termitidae, Nasutitermitinae) Using 16S rRNA Gene Pyrosequencing

Science.gov (United States)

Diouf, Michel; Roy, Virginie; Mora, Philippe; Frechault, Sophie; Lefebvre, Thomas; Hervé, Vincent; Rouland-Lefèvre, Corinne; Miambi, Edouard

2015-01-01

Previous surveys of the gut microbiota of termites have been limited to the worker caste. Termite gut microbiota has been well documented over the last decades and consists mainly of lineages specific to the gut microbiome which are maintained across generations. Despite this intimate relationship, little is known of how symbionts are transmitted to each generation of the host, especially in higher termites where proctodeal feeding has never been reported. The bacterial succession across life stages of the wood-feeding higher termite Nasutitermes arborum was characterized by 16S rRNA gene deep sequencing. The microbial community in the eggs, mainly affiliated to Proteobacteria and Actinobacteria, was markedly different from the communities in the following developmental stages. In the first instar and last instar larvae and worker caste termites, Proteobacteria and Actinobacteria were less abundant than Firmicutes, Bacteroidetes, Spirochaetes, Fibrobacteres and the candidate phylum TG3 from the last instar larvae. Most of the representatives of these phyla (except Firmicutes) were identified as termite-gut specific lineages, although their relative abundances differed. The most salient difference between last instar larvae and worker caste termites was the very high proportion of Spirochaetes, most of which were affiliated to the Treponema Ic, Ia and If subclusters, in workers. The results suggest that termite symbionts are not transmitted from mother to offspring but become established by a gradual process allowing the offspring to have access to the bulk of the microbiota prior to the emergence of workers, and, therefore, presumably through social exchanges with nursing workers. PMID:26444989

Bacterias celulolíticas aisladas del intestino de termitas (Nasutitermes nigriceps con características probióticas y potencial en la degradación del pasto

Directory of Open Access Journals (Sweden)

Cecilia Lara Mantilla

2013-01-01

Abstract: The objective of this research was to isolate cellulolytic bacteria from the gut of termites (Nasutitermes nigriceps to determine their probiotic properties in vitro and its potential in degrading  grass. Termites were treated with antibacterial detergent, then their intestine was separated and macerated in sterile peptone water. Dilutions of this mixture were inoculated in Petri dishes using  Luria Bertani (LB method and carboxymethylcellulose (CMC 2%, incubated at 37 ° C for 24 hours, and then revealed with 1% Congo Red. Bacteria with higher degradation halos were subjected to Gram staining and probiotic temperature tests, pH, salinity and the presence of bile salts, as well as antagonism and degradation of grass tests. The results revealed the presence of 9 Gram (-  cellulolytic bacillifrom which the bacilli BTN7 and BTN8, showed the best degradation halosof 12 and 14 mm in diameter respectively, growing suitably in the different probiotic tests with densities between 106 and 108 CFU / ml, the degradation percentages of dry matter was 39.73% and 36.10% within 48 and 72 hours respectively. Biochemical tests API E showed that (bioMérieux SA bacilli BTN8 and BTN7 belong to the genus Enterobacter sp. The above mentioned results open the possibility of using these organisms as additives for ruminants feeding, in order to contribute to a better use of pasture, and other lignocellulosic vegetal substrates. Key words:Probiotics, Maralfalfa (Pennisetum sp., ruminal microbes, lignocellulose, Enterobacter.

Insecticidal Properties of Peumus boldus Molina Powder Used Alone and Mixed with Lime Against Sitophilus zeamais Motschulsky (Coleopter: Curculionidae Propiedades Insecticidas del Polvo de Peumus boldus Molina Solo y en Mezcla con Cal contra Sitophilus zeamais Motschulsky (Coleoptera: Curculionidae

Directory of Open Access Journals (Sweden)

Gabriel Bustos-Figueroa

2009-09-01

Full Text Available The insecticidal properties of boldus (Peumus boldus Molina powder used alone and mixed with lime against adults of maize weevil (Sitophilus zeamais Motschulsky were evaluated under laboratory conditions. Additionally, aeration effects (presence or absence and temperature (room temperature vs. 3 ºC on insecticidal properties were studied over time. A mortality rate of 100% was observed at 20 g kg-1 (w/w of P. boldus powder when used alone and mixed with lime in proportions of 50:50, 60:40, and 80:20. The 50% lethal concentration (LC50 for all treatments was Se evaluaron las propiedades insecticidas del polvo de boldo (Peumus boldus Molina, solo y en mezcla con cal, bajo condiciones de laboratorio. Adicionalmente, se evaluó el efecto de la aeración (presencia vs. ausencia y de la temperatura (temperatura ambiente vs. 3 ºC sobre la mortalidad y emergencia de adultos de la F1. La concentración de 20 g kg-1 (p/p del polvo de boldo ya sea solo o en combinación con cal en las proporciones de 50:50, 60:40 y 80:20 mostraron 100% de mortalidad. La concentración letal 50% (CL50, en todos los tratamientos fue menor a 5 g kg-1 (p/p mientras que la CL90 no superó 11 g kg-1 (p/p. La mezcla del polvo con los granos de maíz tanto solo como en mezcla con cal no afectó la germinación. La temperatura y la aeración no afectaron la mortalidad de los adultos parentales ni la emergencia de adultos de la F1. Cuando se mezcló el maíz con el polvo de boldo molido 24 h antes de la infestación con adultos, la mortalidad de los adultos parentales y la emergencia de adultos de la F1 fue de 100 y de 0%, respectivamente. Los resultados no fueron satisfactorios cuando el polvo de boldo almacenado durante 30, 60 y 90 d fue mezclado con el maíz infestado. La toxicidad del follaje de boldo es alta 24 h después de pulverizarse; si el tiempo es mayor, la toxicidad declina significativamente.

Cuticular hydrocarbons for species determination of tropical termites

Science.gov (United States)

Michael I. Haverty; Lori J. Nelson; Barbara L. Thorne; Margaret S. Collins; Johanna P.E.C. Darlington; Marion Page

1992-01-01

Cuticular hydrocarbons can be used to discriminate species in Coptotermes and Nasutitermes, here discussed for selected species from locations in the Pacific Rim and several Caribbean islands. We recently reexamined the cuticular hydrocarbons of Coptotermes formosanus and identified several dimethylalkanes that...

Phylogeny of not-yet-cultured spirochetes from termite guts

DEFF Research Database (Denmark)

Paster, B.J.; Dewhirst, F.E.; Cooke, S.M.

1996-01-01

Comparisons of 16S rDNA sequences were used to determine the phylogeny of not-yet-cultured spirochetes from hindguts of the African higher termite, Nasutitermes lujae (Wasmann). The 16S rRNA genes were amplified directly from spirochete-rich hindguts by using universal primers, and the amplified...

Degradation of mangrove tissues by arboreal termites (Nasutitermes acajutlae) and their role in the mangrove C cycle (Puerto Rico): Chemical characterization and organic matter provenance using bulk δ13C, C/N, alkaline CuO oxidation-GC/MS, and solid-state 13C NMR

Science.gov (United States)

Vane, Christopher H.; Kim, Alexander W.; Moss-Hayes, Vicky; Snape, Colin E.; Diaz, Miguel Castro; Khan, Nicole S.; Engelhart, Simon E.; Horton, Benjamin P.

2013-08-01

Arboreal termites are wood decaying organisms that play an important role in the first stages of C cycling in mangrove systems. The chemical composition of Rhizophora mangle, Avicennia germinans, and Laguncularia racemosa leaf, stem, and pneumatophore tissues as well as associated sediments was compared to that of nests of the termite Nasutitermes acajutlae. Nests gave δ13C values of -26.1 to -27.2‰ (±0.1) and C/N of 43.3 (±2.0) to 98.6 (±16.2) which were similar to all stem and pneumatophores but distinct from mangrove leaves or sediments. Organic matter processed by termites yielded lignin phenol concentrations (Λ, lambda) that were 2-4 times higher than stem or pneumatophores and 10-20 times higher than that of leaves or sediments, suggesting that the nests were more resistant to biodegradation than the mangrove vegetation source. 13C NMR revealed that polysaccharide content of mangrove tissues (50-69% C) was higher than that of the nests (46-51% C). Conversely, lignin accounted for 16.2-19.6% C of nest material, a threefold increase relative to living mangrove tissues; a similar increase in aromatic methoxyl content was also observed in the nests. Lipids (aliphatic and paraffinic moieties) were also important but rather variable chemical components of all three mangrove species, representing between 13.5 and 28.3% of the C content. Termite nests contained 3.14 Mg C ha-1 which represents approximately 2% of above ground C storage in mangroves, a value that is likely to increase upon burial due to their refractory chemical composition.

Control of Sitophilus zeamais Motschulsky (Coleoptera ...

African Journals Online (AJOL)

2010-05-24

May 24, 2010 ... local plant materials in the western highlands of Cameroon. AKOB C. A.1,2*, and .... 10. 78. 22.3. Awareness of hazards of insecticides**. 19. 15. 12. 20. 25. 19. 27. 137. 39.1 .... been known to possess insecticidal properties and grain protectants in particular .... Dike, P. M. & Mshelia, G. B. (1997). Laboratory.

Susceptibility of Seven Termite Species (Isoptera) to the Entomopathogenic Fungus Metarhizium anisopliae

OpenAIRE

Chouvenc , Thomas; Su , Nan-Yao; Robert , Alain

2009-01-01

Seven termite species (Isoptera) from five families were tested for disease susceptibility against the entomopathogenic fungus Metarhizium anisopliae using a standard protocol: Mastotermes darwiniensis (Mastotermitidae), Hodotermopsis sjoestedti (Termopsidae), Hodotermes mossambicus (Hodotermitidae), Kalotermes flavicollis (Kalotermitidae), Reticulitermes flavipes and Prorhinotermes canalifrons (Rhinotermitidae), and Nasutitermes voeltzkowi (Termitidae). Our results showed a large diversity i...

The Ground-Beetles Of The Genus Anthracus (Coleoptera, Carabidae Of Ukraine

Directory of Open Access Journals (Sweden)

Putchkov A. V.

2015-04-01

Full Text Available The data of geographical distribution of 3 species of the genus Anthracus Motschulsky, 1850 in Ukraine are presented. Th e short geographical and ecological data and a key of Anthracus are given.

Interaction of insecticide and media moisture on ambrosia beetle (Coleoptera: Curculionidae) attacks on ornamental trees

Science.gov (United States)

Exotic ambrosia beetles, particularly Xylosandrus crassiusculus (Motschulsky) and Xylosandrus germanus (Blandford), are among the most economically damaging pests of ornamental trees in nurseries. Growers have had few tactics besides insecticide applications to reduce ambrosia beetle attacks but rec...

Fumigant activity of plant essential oil from Armoracia rusticana (L ...

African Journals Online (AJOL)

L.), was assessed against Plodia interpunctella (Hübner) and Sitophilus zeamais Motschulsky. A. rusticana oil was active against different life stages of P. interpunctella and adults of S. zeamais. The LC50 value for adults was the lowest and ...

Evaluating the virulence and longevity of non-woven fiber bands impregnated with Metarhizium anisopliae against the Asian longhorned beetle, Anoplophora glabripennis (Coleoptera: Cerambycidae)

Science.gov (United States)

Ryan P. Shanley; Melody Keena; Micheal M. Wheeler; Jarrod Leland; Ann E. Hajek

2009-01-01

Fiber bands impregnated with entomopathogenic fungi (=fungal bands) provide an effective method for controlling the invasive Asian longhorned beetle, Anoplophora glabripennis (Motschulsky) (Coleoptera: Cerambycidae). In this study we investigated the effective longevity of fungal bands for use against A. glabripennis, using...

Spatial spread and infestation risk assessment in the Asian longhorned beetle, Anoplophora glabripennis

DEFF Research Database (Denmark)

Favaro, Riccardo; Wichmann, Lars; Ravn, Hans Peter

2015-01-01

The Asian longhorned beetle (ALB), Anoplophora glabripennis (Motschulsky) (Coleoptera: Cerambycidae), is recognised as potentially one of the most damaging invasive insects in Europe and North America. International trade has increased the risk of accidental introduction of ALB. An eradication pr...

Asian longhorned beetle, over the river and through the woods: habitat-dependent population spread

Science.gov (United States)

Alan J. Sawyer; William S. Panagakos; Audra E. Horner; Kevin J. Freeman

2011-01-01

The Asian longhorned beetle (ALB), Anoplophora glabripennis (Motschulsky) (Coleoptera: Cerambycidae), is an introduced pest of hardwood trees in North America. This paper addresses population spread in open landscapes and wooded areas, with emphasis on recent findings from Staten Island, NY, and Worcester, MA.

Possible living flea beetle fossil in Bolivia: A new genus of flea beetles with modified hind legs (Coleoptera: Chrysomelidae: Galerucinae: Alticini)

Science.gov (United States)

A new genus (Chanealtica) with three new species (C. cuevas, C. ellimon, and C. maxi) from Bolivia is described and illustrated. It is compared with Aphthonoides Jacoby 1885, Argopistes Motschulsky 1860, Metroserrapha Bechyne 1958, Psylliodes Berthold 1827 and Psyllototus Nadein 2010. Remarkably, ba...

Bacteria associated with larvae and adults of the Asian longhorned beetle (Coleoptera: Cerambycidae)

Science.gov (United States)

John D. Podgwaite; Vincent D' Amico; Roger T. Zerillo; Heidi Schoenfeldt

2013-01-01

Bacteria representing several genera were isolated from integument and alimentary tracts of live Asian longhorned beetle, Anaplophora glabripennis (Motschulsky), larvae and adults. Insects examined were from infested tree branches collected from sites in New York and Illinois. Staphylococcus sciuri (Kloos) was the most common...

Flight propensty of Anoplophora glabripennis, an Asian longhorned beetle (Coleoptera: Cerambycidae)

Science.gov (United States)

J. A. Francese; B. Wang; D. R. Lance; Z. Xu; S. Zong; Y. Luo; A. J. Sawyer; V. C. Mastro

2003-01-01

Anoplophora glabripennis (Coleoptera: Cerambycidae) (Motschulsky), is a recently introduced pest of hardwoods. Research to study its flight behavior was conducted in the field in Ningxia Autonomous Region, Peoples' Republic of China. To study the flight propensity of A. glabripennis, adult beetles were observed in population...

Survival and development of a stored-product pest, Sitophilus zeamais (Coleoptera: Curculionidae), and its natural enemy, the parasitoid Lariophagus distinguendus (Hymenoptera. Pteromalidae), on transgenic Bt maize

DEFF Research Database (Denmark)

Hansen, Lise S.; Lövei, Gabor L; Székács, András

2013-01-01

Background The effect of transgenic maize (Zea mays L.) containing a lepidopteran-specific Bt toxin on a stored-product pest, Sitophilus zeamais Motschulsky, and its parasitoid, Lariophagus distinguendus Förster, was examined in the laboratory to test the impact of transgenic maize on stored...

Seasonal abundance and development of the Asian longhorned beetle and natural enemy prevalence in different forest types in China

Science.gov (United States)

Houping Liu; Leah S. Bauer; Tonghai Zhao; Ruitong Gao; Therese M. Poland

2016-01-01

Seasonal abundance and population development of the Asian longhorned beetle (ALB), Anoplophora glabripennis (Motschulsky) (Coleoptera: Cerambycidae), and prevalence of its natural enemies were studied on Hankow willow (Salix matsudana Koidz.) at an urban forest site (Anci) and a rural forest site (Tangerli) in Hebei province...

Synergistic effect of dual imidacloprid-Metarhizium anisopliae applications against Asian longhorned beetles (Anoplophora glabripennis)

Science.gov (United States)

Todd A. Ugine; Calum W. Russell; Ann E. Hajek

2011-01-01

Anoplophora glabripennis (Motschulsky) (Coleoptera: Cerambycidae), a longhorned beetle species native to Asia, has been introduced into several North American and European cities. Currently, eradication and preventive measures are limited to identifying and destroying infested trees and protecting uninfested trees with trunk or soil-injections of the...

New associations between the Asian pests Anoplophora spp. and local parasitoids, in Italy (2005)

Science.gov (United States)

Franck Herard; Mariangela Ciampitti; Matteo Maspero; Christian Cocquempot; Gerard Delvare; Jamie Lopez; Mario Colombo

2007-01-01

The Asian longhorned beetle (ALB) Anoplophora glabripennis (Motschulsky), and the citrus longhorned beetle (CLB) Anoplophora chinensis (Forster) (Coleoptera, Cerambycidae) have been accidentally introduced in a few urban sites in North America and Europe where they are considered as serious threats to urban and natural forests, and...

Lethal Effects of Lambda-Cyhalothrin and Demand® CS on Asian Longhorned Beetle, Anoplophora glabripennis (Coleoptera: Cerambycidae): Implications for Population Suppression, Tree Protection, Eradication and Containment

Science.gov (United States)

We evaluated the 24h contact toxicity of lambda-cyhalothrin for adult Asian longhorned beetle, Anoplophora glabripennis Motschulsky, using topical application. Results showed that beetles are sensitive to lambda-cyhalothrin: the LD50 and LD90 were 0.13639 and 0.78461µg/beetle, respectively. Residual...

Contribution of different constituents to the toxicity of the essential oil ...

African Journals Online (AJOL)

The lethal toxicity of the major constituent of the essential oils of Vernonia amygdalina and Xylopia aetiopica, and of selected blends of these against Sitophilus zeamais (Motschulsky) (Coleoptera: Curculionidae) was compared with those of the full blends of the essential oils. The compounds were assayed in amounts and ...

Reproductive behaviors of Anoplophora glabripennis (Coleoptera: Cerambycidae) in the laboratory

Science.gov (United States)

Melody A. Keena; Vicente Sanchez

2007-01-01

There is a critical need for information on the reproductive behavior of Anoplophora glabripennis (Motschulsky) to provide the biological basis for predicting population dynamics, especially as the population size declines due to eradication efforts. To document the reproductive behaviors (both mating and oviposition) five males each from the Chicago...

Effects of pheromone and plant volatile release rates and ratios on trapping Anoplophora glabripennis (Coleoptera: Cerambycidae) in China

Science.gov (United States)

P.S. Meng; R.T. Trotter; M.A. Keena; T.C. Baker; S. Yan; E.G. Schwartzberg; K. Hoover

2014-01-01

Native to China and Korea, the Asian longhorned beetle, Anoplophora glabripennis (Motschulsky) (Coleoptera: Cerambycidae), is a polyphagous wood-boring pest for which a trapping system would greatly benefit eradication and management programs in both the introduced and native ranges. Over two field seasons, a total of 160 flight intercept panel traps...

Asian longhorned beetle (Coleoptera: Cerambycidae), an introduced pest of maple and other hardwood trees in North America and Europe

Science.gov (United States)

P.S. Meng; K. Hoover; M.A. Keena

2015-01-01

The Asian longhorned beetle, Anoplophora glabripennis (Motschulsky), threatens urban and forest hardwood trees both where introduced and in parts of its native range. Native to Asia, this beetle has hitchhiked several times in infested wood packaging used in international trade, and has established breeding populations in five U.S. states, Canada,...

Variation in Inspection Efficacy by Member States of Wood Packaging Material Entering the European Union

Science.gov (United States)

Dominic Eyre; Roy Macarthur; Robert A Haack; Yi Lu; Hannes Krehan

2018-01-01

The use of wood packaging materials (WPMs) in international trade is recognized as a pathway for the movement of invasive pests and as the origin of most introductions of Asian longhorned beetle, Anoplophora glabripennis (Motschulsky) (Coleoptera: Cerambycidae) in Europe and North America. Following several pest interceptions on WPM associated with...

Determination of the Heterotic groups of Maize inbred lines and the ...

African Journals Online (AJOL)

Maize weevil (Sitophilus zeamais Motschulsky) is a major maize (Zea mays L) storage insect pest in the tropics. Fifty-two inbred lines developed for weevil resistance were crossed to two testers, A and B, to determine their heterotic groups and inheritance of resistance to maize weevil. For 10 testcrosses selected for ...

Effects of host species and population density on Anoplophora glabripennis flight propensity

Science.gov (United States)

Joseph A. Francese; David R. Lance; Baode Wang; Zhichun Xu; Alan J. Sawyer; Victor C. Mastro

2007-01-01

Anoplophora glabripennis Motschulsky (Coleoptera: Cerambycidae), the Asian longhorned beetle (ALB) is a pest of hardwoods in its native range of China. While the host range of this pest has been studied extensively, its mechanisms for host selection are still unknown. Our goal was to study the factors influencing movement and orientation of adult ALB...

