Evaluation of {sup 23}Na(n,2n){sup 22}Na reaction cross-sections
Energy Technology Data Exchange (ETDEWEB)
Manokhin, V N [Institute of Physics and Power Engineering, Obninsk (Russian Federation)
1997-06-01
Using available experimental data and (n,2n) excitation function systematics {sup 23}Na(n,2n){sup 22}Na reaction cross-sections were evaluated for energies ranging from the reaction threshold to 20 MeV. (author). 21 refs, 1 fig., 2 tabs.
Energy Technology Data Exchange (ETDEWEB)
E Rangarajan; K Ruane; A Proteau; J Schrag; R Valladares; C Gonzalez; M Gilbert; A Yakunin; M Cygler
2011-12-31
There is a high prevalence of sialic acid in a number of different organisms, resulting in there being a myriad of different enzymes that can exploit it as a fermentable carbon source. One such enzyme is NanS, a carbohydrate esterase that we show here deacetylates the 9 position of 9-O-sialic acid so that it can be readily transported into the cell for catabolism. Through structural studies, we show that NanS adopts a SGNH hydrolase fold. Although the backbone of the structure is similar to previously characterized family members, sequence comparisons indicate that this family can be further subdivided into two subfamilies with somewhat different fingerprints. NanS is the founding member of group II. Its catalytic center contains Ser19 and His301 but no Asp/Glu is present to form the classical catalytic triad. The contribution of Ser19 and His301 to catalysis was confirmed by mutagenesis. In addition to structural characterization, we have mapped the specificity of NanS using a battery of substrates.
Severe haze episodes and seriously polluted fog water in Ji'nan, China.
Wang, Xinfeng; Chen, Jianmin; Sun, Jianfeng; Li, Weijun; Yang, Lingxiao; Wen, Liang; Wang, Wenxing; Wang, Xinming; Collett, Jeffrey L; Shi, Yang; Zhang, Qingzhu; Hu, Jingtian; Yao, Lan; Zhu, Yanhong; Sui, Xiao; Sun, Xiaomin; Mellouki, Abdelwahid
2014-09-15
Haze episodes often hit urban cities in China recently. Here, we present several continuous haze episodes with extremely high PM2.5 levels that occurred over several weeks in early 2013 and extended across most parts of the northern and eastern China-far exceeding the Beijing-Tianjin-Hebei region. Particularly, the haze episode covered ~1 million km(2) on January 14, 2013 and the daily averaged PM2.5 concentration exceeded 360 μg m(-3) in Ji'nan. The observed maximum hourly PM2.5 concentration in urban Ji'nan reached 701 μg m(-3) at 7:00 am (local time) in January 30. During these haze episodes, several fog events happened and the concurrent fog water was found to be seriously polluted. For the fog water collected in Ji'nan from 10:00 pm in January 14 to 11:00 am in January 15, sulfate, nitrate, and ammonium were the major ions with concentrations of 1.54 × 10(6), 8.98 × 10(5), and 1.75 × 10(6) μeq L(-1), respectively, leading to a low in-situ pH of 3.30. The sulfate content in the fog sample was more than 544 times as high as those observed in other areas. With examination of the simultaneously observed data on PM2.5 and its chemical composition, the fog played a role in scavenging and removing fine particles from the atmosphere during haze episodes and thus was seriously contaminated. However, the effect was not sufficient to obviously cleanse air pollution and block haze episodes. Copyright © 2014 Elsevier B.V. All rights reserved.
Safety features of TR-2 reactor
International Nuclear Information System (INIS)
Tuerker, T.
2001-01-01
TR-2 is a swimming pool type research reactor with 5 MW thermal power and uses standard MTR plate type fuel elements. Each standard fuel element consist of 23 fuel plates with a meat + cladding thickness of 0.127 cm, coolant channel clearance is 0.21 cm. Originally TR-2 is designed for %93 enriched U-Al. Alloy fuel meat.This work is based on the preparation of the Final Safety Analyses Report (FSAR) of the TR-2 reactor. The main aspect is to investigate the behaviour of TR-2 reactor under the accident and abnormal operating conditions, which cowers the accident spectrum unique for the TR-2 reactor. This presentation covers some selected transient analyses which are important for the safety aspects of the TR-2 reactor like reactivity induced startup accidents, pump coast down (Loss of Flow Accident, LOFA) and other accidents which are charecteristic to the TR-2
Johnson, Robert W.
1992-01-01
Presents information on the Capac Nan, the highway system of the Incas. Describes its use by the Spanish conquistadors in the destruction of the Incan empire. Includes suggested classroom uses for the article, a homework assignment, and discussion topics. (DK)
International Nuclear Information System (INIS)
Tapia, M.; Roth, M.; Ruiz, M.T.
1988-01-01
Near-infrared JHKL photometry of more than 200 stars, members of the open clusters Tr14, Tr15, Tr16, Cr228 and Cr232 in the Carina Nebula are presented. From comparing these results with the available visual photometry and spectroscopy, it is found that, except in Tr15, the intracluster reddening is characterized by a 'normal' extinction law at λ > 0.5μm but is highly anomalous and variable in the U- and B-bands. This behaviour may be explained by the presence of intracluster interstellar grains 'processed' by shock waves presumably associated with the explosive history of η Carinae. All clusters are found to be at the same distance from the Sun at d = 2.4 ± 0.2 kpc or Vsub(o) - Msub(v) 11.9 ± 0.2. The total amount of reddening, though, differs significantly from cluster to cluster. (author)
Current temporal asymmetry and the role of tides: Nan-Wan Bay vs. the Gulf of Elat
Ashkenazy, Yosef; Fredj, Erick; Gildor, Hezi; Gong, Gwo-Ching; Lee, Hung-Jen
2016-05-01
Nan-Wan Bay in Taiwan and the Gulf of Elat in Israel are two different coastal environments, and as such, their currents are expected to have different statistical properties. While Nan-Wan Bay is shallow, has three open boundaries, and is directly connected to the open ocean, the Gulf of Elat is deep, semi-enclosed, and connected to the Red Sea via the Straits of Tiran. Surface currents have been continuously measured with fine temporal (less than or equal to 1 h) and spatial resolution (less than or equal to 1 km) for more than a year in both environments using coastal radars (CODARs) that cover a domain of roughly 10 × 10 km. These measurements show that the currents in Nan-Wan Bay are much stronger than those in the Gulf of Elat and that the mean current field in Nan-Wan Bay exhibits cyclonic circulation, which is stronger in the summer; in the Gulf of Elat, the mean current field is directed southward and is also stronger during the summer. We have compared the statistical properties of the current speeds in both environments and found that both exhibit large spatial and seasonal variations in the shape parameter of the Weibull distribution. However, we have found fundamental and significant differences when comparing the temporal asymmetry of the current speed (i.e., the ratio between the time during which the current speed increases and the total time). While the Nan-Wan Bay currents are significantly asymmetric, those of the Gulf of Elat are not. We then extracted the tidal component of the Nan-Wan Bay currents and found that it is strongly asymmetric, while the asymmetry of tidally filtered currents is much weaker. We thus conclude that the temporal asymmetry of the Nan-Wan Bay currents reported here is due to the strong tides in the region. We show that the asymmetry ratio in Nan-Wan Bay varies spatially and seasonally: (i) the currents increase rapidly and decay slowly in the northern part of the domain and vice versa in the southern part, and (ii) the
Recent results from CODALEMA and the Nançay radio facilities related to cosmic-ray measurements
Directory of Open Access Journals (Sweden)
Dallier Richard
2017-01-01
Full Text Available Since 2003, the NanÇay Radio Observatory hosts the CODALEMA experiment, dedicated to radio detection of cosmic ray induced extensive air showers. CODALEMA also features the R&D EXTASIS project, aiming at detecting the lowfrequency signal ([2-6] MHz produced at the sudden disappearance of the air shower particles hitting the ground. The 3 current antenna arrays present different antenna density and extent, and can be operated in a joint mode to record simultaneously the radio signal coming from air showers. Therefore, the NanÇay facilities may offer a complete description of the air shower induced electric field at small, medium and large scale, and over an unique and very wide frequency band (from ~ 2 to 200 MHz.
Soporte de QoS con 802.11e para tráfico heterogéneo en ambientes MANET
Murazzo, María Antonia; Rodríguez, Nelson R.; Guevara, Miguel José; Scheffer, María
2014-01-01
Hoy en día existe una gran necesidad de mejorar la calidad de servicio (QoS) ofrecida en redes móviles Ad Hoc (Mobile Ad-Hoc Networks -MANET-) que actualmente sólo ofrecen servicio best effort. Esto posee gran impacto en las aplicaciones que se corren, las cuales generan tráficos con diferentes requerimientos de recursos de la red. El presente trabajo tiene como objetivo fundamental analizar el comportamiento de la implementación de QoS en la sub capa MAC mediante 802.11e en ambientes con trá...