Host tree resistance against the polyphagous

Science.gov (United States)

W. D. Morewood; K. Hoover; P. R. Neiner; J.R. McNeil; J. C. Sellmer

2004-01-01

Anoplophora glabripennis (Motschulsky) (Coleoptera: Cerambycidae: Lamiini) is an invasive wood-boring beetle with an unusually broad host range and a proven ability to increase its host range as it colonizes new areas and encounters new tree species. The beetle is native to eastern Asia and has become an invasive pest in North America and Europe,...

Distribution and Abundance of Anoplophora glabripennis (Coleoptera: Cerambycidae) in Natural Acer Stands in South Korea

Science.gov (United States)

David W. Williams; Hai-Poong Lee; Kwon Kim

2004-01-01

Anoplophora glabripennis (Motschulsky) (Asian longhorned beetle) was found attacking street trees in New York City and Chicago in the 1990s, after its accidental introduction from East Asia, and is currently the subject of a major eradication campaign by the U.S. Department of Agriculture. The borer has been a destructive outbreak pest in poplar plantations in China...

Development of the teneral adult Anoplophora glabripennis (Coleoptera: Cerambycidae): time to initiate and completely bore out of maple wood

Science.gov (United States)

V. Sanchez; M.A. Keena

2013-01-01

Anoplophora glabripennis (Motschulsky) is an introduced invasive pest with the potential to devastate hardwood forests in North America. Using artificial pupal chambers, we documented the time required by teneral adults at three temperatures (20, 25, and 30°C), 60-80% RH, and a photoperiod of 16:8 (L:D) h to initiate boring after eclosion...

Author Details

African Journals Online (AJOL)

Okorie, M.N. Vol 40, No 1-2 (2009) - Articles Toxicity of some biopesticides to Sitophilus zeamais motschulsky on maize in storage. Abstract. ISSN: 0300-368X. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and ...

Toxicity of the Essential Oil of Illicium difengpi Stem Bark and Its Constituent Compounds Towards Two Grain Storage Insects

OpenAIRE

Sha Chu, Sha; Fang Wang, Cheng; Shan Du, Shu; Liang Liu, Shao; Long Liu, Zhi

2011-01-01

During our screening program for new agrochemicals from Chinese medicinal herbs, the essential oil of Illicium difengpi stem bark was found to possess strong insecticidal activities against the maize weevil, Sitophilus zeamais (Motschulsky) (Coleoptera: Curculionidae) and red flour beetle, Tribolium castaneum Herbst (Coleoptera: Tenebrionidae). A total of 37 components of the essential oil of I. difengpi were identified. The main components of the essential oil were safrole (23.61%), linalool...

Atmospheric versus biological sources of polycyclic aromatic hydrocarbons (PAHs) in a tropical rain forest environment.

Science.gov (United States)

Krauss, Martin; Wilcke, Wolfgang; Martius, Christopher; Bandeira, Adelmar G; Garcia, Marcos V B; Amelung, Wulf

2005-05-01

To distinguish between pyrogenic and biological sources of PAHs in a tropical rain forest near Manaus, Brazil, we determined the concentrations of 21 PAHs in leaves, bark, twigs, and stem wood of forest trees, dead wood, mineral topsoil, litter layer, air, and Nasutitermes termite nest compartments. Naphthalene (NAPH) was the most abundant PAH with concentrations of 35 ng m(-3) in air (>85% of the sum of 21PAHs concentration), up to 1000 microg kg(-1) in plants (>90%), 477 microg kg(-1) in litter (>90%), 32 microg kg(-1) in topsoil (>90%), and 160 microg kg(-1) (>55%) in termite nests. In plants, the concentrations of PAHs in general decreased in the order leaves > bark > twigs > stem wood. The concentrations of most low-molecular weight PAHs in leaves and bark were near equilibrium with air, but those of NAPH were up to 50 times higher. Thus, the atmosphere seemed to be the major source of all PAHs in plants except for NAPH. Additionally, phenanthrene (PHEN) had elevated concentrations in bark and twigs of Vismia cayennensis trees (12-60 microg kg(-1)), which might have produced PHEN. In the mineral soil, perylene (PERY) was more abundant than in the litter layer, probably because of in situ biological production. Nasutitermes nests had the highest concentrations of most PAHs in exterior compartments (on average 8 and 15 microg kg(-1) compared to atmosphere controls the concentrations of most PAHs. However, the occurrence of NAPH, PHEN, and PERY in plants, termite nests, and soils at elevated concentrations supports the assumption of their biological origin.

Dicty_cDB: Contig-U14355-1 [Dicty_cDB

Lifescience Database Archive (English)

Full Text Available lkiii*iwl *ly*iiivk*ipmklipliqkvihhyimpyslnvlikfsciy*ikrkyvlenviwmvihh fiisvknsnhqnvre*fkp*lkkvqiltnkiim...AQ046505 ) RPCI11-42E14.TJ RPCI-11 Homo sapiens genomic clon... 46 1.5 1 ( EJ349319 ) 1092963571972 Global-Ocean-Sampli...655( CP000236 |pid:none) Ehrlichia chaffeensis str. Arkan... 46 0.001 DQ058898_1( DQ058898 |pid:none) Nasutitermes graveolus reli...041156664 Global-Ocean-Sampling_GS-34-01-01-1... 48 0.37 1 ( EJ247332 ) 1095337027578 Global-Ocean-Sampling_...ry Neovison vison ... 46 1.5 1 ( ER388657 ) 1094428746559 Global-Ocean-Sampling_GS-34-01-01-1... 46 1.5 1 (

Conodont zonation of Lower Triassic strata in Slovenia

Directory of Open Access Journals (Sweden)

Tea Kolar-Jurkovšek

2015-12-01

Full Text Available The paper presents the results of a conodont study carried out in the Triassic strata in the area of the Slovenian part of the Southern Alps, External Dinarides and the Transition region between the External and Internal Dinarides. The following conodont zones have been distinguished: Hindeodus praeparvus Z., H. parvus Z., Isarcicella lobata Z., I. staeschei – I. isarcica Z., H. postparvus Z., Hadrodontina aequabilis Z., Ha. anceps Z., Eurygnathodus costatus Z., Neospathodus planus Z., N. robustus Z., Platyvillosus corniger Z., Pl. regularis Z., Pachycladina obliqua Z., Foliella gardenae Z., Triassospathodus hungaricus Z., T. symmetricus Z., N. robustispinus - T. homeri Z. and T. triangularis Z. The introduced conodont zonation spans from the Induan, including the Permian-Triassic boundary interval to the late Olenekian and is valid for the shallow shelf environments of western Tethys.

Origin and alteration of organic matter in termite mounds from different feeding guilds of the Amazon rainforests.

Directory of Open Access Journals (Sweden)

Nina Siebers

Full Text Available The impact of termites on nutrient cycling and tropical soil formation depends on their feeding habits and related material transformation. The identification of food sources, however, is difficult, because they are variable and changed by termite activity and nest construction. Here, we related the sources and alteration of organic matter in nests from seven different termite genera and feeding habits in the Terra Firme rainforests to the properties of potential food sources soil, wood, and microepiphytes. Chemical analyses comprised isotopic composition of C and N, cellulosic (CPS, non-cellulosic (NCPS, and N-containing saccharides, and molecular composition screening using pyrolysis-field ionization mass spectrometry (Py-FIMS. The isotopic analysis revealed higher soil δ13C (-27.4‰ and δ15N (6.6‰ values in nests of wood feeding Nasutitermes and Cornitermes than in wood samples (δ13C = -29.1‰, δ15N = 3.4‰, reflecting stable-isotope enrichment with organic matter alterations during or after nest construction. This result was confirmed by elevated NCPS:CPS ratios, indicating a preferential cellulose decomposition in the nests. High portions of muramic acid (MurAc pointed to the participation of bacteria in the transformation processes. Non-metric multidimensional scaling (MDS revealed increasing geophagy in the sequence Termes < Embiratermes < Anoplotermes and increasing xylophagy for Cornitermes < Nasutitermes., and that the nest material of Constrictotermes was similar to the microepiphytes sample, confirming the report that Constrictotermes belongs to the microepiphyte-feeders. We therewith document that nest chemistry of rainforest termites shows variations and evidence of modification by microbial processes, but nevertheless it primarily reflects the trophic niches of the constructors.

Screening of promising maize genotypes against maize weevil (Sitophilus zeamais Motschulky) in storage condition

OpenAIRE

Ram B Paneru; Resham B Thapa

2017-01-01

The maize weevil (Sitophilus zeamais Motschulsky) is a serious pest of economic importance in stored grains. It causes major damage to stored maize grain thereby reducing its weight, quality and germination. An experiment was conducted in randomized complete block design (RCBD) with 3 replications to screen 32 maize genotypes against maize weevil in no-choice and free-choice conditions at Entomology Division, Khumaltar, Lalitpur (Room temperature: Maximum 24-32°C and Minimum 18-27°C). The fin...

I. Structural studies of termite defense secretions. II. Structural studies of natural products of marine nudibranchs. [Kempene, tridachione

Energy Technology Data Exchange (ETDEWEB)

Solheim, B.A.

1977-12-01

Three families of termites have the ability to produce a sticky secretion that envelopes and immobilizes the enemy. In the family Termitidae the secretion contains the diterpenoid hydrocarbons, kempene I and kempene II. The molecular structure of kempene II from the termite, Nasutitermes kempae, is described in detail. Another species of termite, Cubitermes umbratus, contained the diterpenoid hydrocarbon biflora-4,10-19,15-triene in the secretion and this compound is described. Studies were also conducted on the mucous secretion of the pedal gland of the marine nudibranch, Tidachiella diomedea. Tridachione, a substituted ..gamma..-pyrone, was isolated in the pure state and its molecular structure is described in detail. (HLW)

Popularity of Different Lampyrid Species in Japanese Culture as Measured by Google Search Volume.

Science.gov (United States)

Takada, Kenta

2011-07-05

I investigated the popularity of different lampyrid species (34 species) in Japanese culture as part of a study on cultural entomology. Popularity was assessed by the Google search volume for Japanese lampyrid species names in katakana and hiragana scripts, using the Keyword Tool of Google AdWords. The search volume of lampyrid species as "Genji-botaru" (Luciola cruciata Motschulsky), "Heike-botaru" (Luciola lateralis Motschulsky) and "Hime-botaru" (Hotaria parvula Kiesenwetter), in either or both katakana and hiragana syllabic scripts, was enormously high relative to other lampyrid species, indicating the biased attention of Japanese to these lampyrid species. In addition, search volumes for familial or common lampyrid name ("Hotaru") was assessed and compared with that of 34 lampyrid species. This analyzing result showed that: (1) the search volumes for katakana and hiragana were 37.7 and 773.1 times higher for "Hotaru" than "Genji-botaru", respectively; and (2) the search volume for all lampyrid species was clearly higher in katakana than hiragana, whereas the search volumes for "Hotaru" were clearly higher in hiragana than katakana. These results suggest that: (1) the Japanese public tends to perceive lampyrids with not a clear but an ambiguous taxonomic view; and (2) the attitude of the Japanese public toward lampyrids differs between those who perceive lampyrids with a clear taxonomic view (at species level) and with an ambiguous taxonomic view.

Durabilidade natural do estipe de pupunha (Bactris gasipaes Kunth, Arecaceae II: insetos Natural durability of Bactris gasipaes Kunth (peach palm, Arecaceae stipe II: insects

Directory of Open Access Journals (Sweden)

Raimunda Liege Souza de Abreu

2004-09-01

Full Text Available Neste trabalho estão apresentados os resultados da durabilidade natural do estipe (madeira de Bactris gasipaes Kunth (pupunha, quando submetido ao ataque de insetos xilófagos, em ensaios em ambiente florestal e urbano. Foram utilizados dez palmeiras, cinco com espinhos e cinco sem espinhos, de plantios da Fazenda Experimental da Universidade Federal do Amazonas, localizada no km 40 da rodovia Manaus-Boa Vista (BR 174. De cada uma das palmeiras foram cortados três discos de aproximadamente 30 cm de espessura, retirados da base, do meio e do topo. No ambiente florestal, os discos foram distribuídos aleatoriamente, em área próxima ao plantio, no espaçamento de 0,5m, permanecendo durante 18 meses, período no qual foram efetuadas seis inspeções trimestrais para avaliar o grau de deterioração e coleta de insetos. Para o ensaio em condição urbana, os discos foram secionados axialmente para a retirada da medula e distribuídos aleatoriamente, nas posições côncava e convexa, sobre uma estrutura de madeira, localizada no Campus do INPA em Manaus, e inspecionados bimestralmente por um ano. Os resultados do ensaio no ambiente florestal indicaram que a maioria dos discos foi deteriorada por térmitas e a vida útil da base foi em torno de 18 meses, a do meio e do topo em torno de 15. As principais espécies de cupins foram: Heterotermes tenuis (Hagen (Rhinotermitidae responsável pela deterioração da parte basal, mediana e o topo; Nasutitermes similis Emerson (Termitidae que infestou a região da base e do meio; Anoplotermes sp.(Termitidae e Nasutitermes tatarandae (Holmgren (Termitidae responsáveis pela infestação da parte mediana do estipe. No ambiente urbano, o principal responsável pela deterioração das amostras foi o besouro Dinoderus bifoveolatus Wollston (Bostrichidae, e em seguida, o térmita N. similis.The durability of the stipe of Bactris gasipaes Kunth (Peach palm when under attack by xylophage insects, is evaluated in

Extraction and Characterization of Chitin from the Beetle Holotrichia parallela Motschulsky

Directory of Open Access Journals (Sweden)

Feng Zhu

2012-04-01

Full Text Available Insect chitin was isolated from adult Holotrichia parallela by treatment with 1 M HCl and 1 M NaOH, following by 1% potassium permanganate solution for decolorization. The yield of chitin from this species is 15%. This insect chitin was compared with the commercial a-chitin from shrimp, by infrared spectroscopy, X-ray diffraction, scanning electron microscopy, and elemental analysis. Both chitins exhibited similar chemical structures and physicochemical properties. Adult H. parallela is thus a promising alternative source of chitin.

A long-living species of the hydrophiloid beetles: Helophorus sibiricus from the early Miocene deposits of Kartashevo (Siberia, Russia

Directory of Open Access Journals (Sweden)

Martin Fikácek

2011-09-01

Full Text Available The recent hydrophiloid species Helophorus (Gephelophorus sibiricus (Motschulsky, 1860 is recorded from the early Miocene deposits of Kartashevo assigned to the Ombinsk Formation. A detailed comparison with recent specimens allowed a confident identification of the fossil specimen, which is therefore the oldest record of a recent species for the Hydrophiloidea. The paleodistribution as well as recent distribution of the species is summarized, and the relevance of the fossil is discussed. In addition, the complex geological settings of the Kartashevo area are briefly summarized.

Taxonomic review of Chinese species of ground beetles of the subgenus Pseudoophonus (genus Harpalus) (Coleoptera: Carabidae).

Science.gov (United States)

Kataev, Boris M; Liang, Hongbin

2015-02-19

A taxonomic review of 23 species of the subgenus Pseudoophonus Motschulsky, 1844, the genus Harpalus Latreille, 1802, occurring in China is given, and a key to these species is provided. The species are divided in three species groups and five subgroups, the distinctive characters of which are listed. The following new synonyms are established: Harpalus calceatus Duftschmid, 1812 = Anisodactylus propinquus Ballion, 1870, syn. n.; H. davidi (Tschitschérine, 1897) = H. kailiensis Huang, 1992, syn. n.; = H. adenticulatus Huang, 1992, syn. n.; = H. cilihumerus Huang, Hu & Sun, 1994, syn. n.; H. fokienensis Schauberger, 1930 = H. muciulus Huang, 1992, syn. n.; H. griseus (Panzer, 1796) = H. xinjiangensis Huang, Hu & Sun, 1994, syn. n.; H. hauserianus Schauberger, 1929 = H. disaogashimensis Huang, 1995, syn. n.; H. pastor pastor Motschulsky, 1844 = H. penglainus Huang, Hu & Sun, 1994, syn. n.; = H. chiloschizontus Huang, 1995, syn. n.; H. rufipes (DeGeer, 1774) = H. scabripectus Huang, Hu & Sun, 1994, syn. n.; H. singularis Tschitschérine, 1906 = H. chengjiangensis Huang, 1993, syn. n.; H. sinicus Hope, 1845 = H. periglabellus Huang, 1992, syn. n.; = H. longihornus Lei & Huang, 1997, syn. n.; and H. tridens Morawitz, 1862 = H. hypogeomysis Huang, 1993, syn. n.; = H. pilosus Huang, 1995, syn. n. Statuses of H. yinchuanensis Huang, 1993 and H. disimuciulus Huang, Lei, Yan & Hu, 1996 are discussed. Lectotypes are designated for H. capito Morawitz, 1862, H. japonicus Morawitz, 1862 and H. eous Tschitschérine, 1901. New data on distribution of Pseudoophonus species in China are provided. Harpalus babai Habu, 1973 is reported from China (Jiangxi) for the first time. The following taxa are recorded from the following Chinese provinces for the first time: H. ussuriensis Chaudoir, 1863 from Hunan; H. aenigma (Tschitschérine, 1897) from Hubei, Jiangxi, and Guangxi; H. pastor Motschulsky, 1844 from Beijing and Xizang; H. fokienensis Schauberger, 1930 from Anhui and Jiangxi; H

Popularity of Different Lampyrid Species in Japanese Culture as Measured by Google Search Volume

Directory of Open Access Journals (Sweden)

Kenta Takada

2011-07-01

Full Text Available I investigated the popularity of different lampyrid species (34 species in Japanese culture as part of a study on cultural entomology. Popularity was assessed by the Google search volume for Japanese lampyrid species names in katakana and hiragana scripts, using the Keyword Tool of Google AdWords. The search volume of lampyrid species as “Genji-botaru” (Luciola cruciata Motschulsky, “Heike-botaru” (Luciola lateralis Motschulsky and “Hime-botaru” (Hotaria parvula Kiesenwetter, in either or both katakana and hiragana syllabic scripts, was enormously high relative to other lampyrid species, indicating the biased attention of Japanese to these lampyrid species. In addition, search volumes for familial or common lampyrid name (“Hotaru” was assessed and compared with that of 34 lampyrid species. This analyzing result showed that: (1 the search volumes for katakana and hiragana were 37.7 and 773.1 times higher for “Hotaru” than “Genji-botaru”, respectively; and (2 the search volume for all lampyrid species was clearly higher in katakana than hiragana, whereas the search volumes for “Hotaru” were clearly higher in hiragana than katakana. These results suggest that: (1 the Japanese public tends to perceive lampyrids with not a clear but an ambiguous taxonomic view; and (2 the attitude of the Japanese public toward lampyrids differs between those who perceive lampyrids with a clear taxonomic view (at species level and with an ambiguous taxonomic view.

Ekstrakcija kofeina iz različnih naravnih virov ter njegov učinek na izbrane škodljivce

OpenAIRE

Gačnik, Barbara

2017-01-01

Eden od pomembnejših sekundarnih metabolitov, ki ga najdemo v kavi, čajih, guarani itn. je kofein. Kofein rastlino ščiti pred herbivori in patogenimi organizmi. Naš namen je bil preveriti kakšne vsebnosti kofeina vsebujejo različni rastlinski viri in ali bi lahko kofein uporabili kot naravno sredstvo za varstvo rastlin pred škodljivci. V našem primeru sta bila to skladiščni škodljivec koruzni žužek (Sitophilus zeamais Motschulsky) in siva breskova uš (Myzus persicae Sulzer). Iz različnih nara...