International Nuclear Information System (INIS)
Yamada, Kazumasa; Ono, Tetsuyoshi; Nishioka, Hajime
1996-01-01
Escherichia coli mutants which lack defence systems against such active oxygen forms as OxyR (ΔoxyR), superoxide dismutase (SOD) (sodA and sodB) and catalase (katE and katG) are sensitive to UV-A lethality under aerobic conditions, whereas OxyR- and SOD-mutants have resistance under anaerobic conditions and in the presence of sodium azide (NaN 3 ) during irradiation. UV-A induces lipid peroxidation in the ΔoxyR mutant, which is suppressed by NaN 3 . These results suggest that UV-A generates 1 O 2 or the hydroxyl radical to produce lipid peroxides intracellularly in the ΔoxyR mutant and that O 2 - stress may be generated in the sodAB mutant after 8 hr of exposure to UV-A. The sensitivities of such DNA repair-deficient mutants as recA ind- and uvrA to UV-A also were examined and compared. These mutants are sensitive to UV-A lethality under aerobic conditions but show only slight resistance under anaerobic conditions or in the presence of NaN 3 during irradiation. We conclude that NaN 3 protects these mutant cells from oxygen-dependent UV-A lethality. (author)
Saile, Nadja; Schwarz, Lisa; Eißenberger, Kristina; Klumpp, Jochen; Fricke, Florian W; Schmidt, Herbert
2018-06-01
Enterohemorrhagic E. coli (EHEC) are serious bacterial pathogens which are able to cause a hemorrhagic colitis or the life-threatening hemolytic-uremic syndrome (HUS) in humans. EHEC strains can carry different numbers of phage-borne nanS-p alleles that are responsible for acetic acid release from mucin from bovine submaxillary gland and 5-N-acetyl-9-O-acetyl neuraminic acid (Neu5,9Ac 2 ), a carbohydrate present in mucin. Thus, Neu5,9Ac 2 can be transformed to 5-N-acetyl neuraminic acid, an energy source used by E. coli strains. We hypothesize that these NanS-p proteins are involved in competitive growth of EHEC in the gastrointestinal tract of humans and animals. The aim of the current study was to demonstrate and characterize the nanS-p alleles of the 2011 E. coli O104:H4 outbreak strain LB226692 and analyze whether the presence of multiple nanS-p alleles in the LB226692 genome causes a competitive growth advantage over a commensal E. coli strain. We detected and characterized five heterogeneous phage-borne nanS-p alleles in the genome of E. coli O104:H4 outbreak strain LB226692 by in silico analysis of its genome. Furthermore, successive deletion of all nanS-p alleles, subsequent complementation with recombinant NanS-p13-His, and in vitro co-culturing experiments with the commensal E. coli strain AMC 198 were conducted. We could show that nanS-p genes of E. coli O104:H4 are responsible for growth inhibition of strain AMC 198, when Neu5,9Ac 2 was used as sole carbon source in co-culture. The results of this study let us suggest that multiple nanS-p alleles may confer a growth advantage by outcompeting other E. coli strains in Neu5,9Ac 2 rich environments, such as mucus in animal and human gut. Copyright © 2018 Elsevier GmbH. All rights reserved.
[Roadside observation on the use of safety belt in Guangzhou and Nanning cites of China].
Li, Li-ping; Stevenson, Mark; Ivers, Rebecca; Zhou, Ying
2006-08-01
To determine the rates of correct use of safety belt (CUSB) among drivers and front seat passengers in Guangzhou and Nanning through roadside observation and to provide scientific evidence for the development of intervention plan and to strengthen road safety law enforcement. Observational sites were randomly selected from three road types (Highway, Main Street and Subordinate Street). Targeted automobiles were observed at each site at four different times and uniformed checklists were used to record safety belt use during observations. Within each vehicle, belt use by drivers of different sex, road type, workday/weekend, day/night and seating position were calculated. Data was analyzed, using Chi-square tests to compare the statistic significance. (1)The rate of CUSB and non-use rate among drivers were higher in Nanning than in Guangzhou (P= 0.00) but the rate of incorrect use was on the contrarary. (2) The rate of CUSB by front seat passengers in Guangzhou was higher than that in Nanning (P = 0.04); as well as the rate of (P = 0.00) incorrect use while the non-use rate was on the contrarary. (3)In general, the rate of CUSB was higher on highways than on local streets (P = 0.00). (4) The CUSB rate of drivers and front seat passengers was higher at daytime than at night (P = 0.00), and the rate of incorrect use was higher at working days than weekends (P = 0.00). (5) The CUSB rate was higher for female drivers than for males in Guangzhou (P = 0.00), but there no statistical significance was found in Nanning (P = 0.21). Results suggested that intervention actions should be undertaken to raise the awareness of the importance of safety belt use. Effective public information and education programs, law enforcement and mandatory safety belt use, prioritizing programs on people neglegent to the importance are necessary to increase the safety belt use and to decrease the mortality and injuries caused by traffic accidents.
Directory of Open Access Journals (Sweden)
Pamela eDi Pasquale
2016-02-01
Full Text Available DNA methylation damage can be induced by endogenous and exogenous chemical agents, which has led every living organism to develop suitable response strategies. We investigated protein expression profiles of Escherichia coli upon exposure to the alkylating agent methyl-methane sulfonate (MMS by differential proteomics. Quantitative proteomic data showed a massive downregulation of enzymes belonging to the glycolytic pathway and fatty acids degradation, strongly suggesting a decrease of energy production. A strong reduction in the expression of the N-acetylneuraminate lyases (NanA involved in the sialic acid metabolism was also observed. Using a null NanA mutant and DANA, a substrate analogue acting as competitive inhibitor, we demonstrated that down regulation of NanA affects biofilm formation and adhesion properties of E. coli MV1161. Exposure to alkylating agents also decreased biofilm formation and bacterial adhesion to Caco-2 eukaryotic cell line by the adherent invasive E. coli (AIEC strain LF82. Our data showed that methylation stress impairs E. coli adhesion properties and suggest a possible role of NanA in biofilm formation and bacteria host interactions.
NanTroSEIZE: The IODP Nankai Trough Seismogenic Zone Experiment
Directory of Open Access Journals (Sweden)
Harold J. Tobin
2006-03-01
Full Text Available The IODP Nankai Trough Seismogenic Zone Experiment (NanTroSEIZE will, for the fi rst time ever, attempt to drill into, sample, and instrument the seismogenic portion of a plate-boundary fault or megathrust within a subduction zone. Access to the interior of active faults where in situ processes can be monitored and fresh fault zone materials can be sampled is of fundamental importance to the understanding of earthquake mechanics. As the December 2004 Sumatraearthquake and Indian Ocean tsunami so tragically demonstrated,large subduction earthquakes represent one of the greatest natural hazards on the planet. Accordingly, drilling into and instrumenting an active interplate seismogenic zone is a very high priority in the IODP Initial Science Plan (2001. Through a decade-long series of national and international workshops, a consensus emerged that the Nankai Trough is an ideal place to attempt drilling and monitoring of the seismogenic plate interface. The fi rst phase of NanTroSEIZE drilling operations has now been scheduled for the late summer of 2007. It involves parallel deployment of both the new U.S. Scientifi c Ocean Drilling Vessel (SODV, this volume and the riser drilling vessel Chikyu.
Czech Academy of Sciences Publication Activity Database
Dos Santos, S.; Vejvodová, Šárka; Převorovský, Zdeněk
2009-01-01
Roč. 19, č. 2 (2009), s. 14-14 ISSN 1213-3825. [NDT in PROGRESS. 12.11.2009-14.11.2009, Praha] R&D Projects: GA ČR GA106/07/1393; GA MPO(CZ) FR-TI1/274 Institutional research plan: CEZ:AV0Z20760514 Keywords : nonlinear elastic wave spectroscopy (NEWS) * ESAM * time reversal (TR) * TR-NEWS imaging * tomography * DORT Subject RIV: BI - Acoustics
Elton-Marshall, Tara; Leatherdale, Scott T; Turner, Nigel E
2016-03-18
With the rapid proliferation of new gambling technology and online gambling opportunities, there is a concern that online gambling could have a significant impact on public health, particularly for adolescents. The aim of this study is to examine online and land-based gambling behaviour among adolescents in 3 Canadian provinces (Ontario, Newfoundland and Labrador, Saskatchewan) prior to the implementation of legalized online gambling. Data are from 10,035 students in grades 9 to 12 who responded to the 2012-2013 Youth Gambling Survey (YGS) supplement, a questionnaire administered as part of the Canadian Youth Smoking Survey (YSS, 2012) in 3 provinces: Newfoundland and Labrador (n = 2,588), Ontario (n = 3,892), and Saskatchewan (n = 3,555). Overall, 41.6% of adolescents (35.9% of females and 47.4% of males) had gambled in the past 3 months. 9.4% of adolescents had gambled online in the past 3 months alone (3.7% of females and 15.3% of males). The most popular form of online gambling was online sports betting. Adolescents also engaged in online simulated gambling including internet poker (9.1%) and simulated gambling on Facebook (9.0%). Few adolescents participated in online gambling exclusively and online gamblers were more likely than land-based gamblers to engage in multiple forms of gambling. A higher proportion of adolescent online gamblers scored "high" or "low to moderate" in problem gambling severity compared to land-based only gamblers. Despite restrictions on online gambling at the time of the study, adolescents were engaging in online gambling at a significantly higher rate than has been previously found. Adolescents were also using technology such as video games to gamble and free online gambling simulations.