Atmospheric versus biological sources of polycyclic aromatic hydrocarbons (PAHs) in a tropical rain forest environment

International Nuclear Information System (INIS)

Krauss, Martin; Wilcke, Wolfgang; Martius, Christopher; Bandeira, Adelmar G.; Garcia, Marcos V.B.; Amelung, Wulf

2005-01-01

To distinguish between pyrogenic and biological sources of PAHs in a tropical rain forest near Manaus, Brazil, we determined the concentrations of 21 PAHs in leaves, bark, twigs, and stem wood of forest trees, dead wood, mineral topsoil, litter layer, air, and Nasutitermes termite nest compartments. Naphthalene (NAPH) was the most abundant PAH with concentrations of 35 ng m -3 in air (>85% of the Σ21PAHs concentration), up to 1000 μg kg -1 in plants (>90%), 477 μg kg -1 in litter (>90%), 32 μg kg -1 in topsoil (>90%), and 160 μg kg -1 (>55%) in termite nests. In plants, the concentrations of PAHs in general decreased in the order leaves > bark > twigs > stem wood. The concentrations of most low-molecular weight PAHs in leaves and bark were near equilibrium with air, but those of NAPH were up to 50 times higher. Thus, the atmosphere seemed to be the major source of all PAHs in plants except for NAPH. Additionally, phenanthrene (PHEN) had elevated concentrations in bark and twigs of Vismia cayennensis trees (12-60 μg kg -1 ), which might have produced PHEN. In the mineral soil, perylene (PERY) was more abundant than in the litter layer, probably because of in situ biological production. Nasutitermes nests had the highest concentrations of most PAHs in exterior compartments (on average 8 and 15 μg kg -1 compared to -1 in interior parts) and high PERY concentrations in all compartments (12-86 μg kg -1 ), indicating an in situ production of PERY in the nests. Our results demonstrate that the deposition of pyrolytic PAHs from the atmosphere controls the concentrations of most PAHs. However, the occurrence of NAPH, PHEN, and PERY in plants, termite nests, and soils at elevated concentrations supports the assumption of their biological origin. - Evidence of non-pyrolytic, biogenic production of PAHs is provided

Using termite nests as a source of organic matter in agrosilvicultural production systems in Amazonia Uso de ninhos de cupin como fonte de matéria orgânica em sistemas de produção agrosilviculturais na Amazônia

Directory of Open Access Journals (Sweden)

L. S. Batalha

1995-08-01

Full Text Available The growth of two annual crops, okra (Abelmoschus escutentus and egg-plant (Solatium melongena and one perennial crop, andiroba (Carapa guianensis, a native forest tree of Amazonia under different treatments with organic manure derived from termite nest material of wood-feeding Nasutitermes species was tested (randomized block design. The use of 25-100 g of nest material gave no significant increase in okra productivity, and 25-200 g gave no significant response in andiroba. The combined use of NPK with 200 g of nest material gave a significant higher production in egg-plant (total number and total fresh weight of fruits when compared to the control (without fertilizer and to the treatment with NPK only.The results suggest the possibility to use termite nest material to enhance crop production in Amazonia, particularly in combination with low amounts of mineral fertilizer. Research lines for further investigations are outlined.Foi avaliado crescimento de duas espécies agriculturais anuais, quiabo (Abelmoschus esculentus e berinjela (Solatium melongena, e de uma espécie perene, andiroba (Carapa guianensis, uma árvore nativa da Amazônia sob diferentes tratamentos com matéria orgânica derivada de material de cupinzeiro de espécies xilófagas de Nasutitermes (desenho de bloco randomizado. O uso de 25-100 g de material de termiteiro não levou a um incremento significativo da produtividade em quiabo, e 25-200 g não resultou numa resposta significativa em andiroba. O uso combinado de NPK com 200 g de ninho de cupim resultou numa produção significantemente maior em S. melongena (número total e peso fresco total de frutos se comparado com o controle (sem fertilizante nenhum e com o tratamento de NPK apenas. Os resultados sugerem a possibilidade de usar material de cupinzeiro para melhorara produção agrossilvicultural na Amazônia, especialmente em combinação com pequenas quantidades de fertilizante mineral Linhas de pesquisa para futuras

Chemosensory gene families in adult antennae of Anomala corpulenta Motschulsky (Coleoptera: Scarabaeidae: Rutelinae.

Directory of Open Access Journals (Sweden)

Xiao Li

Full Text Available The metallic green beetle, Anomala corpulenta (Coleoptera: Scarabaeidae: Rutelinae, is a destructive pest in agriculture and horticulture throughout Asia, including China. Olfaction plays a crucial role in the survival and reproduction of A. corpulenta. As a non-model species, A. corpulenta is poorly understood, and information regarding the molecular mechanisms underlying olfaction in A. corpulenta and other scarab species is scant.We assembled separate antennal transcriptome for male and female A. corpulenta using Illumina sequencing technology. The relative abundance of transcripts with gene ontology annotations, including those related to olfaction in males and females was highly similar. Transcripts encoding 15 putative odorant binding proteins, five chemosensory proteins, one sensory neuron membrane protein, 43 odorant receptors, eight gustatory receptors, and five ionotropic receptors were identified. The sequences of all of these chemosensory-related transcripts were confirmed using reverse transcription polymerase chain reaction (RT-PCR, and direct DNA sequencing. The expression patterns of 54 putative chemosensory genes were analyzed using quantitative real time RT-PCR (qRT-PCR. Antenna-specific expression was detected for many of these genes, suggesting that they may have important functions in semiochemical detection.The identification of a large number of chemosensory proteins provides a major resource for the study of the molecular mechanism of odorant detection in A. corpulenta and its chemical ecology. The genes identified, especially those that were expressed at high levels in the antennae may represent novel molecular targets for the development of population control strategies based on the manipulation of chemoreception-driven behaviors.

A synopsis of the South American Hydrovatus (Coleoptera: Dytiscidae: Hydroporinae, with notes on habitat and distribution, and a key to species Sinopsis de los Hydrovatus sudamericanos (Coleoptera: Dytiscidae: Hydroporinae, con notas sobre hábitat y distribución, y una clave para las especies

Directory of Open Access Journals (Sweden)

Edgardo R. Trémouilles

2005-07-01

Full Text Available We revised the South American members of the genus Hydrovatus Motschulsky. Each of the three recognized species is diagnosed, with emphasis on diagnostic characters. A key summarizing the main differences is provided. To identify South American specimens of H. caraibus Sharp, they were compared with Central American specimens, including type material. Based on the material examined, H. caraibus is a species broadly distributed in Central and South America, with representatives of different areas separated by minor differences. The geographical distributions of the three species are considerably enlarged: H. crassulus Sharp and H. turbinatus Zimmermann are recorded for the first time from Paraguay, and H. caraibus is recorded for the first time from Argentina and Nicaragua. Bionomical information of the species is presented.Se estudiaron los representantes sudamericanos del género Hydrovatus Motschulsky. Se diagnostica cada una de las tres especies conocidas, enfatizando el reconocimiento de caracteres valiosos para su identificación; las principales diferencias se resumen en una clave. Para identificar los ejemplares sudamericanos de H. caraibus Sharp, se los comparó con especímenes de América Central, incluyendo material tipo. En base al material examinado, H. caraibus se encuentra ampliamente distribuida en America Central y del Sur, con representantes de diferentes áreas separados por diferencias menores. Las distribuciones geográficas de las tres especies se amplían considerablemente: H. crassulus Sharp y H. turbinatus Zimmermann se citan por primera vez de Paraguay, y H. caraibus se cita por primera vez de Argentina y Nicaragua. Se presenta información bionómica de las especies.

A new species and new records of Molophilus Curtis, 1833 (Diptera: Limoniidae) from the Western Palaearctic Region.

Science.gov (United States)

Kolcsár, Levente-Péter; Török, Edina; Keresztes, Lujza

2015-01-01

Molophilus Curtis, 1833 is the most species-rich Limoniidae genus with a total number of 1006 species and subspecies, from which 97 are recorded in the Western-Palaearctic region so far. However new species are still expected from less investigated regions, like the Balkans or the Eastern Europe. In the present article, we desrcibe a new limonid crane fly species, Molophilus balcanicus Kolcsár sp. n. from the Central Balkan area (Bulgaria). This new taxa is closely related to M. serpentiger Edwards, 1938 and M. variispinus Starý​, 1971 based on the external male genital structures, but differs from its siblings mostly in the structure of the inner and outer gonostylus. Additionally, a number of species are reported for the first time from various European countries, like M. variispinus Starý, 1971 and M. occultus de Meijere, 1918 from Romania; M. crassipygus de Meijere 1918, M. obsoletus Lackschewitz, 1940 and M. medius de Meijere, 1918 from Greece; M. flavus Goetghebuer, 1920 from Andorra; M. cinereifrons de Meijere, 1920 from Bulgaria and M. corniger Meijere, 1920 from Spain.

Development of biological coal gasification (MicGAS process). Final report, May 1, 1990--May 31, 1995

Energy Technology Data Exchange (ETDEWEB)

NONE

1998-12-31

ARCTECH has developed a novel process (MicGAS) for direct, anaerobic biomethanation of coals. Biomethanation potential of coals of different ranks (Anthracite, bitumious, sub-bitumious, and lignites of different types), by various microbial consortia, was investigated. Studies on biogasification of Texas Lignite (TxL) were conducted with a proprietary microbial consortium, Mic-1, isolated from hind guts of soil eating termites (Zootermopsis and Nasutitermes sp.) and further improved at ARCTECH. Various microbial populations of the Mic-1 consortium carry out the multi-step MicGAS Process. First, the primary coal degraders, or hydrolytic microbes, degrade the coal to high molecular weight (MW) compounds. Then acedogens ferment the high MW compounds to low MW volatile fatty acids. The volatile fatty acids are converted to acetate by acetogens, and the methanogens complete the biomethanation by converting acetate and CO{sub 2} to methane.

IMPACT OF TROPICAL RAIN FOREST CONVERSION ON THE DIVERSITY AND ABUNDANCE OF TERMITES IN JAMBI PROVINCE (Dampak Konversi Hutan Tropika Basah Terhadap Keragaman Jenis dan Kelimpahan Rayap di Provinsi Jambi

Directory of Open Access Journals (Sweden)

Suryo Hardiwinoto

2010-03-01

Full Text Available ABSTRACT The degradation of tropical rain forest might exert impacts on biodiversity loss and affect the function and stability of the ecosystems. The objective of this study was to clarify the impacts of tropical rain forests conversion into other land-uses on the diversity and abundance of termites in Jambi, Sumatera. Six land use types used in this study were primary forest, secondary forest, rubber plantation, oil-palm plantation, cassava cultivation and Imperata grassland. The result showed that a total of 30 termite species were found in the six land use types, with highest species richness and abundance in the forests. The species richness and the relative abundance of termites decreased significantly when the tropical rain forests were converted to rubber plantation and oil-palm plantation. The loss of species richness was much greater when the forests were changed to cassava cultivation and Imperata grassland, while their abundance greatly decreased when the forests were degraded to Imperata grassland. Termite species which had high relative abundances in primary and secondary forests were Dicuspiditermes nemorosus, Schedorhinotermes medioobscurus, Nasutitermes longinasus and Procapritermes setiger.   ABSTRAK  Kerusakan hutan tropika basah dapat menimbulkan dampak lingkungan berupa penurunan keanekaragaman hayati serta terganggunya fungsi dan stabilitas ekosistem. Tujuan dari penelitian ini adalah untuk mengetahui dampak konversi hutan tropika basah  menjadi bentuk penggunaan lahan lain di Jambi Sumatra terhadap keragaman jenis dan kelimpahan rayap. Enam tipe penggunaan lahan yang digunakan dalam penelitian ini adalah hutan primer, hutan sekunder, tanaman karet, tanaman kelapa sawit, kebun ketela pohon dan padang alang-alang. Hasil penelitian menunjukkan bahwa ditemukan 30 jenis rayap pada 6 tipe penggunaan lahan tersebut, dengan keragaman jenis dan kelimpahan individu rayap tertinggi pada lahan hutan. Kekayaan jenis dan kelimpahan

Perception of gamma radiation by adults of Sitophilus zeamais mots

International Nuclear Information System (INIS)

Wiendl, F.M.; Walder, J.M.M.

1975-05-01

Perception of gamma radiation by living organisms has been evidenced only a few times. The occurence of such perception with maize weevil, Sitophilus zeamais Motschulsky is presented. Tubes containing maize weevil were placed in a radial position to a gamma source. Counting of the insects inside the tubes at different distances from the source was made immediately after irradiation. It was noticed that the insects submitted to irradiation had been driven away from the source as compared with those not submitted (control). A possible relationship exists between this effect and the Cerenkov effect which affects directly the visual organs of the insect. This is probably due to the fact that the insects have a large quantity of water in the occular cells

Resposta de Sitophilus zeamais Motschulsky 1885 (Coleoptera: Curculionidae frente ao extrato de Capsicum annuum L.

Directory of Open Access Journals (Sweden)

Juliana Ferreira da Silva

2013-08-01

Full Text Available O uso desenfreado de agrotóxicos vem a ser um caso de saúde pública, pois prejudica a saúde do trabalhador do campo assim como do consumidor final desses produtos. O Sitophilus zeamais é uma praga de armazenamento que ataca o milho, e no combate a essa praga comumente é utilizado produtos tóxicos. Visando essa problemática, a busca por produtos alternativos vem a ser um campo de investigação promissor, pois esse método de controle não gera resíduos para o homem tão pouco ao meio ambiente. O extrato utilizado para avaliar o potencial de repelência foi o de Capsicum annuum L. popularmente conhecido como pimentão. Os testes foram realizados com a utilização de arenas, onde em cada arena foram liberados 30 adultos de S. zeamais, não sexados e após 24 horas, foram registrados o número de insetos em cada recipiente. Os grãos de milho foram tratados com volume de extrato correspondente a 1,0% da massa de grãos, nas concentrações 0,0 (álcool 70%; 25,0; 50,0; 75,0 e 100,0% (volume de extrato/volume álcool. O experimento foi organizado segundo o delineamento inteiramente casualizado e constou de cinco tratamentos e quatro repetições. As maiores repelências foram observadas nas concentrações de 25% e 100%, repelindo 72 e 70% dos insetos respectivamente. Sendo assim a utilização desse extrato pode ser empregado no tratamento de sementes armazenadas, evitando assim uma maior infestação desses insetos, preservando assim a integridade física e fisiológica das sementes.

De novo sequencing, assembly and characterization of antennal transcriptome of Anomala corpulenta Motschulsky (Coleoptera: Rutelidae.

Directory of Open Access Journals (Sweden)

Haoliang Chen

Full Text Available Anomala corpulenta is an important insect pest and can cause enormous economic losses in agriculture, horticulture and forestry. It is widely distributed in China, and both larvae and adults can cause serious damage. It is difficult to control this pest because the larvae live underground. Any new control strategy should exploit alternatives to heavily and frequently used chemical insecticides. However, little genetic research has been carried out on A. corpulenta due to the lack of genomic resources. Genomic resources could be produced by next generation sequencing technologies with low cost and in a short time. In this study, we performed de novo sequencing, assembly and characterization of the antennal transcriptome of A. corpulenta.Illumina sequencing technology was used to sequence the antennal transcriptome of A. corpulenta. Approximately 76.7 million total raw reads and about 68.9 million total clean reads were obtained, and then 35,656 unigenes were assembled. Of these unigenes, 21,463 of them could be annotated in the NCBI nr database, and, among the annotated unigenes, 11,154 and 6,625 unigenes could be assigned to GO and COG, respectively. Additionally, 16,350 unigenes could be annotated in the Swiss-Prot database, and 14,499 unigenes could map onto 258 pathways in the KEGG Pathway database. We also found 24 unigenes related to OBPs, 6 to CSPs, and in total 167 unigenes related to chemodetection. We analyzed 4 OBPs and 3CSPs sequences and their RT-qPCR results agreed well with their FPKM values.We produced the first large-scale antennal transcriptome of A. corpulenta, which is a species that has little genomic information in public databases. The identified chemodetection unigenes can promote the molecular mechanistic study of behavior in A. corpulenta. These findings provide a general sequence resource for molecular genetics research on A. corpulenta.

Eficácia biológica de bifentrina aplicado em milho armazenado sob diferentes temperaturas Biological efficacy of applied bifenthrin in stored corn under different temperatures

Directory of Open Access Journals (Sweden)

Marco A. G. Pimentel

2005-06-01

Full Text Available Considerando-se as altas temperaturas nos graneleiros junto à esteira transportadora de grãos objetivou-se, neste trabalho, avaliar a influência da temperatura no momento da pulverização, sobre a eficácia biológica do bifentrina. Para isso, pulverizou-se o inseticida sobre grãos de milho dentro de uma câmara climática nas temperaturas de 25, 30, 35, 40, 45 e 50 ºC, com umidade relativa em torno de 55%. Após a pulverização e a cada 15 dias, até completar 90 dias, foram feitas as análises da eficácia biológica utilizando-se os insetos Sitophilus zeamais Motschulsky (Coleoptera: Curculionidae, Rhyzopertha dominica (Fabricius (Coleoptera: Bostrichidae e Tribolium castaneum (Herbst (Coleoptera: Tenebrionidae. Observou-se tendência decrescente da eficácia biológica do bifentrina com o aumento da temperatura do ar ambiente, no momento da pulverização e com o maior tempo de armazenamento dos grãos de milho, resultando em menor mortalidade dos insetos-praga.Considering the high temperatures in the granary ships alongwith the transporting mat, the objective of this paper was to evaluate the influence of the temperature at the moment of spraying on the biological effectiveness of the bifenthrin. For the purpose the insecticide was sprayed on maize grains inside a climatic chamber maintained at the temperatures of 25, 30, 35, 40, 45 and 50 ºC with relative humidity around 55%. After the spraying and every fifteen days up to 90 days, analyses of the biological effectiveness were made by using insects of the Sitophilus zeamais Motschulsky (Coleoptera: Curculionidae, Rhyzopertha dominica (Fabricius (Coleoptera: Bostrichidae and Tribolium castaneum (Herbst (Coleoptera: Tenebrionidae. A decreasing tendency of the biological effectiveness of the bifenthrin was observed with the increase of the air temperature at the moment of spraying and with the increased time of maize storage, resulting in a smaller mortality of the insect-pest.

Taxonomía y distribución de Mylabris (Micrabris maculosopunctata Graells, 1858 y M. (M. beauregardi Górriz Muñoz, 1884 con estudio del material tipo de Zonabris rosinae Escherich, 1899 y Z. pauper Escherich, 1899 (Coleoptera, Meloidae, Mylabrini

Directory of Open Access Journals (Sweden)

Ruiz, J. L.

2008-06-01

Full Text Available The study of the type material of Zonabris rosinae Escherich, 1899 and Zonabris pauper Escherich, 1899, allow us to confirm the taxonomic criteria for the recognition of these two species established by Pardo Alcaide (1948, 1950. In order to properly discuss the nomenclatural and taxonomic issues associated with these taxa, we designate lecto- and paralectotypes of both species. We have located at the Museo Nacional de Ciencias Naturales (Madrid, Spain three specimens assignables to the type series of Mylabris quadripunctata var. beauregardi Górriz Muñoz, 1884. Once designated as lecto- and paralectotypes we are able to discuss the identification of this species, ignored or confused until now, and establish its synonymy with Z. pauper (syn. nov.. The nomenclatural priority corresponds to Mylabris beauregardi. We discuss the geographic range of M. (Micrabris beauregardi and M. (M. maculosopunctata Graells, 1858 and finally we comment on Mylabris restricta Motschulsky, 1849, a possible senior synonym of M. (Micrabris maculosopunctata.A raíz del estudio del material tipo de Zonabris rosinae Escherich, 1899 y Zonabris pauper Escherich, 1899 se confirman los criterios adoptados por Pardo Alcaide (1948, 1950 con respecto a ambas especies. Para poder discutir adecuadamente los aspectos nomenclaturales y taxonómicos asociados con estos taxones, se designan lecto y paralectotipos de las dos especies. Asimismo se han localizado tres ejemplares atribuibles a la serie tipo de Mylabris quadripunctata var. beauregardi Górriz Muñoz, 1884 en la colección del Museo Nacional de Ciencias Naturales (Madrid, España. Una vez designados estos ejemplares como lecto y paralectotipos, discutimos la identidad de este taxon, ignorado o malinterpretado hasta el momento, y establecemos su sinonimia con Z. pauper (syn. nov. correspondiendo la prioridad nomenclatural a Mylabris beauregardi. Finalmente se discute la distribución geográfica de M. (Micrabris beauregardi

Association of insect life stages using DNA sequences : the larvae of Philodytes umbrinus (Motschulsky) (Coleoptera : Dytiscidae)

NARCIS (Netherlands)

Miller, KB; Alarie, Y; Wolfe, GW; Whiting, MF

2005-01-01

Insect life stages are known imperfectly in many cases, and classifications are based often on only one or a few semaphoronts of a species. This is unfortunate as information in alternative life stages often is useful for scientific study. Although recent examples of DNA in taxonomy have emphasized

Selection of arboreal termitaria for nesting by cooperatively breeding Micronesian Kingfishers Todiramphus cinnamominus reichenbachii

Science.gov (United States)

Kesler, Dylan C.; Haig, Susan M.

2005-01-01

Limited nest-site availability appears to be an important factor in the evolution of delayed dispersal and cooperative breeding in some cavity-nesting species. The cooperatively breeding Pohnpei subspecies of Micronesian Kingfisher Todiramphus cinnamominus reichenbachii excavates nest cavities from the nests of arboreal termites Nasutitermes spp., or termitaria. In this first published description of nest-sites for this subspecies, we used surveys, remote sensing and radiotelemetry to evaluate the relationship between nest-site availability and co-operation. Results illustrate that nest termitaria are higher in the forest canopy, larger in volume and occur in areas with more contiguous canopy cover than unused termitaria. Nest termitaria were selected independently of the proximity to forest edges and territory boundaries, and we found no difference in characteristics of termitaria used by cooperative groups and breeding pairs. Logistic regression modelling indicated that termitaria with nest-like characteristics were not limited in abundance, suggesting that neither the prospects of inheriting nesting resources nor limited nest-site abundance are probable explanations for delayed dispersal in the Pohnpei subspecies of Micronesian Kingfisher.