Directory of Open Access Journals (Sweden)
Amalia Rossi
2012-01-01
Full Text Available This paper discusses the efforts of the royal family to moralise the environmental behaviour of their subjects in the name of the Sufficiency Economy philosophy solicited by King Bhumibol since the 1990s in Thailand. Drawing on ethnographic fieldwork conducted in Nan province, Northern Thailand, in 2008 and 2009, I focus particularly on Royal Projects recently promoted to correct the rural practices of the ethnic minority groups living in the hills of Nan. In the past, many of these ethnic groups took part in the Maoist insurgency while at present, they represent a key basin of support- ers for the reformist Red Shirts movement which is currently threatening the role of the monarchy in Thai politics. The research suggests that the recently increased trend of staging new projects for sustainable agro-forestry management in a ‘red’ area as Nan does not only aim at improving the conditions of mountain peoples and of the environment, but simultaneously increases the political influence of the conservative forces over this ‘ungovernable’ territory in times of political crisis. ----- Dieser Artikel diskutiert die Bemühungen der königlichen Familie in Thailand seit den 1990-er Jahren, das Umweltverhalten ihrer Subjekte im Namen der Sufficiency Economy Philosophie von König Bhumibol zu moralisieren. Mit Bezug auf ethnografische Forschung in der Provinz Nan in Nordthailand in den Jahren 2008 und 2009 fokussiere ich insbesondere auf Royal Projects, die in letzter Zeit gefördert werden, um ländliche Praktiken ethnischer Minderheiten in den Bergen von Nan zu korrigieren. In der Vergangenheit waren viele dieser ethnischen Gruppen am maoistischen Aufstand beteiligt, während sie heute ein zentrales Auffangbecken für UnterstützerInnen der reformistischen Rothemden, die derzeit die Rolle der Monarchie in der thailändischen Politik in Frage stellen, darstellen. Die Forschung deutet an, dass der Trend zur Einführung von neuen Projekten f
Maximum credible accident analysis for TR-2 reactor conceptual design
International Nuclear Information System (INIS)
Manopulo, E.
1981-01-01
A new reactor, TR-2, of 5 MW, designed in cooperation with CEN/GRENOBLE is under construction in the open pool of TR-1 reactor of 1 MW set up by AMF atomics at the Cekmece Nuclear Research and Training Center. In this report the fission product inventory and doses released after the maximum credible accident have been studied. The diffusion of the gaseous fission products to the environment and the potential radiation risks to the population have been evaluated
Directory of Open Access Journals (Sweden)
Tara Elton-Marshall
2016-03-01
Full Text Available Abstract Background With the rapid proliferation of new gambling technology and online gambling opportunities, there is a concern that online gambling could have a significant impact on public health, particularly for adolescents. The aim of this study is to examine online and land-based gambling behaviour among adolescents in 3 Canadian provinces (Ontario, Newfoundland and Labrador, Saskatchewan prior to the implementation of legalized online gambling. Methods Data are from 10,035 students in grades 9 to 12 who responded to the 2012–2013 Youth Gambling Survey (YGS supplement, a questionnaire administered as part of the Canadian Youth Smoking Survey (YSS, 2012 in 3 provinces: Newfoundland and Labrador (n = 2,588, Ontario (n = 3,892, and Saskatchewan (n = 3,555. Results Overall, 41.6 % of adolescents (35.9 % of females and 47.4 % of males had gambled in the past 3 months. 9.4 % of adolescents had gambled online in the past 3 months alone (3.7 % of females and 15.3 % of males. The most popular form of online gambling was online sports betting. Adolescents also engaged in online simulated gambling including internet poker (9.1 % and simulated gambling on Facebook (9.0 %. Few adolescents participated in online gambling exclusively and online gamblers were more likely than land-based gamblers to engage in multiple forms of gambling. A higher proportion of adolescent online gamblers scored “high” or “low to moderate” in problem gambling severity compared to land-based only gamblers. Conclusions Despite restrictions on online gambling at the time of the study, adolescents were engaging in online gambling at a significantly higher rate than has been previously found. Adolescents were also using technology such as video games to gamble and free online gambling simulations.
Tudge, J.; Webb, S. I.; Tobin, H. J.
2013-12-01
Since 2007 the Nankai Trough Seismogenic Zone Experiment (NanTroSEIZE) has drilled a total of 15 sites across the Nankai Trough subduction zone, including two sites on the incoming sediments of the Philippine Sea plate (PSP). Logging-while-drilling (LWD) data was acquired at 11 of these sites encompassing the forearc Kumano Basin, upper accretionary prism, toe region and input sites. Each of these tectonic domains is investigated for changes in physical properties and LWD characteristics, and this work fully integrates a large data set acquired over multiple years and IODP expeditions, most recently Expedition 338. Using the available logging-while-drilling data, primarily consisting of gamma ray, resistivity and sonic velocity, a log-based lithostratigraphy is developed at each site and integrated with the core, across the entire NanTroSEIZE transect. In addition to simple LWD characterization, the use of Iterative Non-hierarchical Cluster Analysis (INCA) on the sites with the full suite of LWD data clearly differentiates the unaltered forearc and slope basin sediments from the deformed sediments of the accretionary prism, suggesting the LWD is susceptible to the subtle changes in the physical properties between the tectonic domains. This differentiation is used to guide the development of tectonic-domain specific physical properties relationships. One of the most important physical property relationships between is the p-wave velocity and porosity. To fully characterize the character and properties of each tectonic domain we develop new velocity-porosity relationships for each domain found across the NanTroSEIZE transect. This allows the porosity of each domain to be characterized on the seismic scale and the resulting implications for porosity and pore pressure estimates across the plate interface fault zone.
NanOx, a new model to predict cell survival in the context of particle therapy
Cunha, M.; Monini, C.; Testa, E.; Beuve, M.
2017-02-01
Particle therapy is increasingly attractive for the treatment of tumors and the number of facilities offering it is rising worldwide. Due to the well-known enhanced effectiveness of ions, it is of utmost importance to plan treatments with great care to ensure tumor killing and healthy tissues sparing. Hence, the accurate quantification of the relative biological effectiveness (RBE) of ions, used in the calculation of the biological dose, is critical. Nevertheless, the RBE is a complex function of many parameters and its determination requires modeling. The approaches currently used have allowed particle therapy to thrive, but still show some shortcomings. We present herein a short description of a new theoretical framework, NanOx, to calculate cell survival in the context of particle therapy. It gathers principles from existing approaches, while addressing some of their weaknesses. NanOx is a multiscale model that takes the stochastic nature of radiation at nanometric and micrometric scales fully into account, integrating also the chemical aspects of radiation-matter interaction. The latter are included in the model by means of a chemical specific energy, determined from the production of reactive chemical species induced by irradiation. Such a production represents the accumulation of oxidative stress and sublethal damage in the cell, potentially generating non-local lethal events in NanOx. The complementary local lethal events occur in a very localized region and can, alone, lead to cell death. Both these classes of events contribute to cell death. The comparison between experimental data and model predictions for the V79 cell line show a good agreement. In particular, the dependence of the typical shoulders of cell survival curves on linear energy transfer are well described, but also the effectiveness of different ions, including the overkill effect. These results required the adjustment of a number of parameters compatible with the application of the model in
Mingoia, Marina; Morici, Eleonora; Marini, Emanuela; Brenciani, Andrea; Giovanetti, Eleonora; Varaldo, Pietro E
2016-03-01
The objective of this study was to investigate macrolide-resistant Streptococcus agalactiae isolates harbouring erm(TR), an erm(A) gene subclass, with emphasis on their erm(TR)-carrying genetic elements. Four erm(TR)-carrying elements have been described to date: three closely related (ICE10750-RD.2, Tn1806 and ICESp1108) in Streptococcus pyogenes, Streptococcus pneumoniae and S. pyogenes, respectively; and one completely different (IMESp2907, embedded in ICESp2906 to form ICESp2905) in S. pyogenes. Seventeen macrolide-resistant erm(TR)-positive S. agalactiae isolates were phenotypically and genotypically characterized. Their erm(TR)-carrying elements were explored by analysing the distinctive recombination genes of known erm(TR)-carrying integrative and conjugative elements (ICEs) and by PCR mapping. The new genetic context and organization of IMESp2907 in S. agalactiae were explored using several experimental procedures and in silico analyses. Five isolates harboured ICE10750-RD.2/Tn1806, five isolates harboured ICESp1108 and five isolates bore unknown erm(TR)-carrying elements. The remaining two isolates, exhibiting identical serotypes and pulsotypes, harboured IMESp2907 in a new genetic environment, which was further investigated in one of the two isolates, SagTR7. IMESp2907 was circularizable in S. agalactiae, as described in S. pyogenes. The new IMESp2907 junctions were identified based on its site-specific integration; the att sites were almost identical to those in S. pyogenes. In strain SagTR7, erm(TR)-carrying IMESp2907 was embedded in an erm(TR)-less internal element related to ICE10750-RD.2/Tn1806, which, in turn, was embedded in an ICESde3396-like element. The resulting whole ICE, ICESagTR7 (∼129 kb), was integrated into the chromosome downstream of the rplL gene, and was excisable in circular form and transferable by conjugation. This is the first study exploring erm(TR)-carrying genetic elements in S. agalactiae. © The Author 2015. Published by
Directory of Open Access Journals (Sweden)
Chaowalee Jaisuk
2018-03-01
Full Text Available Spatial genetic variation of river-dwelling freshwater fishes is typically affected by the historical and contemporary river landscape as well as life-history traits. Tropical river and stream landscapes have endured extended geological change, shaping the existing pattern of genetic diversity, but were not directly affected by glaciation. Thus, spatial genetic variation of tropical fish populations should look very different from the pattern observed in temperate fish populations. These data are becoming important for designing appropriate management and conservation plans, as these aquatic systems are undergoing intense development and exploitation. This study evaluated the effects of landscape features on population genetic diversity of Garra cambodgiensis, a stream cyprinid, in eight tributary streams in the upper Nan River drainage basin (n = 30–100 individuals/location, Nan Province, Thailand. These populations are under intense fishing pressure from local communities. Based on 11 microsatellite loci, we detected moderate genetic diversity within eight population samples (average number of alleles per locus = 10.99 ± 3.00; allelic richness = 10.12 ± 2.44. Allelic richness within samples and stream order of the sampling location were negatively correlated (P < 0.05. We did not detect recent bottleneck events in these populations, but we did detect genetic divergence among populations (Global FST = 0.022, P < 0.01. The Bayesian clustering algorithms (TESS and STRUCTURE suggested that four to five genetic clusters roughly coincide with sub-basins: (1 headwater streams/main stem of the Nan River, (2 a middle tributary, (3 a southeastern tributary and (4 a southwestern tributary. We observed positive correlation between geographic distance and linearized FST (P < 0.05, and the genetic differentiation pattern can be moderately explained by the contemporary stream network (STREAMTREE analysis, R2 = 0.75. The MEMGENE analysis
Characteristics of a pressure sensitive touch sensor using a piezoelectric PVDF-TrFE/MoS2 stack
International Nuclear Information System (INIS)
Park, Woojin; Yang, Jin Ho; Kang, Chang Goo; Lee, Young Gon; Hwang, Hyeon Jun; Kang, Soo Cheol; Lee, Sang Kyung; Lee, Byoung Hun; Cho, Chunhum; Lim, Sung Kwan; Lee, Sangchul; Hong, Woong-Ki
2013-01-01
A new touch sensor device has been demonstrated with molybdenum disulfide (MoS 2 ) field effect transistors stacked with a piezoelectric polymer, polyvinylidene fluoride–trifluoroethylene (PVDF–TrFE). The performance of two device stack structures, metal/PVDF–TrFE/MoS 2 (MPM) and metal/PVDF–TrFE/Al 2 O 3 /MoS 2 (MPAM), were compared as a function of the thickness of PVDF–TrFE and Al 2 O 3 . The sensitivity of the touch sensor has been improved by two orders of magnitude by reducing the charge scattering and enhancing the passivation effects using a thin Al 2 O 3 interfacial layer. Reliable switching behavior has been demonstrated up to 120 touch press cycles. (paper)
He, Y.; He, Y.