Toxicidade por fumigação, contato e ingestão de óleos essenciais para Sitophilus zeamais Motschulsky, 1885 (Coleoptera: Curculionidae Toxicity by fumigation, contact and ingestion of essential oils in Sitophilus zeamais Motschulsky, 1885 (Coleoptera: Curculionidae

Directory of Open Access Journals (Sweden)

Rodrigo Leandro Braga de Castro Coitinho

2011-02-01

Full Text Available A espécie Sitophilus zeamais é uma das principais pragas do milho armazenado no Brasil. O controle é feito, comumente, utilizando-se medidas de higienização e limpeza, bem como inseticidas sintéticos fumigantes e protetores. A busca por produtos menos tóxicos, biodegradáveis e seguros do ponto de vista ecológico, é muito bem aceita pela sociedade. Assim, os objetivos do presente trabalho foram testar a toxicidade de contato e ingestão e fumigante de óleos essenciais e do composto orgânico natural eugenol para adultos de S. zeamais. Os valores de CL50 dos óleos essenciais provenientes de folhas de Piper hispidinervum, Eugenia uniflora, Cinnamomum zeylanicum, P. marginatum, Schinus terebinthifolius, Melaleuca leucadendron, dos frutos verdes de S terebinthifolius e do composto eugenol, nos testes de contato e ingestão, foram estimados em 1,0; 11,6; 14,2; 21,1; 57,7; 75,8; 98,8 e 14,8 µL/40 g de milho, respectivamente. As razões de toxicidade (RT variaram entre 1,3 e 98,8. Na fumigação em adultos, as concentrações letais dos óleos variaram de 0,53 a 94,7 µL/L de ar, obedecendo à seguinte ordem decrescente de toxicidade: P. hispidinervum > P. aduncum > S. terebinthifolius > frutos verdes de S. terebinthifolius > P. marginatum > eugenol e as RT variaram entre 2,0 a 178,7.The Sitophilus zeamais species is a major pest of stored maize in Brazil. The control is made, usually, using measures of hygiene and cleanliness, synthetic insecticides and fumigant protectors. The search for less toxic products, biodegradable and safe from an ecological point of view is very well accepted by society. the objective of this study was to test the toxicity by contact and ingestion and fumigant of essential oils and eugenol natural organic compound for adults of S. zeamais. The values of LC50 in oil from leaves of Piper hispidinervum, Eugenia uniflora, Cinnamomum zeylanicum, P. marginatum, Schinus terebinthifolius, Melaleuca leucadendron, green fruits of S. terebinthifolius and eugenol compound in tests of contact and ingestion were estimated at 1.0; 11.6, 14.2, 21.1, 57.7, 75.8, 98.8 and 14.8 L/40 g maize, respectively. The toxicity ratios (TR ranged from 1.3 to 98.8. In the fumigation of adults, the lethal concentrations ranged from 0.53 to 94.7 L/L air, in the following order of toxicity: P. hispidinervum > P. aduncum > S. terebinthifolius > green fruits of S. terebinthifolius > P. marginatum > eugenol, and the TR ranged from 2.0 to 178.7.

Nutritional composition and protein quality of the edible beetle Holotrichia parallela.

Science.gov (United States)

Yang, Qingli; Liu, Shaofang; Sun, Jie; Yu, Lina; Zhang, Chushu; Bi, Jie; Yang, Zhen

2014-10-15

The adult edible beetle Holotrichia parallela Motschulsky (Coleoptera: Scarabaeoidea) represents a traditional food source in China. Based on nutritional analyses, adult H. parallela is high in protein (70%) and minerals and low in fat. H. parallela contained approximately 10% chitin; the corrected protein content was 66%. Oleic acid and linoleic acid were the most abundant fatty acids. Of the total amino acids in H. parallela, 47.4% were essential amino acids. The amino acid scores were 87 and 100, based on the corrected crude and net protein contents, respectively; threonine was the limiting amino acid. In vitro protein digestibility was 78%, and the protein digestibility-corrected amino acid score was 89 based on the net protein content. Adult H. parallela may be a potential source of proteins and minerals for humans and animals. © The Author 2014. Published by Oxford University Press on behalf of the Entomological Society of America.

A synopsis of the South American Hydrovatus (Coleoptera: Dytiscidae: Hydroporinae, with notes on habitat and distribution, and a key to species

Directory of Open Access Journals (Sweden)

Edgardo R. TRÉMOUILLES

2005-01-01

Full Text Available Se estudiaron los representantes sudamericanos del género Hydrovatus Motschulsky. Se diagnostica cada una de las tres especies conocidas, enfatizando el reconocimiento de caracteres valiosos para su identificación; las principales diferencias se resumen en una clave. Para identificar los ejemplares sudamericanos de H. caraibus Sharp, se los comparó con especímenes de AméricaCentral, incluyendo material tipo. En base al material examinado, H. caraibus se encuentra ampliamente distribuida en America Central y del Sur, con representantes de diferentes áreas separados por diferencias menores. Lasdistribuciones geográficas de las tres especies se amplían considerablemente: H. crassulus Sharp y H. turbinatus Zimmermann se citan por primera vez de Paraguay, y H. caraibus se cita por primera vez de Argentina y Nicaragua. Se presenta información bionómica de las especies.

Enzyme Polymorphism in Sitophilus oryzae (Linnaeus, 1763 and Sitophilus zeamais (Motschulsky, 1855 (Coleoptera, Curculionidae in southern Brazil

Directory of Open Access Journals (Sweden)

Danielle das Neves Bespalhok

2015-08-01

Full Text Available Beetles of the species Sitophilus oryzae and S. zeamais are pests of great economic importance since they attack not only rice and maize but also several other cereals. In fact, these beetles are one of the most visible threats to sustainable food production. Current study estimated the genetic variability of S. oryzae in two samples, one from the State of Paraná (PR, Brazil, and another from the state of Rio Grande do Sul (RS, Brazil, and a sample of S. zeamais from the State of Santa Catarina (SC, Brazil. Isozyme electrophoresis in starch gel technique was employed to analyze eight enzyme systems (AAT, ACP, GDH, GPI, IDH, MDH, PGM and ME. Average heterozygosity rates were 0.0091, 0.0100 and 0.0000 and expected heterozygosity rates were 0.0419, 0.0452 and 0.0000 respectively for the samples of PR, SC and RS samples. The percentage of polymorphic loci was 30% in the PR sample, 0% in the RS sample and 30% in the SC sample. Genetic identity rates were I=0.9983 between samples from PR and RS; I = 0.6892 between PR and SC, and I = 0.6925 between SC and RS. Nei´s (1978 genetic distance rates  were 0.0017, 0.3722 and 0.3675. Samples presented low genetic variability.

A comparison of electrophysiologically determined spectral responses in six subspecies of Lymantria.

Science.gov (United States)

Crook, Damon J; Hull-Sanders, Helen M; Hibbard, Emily L; Mastro, Victor C

2014-04-01

The spectral sensitivity of the compound eye in three gypsy moth species from six different geographical regions (Lymantria dispar asiatica Vnukovskij [Asian gypsy moth], Lymantria dispar japonica Motschulsky [Japanese gypsy moth], and Lymantria dispar dispar L. [North American gypsy moth]) was tested electrophysiologically in the wavelength region 300-700 nm. For all moths examined, a maximum response occurred in the 480-520-nm range (blue-green region) with a shoulder peak occurring at 460 nm. A smaller, secondary peak was observed for both sexes at the 340-380-nm range, which is in the region considered behaviorally maximal in night-flying insects. No peaks in sensitivity were observed between 520 and 700 nm (red region) for any of the moths tested. Based on our retinal recording data, a short wavelength blocking filter with a transition wavelength near 500 nm should reduce gypsy moth attraction to artificial lighting sources. This would help reduce the number of Lymantria-infested ships traveling to and from foreign ports.

Urban mosquito species (Diptera: Culicidae) of dengue endemic communities in the Greater Puntarenas area, Costa Rica.

Science.gov (United States)

Calderón-Arguedas, Olger; Troyo, Adriana; Solano, Mayra E; Avendaño, Adrián; Beier, John C

2009-12-01

Field studies were conducted to determine the mosquito species richness in the urban area of Greater Puntarenas in Costa Rica. Two cross-sectional entomological surveys were performed in seven localities of Puntarenas: one survey was performed during the wet season and the other during the dry season. The sections evaluated were determined by applying a stratified cluster sampling method using satellite imagery, and a sample of 26 cells (100 x 100m) was selected for the study. The number of cells per locality was proportional to the area of each locality. The presence of mosquito larvae and pupae in water-filled artificial and natural containers was determined in each cell. Infestation was expressed as a diversity index per type of container (Ii). Eight types of larvae were identified (Aedes aegypti, Culex quinquefasciatus, Culex interrogator, Culex nigripalpus, Culex corniger, Culex tarsalis, Limatus durhamii and Toxorhynchites theobaldi) and in two cases it was only possible to identify the genus (Culex sp. and Uranotaenia sp.). A. aegypti was the most common species followed by C. quinquefascitus. Diversity of wet environments can explain the co-occurrence of various culicid species in some localities. Although A. aegypti is the only documented disease vector in the area, C quinquefasciatus, C nigripalpus, and the other species of Culex could be considered potential vectors of other pathogens. The presence and ecology of all mosquito species should be studied to optimize surveillance and prevention of dengue and to prevent the emergence of other mosquito-transmitted diseases.

Schools as Potential Risk Sites for Vector-Borne Disease Transmission: Mosquito Vectors in Rural Schools in Two Municipalities in Colombia.

Science.gov (United States)

Olano, Víctor Alberto; Matiz, María Inés; Lenhart, Audrey; Cabezas, Laura; Vargas, Sandra Lucía; Jaramillo, Juan Felipe; Sarmiento, Diana; Alexander, Neal; Stenström, Thor Axel; Overgaard, Hans J

2015-09-01

Dengue and other vector-borne diseases are of great public health importance in Colombia. Vector surveillance and control activities are often focused at the household level. Little is known about the importance of nonhousehold sites, including schools, in maintaining vector-borne disease transmission. The objectives of this paper were to determine the mosquito species composition in rural schools in 2 municipalities in Colombia and to assess the potential risk of vector-borne disease transmission in school settings. Entomological surveys were carried out in rural schools during the dry and rainy seasons of 2011. A total of 12 mosquito species were found: Aedes aegypti, Anopheles pseudopunctipennis, Culex coronator, Cx. quinquefasciatus, and Limatus durhamii in both immature and adult forms; Ae. fluviatilis, Cx. nigripalpus, Cx. corniger, and Psorophora ferox in immature forms only; and Ae. angustivittatus, Haemagogus equinus, and Trichoprosopon lampropus in adult forms only. The most common mosquito species was Cx. quinquefasciatus. Classrooms contained the greatest abundance of adult female Ae. aegypti and Cx. quinquefasciatus. The most common Ae. aegypti breeding sites were containers classified as "others" (e.g., cans), followed by containers used for water storage. A high level of Ae. aegypti infestation was found during the wet season. Our results suggest that rural schools are potentially important foci for the transmission of dengue and other mosquito-borne diseases. We propose that public health programs should be implemented in rural schools to prevent vector-borne diseases.

Comparative analysis of carbohydrate active enzymes in Clostridium termitidis CT1112 reveals complex carbohydrate degradation ability.

Directory of Open Access Journals (Sweden)

Riffat I Munir

Full Text Available Clostridium termitidis strain CT1112 is an anaerobic, gram positive, mesophilic, cellulolytic bacillus isolated from the gut of the wood-feeding termite, Nasutitermes lujae. It produces biofuels such as hydrogen and ethanol from cellulose, cellobiose, xylan, xylose, glucose, and other sugars, and therefore could be used for biofuel production from biomass through consolidated bioprocessing. The first step in the production of biofuel from biomass by microorganisms is the hydrolysis of complex carbohydrates present in biomass. This is achieved through the presence of a repertoire of secreted or complexed carbohydrate active enzymes (CAZymes, sometimes organized in an extracellular organelle called cellulosome. To assess the ability and understand the mechanism of polysaccharide hydrolysis in C. termitidis, the recently sequenced strain CT1112 of C. termitidis was analyzed for both CAZymes and cellulosomal components, and compared to other cellulolytic bacteria. A total of 355 CAZyme sequences were identified in C. termitidis, significantly higher than other Clostridial species. Of these, high numbers of glycoside hydrolases (199 and carbohydrate binding modules (95 were identified. The presence of a variety of CAZymes involved with polysaccharide utilization/degradation ability suggests hydrolysis potential for a wide range of polysaccharides. In addition, dockerin-bearing enzymes, cohesion domains and a cellulosomal gene cluster were identified, indicating the presence of potential cellulosome assembly.

Microclimate and nest-site selection in Micronesian Kingfishers

Science.gov (United States)

Kesler, Dylan C.; Haig, Susan M.

2005-01-01

We studied the relationship between microclimate and nest-site selection in the Pohnpei Micronesian Kingfisher (Todiramphus cinnamominus reichenbachii) which excavates nest cavities from the mudlike nest structures of arboreal termites (Nasutitermes sp.) or termitaria. Mean daily high temperatures at termitaria were cooler and daily low temperatures were warmer than at random sites in the forest. Results also indicate that termitaria provided insulation from temperature extremes, and that temperatures inside termitaria were within the thermoneutral zone of Micronesian Kingfishers more often than those outside. No differences were identified in temperatures at sites where nest termitaria and nonnest termitaria occurred or among the insulation properties of used and unused termitaria. These results suggest that although termitaria provide insulation from thermal extremes and a metabolically less stressful microclimate, king-fishers did not select from among available termitaria based on their thermal properties. Our findings are relevant to conservation efforts for the critically endangered Guam Micronesian Kingfisher (T. c. cinnamominus) which is extinct in the wild and exists only as a captive population. Captive breeding facilities should provide aviaries with daily ambient temperatures ranging from 22.06 A?C to 28.05 A?C to reduce microclimate-associated metabolic stress and to replicate microclimates used by wild Micronesian Kingfishers.

Metagenomic and functional analysis of hindgut microbiota of a wood-feeding higher termite

Energy Technology Data Exchange (ETDEWEB)

Warnecke, Falk; Warnecke, Falk; Luginbuhl, Peter; Ivanova, Natalia; Ghassemian, Majid; Richardson, Toby H.; Stege, Justin T.; Cayouette, Michelle; McHardy, Alice C.; Djordjevic, Gordana; Aboushadi, Nahla; Sorek, Rotem; Tringe, Susannah G.; Podar, Mircea; Martin, Hector Garcia; Kunin, Victor; Dalevi, Daniel; Madejska, Julita; Kirton, Edward; Platt, Darren; Szeto, Ernest; Salamov, Asaf; Barry, Kerrie; Mikhailova, Natalia; Kyrpides, Nikos C.; Matson, Eric G.; Ottesen, Elizabeth A.; Zhang, Xinning; Hernandez, Myriam; Murillo, Catalina; Acosta, Luis G.; Rigoutsos, Isidore; Tamayo, Giselle; Green, Brian D.; Chang, Cathy; Rubin, Edward M.; Mathur, Eric J.; Robertson, Dan E.; Hugenholtz, Philip; Leadbetter, Jared R.

2007-10-01

From the standpoints of both basic research and biotechnology, there is considerable interest in reaching a clearer understanding of the diversity of biological mechanisms employed during lignocellulose degradation. Globally, termites are an extremely successful group of wood-degrading organisms and are therefore important both for their roles in carbon turnover in the environment and as potential sources of biochemical catalysts for efforts aimed at converting wood into biofuels. Only recently have data supported any direct role for the symbiotic bacteria in the gut of the termite in cellulose and xylan hydrolysis. Here we use a metagenomic analysis of the bacterial community resident in the hindgut paunch of a wood-feeding Nasutitermes species to show the presence of a large, diverse set of bacterial genes for cellulose and xylan hydrolysis. Many of these genes were expressed in vivo or had cellulase activity in vitro, and further analyses implicate spirochete and fibrobacter species in gut lignocellulose degradation. New insights into other important symbiotic functions including H{sub 2} metabolism, CO{sub 2}-reductive acetogenesis and N{sub 2} fixation are also provided by this first system-wide gene analysis of a microbial community specialized towards plant lignocellulose degradation. Our results underscore how complex even a 1-{micro}l environment can be.

Screening of promising maize genotypes against maize weevil (Sitophilus zeamais Motschulky in storage condition

Directory of Open Access Journals (Sweden)

Ram B Paneru

2017-12-01

Full Text Available The maize weevil (Sitophilus zeamais Motschulsky is a serious pest of economic importance in stored grains. It causes major damage to stored maize grain thereby reducing its weight, quality and germination. An experiment was conducted in randomized complete block design (RCBD with 3 replications to screen 32 maize genotypes against maize weevil in no-choice and free-choice conditions at Entomology Division, Khumaltar, Lalitpur (Room temperature: Maximum 24-32°C and Minimum 18-27°C. The findings showed that the maize genotypes had different response to maize weevil damage ranging from susceptible to tolerance. The genotypes Manakamana-3, Lumle White POP Corn and Ganesh-2 showed their tolerance to S. zeamais as evidenced by lower number of weevil emerged/attracted, lower amount of grain debris release and lower proportion of bored grains, while the genotype ZM-627 was the most susceptible to weevil damage in both tests. The other remaining genotypes were intermediate types. This information is useful to improve grain protection in storage and varietal improvement/release program.

Variación anual de las propiedades insecticidas de Peumus boldus sobre Sitophilus zeamais Annual variation of insecticide properties of Peumus boldus on Sitophilus zeamais

Directory of Open Access Journals (Sweden)

Felipe Pérez

2007-05-01

Full Text Available El objetivo del presente trabajo fue determinar la variación anual en las propiedades insecticidas de Peumus boldus Molina, en el control de Sitophilus zeamais Motschulsky, bajo condiciones de laboratorio. El polvo de hojas de P. boldus se evaluó durante 12 meses, en concentraciones de 0,5, 1 y 2% (p/p. Se evaluaron 36 tratamientos con tres repeticiones, en un diseño experimental completamente al azar, con un arreglo factorial. Se determinó el porcentaje de mortalidad y emergencia de insectos adultos e inmaduros y pérdida de peso y germinación del grano. La mayor mortalidad se obtuvo en los meses de agosto y septiembre de 2003, para las tres concentraciones con un 100%, mientras que la menor fue en mayo de 2003, cuando solo la concentración de 2% fue próxima a 100% de mortalidad. La menor emergencia de insectos adultos y pérdida de peso se obtuvieron en los mismos tratamientos. El efecto sobre estados inmaduros fue menor que contra adultos, y la germinación de los granos de maíz fue afectada por los polvos de P. boldus. Las propiedades insecticidas del polvo de hojas de P. boldus no son estables durante el año, Mayo es el mes con la menor eficacia insecticida, y la germinación de las semillas se ve afectada por el polvo.The objective of this work was to determine the annual variation of Peumus boldus Molina insecticidal properties for the control of Sitophilus zeamais Motschulsky, under laboratory conditions. The powder of P. boldus leaves was evaluated, during 12 months, in 0.5, 1, and 2% (w/w concentrations. Thirty-six treatments, with three replications, were evaluated in a completely randomized experimental design, with a factorial arrangement. Evaluations were made for adult and immature insect percentage mortality and emergence, grain weight loss and seed germination. The greatest mortality was obtained in August and September 2003, in the three concentrations with 100%, and the lowest mortality was registered in May 2003

RESISTÊNCIA DE DUAS ESPÉCIES DE BAMBU TRATADAS COM CCB CONTRA CUPINS E COLEÓPTEROS XILÓFAGOS

Directory of Open Access Journals (Sweden)

Rogy Frigeri Tiburtino

2015-01-01

Full Text Available ABSTRACTThe research aimed to evaluate the effectiveness of CCB preservative in improving the resistance of twobamboo species (Bambusa vulgarisandDendrocalamus giganteus the action of termites and xylophagousbeetles. The bamboo stems collected in the vicinity of Alegre and Jerônimo Monteiro, towns of southernEspírito Santo state, Brazil, were transformed into culms of 2.0 m long and treated in a solution of 1 or 3%active ingredient (a.i. of the commercial product “MOQ OX 50”, based on copper, chromium and boron (CCB.The treatment methods used were the sap displacement (intact and ruptured diaphragm, long-termimmersion and Boucherie modified. In the methods by sap displacement and the long-term immersion thestems were exposed in solutions for periods of 5, 10 or 15 days, and in Boucherie’s modified method oftreatment there was no segregation between treatment times. To assess the efficiency of the methods, testsamples were taken at the position of 50 cm from the base of the stems. In the tests, the termite speciesNasutitermes cornigerand the beetleDinoderus minutuswere used. Based on the analysis of the resultsobtained, it was found that the two species of bamboo treated showed high resistance to attack by termitesand beetles, and including untreated samples showed low mass loss when subjected to the tests.