2018-04-01
Urban shanty towns are communities that has contiguous old and dilapidated houses with more than 2000 square meters built-up area or more than 50 households. This study makes attempts to extract shanty towns in Nanning City using the product of Census and TripleSat satellite images. With 0.8-meter high-resolution remote sensing images, five texture characteristics (energy, contrast, maximum probability, and inverse difference moment) of shanty towns are trained and analyzed through GLCM. In this study, samples of shanty town are well classified with 98.2 % producer accuracy of unsupervised classification and 73.2 % supervised classification correctness. Low-rise and mid-rise residential blocks in Nanning City are classified into 4 different types by using k-means clustering and nearest neighbour classification respectively. This study initially establish texture feature descriptions of different types of residential areas, especially low-rise and mid-rise buildings, which would help city administrator evaluate residential blocks and reconstruction shanty towns.
Experience of Sponge City Master Plan: A Case Study of Nanning City
Institute of Scientific and Technical Information of China (English)
Zhang Wei; Wang Jiazhuo; Che Han; Wang Chen; Zhang Chunyang; Shi Lian; Fan Jin; Li Caige
2017-01-01
As a new urban development pattern, the construction of sponge cities has been deeply integrated into the new urbanization and water safety strategy. Nanning City, as one of the first batch of experimental sponge cities in China, has undertaken exploration and practice on sponge city planning, construction, and management. The sponge city master plan of Nanning City establishes an urban ecological spatial pattern in order to protect the security of the sponge base. The sponge city construction strategy has also proposed an overall construction strategy of a sponge city in line with urban development features. Through the systematic analysis and planning, a “23+10+202” pattern of sponge city construction has been formed. “23” represents 23 drainage basins, in which major sponge facilities such as storage facilities, waterfront buffer zones, wetland parks, ecological rainwater corridor and sponge parks are allocated. “10” represents 10 sponge functional zones, which provide important reference for the establishment of sponge city construction index system. “202” represents 202 management units, which decomposes the general objective and provides technical support not only for sponge city construction and management, but also for the implementation of general objectives in the regulatory plan as well.
Turkey's regulatory plans for high enriched to low enriched conversion of TR-2 reactor core
International Nuclear Information System (INIS)
Guelol Oezdere, Oya
2003-01-01
Turkey is a developing country and has three nuclear facilities two of which are research reactors and one pilot fuel production plant. One of the two research reactors is TR-2 which is located in Cekmece site in Istanbul. TR-2 Reactor's core is composed of both high enriched and low enriched fuel and from high enriched to low enriched core conversion project will take place in year 2005. This paper presents the plans for drafting regulations on the safety analysis report updates for high enriched to low enriched core conversion of TR-2 reactor, the present regulatory structure of Turkey and licensing activities of nuclear facilities. (author)
MPID-T2: a database for sequence-structure-function analyses of pMHC and TR/pMHC structures.
Khan, Javed Mohammed; Cheruku, Harish Reddy; Tong, Joo Chuan; Ranganathan, Shoba
2011-04-15
Sequence-structure-function information is critical in understanding the mechanism of pMHC and TR/pMHC binding and recognition. A database for sequence-structure-function information on pMHC and TR/pMHC interactions, MHC-Peptide Interaction Database-TR version 2 (MPID-T2), is now available augmented with the latest PDB and IMGT/3Dstructure-DB data, advanced features and new parameters for the analysis of pMHC and TR/pMHC structures. http://biolinfo.org/mpid-t2. shoba.ranganathan@mq.edu.au Supplementary data are available at Bioinformatics online.
Psychopathology and cognition in children with 22q11.2 deletion syndrome
Niarchou, Maria; Zammit, Stanley; van Goozen, Stephanie H. M.; Thapar, Anita; Tierling, Hayley M.; Owen, Michael J.; van den Bree, Marianne B. M.
2014-01-01
Background Children with 22q11.2 deletion syndrome (22q11.2DS) have been reported to have high rates of cognitive and psychiatric problems. Aims To establish the nature and prevalence of psychiatric disorder and neurocognitive impairment in children with 22q11.2DS and test whether risk of psychopathology is mediated by the children’s intellectual impairment. Method Neurocognition and psychopathology were assessed in 80 children with 22q11.2DS (mean age 10.2 years, s.d. = 2.1) and 39 sibling controls (mean age 10.9 years, s.d. = 2.0). Results More than half (54%) of children with 22q11.2DS met diagnostic criteria for one or more DSM-IV-TR psychiatric disorder. These children had lower IQ (mean 76.8, s.d. = 13.0) than controls (mean 108.6, s.d. = 15.2) (Ppsychopathology was not mediated by intellectual impairment. Conclusions 22q11.2DS is not related to a specific psychiatric phenotype in children. Moreover, the deletion has largely independent effects on IQ and risk of psychopathology, indicating that psychopathology in 22q11.2DS is not a non-specific consequence of generalised cognitive impairment. PMID:24115343
Chu, Ping-Yi.
Taking four Wan-nan Confucian scholars--Yang Kuang -hsien, Mei Wen-ting, Chiang Yung and Tai Chen--as examples, this dissertation studies how an immigrant Jesuit scientific community built and defended itself in a specialized institutional niche located at the Ch'ing court and how a defeated Chinese scientific tradition successfully survived by occupying a broader cultural space, with the Manchu emperor in between. Special attention is paid to how these four Confucian scholars constructed social boundaries between the Chinese and the Westerners in their astronomical discourses and how they domesticated Western astronomy in order to fit the Chinese cultural conditions situated in the power structure built by the Manchus. This inquiry begins with a brief introduction of Wan-nan and the Wan-nan school. I then discuss how the Jesuits legitimated their knowledge during the Ming -Ch'ing transition, and how Jesuit astronomy was situated within the power nexus between the Confucian literati and the emperors. The next chapter focuses on Yang Kuang-hsien and his challenges to the Jesuits. I examine his strategies and the power structure in which Yang carried out his challenge to the Jesuits. The fourth and fifth chapters investigate how Mei Wen-ting restructured the relationship between Confucianism and astronomy. The former chapter focuses on Mei's social networking and his ambivalence towards the Ming and Ch'ing dynasties, on the one hand, and towards Chinese and Western learning on the other. The latter chapter deals with how Mei Wen-ting recast Chinese astronomical tradition and Confucianism. In the sixth chapter, I will compare the fame of Chiang Yung and Tai Chen in order to demonstrate how astronomy was practiced in evidential studies after Mei Wen-ting, and how evidential studies itself conveyed an ideological construction of the other. Through integrating Western astronomy with indigenous tradition while exorcising the otherness contained within the cultural package
Hanif, Ahmad; Edin, Matthew L.; Zeldin, Darryl C.; Morisseau, Christophe; Falck, John R.