Origin and alteration of organic matter in termite mounds from different feeding guilds of the Amazon rainforests.

Science.gov (United States)

Siebers, Nina; Martius, Christopher; Eckhardt, Kai-Uwe; Garcia, Marcos V B; Leinweber, Peter; Amelung, Wulf

2015-01-01

The impact of termites on nutrient cycling and tropical soil formation depends on their feeding habits and related material transformation. The identification of food sources, however, is difficult, because they are variable and changed by termite activity and nest construction. Here, we related the sources and alteration of organic matter in nests from seven different termite genera and feeding habits in the Terra Firme rainforests to the properties of potential food sources soil, wood, and microepiphytes. Chemical analyses comprised isotopic composition of C and N, cellulosic (CPS), non-cellulosic (NCPS), and N-containing saccharides, and molecular composition screening using pyrolysis-field ionization mass spectrometry (Py-FIMS). The isotopic analysis revealed higher soil δ13C (-27.4‰) and δ15N (6.6‰) values in nests of wood feeding Nasutitermes and Cornitermes than in wood samples (δ13C = -29.1‰, δ15N = 3.4‰), reflecting stable-isotope enrichment with organic matter alterations during or after nest construction. This result was confirmed by elevated NCPS:CPS ratios, indicating a preferential cellulose decomposition in the nests. High portions of muramic acid (MurAc) pointed to the participation of bacteria in the transformation processes. Non-metric multidimensional scaling (MDS) revealed increasing geophagy in the sequence Termes rainforest termites shows variations and evidence of modification by microbial processes, but nevertheless it primarily reflects the trophic niches of the constructors.

Efficacy of imidacloprid, trunk-injected into Acer platanoides, for control of adult Asian longhorned beetles (Coleoptera: Cerambycidae).

Science.gov (United States)

Ugine, Todd A; Gardescu, Sana; Lewis, Phillip A; Hajek, Ann E

2012-12-01

Feeding experiments with Asian longhorned beetles (Anoplophora glabripennis (Motschulsky)) in a quarantine laboratory were used to assess the effectiveness of imidacloprid in reducing adult fecundity and survival. The beetles were fed twigs and leaves cut between June-September 2010 from Norway maples (Acer platanoides L.) in the beetle-infested area of Worcester, MA. Treated trees had been trunk-injected once with imidacloprid in spring 2010 under the U.S. Department of Agriculture-Animal and Plant Health Inspection Service operational eradication program. The 21 d LC50 value for adult beetles feeding on twig bark from imidacloprid-injected trees was 1.3 ppm. Adult reproductive output and survival were significantly reduced when beetles fed on twig bark or leaves from treated trees. However, results varied widely, with many twig samples having no detectable imidacloprid and little effect on the beetles. When twigs with > 1 ppm imidacloprid in the bark were fed to mated beetles, the number of larvae produced was reduced by 94% and median adult survival was reduced to 14 d. For twigs with 1 ppm). When given a choice of control twigs and twigs from injected trees, beetles did not show a strong preference.

Studies on food preferences of maize weevil, Sitophilus zeamais Mots. to different crops in Chitwan, Nepal

Directory of Open Access Journals (Sweden)

Sheela Devi Sharma

2016-12-01

Full Text Available Food preference by the maize weevil, Sitophilus zeamais Motschulsky was studied on seven different crops and varieties including maize, wheat and rice. They were maize cultivars namely Arun-2, Manakamana-4, Deuti, buckwheat local cultivar, wheat cultivar namely Annapurna-1, polished rice-Radha 4 and unshelled rice cultivar Mansuli under storage condition at Institute of Agriculture and Animal Science, Rampur, Chitwan, Nepal from June 2013 to February 2014 . The hosts were tested using completely randomized design with three replications and were laid in free-choice and no-choice conditions. The maximum number of grain loss was recorded in wheat followed by polished rice respectively. Similarly, the highest weight loss was recorded in polished rice followed by Wheat in both conditions. F1 progeny emergence of weevil was highest in wheat followed by polished rice in free-choice and in no choice conditions, the highest progeny were emerged from polished rice followed by wheat. The lowest numbers of weevils emerged from rice in both conditions. Maximum germination losses were recorded in wheat (24.33% and lowest in Arun-2 (9.67. The rice showed a relatively higher preference to maize weevil under storage condition.

Effects of temperature variation before and after gamma irradiation on the longevity and reproduction of Sitophilus zeamais Motschulsky, 1855 (Coleoptera, Curculionidae)

International Nuclear Information System (INIS)

Camargo, A.A.; Wiendl, F.M.; Bergamo, M.A.

1983-01-01

A basic study of radiobiology in order to verify the synergistic effects of the sudden variation of temperature on the longevity and reproduction of Sitophilus zeamais Mots., 1855 is done, before and after gamma irradiation, and to analyse such effects in the practical application of the irradiation system of stored grains for human consumption. Also to take advantage of the synergistic effects so as to reduce the dose rate necessary to control weevils attacking stored grains. The insects were irradiated at the rates of 0 (control), 2, 4, 8, 16, 32 and 64 krad, by using a 60-Cobalt source. In a first experiment, the insects were exposed to cooling at -8 0 C below zero for 15 minutes after irradiation; in a second experiment this treatment was done before irradiation. The countings of the insect birth and death rates were weekly done. From these data one can conclude that the adult longevity decreased and the mortality increased when the insects were cooled before irradiation, and also that cooling before irradiation induces a more deleterious effect on the insect than cooling after irradiation, resulting in a lower birth rate. (Author) [pt

Urban mosquito species (Diptera: Culicidae of dengue endemic communities in the Greater Puntarenas area, Costa Rica

Directory of Open Access Journals (Sweden)

Olger Calderón-Arguedas

2009-12-01

Full Text Available Field studies were conducted to determine the mosquito species richness in the urban area of Greater Puntarenas in Costa Rica. Two cross-sectional entomological surveys were performed in seven localities of Puntarenas: one survey was performed during the wet season and the other during the dry season. The sections evaluated were determined by applying a stratified cluster sampling method using satellite imagery, and a sample of 26 cells (100x100m was selected for the study. The number of cells per locality was proportional to the area of each locality. The presence of mosquito larvae and pupae in water-filled artificial and natural containers was determined in each cell. Infestation was expressed as a diversity index per type of container (Ii. Eight types of larvae were identified (Aedes aegypti, Culex quinquefasciatus, Culex interrogator, Culex nigripalpus, Culex corniger, Culex tarsalis, Limatus durhamii and Toxorhynchites theobaldi and in two cases it was only possible to identify the genus (Culex sp. and Uranotaenia sp.. A. aegypti was the most common species followed by C. quinquefascitus. Diversity of wet environments can explain the co-occurrence of various culicid species in some localities. Although A. aegypti is the only documented disease vector in the area, C quinquefasciatus, C. nigripalpus, and the other species of Culex could be considered potential vectors of other pathogens. The presence and ecology of all mosquito species should be studied to optimize surveillance and prevention of dengue and to prevent the emergence of other mosquito-transmitted diseases. Rev. Biol. Trop. 57 (4: 1223-1234. Epub 2009 December 01.La riqueza de especies de mosquitos urbanos de la Gran Puntarenas (Puntarenas, Costa Rica fue evaluada por medio de análisis larvales. Dos encuestas entomológicas fueron realizadas en siete localidades de la Gran Puntarenas durante un año. Una de las encuestas fue realizada en la estación seca y la otra se llevó a

Termites community as environmental bioindicators in highlands: a case study in eastern slopes of Mount Slamet, Central Java

Directory of Open Access Journals (Sweden)

IDHAM SAKTI HARAHAP

2011-10-01

Full Text Available Pribadi T,Raffiudin R,HarahapIS (2011Termites community as environmental bioindicators in highlands: a case study in eastern slopes of Mount Slamet, Central Java. Biodiversitas 12: 235-240. Termites ecological behaviour is much affected by land use change and disturbance level. Their variation in diversity can be used as bioindicator of environmental quality. However, termite community response to land use changes and habitat disturbance in highland ecosystems remains poorly understood. This study was conducted to investigate the response of termite community to land use intensification and to explore their role as environmental bioindicator in Mount Slamet. A standard survey protocol was used to collect termites in five land use typesof various disturbance levels,i.e. protected forest, recreation forest, production forest,agroforestry, and urban area. It was found two termite families i.e. Rhinotermitidae and Termitidae with seven species, i.e Schedorhinotermes javanicus, Procapritermes sp, Pericapritermes semarangi, Macrotermes gilvus, Microtermes insperatus, Nasutitermes javanicus, and N. matanganensis. Termite species’ richness and evenness, Shannon-Wiener index, relative abundance, and biomass of termite were declined along with the land use types and disturbance level from protected forest to urban area. Habitat disturbance was the main declining factor of termite diversity. Termite composition changed along with the land use disturbance level. Soil feeding termites were sensitive to the disturbance – they were not found in urban area. Hence, their presence or absence can be used as environmental bioindicator to detect habitat disturbance.

Origin and Alteration of Organic Matter in Termite Mounds from Different Feeding Guilds of the Amazon Rainforests

Science.gov (United States)

Siebers, Nina; Martius, Christopher; Eckhardt, Kai-Uwe; Garcia, Marcos V. B.; Leinweber, Peter; Amelung, Wulf

2015-01-01

The impact of termites on nutrient cycling and tropical soil formation depends on their feeding habits and related material transformation. The identification of food sources, however, is difficult, because they are variable and changed by termite activity and nest construction. Here, we related the sources and alteration of organic matter in nests from seven different termite genera and feeding habits in the Terra Firme rainforests to the properties of potential food sources soil, wood, and microepiphytes. Chemical analyses comprised isotopic composition of C and N, cellulosic (CPS), non-cellulosic (NCPS), and N-containing saccharides, and molecular composition screening using pyrolysis-field ionization mass spectrometry (Py-FIMS). The isotopic analysis revealed higher soil δ13C (-27.4‰) and δ15N (6.6‰) values in nests of wood feeding Nasutitermes and Cornitermes than in wood samples (δ13C = -29.1‰, δ15N = 3.4‰), reflecting stable-isotope enrichment with organic matter alterations during or after nest construction. This result was confirmed by elevated NCPS:CPS ratios, indicating a preferential cellulose decomposition in the nests. High portions of muramic acid (MurAc) pointed to the participation of bacteria in the transformation processes. Non-metric multidimensional scaling (NMDS) revealed increasing geophagy in the sequence Termes termites shows variations and evidence of modification by microbial processes, but nevertheless it primarily reflects the trophic niches of the constructors. PMID:25909987

Metagenomic insights into metabolic capacities of the gut microbiota in a fungus-cultivating termite (Odontotermes yunnanensis.

Directory of Open Access Journals (Sweden)

Ning Liu

Full Text Available Macrotermitinae (fungus-cultivating termites are major decomposers in tropical and subtropical areas of Asia and Africa. They have specifically evolved mutualistic associations with both a Termitomyces fungi on the nest and a gut microbiota, providing a model system for probing host-microbe interactions. Yet the symbiotic roles of gut microbes residing in its major feeding caste remain largely undefined. Here, by pyrosequencing the whole gut metagenome of adult workers of a fungus-cultivating termite (Odontotermes yunnanensis, we showed that it did harbor a broad set of genes or gene modules encoding carbohydrate-active enzymes (CAZymes relevant to plant fiber degradation, particularly debranching enzymes and oligosaccharide-processing enzymes. Besides, it also contained a considerable number of genes encoding chitinases and glycoprotein oligosaccharide-processing enzymes for fungal cell wall degradation. To investigate the metabolic divergence of higher termites of different feeding guilds, a SEED subsystem-based gene-centric comparative analysis of the data with that of a previously sequenced wood-feeding Nasutitermes hindgut microbiome was also attempted, revealing that SEED classifications of nitrogen metabolism, and motility and chemotaxis were significantly overrepresented in the wood-feeder hindgut metagenome, while Bacteroidales conjugative transposons and subsystems related to central aromatic compounds metabolism were apparently overrepresented here. This work fills up our gaps in understanding the functional capacities of fungus-cultivating termite gut microbiota, especially their roles in the symbiotic digestion of lignocelluloses and utilization of fungal biomass, both of which greatly add to existing understandings of this peculiar symbiosis.

[Twenty-year surveillance of insects relevant to public health during the construction of hydroelectric facilities in Antioquia, Colombia].

Science.gov (United States)

Zuluaga, Walter Alonso; López, Yolanda Lucía; Osorio, Lisardo; Salazar, Luis Fernando; González, Marta Claudia; Ríos, Claudia María; Wolff, Marta Isabel; Escobar, José Pablo

2012-09-01

Entomological studies conducted in large hydroelectric infrastructure projects are a tool for the prevention and control of vector-borne diseases. These diseases emerge as a consequence of changes made to the terrain that often increase the natural and artificial mosquito larval habitats. Many of these insects are of public health importance and population increases result in an increased risk of disease transmission. The culicine (mosquito) and phlebotomine (sand fly) populations were characterized in the area of the Porce II and Porce III hydroelectric projects of Antioquia between 1990 to 2009. Periodical entomological samplings were made in the area of impact, in the workers camps, and construction sites. Adult specimens were captured with nets, Shannon light traps, CDC light traps, and protected human bait. Mosquito larvae of the following species were identified: Culex coronator, Culex nigripalpus, Culex corniger, Culex quinquefasciatus and Limatus durhami. The most frequently identifiers of larval habitats were low tanks, waste cans, tires, and aquatic plants. Aedes aegypti specimens were captured in only two rural locations from two municipalities within the area of influence. Specimens from the following mosquito genera were captured in forest areas: Aedes, Mansonia, Culex, Psorophora, Wyeomyia, Phonyomyia, Uranotaenia, Haemagogus and Sabethes. The most important mosquito found was Haemogogus janthinomis, an efficient yellow fever vector in Colombia. The area has been endemic for leishmaniasis and in the current study, 20 species of Lutzomyia sand flies, potential vectors, were identified. Among malaria vectors, the most important species found in the area were Anopheles nuneztovari and Anopheles pseudopunctipennis. A wide variety of vectors were discovered in the area of the Porce II and Porce III hydroelectric projects, and many of these were relevant for public health. Further monitoring will be necessary to minimize disease transmission risks among the

Control of Eucryptorrhynchus scrobiculatus (Coleoptera: Cuculionidae), a Major Pest of Ailanthus altissima (Sapindales: Simaroubaceae), Using a Modified Square Trap Net.

Science.gov (United States)

Yang, Kailang; Wen, Xiaojian; Ren, Yuan; Wen, Junbao

2018-04-19

Eucryptorrhynchus scrobiculatus (Motschulsky) (Coleoptera: Cuculionidae) is a borer that mainly attacks the tree of heaven, Ailanthus altissima (Mill.) Swingle (Sapindales: Simaroubaceae), and is one of the most damaging forestry pests in China. We developed a trap net for entangling and immobilizing soil-emerging weevils in order to reduce their impact. Recapture rates of weevils in the laboratory was significantly higher with nylon netting of 9, 10, or 11 mm mesh sizes than larger sizes, and these sizes were used to make trial nets for preventing weevil emergence from the soil around impacted trees in the field. Nets were 2 × 2 m with a reinforced border and Velcro-closable, radial slit which allowed the net to be arranged around the base of the tree while producing an unbroken barrier beneath the soil surface (i.e., a modified square trap net, MSTN). Recapture rates of weevils released in the soil did not differ among the MSTNs of 9, 10, or 11 mm mesh sizes. MSTN treatments significantly reduced emergence by naturally-occurring weevils from the soil surrounding trees and reduced numbers of weevils caught in population monitoring traps deployed in treated stands. The results demonstrated that MSTNs might be used to manage of E. scrobiculatus.

Resistance of Rice Varieties to the Stored-Product Insect, Sitophilus zeamais (Coleoptera: Curculionidae).

Science.gov (United States)

Antunes, Catarina; Mendes, Raquel; Lima, Arlindo; Barros, Graça; Fields, Paul; Da Costa, Luísa Beirão; Rodrigues, José Carlos; Silva, Maria José; Correia, Augusto Manuel; Carvalho, Maria Otilia

2016-02-01

Four common Portuguese rice varieties--Thaibonnet, Gladio, Albatros, and Eurosis--were tested for their relative susceptibility to Sitophilus zeamais Motschulsky, a common pest of stored rice in Portugal and in tropical countries. Physical (moisture content, hardness, length, and width) and chemical (by attenuated total reflection-Fourier transform infrared spectroscopy) properties of rice kernels were measured. Insect bioassays measured median developmental time, Dobie's index of susceptibility, percentage of damaged grains and weight loss, and progeny developed. This was done for paddy, brown rice, and polished rice for each variety. There were small, but significant, differences in insect resistance among the varieties. However, it was different for paddy and polished rice. In paddy, these differences were correlated with hull damage, and Eurosis was the most susceptible variety. In polished rice, resistance was correlated with hardness, and Thaibonnet was the most susceptible variety. In general, paddy rice was more resistant to insect attack, followed by polished rice and then brown rice. Paddy kernels selected with undamaged hull were completely resistant to attack. Implications for IPM and breeding for resistant varieties are discussed. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

GC-MS Analysis of Insecticidal Essential Oil of Aerial Parts of Echinops latifolius Tausch

Directory of Open Access Journals (Sweden)

Xin Chao Liu

2013-01-01

Full Text Available The roots of Echinops latifolius Tausch (Asteraceae have been used in the traditional medicine. However, no report on chemical composition and insecticidal activities of the essential oil of this plant exists. The aim of this research was to determine chemical composition and insecticidal activities of the essential oil of E. latifolius aerial parts against maize weevils (Sitophilus zeamais Motschulsky for the first time. Essential oil of E. latifolius aerial parts at flowering stage was obtained by hydrodistillation and analyzed by gas chromatography-mass spectrometry (GC-MS. A total of 35 components of the essential oil of E. latifolius aerial parts were identified. The major compounds in the essential oil were 1,8-cineole (19.63%, (Z-β-ocimene (18.44%, and β-pinene (15.56% followed by β-myrcene (4.75% and carvone (4.39%. The essential oil of E. latifolius possessed contact toxicity against S. zeamais with an LD50 value of 36.40 µg/adult. The essential oil also exhibited fumigant toxicity against S. zeamais with an LC50 value of 9.98 mg/L. The study indicates that the essential oil of E. latifolius aerial parts has a potential for development into a natural insecticide/fumigant for control of insects in stored grains.

Development and Life History of Sitophilus zeamais (Coleoptera: Curculionidae on Cereal Crops

Directory of Open Access Journals (Sweden)

James Adebayo Ojo

2016-01-01

Full Text Available The maize weevil, Sitophilus zeamais Motschulsky (Coleoptera: Curculionidae, is one of the most destructive pests of stored cereals. Knowledge of the life history and biology is important to the development of an integrated pest management program. Investigation was carried out on developmental biology of S. zeamais on four main cereal crops, maize, rice, sorghum, and millet, under laboratory conditions. Egg incubation, oviposition periods, and larval instar development were not different significantly among the food hosts. Number of eggs laid varied significantly among the cereal grains; mean fecundity was highest on maize (67.2±3.16 and lowest on millet (53.8±0.17. Number of immature (larva and pupa and adult stages varied significantly among the cereal grains. There exist four larval instars with a varied mean head capsule width, with a mean total instar larval developmental period of 23.1, 22.2, 22.2, and 21.6 d on maize, rice, sorghum, and millet, respectively. There was linear relationship and significant correlation between the stages of larval development and head capsule width. The mean developmental period from egg to adult varied, being highest on maize (34.7 d and lowest on sorghum (33.5 d.