2017-01-01
Arachidonic acid is metabolized to epoxyeicosatrienoic acids (EETs) by cytochrome (CYP) P450 epoxygenases, and to ω-terminal hydroxyeicosatetraenoic acids (HETEs) by ω-hydroxylases. EETs and HETEs often have opposite biologic effects; EETs are vasodilatory and protect against ischemia/reperfusion injury, while ω-terminal HETEs are vasoconstrictive and cause vascular dysfunction. Other oxylipins, such as epoxyoctadecaenoic acids (EpOMEs), hydroxyoctadecadienoic acids (HODEs), and prostanoids also have varied vascular effects. Post-ischemic vasodilation in the heart, known as coronary reactive hyperemia (CRH), protects against potential damage to the heart muscle caused by ischemia. The relationship among CRH response to ischemia, in mice with altered levels of CYP2J epoxygenases has not yet been investigated. Therefore, we evaluated the effect of endothelial overexpression of the human cytochrome P450 epoxygenase CYP2J2 in mice (Tie2-CYP2J2 Tr) on oxylipin profiles and CRH. Additionally, we evaluated the effect of pharmacologic inhibition of CYP-epoxygenases and inhibition of ω-hydroxylases on CRH. We hypothesized that CRH would be enhanced in isolated mouse hearts with vascular endothelial overexpression of human CYP2J2 through modulation of oxylipin profiles. Similarly, we expected that inhibition of CYP-epoxygenases would reduce CRH, whereas inhibition of ω-hydroxylases would enhance CRH. Compared to WT mice, Tie2-CYP2J2 Tr mice had enhanced CRH, including repayment volume, repayment duration, and repayment/debt ratio (P iso-PGF2α (P < 0.05). Inhibition of CYP epoxygenases with MS-PPOH attenuated CRH (P < 0.05). Ischemia caused a decrease in mid-chain HETEs (5-, 11-, 12-, 15-HETEs P < 0.05) and HODEs (P < 0.05). These data demonstrate that vascular endothelial overexpression of CYP2J2, through changing the oxylipin profiles, enhances CRH. Inhibition of CYP epoxygenases decreases CRH, whereas inhibition of ω-hydroxylases enhances CRH. PMID:28328948
Seto, Michael C; Fedoroff, J Paul; Bradford, John M; Knack, Natasha; Rodrigues, Nicole C; Curry, Susan; Booth, Brad; Gray, Jonathan; Cameron, Colin; Bourget, Dominique; Messina, Sarina; James, Elizabeth; Watson, Diane; Gulati, Sanjiv; Balmaceda, Rufino; Ahmed, Adekunle G
We tested the inter-rater reliability and criterion-related validity of the DSM-IV-TR pedophilia diagnosis and proposed DSM-5 pedohebephilia diagnosis in a sample of 79 men who had committed child pornography offenses, contact sexual offenses against children, or who were referred because of concerns about whether they had a sexual interest in children. Participants were evaluated by two independent psychiatrists with an interview and questionnaire regarding demographic characteristics, sexual history, and self-reported sexual interests; they also completed phallometric and visual reaction time testing. Kappa was .59 for ever meeting DSM-IV-TR criteria for pedophilia and .52 for ever meeting the proposed DSM-5 criteria for pedohebephilia. Ever meeting DSM-IV-TR diagnosis was significantly related to self-reported index of sexual interest in children (highest AUC=.81, 95% CI=.70-.91, pDSM-5 "diagnosis" was similarly related to self-report (AUC=.84, 95% CI=.74-.94, pDSM-5 criteria, we believe these results suggest the revision of DSM-5 and development of ICD-11 could benefit from drawing on the current DSM-5 criteria, which are essentially the same as DSM-IV-TR except for a distinction between having a paraphilia (the interest) and a paraphilic disorder (the paraphilia plus clinically significant distress or impairment). Copyright © 2016. Published by Elsevier Ltd.
Detection of Planetary Emission from the Exoplanet TrES-2 Using Spitzer/IRAC
Donovan, Francis T.; Charbonneau, David; Harrington, Joseph; Madhusudhan, N.; Seager, Sara; Deming, Drake; Knutson, Heather A.
2010-01-01
We present here the results of our observations of TrES-2 using the Infrared Array Camera on Spitzer. We monitored this transiting system during two secondary eclipses, when the planetary emission is blocked by the star. The resulting decrease in flux is 0.127% +/- 0.021%, 0.230% +/- 0.024%, 0.199% +/- 0.054%, and 0.359% +/- 0.060% at 3.6 microns, 4.5 microns, 5.8 microns, and 8.0 microns, respectively. We show that three of these flux contrasts are well fit by a blackbody spectrum with T(sub eff) = 1500 K, as well as by a more detailed model spectrum of a planetary atmosphere. The observed planet-to-star flux ratios in all four lRAC channels can be explained by models with and without a thermal inversion in the atmosphere of TrES-2, although with different atmospheric chemistry. Based on the assumption of thermochemical equilibrium, the chemical composition of the inversion model seems more plausible, making it a more favorable scenario. TrES-2 also falls in the category of highly irradiated planets which have been theoretically predicted to exhibit thermal inversions. However, more observations at infrared and visible wavelengths would be needed to confirm a thermal inversion in this system. Furthermore, we find that the times of the secondary eclipses are consistent with previously published times of transit and the expectation from a circular orbit. This implies that TrES-2 most likely has a circular orbit, and thus does not obtain additional thermal energy from tidal dissipation of a non-zero orbital eccentricity, a proposed explanation for the large radius of this planet. Key words: eclipses - infrared: stars - planetary systems - stars: individual (OSC 03549-02811) - techniques: photometric
DEFF Research Database (Denmark)
Larsen, H.J.; Riberholt, H.
Denne anvisning behandler materialer til trækonstruktioner og beregning af sædvanlige elementer og konstruktioner i henhold til Trænormen fra 2003 med tillæg. Forbindelser behandles i SBI-anvisning 194: Trækonstruktioner. Forbindelser. Anvisningen er tænkt anvendt af projekterende og som lærebog på...
Northrop Grumman TR202 LOX/LH2 Deep Throttling Engine Technology Project Status
Gromski, Jason; Majamaki, Annik; Chianese, Silvio; Weinstock, Vladimir; Kim, Tony S.
2010-01-01
NASA's Propulsion and Cryogenic Advanced Development (PCAD) project is currently developing enabling propulsion technologies in support of future lander missions. To meet lander requirements, several technical challenges need to be overcome, one of which is the ability for the descent engine(s) to operate over a deep throttle range with cryogenic propellants. To address this need, PCAD has enlisted Northrop Grumman Aerospace Systems (NGAS) in a technology development effort associated with the TR202 engine. The TR202 is a LOX/LH2 expander cycle engine driven by independent turbopump assemblies and featuring a variable area pintle injector similar to the injector used on the TR200 Apollo Lunar Module Descent Engine (LMDE). Since the Apollo missions, NGAS has continued to mature deep throttling pintle injector technology. The TR202 program has completed two series of pintle injector testing. The first series of testing used ablative thrust chambers and demonstrated igniter operation as well as stable performance at discrete points throughout the designed 10:1 throttle range. The second series was conducted with calorimeter chambers and demonstrated injector performance at discrete points throughout the throttle range as well as chamber heat flow adequate to power an expander cycle design across the throttle range. This paper provides an overview of the TR202 program, describing the different phases and key milestones. It describes how test data was correlated to the engine conceptual design. The test data obtained has created a valuable database for deep throttling cryogenic pintle technology, a technology that is readily scalable in thrust level.
Energy Technology Data Exchange (ETDEWEB)
Wang, Yi [Department of Chemistry & Biochemistry, University of Delaware, 304A Drake Hall, Newark, DE 19716 (United States); Suen, Nian-Tzu [Department of Chemistry & Biochemistry, University of Delaware, 304A Drake Hall, Newark, DE 19716 (United States); College of Chemistry and Chemical Engineering, Yangzhou University, Yangzhou 225002 (China); Kunene, Thabiso; Stoyko, Stanislav [Department of Chemistry & Biochemistry, University of Delaware, 304A Drake Hall, Newark, DE 19716 (United States); Bobev, Svilen, E-mail: bobev@udel.edu [Department of Chemistry & Biochemistry, University of Delaware, 304A Drake Hall, Newark, DE 19716 (United States)
2017-05-15
15 new quaternary Zintl phases have been synthesized by solid-state reactions from the respective elements, and their structures have been determined by single-crystal X-ray diffraction. Na{sub 3}E{sub 3}TrPn{sub 4} (E=Ca, Sr, Eu; Tr=Al, Ga, In; Pn=P, As, Sb) crystallize in the hexagonal crystal system with the non-centrosymmetric space group P6{sub 3}mc (No. 186). The structure represents a variant of the K{sub 6}HgS{sub 4} structure type (Pearson index hP22) and features [TrPn{sub 4}]{sup 9–} tetrahedral units, surrounded by Na{sup +} and Ca{sup 2+}, Sr{sup 2+}, Eu{sup 2+} cations. The nominal formula rationalization [Na{sup +}]{sub 3}[E{sup 2+}]{sub 3}[TrPn{sub 4}]{sup 9–} follows the octet rule, suggesting closed-shell configurations for all atoms and intrinsic semiconducting behavior. However, structure refinements for several members hint at disorder and mixing of cations that potentially counteract the optimal valence electron count. - Graphical abstract: The hexagonal, non-centrosymmetric structure of Na{sub 3}E{sub 3}TrPn{sub 4} (E=Ca, Sr, Eu; Tr=Al, Ga, In; Pn=P, As, Sb) features [TrPn{sub 4}]{sup 9–} tetrahedral units, surrounded by Na{sup +} and Ca{sup 2+}, Sr{sup 2+}, Eu{sup 2+} cations. - Highlights: • 15 quaternary phosphides, arsenides, and antimonides are synthesized and structurally characterized. • The structure is a variant of the hexagonal K{sub 6}HgS{sub 4}-type, with distinctive pattern for the cations. • Occupational and/or positional disorder of yet unknown origin exists for some members of the series.
A review of the probabilistic safety assessment application to the TR-2 research reactor
International Nuclear Information System (INIS)
Goektepe, G.; Adalioglu, U.; Anac, H.; Sevdik, B.; Menteseoglu, S.