Japanese Interest in “Hotaru” (Fireflies) and “Kabuto-Mushi” (Japanese Rhinoceros Beetles) Corresponds with Seasonality in Visible Abundance

Science.gov (United States)

Takada, Kenta

2012-01-01

Seasonal changes in the popularity of fireflies [usually Genji-fireflies (Luciola cruciata Motschulsky) in Japan] and Japanese rhinoceros beetles [Allomyrina dichotoma (Linne)] were investigated to examine whether contemporary Japanese are interested in visible emergence of these insects as seasonal events. The popularity of fireflies and Japanese rhinoceros beetles was assessed by the Google search volume of their Japanese names, “Hotaru” and “Kabuto-mushi” in Japanese Katakana script using Google Trends. The search volume index for fireflies and Japanese rhinoceros beetles was distributed across seasons with a clear peak in only particular times of each year from 2004 to 2011. In addition, the seasonal peak of popularity for fireflies occurred at the beginning of June, whereas that for Japanese rhinoceros beetles occurred from the middle of July to the beginning of August. Thus seasonal peak of each species coincided with the peak period of the emergence of each adult stage. These findings indicated that the Japanese are interested in these insects primarily during the time when the two species are most visibly abundant. Although untested, this could suggest that fireflies and Japanese rhinoceros beetles are perceived by the general public as indicators or symbols of summer in Japan. PMID:26466535

Resistência natural da madeira de Corymbia maculata (Hook. K.D.Hill & L.A.S. Johnson a fungos e cupins xilófagos, em condições de laboratório Wood natural resistance of Corymbia maculata (Hook. K.D.Hill & L.A.S Johnson to wood destroying fungi and termites, under laboratory tests

Directory of Open Access Journals (Sweden)

Juarez Benigno Paes

2002-11-01

Full Text Available A pesquisa teve o objetivo de avaliar a resistência natural da madeira de Corymbia maculata a fungos e a cupins xilófagos, em condições de laboratório. De peças radiais (tábuas que continham o cerne e o alburno intactos foram retirados corpos-de-prova de 2,00 x 2,00 x 1,00 cm, com a menor dimensão na direção tangencial (ensaio com fungos, e de 2,54 x 2,00 x 0,64 cm, com a maior dimensão na direção das fibras (ensaio com cupins, em quatro posições na direção medula-casca. As amostras foram submetidas à ação dos fungos Postia placenta, Neolentinus lepideus e Polyporus fumosus por 12 semanas, ou à ação de cupins do gênero Nasutitermes por 30 dias. Constatou-se que a resistência da madeira ao apodrecimento foi dependente da posição na direção medula-casca e dos fungos utilizados. As amostras retiradas nas posições mais externas do tronco foram mais deterioradas que as internas. Dentro de cada posição, os fungos causaram deterioração semelhante à madeira, exceto para a posição mais externa (alburno, em que o fungo P. fumosus causou menos deterioração que os demais. De modo geral, a madeira de C. maculata foi altamente resistente (posições internas ou resistente (posições externas aos fungos ensaiados. Somente para o fungo N. lepideus a posição mais externa foi moderadamente resistente. Quanto aos cupins, a resistência da madeira não foi afetada pela posição na direção medula-casca e apresentou uma baixa perda de massa para as posições analisadas. Além disto, os cupins causaram somente desgaste superficial à madeira, e morreram durante o ensaio, o que permitiu classificar a madeira de C.maculata como resistente aos cupins ensaiados.This research evaluated the natural resistance of Corymbia maculata wood to wood-destroying fungi and termites, under laboratory tests. Radial pieces (boards, containing intact heartwood and sapwood were transformed into test samples measuring 2.00 x 2.00 x 1.00 cm

Borate protection of softwood from Coptotermes acinaciformis (Isoptera: Rhinotermitidae) damage: variation in protection thresholds explained.

Science.gov (United States)

Peters, Brenton C; Fitzgerald, Christopher J

2006-10-01

Laboratory and field data reported in the literature are confusing with regard to "adequate" protection thresholds for borate timber preservatives. The confusion is compounded by differences in termite species, timber species and test methodology. Laboratory data indicate a borate retention of 0.5% mass/mass (m/m) boric acid equivalent (BAE) would cause > 90% termite mortality and restrict mass loss in test specimens to 0.5% m/m BAE are required. We report two field experiments with varying amounts of untreated feeder material in which Coptotermes acinaciformis (Froggatt) (Isoptera: Rhinotermitidae) responses to borate-treated radiata (Monterey) pine, Pinus radiata D. Don, were measured. The apparently conflicting results between laboratory and field data are explained by the presence or absence of untreated feeder material in the test environment. In the absence of untreated feeder material, wood containing 0.5% BAE provided adequate protection from Coptotermes sp., whereas in the presence of untreated feeder material, increased retentions were required. Furthermore, the retentions required increased with increased amounts of susceptible material present. Some termites, Nasutitermes sp. and Mastotermes darwiniensis Froggatt, for example, are borate-tolerant and borate timber preservatives are not a viable management option with these species. The lack of uniform standards for termite test methodology and assessment criteria for efficacy across the world is recognized as a difficulty with research into the performance of timber preservatives with termites. The many variables in laboratory and field assays make "prescriptive" standards difficult to recommend. The use of "performance" standards to define efficacy criteria ("adequate" protection) is discussed.

Starvation and Imidacloprid Exposure Influence Immune Response by Anoplophora glabripennis (Coleoptera: Cerambycidae) to a Fungal Pathogen.

Science.gov (United States)

Fisher, Joanna J; Castrillo, Louela A; Donzelli, Bruno G G; Hajek, Ann E

2017-08-01

In several insect systems, fungal entomopathogens synergize with neonicotinoid insecticides which results in accelerated host death. Using the Asian longhorned beetle, Anoplophora glabripennis (Motschulsky), an invasive woodborer inadvertently introduced into North America and Europe, we investigated potential mechanisms in the synergy between the entomopathogenic fungus Metarhizium brunneum Petch and the insecticide imidacloprid. A potential mechanism underlying this synergy could be imidacloprid's ability to prevent feeding shortly after administration. We investigated whether starvation would have an impact similar to imidacloprid exposure on the mortality of fungal-inoculated beetles. Using real-time PCR to quantify fungal load in inoculated beetles, we determined how starvation and pesticide exposure impacted beetles' ability to tolerate or resist a fungal infection. The effect of starvation and pesticide exposure on the encapsulation and melanization immune responses of the beetles was also quantified. Starvation had a similar impact on the survival of M. brunneum-inoculated beetles compared to imidacloprid exposure. The synergy, however, was not completely due to starvation, as imidacloprid reduced the beetles' melanotic encapsulation response and capsule area, while starvation did not significantly reduce these immune responses. Our results suggest that there are multiple interacting mechanisms involved in the synergy between M. brunneum and imidacloprid. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

Does cypermethrin affect enzyme activity, respiration rate and walking behavior of the maize weevil (Sitophilus zeamais)?

Institute of Scientific and Technical Information of China (English)

Ronnie Von Santos Veloso; Eliseu José G.Pereira; Raul Narciso C.Guedes; Maria Goreti A.Oliveira

2013-01-01

Insecticides cause a range of sub-lethal effects on targeted insects,which are frequently detrimental to them.However,targeted insects are able to cope with insecticides within sub-lethal ranges,which vary with their susceptibility.Here we assessed the response of three strains of the maize weevil Sitophilus zeamais Motschulsky (Coleoptera:Curculionidae) to sub-lethal exposure to the pyrethoid insecticide cypermethrin.We expected enzyme induction associated with cypermethrin resistance since it would aid the resistant insects in surviving such exposure.Lower respiration rate and lower activity were also expected in insecticide-resistant insects since these traits are also likely to favor survivorship under insecticide exposure.Curiously though,cypermethrin did not affect activity of digestive and energy metabolism enzymes,and even reduced the activity of some enzymes (particularly for cellulase and cysteine-proteinase activity in this case).There was strain variation in response,which may be (partially) related to insecticide resistance in some strains.Sub-lethal exposure to cypermethrin depressed proteolytic and mainly cellulolytic activity in the exposed insects,which is likely to impair their fitness.However,such exposure did not affect respiration rate and walking behavior of the insects (except for the susceptible strain where walking activity was reduced).Walking activity varies with strain and may minimize insecticide exposure,which should be a concern,particularly if associated with (physiological) insecticide resistance.

GC-MS Analysis of Insecticidal Essential Oil of Flowering Aerial Parts of Saussurea Nivea Turcz

Directory of Open Access Journals (Sweden)

Zhi Long Liu

2012-08-01

Full Text Available Background:Several species from Saussurea have been used in the traditional medicine, such as S. lappa, S. involucrate, and S. obvallata. There is no report on medicinal use of S. nivea. The aim of this research was to determine chemical composition and insecticidal activity of the essential oil of S. nivea Turcz (Asteraceae aerial parts against maize weevils (Sitophilus zeamais Motschulsky for the first time.Results:Essential oil of S. nivea flowering aerial parts was obtained by hydrodistillation and analyzed by gas chromatography--mass spectrometry (GC-MS. A total of 43 components of the essential oil of S. nivea were identified. The principal compounds in the essential oil were (+-limonene (15.46%, caryophyllene oxide (7.62%, linalool (7.20%, alpha-pinene (6.43%, beta-pinene (5.66% and spathulenol (5.02% followed by beta-eudesmoll (4.64% and eudesma-4,11-dien-2-ol (3.76%. The essential oil of S. nivea exhibited strong contact toxicity against S. zeamais with an LD50 value of 10.56 mug/adult. The essential oil also possessed fumigant toxicity against S. zeamais with an LC50 value of 8.89 mg/L.Conclusion: The study indicates that the essential oil of S. nivea flowering aerial parts has a potential for development into a natural insecticide/fumigant for control of insects in stored grains.

Population growth and development of the psocid Liposcelis brunnea (Psocoptera: Liposcelididae) at constant temperatures and relative humidities.

Science.gov (United States)

Opit, G P; Throne, J E

2009-06-01

We studied the effects of temperature and relative humidity on population growth and development of the psocid Liposcelis brunnea Motschulsky. L. brunnea did not survive at 43% RH, but populations increased from 22.5 to 32.5 degrees C and 55-75% RH. Interestingly, we found population growth was higher at 63% RH than at 75% RH, and the greatest population growth was recorded at 32.5 degrees C and 63% RH. At 35 degrees C, L. brunnea nymphal survivorship was 33%, and populations declined or barely grew. L. brunnea males have two to four nymphal instars, and the percentages of males with two, three, and four instars were 13, 82, and 5%, respectively. Female L. brunnea have three to five instars, and the percentages of females with three, four, and five instars were 18, 78, and 4%, respectively. The life cycle was shorter for males than females. We developed temperature-dependent development equations for male and female eggs, individual nymphal, combined nymphal, and combined immature stages and nymphal survivorship. The ability of L. brunnea to multiply rather rapidly at 55% RH may allow it to thrive under conditions of low relative humidity where other Liposcelis species may not. These data give us a better understanding of L. brunnea population dynamics and can be used to help develop effective management strategies for this psocid.

Vigilancia de insectos de importancia en salud pública durante la construcción de los proyectos hidroeléctricos Porce II y Porce III, Antioquia, Colombia, 1990-2009

Directory of Open Access Journals (Sweden)

Walter Alonso Zuluaga

2012-09-01

Full Text Available Introducción. Los estudios entomológicos en las grandes obras de infraestructura hidroeléctricaconstituyen una herramienta para la prevención y el control de enfermedades transmitidas porvectores, debido a que con frecuencia las alteraciones causadas en el medio producen aumento decriaderos naturales y artificiales en el área de influencia y, por ende, incremento de las poblaciones deartrópodos, entre ellos, insectos de interés en salud pública. Objetivo. Realizar estudio y vigilancia de la fauna de Culicidae y Phlebotominae en el área de losproyectos hidroeléctricos Porce II y Porce III, 1990-2009. Materiales y metódos. Se realizaron muestreos entomológicos periódicos para la vigilancia en saludpública de las comunidades ubicadas en el área de influencia y en campamentos y frentes de obra. Los adultos fueron capturados con red para mariposas, trampas de luz Shannon y CDC, y cebo humanoprotegido. Resultados. Se encontraron larvas de mosquitos de Culex coronator, Cx. nigripalpus, Cx. corniger, Cx.quinquefasciatus y Limatus durhami. Los depósitos más frecuentes fueron: tanques bajos, canecas,llantas y matas sembradas en agua. Aedes aegypti solo fue capturado en dos localidades rurales de dosmunicipios del área de influencia. En las zonas de bosque se capturaron mosquitos Aedes, Mansonia,Culex, Psorophora, Wyeomyia, Phonyomyia, Uranotaenia, Haemagogus y Sabethes; el principal fueHaemogogus janthinomis, eficiente vector de fiebre amarilla en Colombia. La zona es endémica paraleishmaniasis y se identificaron 20 especies de Lutzomyia. Entre los vectores de malaria, las principalesespecies encontradas fueron Anopheles nuñeztovari y An. pseudopunctipennis. Conclusión. En la zona de Porce II y Porce III existe diversidad de vectores de importancia en saludpública, que es necesario continuar vigilando para minimizar el riesgo de transmisión de enfermedadesa los trabajadores de las obras y comunidades aledañas.   doi: http

Further contributions to the Hydradephaga (Coleoptera, Haliplidae, Gyrinidae and Dytiscidae) fauna of Prince Edward Island, Canada: new records, distributions and faunal composition.

Science.gov (United States)

Alarie, Yves

2016-01-01

The Haliplidae, Gyrinidae and Dytiscidae (Coleoptera) of Prince Edward Island, Canada were surveyed during the years 2004-2005. A total of 2450 individuals from 79 species were collected from 98 different localities, among which 30 species are newly recorded from that region. Among these, Acilius sylvanus Hilsenhoff, Rhantus consimilis Motschulsky and Neoporus sulcipennis (Fall) stand out as representing the easternmost reports of these species in Canada. Once removed, Gyrinus aquiris LeConte (Gyrinidae) is reinstated in the faunal list of Prince Edward Island. According to this study and literature 84 species of Hydradephaga are currently known from Prince Edward Island. The Nearctic component of the fauna is made up of 68 species (80.9%) and the Holarctic component of 16 species (19.1%). Most species are characteristic of the Boreal and Atlantic Maritime Ecozones and have a transcontinental distribution. In an examination of the Hydradephaga of insular portions of Atlantic Canada, we found that despite significantly different land areas and different distances to the neighbouring continental mainland the island faunas of Prince Edward Island and insular Newfoundland are very similar in the number of species (84 and 94 species respectively) despite differences in composition. With a land area significantly larger than that of Prince Edward Island, however, the fauna of Cape Breton Island was 39% smaller consisting of 53 species. This difference could be due to the comparative lack of collecting efforts on Cape Breton Island.

Diet-consumer nitrogen isotope fractionation for prolonged fasting arthropods.

Science.gov (United States)

Mizota, Chitoshi; Yamanaka, Toshiro

2011-12-01

Nitrogen acquisition for cellular metabolism during diapause is a primary concern for herbivorous arthropods. Analyses of naturally occurring stable isotopes of nitrogen help elucidate the mechanism. Relevant articles have cited (58 times up to mid-June 2011) anomalously elevated δ(15)N (per mil deviation of (15)N/(14)N, relative to atmospheric nitrogen=0 ‰) values (diet-consumer nitrogen isotope fractionation; up to 12 ‰) for a prolonged fasting raspberry beetle (Byturus tomentosus Degeer (Coleoptera: Byturidae)), which feeds on red raspberries (Rubus idaeus: δ(15)N= ~ +2 ‰). Biologists have hypothesised that extensive recycling of amino acid nitrogen is responsible for the prolonged fasting. Since this hypothesis was proposed in 1995, scientists have integrated biochemical and molecular knowledge to support the mechanism of prolonged diapausing of animals. To test the validity of the recycling hypothesis, we analysed tissue nitrogen isotope ratios for four Japanese arthropods: the shield bug Parastrachia japonensis Scott (Hemiptera: Cydnidae), the burrower bug Canthophorus niveimarginatus Scott (Hemiptera: Cydnidae), leaf beetle Gastrophysa atrocyanea Motschulsky (Coleoptera: Chrysomelidae) and the Japanese oak silkworm Antheraea yamamai (Lepidoptera: Saturniidae), all of which fast for more than 6 months as part of their life-history strategy. Resulting diet-consumer nitrogen isotope discrimination during fasting ranged from 0 to 7‰, as in many commonly known terrestrial arthropods. We conclude that prolonged fasting of arthropods does not always result in anomalous diet-consumer nitrogen isotope fractionation, since the recycling process is closed or nearly closed with respect to nitrogen isotopes.

Notes on the Reproductive Ecology and Description of the Preimaginal Morphology of Elaphrus sugai Nakane, the Most Endangered Species of Elaphrus Fabricius (Coleoptera: Carabidae Ground Beetle Worldwide.

Directory of Open Access Journals (Sweden)

Kôji Sasakawa

Full Text Available Elucidating the basic life-history of endangered species is the first important step in the conservation of such species. This study examined the reproductive ecology and the preimaginal morphology of the endangered ground beetle Elaphrus sugai Nakane (Coleoptera: Carabidae; currently, the Watarase wetland of the central Kanto Plain, Japan is the only confirmed locality of this beetle species. Laboratory rearing of reproductive adults collected in early April revealed that females can lay more than 131 eggs. Eggs were laid in mud, without an egg chamber. Larvae reached adulthood when fed a diet of mealworms, indicating that E. sugai larvae are insect larvae feeders. An earthworm diet, the optimal diet for larvae of a congeneric species (E. punctatus Motschulsky, was lethal to E. sugai larvae. The egg stage was 3-4 days in duration under a 16L8D cycle (22°C. The duration from hatching to adult eclosion was 23-42 days at various temperatures simulating those of the reproductive period. Larval morphology was similar to that of consubgeneric species described previously. The pupa is unusual, in that the setae on the abdominal tergites are long (twice as long as those of the abdominal segment and have somewhat "coiled" apices. Finally, the current endangered status of E. sugai was compared to that of E. viridis Horn, which has been regarded as the most endangered species of the genus worldwide.

Partial purification and characterization of α-amylases from one insecticide-resistant population of Sitophilus zeamais

International Nuclear Information System (INIS)

Lopes, K.V.; Oliveira, M.G.A.; Paixao, G.P.; Visotto, L.E.; Veloso, R.V.S.; Marinho, J.S.; Guedes, R.N.C.; Oliveira, J.A.

2008-01-01

Full text: α-Amylases (EC 3.2.1.1) constitute a family of endo-amylases that catalyze the hydrolysis of a-D- (1,4)-glucan linkages in st ach components and various other related carbohydrates. They play a central role in carbohydrate metabolism of animals, plants and microorganisms. Many insects, especially those that feed on grain products during larval and/or adult life, depend on their amylases for survival. This is particularly true for the Sitophilus zeamais Motschulsky, a cosmopolitan pest of stored products. It is mainly controlled by insecticides. Amylases from adults of S.zeamais insecticide-resistant were purified by using a sequential procedure of glycogen-complex precipitation and ion exchange chromatography. Specific activity increased from 58,0454 AU/dL/mg protein in the crude homogenate to 2558,8720 AU/dL/mg protein in the final purified sample. Amylase unit (AU/dL) refers to the amount of amylase that hydrolysis 10 mg starch in 30 min at 37 deg C. The purified amylase ran as a single protein band on SDS-PAGE. From a plot of log molecular weight against relative mobility in 10% acrylamide gel, molecular weight was estimated to be 56 kDa. The enzyme had a K m of 0,2243 g/L for soluble starch and was most active at ph 5,0. The temperature of major activity was 40 deg C. The activity of enzyme was unaffected by presence or absence of Cl - and Ca 2+

Development and characterization of polymorphic genomic-SSR markers in Asian long-horned beetle (Anoplophora glabripennis).

Science.gov (United States)

Liu, Zhaoyang; Tao, Jing; Luo, Youqing

2017-12-01

The Asian long-horned beetle (ALB), Anoplophora glabripennis (Motschulsky) (Coleoptera: Cerambycidae: Lamiinae), is a wood-borer and polyphagous xylophage that is native to Asia. It infests and seriously harms healthy trees, and therefore is a cause for considerable environmental concern. The analysis of population genetic structure of ALB and sibling species Anoplophora nobilis (Ganglbauer) will not only help to clarify the relationship between environmental variables and mechanisms of speciation, but also will enhance our understanding of evolutionary processes. However, the known genetic markers, particularly microsatellites, are limited for this species. SSRLocator software was used to analyze the distribution and frequencies of genomic simple sequence repeat (SSR), to infer the basic characteristics of repeat motifs, and to design primers. We developed SSR loci of 2-6 repeated units, including 10,650 perfect SSRs, and found 140 types of repeat motifs. A total of 2621 SSR markers were discovered in ALB whole-genome shotgun sequences. 48 pairs of SSR primers were randomly chosen from 2621 SSR markers, and half of these 48 pairs were polymorphic containing 4 di-, 7 tri-, 2 tetra-, and 11-hexamer SSRs. Four populations test the effectiveness of the primers. These results suggest that our method for whole-genome SSR screening is feasible and efficient, and the SSR markers developed in this study are suitable for further population genetics studies of ALB. Moreover, they may also be useful for the development of SSRs for other Coleoptera.

Partial purification and characterization of {alpha}-amylases from one insecticide-resistant population of Sitophilus zeamais

Energy Technology Data Exchange (ETDEWEB)

Lopes, K.V.; Oliveira, M.G.A.; Paixao, G.P.; Visotto, L.E. [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Bioquimica e Biologia Molecular; Veloso, R.V.S.; Marinho, J.S.; Guedes, R.N.C. [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Biologia Animal; Oliveira, J.A. [Universidade Federal de Vicosa (UFV), MG (Brazil). Dept. de Quimica

2008-07-01

Full text: {alpha}-Amylases (EC 3.2.1.1) constitute a family of endo-amylases that catalyze the hydrolysis of a-D- (1,4)-glucan linkages in st ach components and various other related carbohydrates. They play a central role in carbohydrate metabolism of animals, plants and microorganisms. Many insects, especially those that feed on grain products during larval and/or adult life, depend on their amylases for survival. This is particularly true for the Sitophilus zeamais Motschulsky, a cosmopolitan pest of stored products. It is mainly controlled by insecticides. Amylases from adults of S.zeamais insecticide-resistant were purified by using a sequential procedure of glycogen-complex precipitation and ion exchange chromatography. Specific activity increased from 58,0454 AU/dL/mg protein in the crude homogenate to 2558,8720 AU/dL/mg protein in the final purified sample. Amylase unit (AU/dL) refers to the amount of amylase that hydrolysis 10 mg starch in 30 min at 37 deg C. The purified amylase ran as a single protein band on SDS-PAGE. From a plot of log molecular weight against relative mobility in 10% acrylamide gel, molecular weight was estimated to be 56 kDa. The enzyme had a K{sub m} of 0,2243 g/L for soluble starch and was most active at ph 5,0. The temperature of major activity was 40 deg C. The activity of enzyme was unaffected by presence or absence of Cl{sup -} and Ca{sup 2+}.

Assessment of the risk of introduction of Anoplophora glabripennis (Coleoptera: Cerambycidae) in municipal solid waste from the quarantine area of New York City to landfills outside of the quarantine area: a pathway analysis of the risk of spread and establishment.

Science.gov (United States)

Auclair, Allan N D; Fowler, G; Hennessey, M K; Hogue, A T; Keena, M; Lance, D R; McDowell, R M; Oryang, D O; Sawyer, A J

2005-02-01

The risk associated with spread of Asian longhorned beetle, Anoplophora glabripennis (Motschulsky), from infested areas in New York City to the wide array of landfills across the eastern United States contracted by the city since 1997 was unknown, but of great concern. Landfills, some as far as South Carolina, Virginia, and Ohio, occupied forest types and climates at high risk of Asian longhorned beetle establishment. The city proposed a separate waste wood collection known as the "311 System;" this was estimated to cost federal and state agencies $6.1 to $9.1 million per year, including the cost of processing and disposal of the wood. Pathway analysis was used to quantify the probability that Asian longhorned beetle present in wood waste collected at curbside would survive transport, compaction, and burial to form a mated pair. The study found that in seven alternate management scenarios, risks with most pathways are very low, especially given existing mitigations. Mitigations included chemical control, removal of infested trees, and burial of wood waste in managed landfills that involved multiple-layering, compaction, and capping of dumped waste with a 15-cm soil cover at the end of each day. Although the risk of business-as-usual collection and disposal practices was virtually nil, any changes of policy or practice such as illegal dumping or disposal at a single landfill increased the risk many thousandfold. By rigorously maintaining and monitoring existing mitigations, it was estimated that taxpayers would save $75 to $122 million dollars over the next decade.

Identification of multiple ear-colonizing insect and disease resistance in CIMMYT maize inbred lines with varying levels of silk maysin.

Science.gov (United States)

Ni, Xinzhi; Krakowsky, Matthew D; Buntin, G David; Rector, Brian G; Guo, Baozhu; Snook, Maurice E

2008-08-01

Ninety four corn inbred lines selected from International Center for the Improvement of Maize and Wheat (CIMMYT) in Mexico were evaluated for levels of silk maysin in 2001 and 2002. Damage by major ear-feeding insects [i.e., corn earworm, Helicoverpa zea (Boddie) (Lepidoptera: Noctuidae); maize weevil, Sitophilus zeamais (Motschulsky) (Coleoptera: Curculionidae); brown stink bug, Euschistus servus (Say); southern green stink bugs, Nezara viridula (L.) (Heteroptera: Pentatomidae)], and common smut [Ustilago maydis DC (Corda)] infection on these inbred lines were evaluated in 2005 and 2006 under subtropical conditions at Tifton, GA. Ten inbred lines possessing good agronomic traits were also resistant to the corn earworm. The correlation between ear-feeding insect damage or smut infection and three phenotypic traits (silk maysin level, husk extension, and husk tightness of corn ears) was also examined. Corn earworm and stink bug damage was negatively correlated to husk extension, but not to either silk maysin levels or husk tightness. In combination with the best agronomic trait ratings that show the least corn earworm and stink bug damage, lowest smut infection rate, and good insect-resistant phenotypic traits (i.e., high maysin and good husk coverage and husk tightness), 10 best inbred lines (CML90, CML92, CML94, CML99, CML104, CML108, CML114, CML128, CML137, and CML373) were identified from the 94 lines examined. These selected inbred lines will be used for further examination of their resistance mechanisms and development of new corn germplasm that confers multiple ear-colonizing pest resistance.

What does "local" firewood buy you? Managing the risk of invasive species introduction.

Science.gov (United States)

Tobin, Patrick C; Diss-Torrance, Andrea; Blackburn, Laura M; Brown, Brian D

2010-10-01

Firewood can serve as a vector in the transport of non-native species, including wood-boring insects that feed within the wood and thus can be transported accidentally. Governments have enacted limitations on the movement of firewood in an effort to limit the anthropogenic movement of non-native species through, for example, recreational camping. Although the movement of invasive species through firewood is a documented invasion pathway, it is not trivial for governments to determine a "safe" allowable distance for moving firewood. We were motivated by this challenge and developed a theoretical simulation to determine the campgrounds that could be potentially exposed to infested firewood based upon the hypothetical distribution of an invasive species and the allowable distance for moving firewood. We extend this concept to the known distributions of emerald ash borer, Agrilus planipennis Fairmaire (Coleoptera: Buprestidae) and Asian longhorned beetle, Anoplophora glabripennis (Motschulsky) Coleoptera: Cerambycidae). We illustrate, based upon theoretical and empirical observations, that as the distribution of an invasive species increases, more rigid constraints on the movement of firewood would be required relative to those species that are distributed over a smaller scale. Also, on the level of management within a state, smaller states have far less margin for error than larger ones, as even extremely rigid restrictions on the movement of firewood could have little management effect unless the infested area is spatially limited. These results collectively suggest the potential for a dynamic management strategy that adjusts allowable distances for firewood movement based upon the distribution of the non-native species.

Field observations of climbing behavior and seed predation by adult ground beetles (Coleoptera: Carabidae) in a lowland area of the temperate zone.

Science.gov (United States)

Sasakawa, Kôji

2010-10-01

Granivory is a specialized food habit in the predominantly carnivorous beetle family Carabidae. Most studies of carabid granivory have been conducted under laboratory conditions; thus, our knowledge of the feeding ecology of granivorous carabids in the field is insufficient. I conducted field observations of climbing behavior and seed predation by adult carabids in a lowland area of eastern Japan, from early October to late November in 2008. This is the first systematic field observation of the feeding ecology of granivorous carabids in the temperate zone. In total, 176 carabid individuals of 11 species were observed, with 108 individuals feeding on plant seeds/flowers. Each carabid species was primarily observed feeding on a particular plant species. Frequently observed combinations were: Amara gigantea Motschulsky on Humulus scandens (Loureiro) Merrill (Moraceae) seed, Amara lucens Baliani on Artemisia indica Willdenow (Asteraceae) flower, and Amara macronota (Solsky) and Harpalus (Pseudoophonus) spp. on Digitaria ciliaris (Retzius) Koeler (Poaceae) seed. In all but one species, the sex ratio of individuals observed feeding was female-biased. In Am. gigantea and Am. macronota, a larger proportion of females than males ate seeds. In the three Amara species, copulations on plants, with the female feeding on its seeds/flowers, were often observed. These observations may indicate that, whereas females climb onto plants to feed on seeds, males climb to seek females for copulation rather than forage. Because granivorous carabids play important roles as weed-control agents in temperate agro-ecosystems, the present results would provide valuable basic information for future studies on this subject.

[Diagnosing Low Health and Wood Borer Attacked Trees of Chinese Arborvitae by Using Thermography].

Science.gov (United States)

Wang, Fei; Wu, De-jun; Zhai, Guo-feng; Zang, Li-peng

2015-12-01

Water and energy metabolism of plants is very important actions in their lives. Although the studies about these actions by using thermography were often reported, seldom were found in detecting the health status of forest trees. In this study, we increase the measurement accuracy and comparability of thermo-images by creating the difference indices. Based on it, we exam the water and energy status in stem of Chinese arborvitae (Platycladus orientalis (L.) Franco) by detecting the variance of far infrared spectrum between sap-wood and heart-wood of the cross-section of felling trees and the cores from an increment borer using thermography. The results indicate that the sap rate between sapwood and heartwood is different as the variance of the vigor of forest trees. Meanwhile, the image temperature of scale leaves from Chinese arborvitae trees with different vigor is also dissimilar. The far infrared spectrum more responds the sap status not the wood percentage in comparing to the area rate between sapwood and heartwood. The image temperature rate can be used in early determining the health status of Chinese arborvitae trees. The wood borers such as Phloeosinus aubei Perris and Semanotus bifasciatus Motschulsky are the pests which usually attack the low health trees, dying trees, wilted trees, felled trees and new cultivated trees. This measuring technique may be an important index to diagnose the health and vigor status after a large number of measurements for Chinese arborvitae trees. Therefore, there is potential to be an important index to check the tree vigor and pest damage status by using this technique. It will be a key in the tending and management of ecological and public Chinese arborvitae forest.

Pest management in traditional maize stores in West Africa: a farmer's perspective.

Science.gov (United States)

Meikle, W G; Markham, R H; Nansen, C; Holst, N; Degbey, P; Azoma, K; Korie, S

2002-10-01

Farmers in the Republic of Benin have few resources to invest in protection of stored maize, and prophylactic pesticide application is often recommended by extension and development agencies. Neither the efficacy nor profitability of such an application in traditional maize storage facilities has been addressed quantitatively. In this study, existing management options for stored maize were evaluated monthly over 6 mo in central and southern Benin with respect to their effects on grain injury and on densities of Prostephanus truncatus (Horn) and Sitophilus zeamais Motschulsky. P. truncatus infested 54% of the experimental stores in the study even though Teretrius nigrescens (Lewis), a natural enemy introduced against P. truncatus, was well established in the region. S. zeamais was the most common pest, found in 85% of the experimental storage facilities. Prophylactically treated maize was, on average, worth more than untreated maize for month 1 through 5 in southern Benin, after taking into account market price, pesticide costs, percentage grain damage and weight loss, but maize storage was not profitable overall. No difference was observed between treatments in central Benin. After 6 mo treated storage facilities were not significantly different from untreated storage facilities in terms of either percentage damage or profit in either region. A rapid scouting plan intended to provide farmers with a means for identifying storage facilities at greatest risk of severe P. truncatus infestation was field validated. Given that unsafe pesticide use is prevalent in Benin, research and extension services should clearly state the limitations to prophylactic treatment and increase the effort to educate farmers on appropriate pesticide use, store monitoring and marketing.

USO DE PLANTAS EM PÓ SECO COM PROPRIEDADES TERMITICIDA SOBRE A MORTALIDADE DE CUPINS ARBÓREOS

Directory of Open Access Journals (Sweden)

Chistopher Stallone Cruz

2012-09-01

Full Text Available 1024x768 Normal 0 21 false false false PT-BR X-NONE X-NONE Os térmitas são insetos de grande importância ecológica, com mais de 2.750 espécies catalogadas em todo o mundo. Pequeno número de espécies são conhecidos por provocarem grandes danos econômicos ao homem, sendo considerado como praga urbana ou agrícola, são destruidores de madeira seca, pastagens e outros materiais composto de celulose. A vasta gama de uso indiscriminado de produtos químicos contra o controle deste inseto vem trazendo ao longo do tempo resultados negativos, por apresentarem sérios riscos a saúde humana e dar surgimento a cupins com resistência. Avaliou-se nove espécies vegetais que possivelmente apresentem poder cupinicida em substituição aos tratamentos convencionais, de modo a preservar o meio ambiente. Foram avaliados os seguintes vegetais: caule e folha de Aspidosperma pyrifolium, raiz de Mimosa tenuiflora, raiz de Cnidoscolus urens, gema apical de Syzygium aromaticum, semente de Azadirachta indica, fruto de Piper nigrum, folhas de Eucalyptus sp., raiz de Zingiber officinale e fruto de Punica granatum. Foram coletados 550 espécimes de cupins, 275 operários e 275 soldados, logo em seguida foram distribuídos 10 indivíduos dentro de um cativeiro de polipropileno com capacidade de 250mL, juntamente com 3g do pó seco, 5g de fragmentos de cupinzeiro macerado, verificando a viabilidade dos pós secos durante 5 dias consecutivos, sendo realizado uma leitura de mortalidade a cada 24 horas. O delineamento utilizado foi o inteiramente casualizado e os dados foram avaliados pelos testes Student e Henderson & Tilton. Verificou-se que a utilização dos pós vegetais é  alternativa eficaz e barata no controle de Nasutitermes sp., destacando-se como mais letais folhas e galhos de A. indica,Eucalyptus sp., S. aromaticum, Z. officinale, C. urens e P. nigrum.

Construction and characterization of normalized cDNA libraries by 454 pyrosequencing and estimation of DNA methylation levels in three distantly related termite species.

Directory of Open Access Journals (Sweden)

Yoshinobu Hayashi

Full Text Available In termites, division of labor among castes, categories of individuals that perform specialized tasks, increases colony-level productivity and is the key to their ecological success. Although molecular studies on caste polymorphism have been performed in termites, we are far from a comprehensive understanding of the molecular basis of this phenomenon. To facilitate future molecular studies, we aimed to construct expressed sequence tag (EST libraries covering wide ranges of gene repertoires in three representative termite species, Hodotermopsis sjostedti, Reticulitermes speratus and Nasutitermes takasagoensis. We generated normalized cDNA libraries from whole bodies, except for guts containing microbes, of almost all castes, sexes and developmental stages and sequenced them with the 454 GS FLX titanium system. We obtained >1.2 million quality-filtered reads yielding >400 million bases for each of the three species. Isotigs, which are analogous to individual transcripts, and singletons were produced by assembling the reads and annotated using public databases. Genes related to juvenile hormone, which plays crucial roles in caste differentiation of termites, were identified from the EST libraries by BLAST search. To explore the potential for DNA methylation, which plays an important role in caste differentiation of honeybees, tBLASTn searches for DNA methyltransferases (dnmt1, dnmt2 and dnmt3 and methyl-CpG binding domain (mbd were performed against the EST libraries. All four of these genes were found in the H. sjostedti library, while all except dnmt3 were found in R. speratus and N. takasagoensis. The ratio of the observed to the expected CpG content (CpG O/E, which is a proxy for DNA methylation level, was calculated for the coding sequences predicted from the isotigs and singletons. In all of the three species, the majority of coding sequences showed depletion of CpG O/E (less than 1, and the distributions of CpG O/E were bimodal, suggesting

Construction and characterization of normalized cDNA libraries by 454 pyrosequencing and estimation of DNA methylation levels in three distantly related termite species.

Science.gov (United States)

Hayashi, Yoshinobu; Shigenobu, Shuji; Watanabe, Dai; Toga, Kouhei; Saiki, Ryota; Shimada, Keisuke; Bourguignon, Thomas; Lo, Nathan; Hojo, Masaru; Maekawa, Kiyoto; Miura, Toru

2013-01-01

In termites, division of labor among castes, categories of individuals that perform specialized tasks, increases colony-level productivity and is the key to their ecological success. Although molecular studies on caste polymorphism have been performed in termites, we are far from a comprehensive understanding of the molecular basis of this phenomenon. To facilitate future molecular studies, we aimed to construct expressed sequence tag (EST) libraries covering wide ranges of gene repertoires in three representative termite species, Hodotermopsis sjostedti, Reticulitermes speratus and Nasutitermes takasagoensis. We generated normalized cDNA libraries from whole bodies, except for guts containing microbes, of almost all castes, sexes and developmental stages and sequenced them with the 454 GS FLX titanium system. We obtained >1.2 million quality-filtered reads yielding >400 million bases for each of the three species. Isotigs, which are analogous to individual transcripts, and singletons were produced by assembling the reads and annotated using public databases. Genes related to juvenile hormone, which plays crucial roles in caste differentiation of termites, were identified from the EST libraries by BLAST search. To explore the potential for DNA methylation, which plays an important role in caste differentiation of honeybees, tBLASTn searches for DNA methyltransferases (dnmt1, dnmt2 and dnmt3) and methyl-CpG binding domain (mbd) were performed against the EST libraries. All four of these genes were found in the H. sjostedti library, while all except dnmt3 were found in R. speratus and N. takasagoensis. The ratio of the observed to the expected CpG content (CpG O/E), which is a proxy for DNA methylation level, was calculated for the coding sequences predicted from the isotigs and singletons. In all of the three species, the majority of coding sequences showed depletion of CpG O/E (less than 1), and the distributions of CpG O/E were bimodal, suggesting the presence of

Sinopsis de los Meloidae (Coleoptera de Chiapas (México y comentarios taxonómicos sobre el género Denierota Kaszab, 1959

Directory of Open Access Journals (Sweden)

Parra-Olea, G.

2009-06-01

Full Text Available The revision of the specimens of the family Meloidae (Coleoptera from the small Entomological Collection of ECOSUR at San Cristóbal de las Casas (Chiapas, Mexico, together with the revision of the material of Chiapas from the National Insect Collection (CNIN-IBUNAM, Instituto de Biología, UNAM, México of the genus Epicauta, Hungarian Museum of Natural History (HMNH, Magyar Természettudományi Múzeum, Budapest and Marco A. Bologna’ collection (MAB, Università degli Studi Roma Tre, Italy, allow us to report the presence of Epicauta diana Pinto, 1991, Epicauta rufipennis (Chevrolat, 1834, Epicauta forticornis (Haag-Rutenberg, 1880, Epicauta distorta (Champion, 1892, Meloe tropicus Motschulsky, 1856, Denierota kraatzi (Haag-Rutenberg, 1880, Pyrota decorata (Haag-Rutenberg, 1880, Cissites auriculata (Champion, 1892 and Tetraonyx frontalis Chevrolat, 1833 for the first time in the State of Chiapas (México. Amongst these records, those of M. tropicus confirm the presence of the species in Mexico. The specimen of D. kraatzi represents the first precise record for the genus Denierota in México. The study of the material used by Z. Kaszab to describe the genus Denierota (HNHM, together with the specimens from M. Bologna’s Collection and the study of photographs of the type specimens of Lytta sanguineoguttata Haag-Rutenberg, 1880 and Lytta kraatzi Haag-Rutenberg, 1880, the two taxa previously included in Denierota, from the Zoologische Staatssammlung of Münich (Germany, allow us to conclude that the genus includes only one described species, and to formalize the synonymy of L. sanguineoguttata with L. kraatzi, solving both the long standing problem of the identity of L. kraatzi and the secondary problem caused by the lack of type locality (“patria ignota” for the species.La revisión de los ejemplares de la familia Meloidae de la pequeña colección entomológica del ECOSUR en San Cristóbal de las Casas (Chiapas, México, acompañada del

Assessment of species diversity of plants and carabid beetles at sample plots in Korean pine-broad-leaved stands of postfire origin

Directory of Open Access Journals (Sweden)

A. V. Ivanov

2018-06-01

Full Text Available For natural pine forests in the southern part of the Primorsky Krai, an assessment of biological diversity has been performed based on the results of descriptions of valuable tree species, living ground cover and carabid beetles Carabus. Field work was carried out on the trial plots laid in the forest plantations of the pine and broad-leaved forest with the domination of Korean pine Pinus koraiensis Siebold & Zucc. Model sites contained a chronological sequence of development of forest plantations of fresh small-grass and different-bush type on the interval of age 50–200 years. In the process of reforestation, a decrease in the total projective coverage of living ground cover was observed, while the number of species characteristic for natural pine forests, as well as their leveling, increased at the same time. By the age of 200 years species richness and leveling of the number of ground beetle species have reached a maximum. Statistically significant difference was found between the total number of caught insects in the plantations of 50 and 200, 80 and 200 years. The most valuable in terms of biological diversity are the old-growth pine forests. A conclusion was made about the value of this group of forests for the protection of valuable communities and habitats of species. Among ground beetle species Carabus schrencki Motschulsky, Carabus maacki Morawitz and Carabus macleayi Dejean can serve as an indicator of forest value. With a minimum total projective coverage (8.3 %, 200-year-old pine forests are favorable for the growth of such characteristic species as the mountain peony Paeonia oreogeton S. Moore, pale-mountain Dryopteris crassirhizoma Nakai, and the Pale Indian Plantain Cacalia auriculata H. Rob. & Brettell. On this site the Shannon index of species of living ground cover was 3.6, the Carabus species is 1.4.