2001-01-01
A review of the Probabilistic Safety Assessment (PSA) to the TR-2 Research Reactor is presented. The level 1 PSA application involved: selection of accident initiators, mitigating functions and system definitions, event tree constructions and quantification, fault tree constructions and quantification, human reliability, component failure data base development, dependent failure analysis. Each of the steps of the analysis given above is reviewed briefly with highlights from the selected results. PSA application is found to be a practical tool for research reactor safety due to intense involvement of human interactions in an experimental facility. Insights gained from the application of PSA methodology to the TR-2 research reactor led to a significant safety review of the system
ATMOSPHERE AND SPECTRAL MODELS OF THE KEPLER-FIELD PLANETS HAT-P-7b AND TrES-2
International Nuclear Information System (INIS)
Spiegel, David S.; Burrows, Adam
2010-01-01
We develop atmosphere models of two of the three Kepler-field planets that were known prior to the start of the Kepler mission (HAT-P-7b and TrES-2). We find that published Kepler and Spitzer data for HAT-P-7b appear to require an extremely hot upper atmosphere on the dayside, with a strong thermal inversion and little day-night redistribution. The Spitzer data for TrES-2 suggest a mild thermal inversion with moderate day-night redistribution. We examine the effect of nonequilibrium chemistry on TrES-2 model atmospheres and find that methane levels must be adjusted by extreme amounts in order to cause even mild changes in atmospheric structure and emergent spectra. Our best-fit models to the Spitzer data for TrES-2 lead us to predict a low secondary eclipse planet-star flux ratio (∼ -5 ) in the Kepler bandpass, which is consistent with what very recent observations have found. Finally, we consider how the Kepler-band optical flux from a hot exoplanet depends on the strength of a possible extra optical absorber in the upper atmosphere. We find that the optical flux is not monotonic in optical opacity, and the non-monotonicity is greater for brighter, hotter stars.
Moskvasse? - Tänan, ei! / Peeter Tulviste
Tulviste, Peeter, 1945-2017
2005-01-01
Ilmunud ka Põhjarannik (2005/Mar/11) lk. 2 ; Severnoje Poberezhje (2005/Mar/11) lk. 2 ; Elva Postipoiss (2005/Mar/12) lk. 2 ; Võrumaa Teataja (2005/Mar/12) lk. 2 ; Koit (2005/Mar/12) lk. 6 ; Nädaline (2005/Mar/15) lk. 5 ; Pärnu Postimees (2005/Mar/17) lk. 11 ; Hiiu Leht (2005/Mar/18) lk. 2 ; Meie Maa (2005/Mar/18) lk. 2. Autor analüüsib Venemaa poolt Eesti vastu õhkuva vale, vaenu ja laimu põhjuseid ning kiidab heaks president Arnold Rüütli otsuse mitte osaleda 9. mai pidustustel Moskvas
Walters, A. S.; Hughes, H. S. R.; Goodenough, K. M.; Gunn, A. G.; Lacinska, A.
2012-04-01
Due to growing global concerns about security of rare earth element (REE) supply, there is considerable interest in identifying new deposits and in understanding the processes responsible for their formation. Ongoing studies by BGS on potential indigenous resources have focused on the Caledonian alkaline intrusive complexes of north-west Scotland. The highest values of total rare earth oxide (TREO) have been found in the Cnoc nan Cuilean intrusion of the Loch Loyal Complex in Sutherland. The Loch Loyal Syenite Complex comprises three intrusions: Ben Loyal, Beinn Stumanadh and Cnoc nan Cuilean. The Cnoc nan Cuilean intrusion, which covers an area of about 3 km2, can be subdivided into two zones: a Mixed Syenite Zone (MSZ) and a later Massive Leucosyenite Zone (MLZ). Evidence from field mapping and 3D-modelling suggests that the melasyenites were passively emplaced to form a lopolith concordant with the Moine and Lewisian country rocks. A later episode of leucosyenitic magmatism caused mixing and mingling with the melasyenite forming the MSZ. Continued intrusion of leucosyenite melts then formed the MLZ [1]. The melasyenites are enriched in TREO relative to the leucosyenites with average values of 3800 ppm and 1400 ppm respectively. The highest contents, up to 20 000 ppm TREO, are found in narrow biotite-magnetite-rich veins identified in a single stream section near the eastern margin of the intrusion. All lithologies are light rare earth element (LREE) dominated with high concentrations of Ba and Sr and low levels of Nb and Ta. Various REE-bearing minerals are present but allanite is dominant, being present in all major magmatic lithologies and the biotite-magnetite veins. Three generations of allanite have been identified: a late-magmatic phase rimming apatite; allanite micro veinlets cross-cutting the syenite; and a third phase only observed in the biotite-magnetite veins. TREO concentrations of the different allanite generations are similar, averaging 22%. The
Directory of Open Access Journals (Sweden)
Mery Kurnia
2017-06-01
Full Text Available The sudy aims to reveal a shifting paradigm of the role of women in Minangkabau. Generally, the society perceived that the country is dominanted by women in which culture becomes an important and secure shield for women economy. This makes the cases of marginalization of women's rights is irrelevant to be discussed, but the pradigm can be re-evaluated by the emergence of the case. Historical method (heuristic, criticism, interpretation, historiogaraphy was used in this research, where the data taken from the case in Kubang Nan Duo. The finding of the study showed that there was a shifting role of women Kubang Nan Duo massively. From economic rulers, it has been shifted into a production center due to the many treasures have been sold and pawned heirlooms, forcing them plunge into agricultural labor. Wwomen have undermined from two sides, where the eternal patriarchal culture overwhelmed them.
Energy Technology Data Exchange (ETDEWEB)
Kuo, L; Viswanathan, A; Damato, A [Brigham and Women’s Hospital, Boston, MA (United States)
2015-06-15
Purpose: To investigate the dosimetric differences associated with the use of TO or TR applicators for cervical-cancer HDR BT. Methods: The records of all cervical-cancer patients treated with image-guided HDR BT in 2013 were reviewed. Image-based planning based on isodose line and DVH metrics inspections was performed following the GEC-ESTRO recommendations. CTV volume, CTV D90, and rectum, bladder and sigmoid D2cc were collected as % of the prescription dose (80Gy EQD2). Patients receiving both TO and TR were identified and plans were compared (paired analysis). A Student T-test was used to evaluate statistical significance (p ≤ 0.05). Results: Twenty-eight patients were identified (20 TR only, 4 TO only, 4 TO and TR), associated with 116 plans (109 TR, 7 TO). Overall metrics: CTV volume, 26.5±10.4 cm3 (TR) and 39.1±14.0 cm3 (TO, p < 0.01); CTV D90, 126±28% (TR) and 110±15% (TO, p = 0.15); rectum D2cc, 56±11% (TR) and 58±19% (TO, p = 0.91); bladder D2cc, 74±20% (TR) and 88±19% (TO, p = 0.09); sigmoid D2cc, 52±17% (TR) and 49±20% (TO, p = 0.63). The paired analysis results were: CTV volume, 37.3±11.9 cm3 (TR) and 51.0±23.1 cm3 (TO, p = 0.23); CTV D90, 111±12% (TR) and 101±17% (TO, p = 0.50); rectum D2cc, 56±12% (TR) and 53±16% (TO, p = 0.71); bladder D2cc, 73±14% (TR) and 90±20% (TO, p = 0.22); sigmoid D2cc, 59±10% (TR) and 59±22% (TO, p = 0.98). Conclusion: TR and TO were both used with good dosimetric results. TO were used for patients with larger CTV volumes than TR, although paired analysis suggest that tissue distortion and contouring bias may partially explain this Result. CTV D90 on average > 80 Gy EQD2 were achieved in both groups despite the different CTV volume. Higher bladder D2cc for TO than TR was observed.
Directory of Open Access Journals (Sweden)
Warawut Chulalaksananukul
2013-05-01
Full Text Available Organic solvent and hot water extracts of freshwater macroalgae, Cladophora glomerata and Microspora floccosa, harvested from Nan River in northern Thailand were screened for antioxidant and anticancer activities using DPPH free radical scavenging assay and inhibition of proliferation of the KB human oral cancer cell lines respectively. The ethyl acetate extract of C. glomerata showed the highest total phenol content (18.1±2.3 mg GAE/g, radical scavenging activity (49.8±2.7% DPPH scavenging at 100 g/ml and in vitro growth inhibition (IC50=1420.0±66 g/g of the KB cell lines. These results indicate that C. glomerata could be a source of valuable bioactive materials.