Field screening of experimental corn hybrids and inbred lines for multiple ear-feeding insect resistance.

Science.gov (United States)

Ni, Xinzhi; Xu, Wenwei; Krakowsky, Matthew D; Buntin, G David; Brown, Steve L; Lee, R Dewey; Coy, Anton E

2007-10-01

Identifying and using native insect resistance genes is the core of integrated pest management. In this study, 10 experimental corn, Zea mays L., hybrids and 10 inbred lines were screened for resistance to major ear-feeding insects in the southeastern Coastal Plain region of the United States during 2004 and 2005. Ear-feeding insect damage was assessed at harvest by visual damage rating for the corn earworm, Helicoverpa zea (Boddie), and by the percentage of kernels damaged by the maize weevil, Sitophilus zeamais Motschulsky, and stink bugs [combination of Euschistus servus (Say) and southern green stink bug, Nezara viridula (L.)]. Among the eight inbred lines and two control populations examined, C3S1B73-5b was resistant to corn earworm, maize weevil, and stink bugs. In contrast, C3S1B73-4 was resistant to corn earworm and stink bugs, but not to maize weevil. In a similar manner, the corn hybrid S1W*CML343 was resistant to all three ear-feeding insects, whereas hybrid C3S1B73-3*Tx205 was resistant to corn earworm and maize weevil in both growing seasons, but susceptible to stink bugs in 2005. The silk-feeding bioassay showed that corn earworm developed better on corn silk than did fall armyworm. Among all phenotypic traits examined (i.e., corn ear size, husk extension, and husk tightness), only corn ear size was negatively correlated to corn earworm damage in the inbred lines examined, whereas only husk extension (i.e., coverage) was negatively correlated to both corn earworm and maize weevil damage on the experimental hybrids examined. Such information could be used to establish a baseline for developing agronomically elite corn germplasm that confers multiple ear-feeding insect resistance.

Interaction of Insecticide and Media Moisture on Ambrosia Beetle (Coleoptera: Curculionidae) Attacks on Selected Ornamental Trees.

Science.gov (United States)

Frank, Steven D; Anderson, Amanda L; Ranger, Christopher M

2017-12-08

Exotic ambrosia beetles, particularly Xylosandrus crassiusculus (Motschulsky) (Coleoptera: Curculionidae: Scolytinae) and Xylosandrus germanus (Blandford) (Coleoptera: Curculionidae: Scolytinae), are among the most damaging pests of ornamental trees in nurseries. Growers have had few tactics besides insecticide applications to reduce ambrosia beetle attacks but recent research has shown that attacks may be reduced by maintaining media moisture below a 50% threshold thereby reducing flood stress. We compared the efficacy of managing media moisture and insecticide applications for reducing ambrosia beetle attacks on three ornamental tree species in North Carolina. During trials in spring 2013 and 2015, flooded Cornus florida and Cornus kousa were heavily attacked despite sprays with permethrin, but nonflooded C. kousa or C. florida were not attacked. In spring 2015 trials, both nonflooded and flooded Styrax japonicus were heavily attacked regardless of permethrin applications. Although ethanol emissions were not measured, the apparently healthy nonflooded S. japonicus trees may have been exposed to an unknown physiological stress, such as low temperature injury, the previous winter, which predisposed them to beetle attack. However, ethanol levels within host tissues were not measured as part of the current study. X. crassiusculus (75%), Xyloborinus saxesenii Ratzburg (13%), and X. germanus (9%) were the most abundant species collected in ethanol baited traps deployed in 2015, while X. crassiusculus (63%) and X. germanus (36%) were the predominant species reared from attacked trees. Results indicate that managing media moisture levels at or below 50%, and maximizing tree health overall, may provide significant protection against Xylosandrus spp. attacks in flood intolerant tree species. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

Vertical Distribution and Daily Flight Periodicity of Ambrosia Beetles (Coleoptera: Curculionidae) in Florida Avocado Orchards Affected by Laurel Wilt.

Science.gov (United States)

Menocal, Octavio; Kendra, Paul E; Montgomery, Wayne S; Crane, Jonathan H; Carrillo, Daniel

2018-03-08

Ambrosia beetles have emerged as significant pests of avocado ((Persea americana Mill. [Laurales: Lauraceae])) due to their association with pathogenic fungal symbionts, most notably Raffaelea lauricola T.C. Harr., Fraedrich & Aghayeva (Ophiostomatales: Ophiostomataceae), the causal agent of the laurel wilt (LW) disease. We evaluated the interaction of ambrosia beetles with host avocado trees by documenting their flight height and daily flight periodicity in Florida orchards with LW. Flight height was assessed passively in three avocado orchards by using ladder-like arrays of unbaited sticky traps arranged at three levels (low: 0-2 m; middle: 2-4 m; high: 4-6 m). In total, 1,306 individuals of 12 Scolytinae species were intercepted, but six accounted for ~95% of the captures: Xyleborus volvulus (Fabricius) (Coleoptera: Curculionidae), Xyleborinus saxesenii Ratzeburg (Coleoptera: Curculionidae), Euplatypus parallelus (Fabricius) (Coleoptera: Curculionidae), Xyleborus bispinatus Eichhoff (Coleoptera: Curculionidae), Xyleborus affinis Eichhoff (Coleoptera: Curculionidae), and Hypothenemus sp. (Coleoptera: Curculionidae). The primary vector of R. lauricola, Xyleborus glabratus Eichhoff (Coleoptera: Curculionidae), was not detected. Females of X. volvulus showed a preference for flight at low levels and X. bispinatus for the low and middle levels; however, captures of all other species were comparable at all heights. At a fourth orchard, a baiting method was used to document flight periodicity. Females of X. saxesenii and Hypothenemus sp. were observed in flight 2-2.5 h prior to sunset; X. bispinatus, X. volvulus, and X. affinis initiated flight at ~1 h before sunset and Xylosandrus crassiusculus (Motschulsky) (Coleoptera: Curculionidae) at 30 min prior to sunset. Results suggest that ambrosia beetles in South Florida fly near sunset (when light intensity and wind speed decrease) at much greater heights than previously assumed and have species-specific patterns in host

Description of an establishment event by the invasive Asian longhorned beetle (Anoplophora glabripennis in a suburban landscape in the northeastern United States.

Directory of Open Access Journals (Sweden)

Helen Hull-Sanders

Full Text Available The establishment of non-native species is commonly described as occurring in three phases: arrival, establishment, and dispersal. Both arrival and dispersal by the Asian longhorned beetle (Anoplophora glabripennis Motschulsky, a xylophagous Cerambycid native to China and the Korean peninsula, has been documented for multiple locations in both North America and Europe, however the transitional phase, establishment, is not well understood for this species due to the need to rapidly remove populations to prevent dispersal and assist eradication, and the evident variation in the behavior of populations. Here we describe the dynamics of an establishment event for the Asian longhorned beetle in a small, isolated population within the regulated quarantine zone near Worcester, Massachusetts, USA. These data were collected during an opportunity afforded by logistical limits on the Cooperative Asian Longhorned Beetle Eradication Program administered by state, federal, and local government partners. Seventy-one infested red maple (Acer rubrum trees and 456 interspersed un-infested trees were surveyed in an isolated, recently established population within a ~0.29 ha stand in a suburban wetland conservation area in which nearly 90% of the trees were host species, and nearly 80% were Acer rubrum. Tree-ring analyses show that within this establishing population, Asian longhorned beetles initially infested one or two A. rubrum, before moving through the stand to infest additional A. rubrum based not on distance or direction, but on tree size, with infestation biased towards trees with larger trunk diameters. Survey data from the larger landscape suggest this population may have generated long-distance dispersers (~1400 m, and that these dispersal events occurred before the originally infested host trees were fully exploited by the beetle. The distribution and intensity of damage documented in this population suggest dispersal here may have been spatially more

Review of the leafhopper genus Penthimia Germar (Hemiptera: Cicadellidae: Deltocephalinae) from the Indian subcontinent with description of seven new species.

Science.gov (United States)

Shobharani, M; Viraktamath, C A; Webb, M D

2018-01-02

Species of the leafhopper genus Penthimia Germar known from the Indian subcontinent are reviewed based on the examination of type specimens. Seven new species of the genus, Penthimia curvata sp. nov. (Karnataka: Bandipur), P. meghalayensis sp. nov. (Meghalaya: Nangpoh), P. neoattenuata sp. nov. (India: Tamil Nadu), P. ribhoi sp. nov. (India: Meghalaya), P. sahyadrica sp. nov. (Karnataka: Dharmasthala, Agumbe; Kerala: Thekkady), P. spiculata sp. nov. (Karnataka: Nagarahole) and P. tumida sp. nov. (Tamil Nadu: Ootacamund; Kerala: Munnar) are described. The following nomenclatorial changes are proposed: Penthimia alba Zahniser, McKamey Dmitriev, 2012 (replacement name for P. thoracica Distant, 1918, nec Panzer, 1799), syn. nov. of P. quadrinotata Distant, 1918; Neodartus scutellatus Distant, 1908 syn. nov. of Penthimia ereba Distant 1908; P. nilgiriensis Distant, 1918 syn. nov. of P. montana Distant, 1918; P. scutellata (Distant) comb. nov. (from genus Neodartus); a lectotype is designated for P. maculosa Distant, stat. revived, thereby removing its synonymy with P. scapularis Distant. The following other lectotypes are designated: P. attenuata Distant, P. subniger Distant, P. scapularis Distant, P. distanti Baker, P. ereba Distant, N. scutellatus Distant, P. fraterna Distant, P. funebris Distant, P. juno Distant, P. maculosa Distant, P. montana Distant, P. noctua Distant, P. quadrinotata Distant, P. alba Zahniser, McKamey Dmitriev. Examination of types of Penthimia rufopunctata Motschulsky revealed that it belongs to Penthimia and hence it is transferred back to that genus from Neodartus, revised placement. The following species previously included in the genus Penthimia are transferred to the genera Tambila Distant and Vulturnus Kirkaldy: Tambila badia (Distant) comb. nov., T. majuscula (Distant) comb. nov., T. vittatifrons (Distant) comb. nov., T. variabilis (Distant) comb. nov. and Vulturnus flavocapitata (Distant) comb. nov. Three species are treated in a new

Up high and down low: Molecular systematics and insight into the diversification of the ground beetle genus Rhadine LeConte.

Science.gov (United States)

Gómez, R Antonio; Reddell, James; Will, Kipling; Moore, Wendy

2016-05-01

Rhadine LeConte is a Nearctic genus of flightless ground beetles that is poorly studied despite its relevance to evolutionary studies of subterranean fauna. Adults are notable for their slender and leggy habitus and the wide variety of habitat preferences among species, with several known only from mountaintops while others are restricted to caves or more general subterranean habitats. In central Texas, USA there are several cave endemics relevant to conservation. Here we present the first phylogenetic hypothesis for the overall structure of the genus with an emphasis on the troglobites in central Texas. We infer the phylogeny of Rhadine from ∼2.4-kb of aligned nucleotide sites from the nuclear genes, 28S rDNA and CAD, and the mitochondrial gene COI. These data were obtained for 30 species of Rhadine as well as from members of their putative sister group, Tanystoma Motschulsky. Results reveal that Rhadine is polyphyletic, and morphological characters that have been traditionally used to classify the genus into species groups are shown to be convergent in many cases. Rhadine aside from two species of uncertain placement is composed of two major clades, Clades I and II that both include epigean and subterranean species in very unequal proportions. Clade I is primarily composed of subterranean species, and Clade II includes many epigean species and high altitude montane endemics. A clade of troglobitic, cave-restricted species in Texas includes several species of large-eyed cave Rhadine. The slender habitus typical of some species [e.g., R. exilis (Barr and Lawrence), R. subterranea (Van Dyke), R. austinica Barr] evolved independently at least three times. Major biogeographic and evolutionary patterns based on these results include: troglobitic species north of the Colorado River in Texas (that also lack lateral pronotal setae) are found to comprise a monophyletic group, beetles in caves south of the Colorado River likely form another monophyletic group, and the

A synopsis of the tribe Lachnophorini, with a new genus of Neotropical distribution and a revision of the Neotropical genus Asklepia Liebke, 1938 (Insecta, Coleoptera, Carabidae)

Science.gov (United States)

Erwin, Terry L.; Zamorano, Laura S.

2014-01-01

Abstract This synopsis provides an identification key to the genera of Tribe Lachnophorini of the Western and Eastern Hemispheres including five genera previously misplaced in carabid classifications. The genus Asklepia Liebke, 1938 is revised with 23 new species added and four species reassigned from Eucaerus LeConte, 1853 to Asklepia Liebke, 1938. In addition, a new genus is added herein to the Tribe: Peruphorticus gen. n. with its type species P. gulliveri sp. n. from Perú. Five taxa previously assigned to other tribes have adult attributes that make them candidates for classification in the Lachnophorini: Homethes Newman, Aeolodermus Andrewes, Stenocheila Laporte de Castelnau, Diplacanthogaster Liebke, and Selina Motschulsky are now considered to belong to the Lachnophorini as genera incertae sedis. Three higher level groups are proposed to contain the 18 recognized genera: the Lachnophorina, Eucaerina, and incertae sedis. Twenty-three new species of the genus Asklepia are described and four new combinations are presented. They are listed with their type localities as follows: (geminata species group) Asklepia geminata (Bates, 1871), comb. n, Santarém, Rio Tapajós, Brazil; (hilaris species group) Asklepia campbellorum Zamorano & Erwin, sp. n., 20 km SW Manaus, Brazil, Asklepia demiti Erwin & Zamorano, sp. n., circa Rio Demiti, Brazil, Asklepia duofos Zamorano & Erwin, sp. n., 20 km SW Manaus, Brazil, Asklepia hilaris (Bates, 1871), comb. n, São Paulo de Olivença, Brazil, Asklepia grammechrysea Zamorano & Erwin, sp. n., circa Pithecia, Cocha Shinguito, Perú, Asklepia lebioides (Bates, 1871), comb. n, Santarém, Rio Tapajós, Brazil, Asklepia laetitia Zamorano & Erwin, sp. n., Leticia, Colombia, Asklepia matomena Zamorano & Erwin, sp.n., 20 km SW Manaus, Brazil; (pulchripennis species group) Asklepia adisi Erwin & Zamorano, sp. n., Ilha de Marchantaria, Lago Camaleão, Brazil, Asklepia asuncionensis Erwin & Zamorano, sp. n., Asunción, Río Paraguay

A synopsis of the tribe Lachnophorini, with a new genus of Neotropical distribution and a revision of the Neotropical genus Asklepia Liebke, 1938 (Insecta, Coleoptera, Carabidae).

Science.gov (United States)

Erwin, Terry L; Zamorano, Laura S

2014-01-01

This synopsis provides an identification key to the genera of Tribe Lachnophorini of the Western and Eastern Hemispheres including five genera previously misplaced in carabid classifications. The genus Asklepia Liebke, 1938 is revised with 23 new species added and four species reassigned from Eucaerus LeConte, 1853 to Asklepia Liebke, 1938. In addition, a new genus is added herein to the Tribe: Peruphorticus gen. n. with its type species P. gulliveri sp. n. from Perú. Five taxa previously assigned to other tribes have adult attributes that make them candidates for classification in the Lachnophorini: Homethes Newman, Aeolodermus Andrewes, Stenocheila Laporte de Castelnau, Diplacanthogaster Liebke, and Selina Motschulsky are now considered to belong to the Lachnophorini as genera incertae sedis. Three higher level groups are proposed to contain the 18 recognized genera: the Lachnophorina, Eucaerina, and incertae sedis. Twenty-three new species of the genus Asklepia are described and four new combinations are presented. They are listed with their type localities as follows: ( geminata species group) Asklepia geminata (Bates, 1871), comb. n, Santarém, Rio Tapajós, Brazil; ( hilaris species group) Asklepia campbellorum Zamorano & Erwin, sp. n., 20 km SW Manaus, Brazil, Asklepia demiti Erwin & Zamorano, sp. n., circa Rio Demiti, Brazil, Asklepia duofos Zamorano & Erwin, sp. n., 20 km SW Manaus, Brazil, Asklepia hilaris (Bates, 1871), comb. n, São Paulo de Olivença, Brazil, Asklepia grammechrysea Zamorano & Erwin, sp. n., circa Pithecia, Cocha Shinguito, Perú, Asklepia lebioides (Bates, 1871), comb. n, Santarém, Rio Tapajós, Brazil, Asklepia laetitia Zamorano & Erwin, sp. n., Leticia, Colombia, Asklepia matomena Zamorano & Erwin, sp.n., 20 km SW Manaus, Brazil; ( pulchripennis species group) Asklepia adisi Erwin & Zamorano, sp. n., Ilha de Marchantaria, Lago Camaleão, Brazil, Asklepia asuncionensis Erwin & Zamorano, sp. n., Asunción, Río Paraguay, Paraguay

NOTE TASSONOMICHE E NOMENCLATORIALI SU ALCUNE SPECIE PALEARTICHE DI SIBINIA E TYCHIUS (COLEOPTERA, CURCULIONIDAE

Directory of Open Access Journals (Sweden)

Roberto Caldara

2009-10-01

attalica Gyllenhal var. unicolor Desbrochers, 1895: 102 (non Fåhraeus, 1843; Sibinia attalica subsp. tibiella var. desbordesi Hoffmann, 1954; Tychius pusillus var. inermis Hoffmann, 1954. Sibinia suturella Motschulsky, 1858 (non Fårhaeus, 1843 viene trasferita al genere Smicronyx.

Catalogue of Tenebrionidae (Coleoptera of North America

Directory of Open Access Journals (Sweden)

Yves Bousquet

2018-01-01

Full Text Available This catalogue includes all valid family-group (8 subfamilies, 52 tribes, 14 subtribes, genus-group (349 genera, 86 subgenera, and species-group names (2825 species, 215 subspecies of darkling beetles (Coleoptera: Tenebrionidae known to occur in North America1 and their available synonyms. Data on extant, subfossil and fossil taxa are given. For each name the author and year and page number of the description are provided, with additional information (e.g., type species for genus-group names, author of synonymies for invalid taxa depending on the taxon rank. Several new nomenclatural acts are included. One new genus, Lepidocnemeplatia Bousquet and Bouchard, is described. Spelaebiosis Bousquet and Bouchard [for Ardoinia Özdikmen, 2004], Blapstinus marcuzzii Aalbu [for Blapstinus kulzeri Marcuzzi, 1977], and Hymenorus campbelli Bouchard [for Hymenorus oculatus Doyen and Poinar, 1994] are proposed as new replacement names. Supporting evidence is provided for the conservation of usage of Tarpela micans (Fabricius, 1798 nomen protectum over Tarpela vittata (Olivier, 1793 nomen oblitum. The generic names Psilomera Motschulsky, 1870 [= Stenomorpha Solier, 1836], Steneleodes Blaisdell, 1909 [= Xysta Eschscholtz, 1829], Ooconibius Casey, 1895 and Euconibius Casey, 1895 [= Conibius LeConte, 1851] are new synonyms (valid names in square brackets. The following 127 new synonymies of species-group names, listed in their original combination, are proposed (valid names, in their current combination, placed in square brackets: Bothrasida mucorea Wilke, 1922 [= Pelecyphorus guanajuatensis (Champion, 1884]; Parasida zacualpanicola Wilke, 1922 [= Pelecyphorus asidoides Solier, 1836]; Stenosides kulzeri Pallister, 1954, Stenosides bisinuatus Pallister, 1954, and Parasida trisinuata Pallister, 1954 [= Pelecyphorus dispar (Champion, 1892]; Asida favosa Champion, 1884 and Asida similata Champion, 1884 [= Pelecyphorus fallax (Champion, 1884]; Ologlyptus bicarinatus