Complicações das operações de reconstrução do trânsito intestinal
Directory of Open Access Journals (Sweden)
Silvana Marques e Silva
2006-03-01
Full Text Available INTRODUÇÃO: A reconstrução do trânsito intestinal acarreta elevados índices de morbimortalidade, dependente do procedimento realizado na operação inicial, da técnica operatória necessária na reconstituição do trânsito intestinal e dos fatores de risco inerentes ao paciente. OBJETIVOS: Determinar as características demográficas dos pacientes submetidos à reconstrução de trânsito intestinal, analisar as operações realizadas e as complicações delas decorrentes. MÉTODOS: Análise retrospectiva dos prontuários dos pacientes submetidos à reconstrução de trânsito intestinal no Hospital Regional da Asa Norte em um período de 4 anos (2001-2004. RESULTADOS: Foram incluídos 70 pacientes, sendo 34% mulheres e 66% homens, com idade média de 42,5 anos. A cirurgia tipo Hartmann foi o motivo para a reconstrução do trânsito intestinal em 45,7% dos pacientes. A anastomose término-terminal foi realizada em 70% dos casos. Intercorrências clínicas ocorreram em 54% dos pacientes e incluíram íleo paralítico (11,4%, vômitos (21,4%, diarréia (7,1% e febre (7,1%. Dentre as intercorrências cirúrgicas podemos citar a infecção (11,4% e a deiscência de ferida operatória (5,7%, evisceração (2,8%, formação de fístula (2,8% e o abscesso intra-cavitário (1,4%. Não houve óbitos. CONCLUSÃO: A operação para reconstrução do trânsito intestinal não é desprovida de complicações. Desta forma, é necessário uma indicação precisa para a realização da colostomia.Colostomy closure is associated with a high morbidity and mortality rates. The risk factors are: the technical conditions at the first procedure, the utilized technique to close the colostomy and the patient status. Our goal is to retrospectively analyze the demographics of the patients who underwent colostomy closure at our institution in a four year period, (2001-2004. Seventy patients were included (66% males, 34% females, with a median age of 42,5 years
Directory of Open Access Journals (Sweden)
Talesa Vincenzo N
2010-10-01
Full Text Available Abstract Background at present, pathogenesis of bladder cancer (BC has not been fully elucidated. Aim of this study is to investigate the role of human telomerase RNA (hTR, human telomerase reverse transcriptase (hTERT and CDC28 protein kinase regulatory subunit 2 (CKS2 in bladder carcinogenesis and their possible clinical significance; Methods the transcript levels of hTR, hTERT and CKS2 were quantified by Real time reverse transcriptase chain reaction in exfoliated cells from bladder washings of 36 patients with BC and 58 controls. The statistical significance of differences between BC bearing patients and control groups, in the general as well as in the stratified analysis (superficial or invasive BC, was assessed by Student's t test. Non parametric Receiver Operating Characteristics analysis (ROC was performed to ascertain the accuracy of study variables to discriminate between BC and controls. The clinical value of concomitant examination of hTR, hTERT and CKS2 was evaluated by logistic regression analysis; Results a significant decrease in hTR and a significant increase in hTERT or CKS2 gene expression were found between BC bearing patients and controls, as well as in the subgroups analysis. The area under the curve (AUC indicated an average discrimination power for the three genes, both in the general and subgroups analysis, when singularly considered. The ability to significantly discriminate between superficial and invasive BC was observed only for hTR transcript levels. A combined model including hTR and CKS2 was the best one in BC diagnosis; Conclusions our results, obtained from a sample set particularly rich of exfoliated cells, provide further molecular evidence on the involvement of hTR, hTERT and CKS2 gene expression in BC carcinogenesis. In particular, while hTERT and CKS2 gene expression seems to have a major involvement in the early stages of the disease, hTR gene expression, seems to be more involved in progression. In
Estudio sobre la distribución de tráfico autosimilar en redes Wi-Fi
Pérez, Santiago; Facchini, Higinio Alberto; Mercado, Gustavo; Taffernaberry, Juan Carlos; Bisaro, Luis
2012-01-01
Los modelos exactos del tráfico Ethernet y Wireless 802.11 son importantes para modelar las aplicaciones de capa superior y los buffers de memoria de switchs, APs y bridges. Los análisis de cola realizados suponiendo la naturaleza Poisson del tráfico de datos difieren significativamente del rendimiento observado en la realidad. Diversos estudios han demostrado que para algunos entornos el patrón de tráfico es autosimilar, en lugar de Poisson. Desde principios de los años 90 se comenzaron a pu...
Northrop Grumman TR202 LOX/LH2 Deep Throttling Engine Project Status
Gromski, J.; Majamaki, A. N.; Chianese, S. G.; Weinstock, V. D.; Kim, T.
2010-01-01
NASA's Propulsion and Cryogenic Advanced Development (PCAD) project is currently developing enabling propulsion technologies in support of the Exploration Initiative, with a particular focus on the needs of the Altair Project. To meet Altair requirements, several technical challenges need to be overcome, one of which is the ability for the lunar descent engine(s) to operate over a deep throttle range with cryogenic propellants. To address this need, PCAD has enlisted Northrop Grumman Aerospace Systems (NGAS) in a technology development effort associated with the TR202, a LOX/LH2 expander cycle engine driven by independent turbopump assemblies and featuring a variable area pintle injector similar to the injector used on the TR200 Apollo Lunar Module Descent Engine (LMDE). Since the Apollo missions, NGAS has continued to mature deep throttling pintle injector technology. The TR202 program has completed two phases of pintle injector testing. The first phase of testing used ablative thrust chambers and demonstrated igniter operation as well as stable performance at several power levels across the designed 10:1 throttle range. The second phase of testing was performed on a calorimeter chamber and demonstrated injector performance at various power levels (75%, 50%, 25%, 10%, and 7.5%) across the throttle range as well as chamber heat flux to show that the engine can close an expander cycle design across the throttle range. This paper provides an overview of the TR202 program. It describes the different phases of the program with the key milestones of each phase. It then shows when those milestones were met. Next, it describes how the test data was used to update the conceptual design and how the test data has created a database for deep throttling cryogenic pintle technology that is readily scaleable and can be used to again update the design once the Altair program's requirements are firm. The final section of the paper describes the path forward, which includes
Directory of Open Access Journals (Sweden)
Zwart John-Anker
2008-12-01
Full Text Available Abstract Background Physical inactivity is associated with several diseases, but studies evaluating the association between chronic musculoskeletal complaints (MSCs and physical exercise have shown conflicting results. The aim of this large-scale prospective population-based study was to investigate the association between self-reported physical exercise at baseline and the prevalence of chronic musculoskeletal complaints (MSCs 11 years later. Methods The results are based upon two consecutive public health studies conducted within the county of Nord-Trøndelag, Norway (The HUNT studies. A total of 39,520 (83% out of 47,556 adults who participated in HUNT 1 and HUNT 2 responded to questions about physical exercise at baseline in 1984–86, and to questions about musculoskeletal complaints 11 years later (1995–97. Chronic MSCs was defined as MSCs ≥ 3 months during the past year, and chronic widespread MSCs such as pain ≥ 15 days during the last month from the axial region, above the waist, and below the waist. Associations were assessed using multiple logistic regression, estimating prevalence odds ratio (OR with 95% confidence intervals (CIs. All the final analyses were adjusted for age, gender, body mass index, smoking and education level. Results At follow-up 20,223 (51% reported chronic MSCs, and among these 2,318 (5.9% reported chronic widespread MSCs. Individuals who exercised at baseline were less likely to report chronic MSCs 11 years later (OR 0.91, 95% CI 0.85–0.97 than inactive persons. Among individuals who exercised more than three times per week, chronic widespread MSCs were 28% less common (OR 0.72, 95% CI 0.59–0.88 compared to inactive individuals. Conclusion In this large-scale population-based study, physical exercise was associated with lower prevalence of chronic MSCs, in particular chronic widespread MSCs. Future studies should try to clarify whether chronic MSCs are a cause or a consequence of inactivity.
Fırat, Hicran Bayraktaroğlu
2014-01-01
ABSTRACT: The International General Certificate of Secondary Education (IGCSE) Exam, the Exam for Transition to Higher Education (YGS) and the Exam for Placement for Undergraduate Studies (LYS) are external exams providing direct admission to higher education abroad: and they are significant for 17-18 year-old Turkish Cypriot students. The discontentment in the newspapers of North Cyprus about the low achievement results for the YGS and the LYS and the teachers’ and students’ complaints about...
More on the TR-OSL signal from BeO ceramics
International Nuclear Information System (INIS)
Bulur, Enver
2014-01-01
Time Resolved Optically Stimulated Luminescence (TR-OSL) from BeO ceramics was investigated using blue (445 nm) and near-IR light (852 nm) for stimulation. Stimulation spectrum of the TR-OSL signal – as measured in the interval 700 to 420 nm- was observed to increase monotonically with the decreasing stimulation wavelength. In addition to the “fast” and “slow” components observed with blue light stimulation, IR stimulated TR-OSL spectra of irradiated BeO ceramics were observed to have two components with average lifetimes around ∼2.5 μs and ∼17 μs. Emission spectra of the both IR stimulated TR-OSL components were observed to have a broad emission band peaking around 330 nm. Thermal stability of the IR stimulated TR-OSL signal was studied by making preheating experiments in the range from 100 °C to 190 °C. It was observed that the IR stimulated OSL signal is stable up to ∼150 °C and decay afterwards. Radiation dose response of the IR stimulated luminescence signal was obtained in the range from 5 to 500 Gy. Both blue and IR stimulated TR-OSL signals grew up to 100 Gy and exhibited saturation for higher doses. Additionally, measurement temperature dependence of the components was also investigated and for the ∼2 μs component thermal assistance with activation energy around 0.16 eV was observed. It seems that the fast component of the blue stimulated TR-OSL component can be correlated to the ∼2 μs IR stimulated TR-OSL component. - Highlights: • IR Stimulated Time-Resolved OSL from BeO was studied. • Two components with lifetimes ∼2 and ∼17us were observed. • IR stimulated TR-OSL signal is found to be stable up to 150 °C. • Thermal quenching energy of the 2us component was found as 0.16 eV
Friluftsinstallationer i træer
DEFF Research Database (Denmark)
Skov, Simon; Thomsen, Iben Margrete
2015-01-01
Abebaner, treetop walking, high rope adventure, slackline, træhuse og parkour-baner er alle installationer, som bruger træerne som støtte, enten midlertidigt eller permanent. Den nye sport, turistattraktionen eller team building-redskabet sætter i alle tilfælde træerne på prøve. Der følger positiv...
Directory of Open Access Journals (Sweden)
Khattapan Jantawongsri
2015-01-01
Full Text Available Herbicides (atrazine, glyphosate and paraquat have been intensively used in Nan Province for a long time. Prior observations indicated that herbicide contamination and adverse health effects were found on the rice frog Fejervarya limnocharis living in paddy fields at Nan Province. Contamination of herbicides may influence disease emergence by acting directly or indirectly upon the immune system of amphibian or by causing disruptions in homeostasis, it is thus interesting to investigate potential effects of herbicide contamination in Nan Province on immune responses of the rice frog living in agricultural areas. Frogs were caught from a paddy field with no history of herbicide utilization (reference site and a paddy field with intensive herbicide utilization (contaminated site during 2010-2011. After dissection, frog livers were fixed in 10% neutral buffer formalin, processed by paraffin method and stained with hematoxylin and eosin. Number of melanomacrophage and melanomacrophage center (MMC were counted under a light microscope and used as markers of non-specific immune response. It was found that there was no significant sex-related difference in these numbers. However, there were significant seasonal differences in these numbers in both reference and contaminated site frogs, suggesting that seasonal difference in herbicide usage tend to affect frog's immune system in agricultural areas. Furthermore, numbers of melanomacrophage and MMC in early wet, late wet and early dry periods were markedly higher in the contaminated site frogs compared to those of the reference site frogs. The observation on amphibian's immune response to environmental contaminants could indicate the impacts of herbicide utilization on other vertebrates, as well as its role in amphibian declines.
Directory of Open Access Journals (Sweden)
Sami Özçelik
2015-02-01
Full Text Available Amasya, Elazığ, Erzincan ve Tokat illerinden alınan soğan örneklerinin (Allium cepa L., test organizması olarak kullanılan Staphylococcus aureus, Mycobacterium phlel, Escherichia coli ve Bacillus cereus bakterilerine karşı, bakterisit etki gösterdikleri bulunmuştur. Test organizmalarından E. coli’nin daha dirençli ve Elazığ ilinden alınan soğan örneklerinin farklı bir çeşit olduğu ve daha az bir bakterisit etkiye sahip olduğu görülmüştür.
DEFF Research Database (Denmark)
Hansen, Henning Otte
2016-01-01
Teorien om landbrugets trædemølle siger, at teknologi medfører stigende produktivitet, stigende udbud og dermed faldende priser. Dermed øges behovet for ny teknologi. Det vedvarende teknologipres gavner de innovative landmænd, mens de mere afventende landmænd kun oplever de negative virkninger i...... form af prisfald. I denne artikel beskrives nærmere de enkelte elementer i trædemøllen. Samtidig vurderes trædemøllens betydning og mulige påvirkning. Det konkluderes, at trædemøllen, dens forudsætninger og afledte virkninger stadig er fuldt gældende. Det er ikke muligt for et enkelt land eller region...... af bremse trædemøllen på lang sigt. På lokalt plan kan man løse nogle sociale og økonomiske problemer skabt af trædemøllen gennem nemmere afvandring....
Nan Goldin: da Fotografia do Cotidiano à Visibilidade Drag Queen
Directory of Open Access Journals (Sweden)
Vivian Castro de Miranda
2017-09-01
Full Text Available Este trabalho tem como objetivo apresentar a biografia da fotógrafa americana Nan Goldin, a partir do recorte de sua produção datada entre as décadas de 1970 e 1990, em que ela fotografou a comunidade drag queen. A partir do cruzamento de informações vigentes em documentário (Série, 2004 e fontes relevantes (Guggenheim Museum, EUA; The Guardian, UK a quem a fotógrafa concedeu entrevistas ou foi notícia, procura-se explorar nesse texto a importância de uma produção que se insere no âmbito de questões caras ao contexto contemporâneo, que é a temática de gênero. Com a perspectiva teórica adotada, baseada principalmente nos apontamentos de Barthes (1984, é possível compreender o corpus analisado como resultante de um olhar sensível para o aspecto humano, com impacto para a discussão e aceitação do grupo social.
Abdulhamid, Mahmoud A.
2017-10-12
A newly designed carbocyclic pseudo Tröger\\'s base diamine (CTB) monomer, 2,8-dimethyl-3,9-diamino-5,6,11,12-tetrahydro-5,11-methanodibenzo[a,e][8]annulene (CTBDA) and its isomeric analogue 2,8-dimethyl-(1,7)(4,10)(3,9)-diamino-5,6,11,12-tetrahydro-5,11-methanodibenzo[a,e][8]annulene (iCTBDA), were designed for the synthesis of microporous 6FDA-based polyimides (6FDA-CTBDA and 6FDA-iCTBDA). Both polyimides were soluble, exhibited excellent thermal stability of ∼490 °C, and had high surface areas of 587 m2 g−1 (6FDA-CTBDA) and 562 m2 g−1 (6FDA-iCTBDA). A 6FDA-based polyimide derived from 4,10-dimethyl-3,9-diamino-6H,12H-5,11-methanodibenzo[b,f][1,5]-diazocine (6FDA-TBDA) was made for comparison to investigate the effects of the basic tertiary nitrogen functionality in the Tröger\\'s base diamine on the polymer properties relative to the carbocyclic 6FDA-CTBDA analogue. 6FDA-TBDA displayed lower gas permeabilities but moderately higher gas-pair permselectivities than 6FDA-CTBDA. The enhanced permselectivity of 6FDA-TBDA resulted exclusively from higher diffusion-based selectivity. Direct gas sorption measurements demonstrated that the basicity in the Tröger\\'s base bridge moiety enhanced the sorption capacity of CO2 only slightly and had no effect on the CO2/CH4 solubility selectivity in 6FDA-TBDA vs. 6FDA-CTBDA.
The Orphan Nuclear Receptor TR4 Is a Vitamin A-activated Nuclear Receptor
Energy Technology Data Exchange (ETDEWEB)
Zhou, X. Edward; Suino-Powell, Kelly M.; Xu, Yong; Chan, Cee-Wah; Tanabe, Osamu; Kruse, Schoen W.; Reynolds, Ross; Engel, James Douglas; Xu, H. Eric (Michigan-Med); (Van Andel)
2015-11-30
Testicular receptors 2 and 4 (TR2/4) constitute a subgroup of orphan nuclear receptors that play important roles in spermatogenesis, lipid and lipoprotein regulation, and the development of the central nervous system. Currently, little is known about the structural features and the ligand regulation of these receptors. Here we report the crystal structure of the ligand-free TR4 ligand binding domain, which reveals an autorepressed conformation. The ligand binding pocket of TR4 is filled by the C-terminal half of helix 10, and the cofactor binding site is occupied by the AF-2 helix, thus preventing ligand-independent activation of the receptor. However, TR4 exhibits constitutive transcriptional activity on multiple promoters, which can be further potentiated by nuclear receptor coactivators. Mutations designed to disrupt cofactor binding, dimerization, or ligand binding substantially reduce the transcriptional activity of this receptor. Importantly, both retinol and retinoic acid are able to promote TR4 to recruit coactivators and to activate a TR4-regulated reporter. These findings demonstrate that TR4 is a ligand-regulated nuclear receptor and suggest that retinoids might have a much wider regulatory role via activation of orphan receptors such as TR4.
Thiazolopyridines Improve Adipocyte Function by Inhibiting 11 Beta-HSD1 Oxoreductase Activity
Directory of Open Access Journals (Sweden)
Thirumurugan Rathinasabapathy
2017-01-01
Full Text Available Background. Glucocorticoid excess has been linked to clinical observations associated with the pathophysiology of metabolic syndrome. The intracellular glucocorticoid levels are primarily modulated by 11β-hydroxysteroid dehydrogenase type 1 (11β-HSD1 enzyme that is highly expressed in key metabolic tissues including fat, liver, and the central nervous system. Methods. In this study we synthesized a set of novel tetrahydrothiazolopyridine derivatives, TR-01–4, that specifically target 11β-HSD1 and studied their ability to interfere with the glucocorticoid and lipid metabolism in the 3T3-L1 adipocytes. Results. Based on the docking model and structure-activity relationships, tetrahydrothiazolopyridine derivatives TR-02 and TR-04 showed the highest potency against 11β-HSD1 by dose-dependently inhibiting conversion of cortisone to cortisol (IC50 values of 1.8 μM and 0.095 μM, resp.. Incubation of fat cells with 0.1–10 μM TR-01–4 significantly decreased cortisone-induced lipid accumulation in adipocytes and suppressed 11β-HSD1 mRNA expression. Observed reduction in adipocyte fat stores could be partially explained by decreased expression levels of adipogenic markers (PPAR-γ, aP2 and key enzymes of lipid metabolism, including fatty acid synthase (FAS, hormone sensitive lipase (HSL, and lipoprotein lipase (LPL. Conclusions. The tetrahydrothiazolopyridine moiety served as an active pharmacophore for inhibiting 11β-HSD1 and offered a novel therapeutic strategy to ameliorate metabolic alterations found in obesity and diabetes.
A short proof of a conjecture on the Tr-choice number of even cycles
Sitters, R. A.
In this note we prove that the Tr-choice number of the cycle C2n is equal to the Tr-choice number of the path (tree) on 4n - 1 vertices, i.e. Tr-ch(C2n) = [((4n - 2)/(4n - 1))(2r + 2)] + 1. This solves a recent conjecture of Alon and Zaks.
Masereeuw, R.; Notenboom, S.; Smeets, P.H.E.; Wouterse, A.C.; Russel, F.G.M.
2003-01-01
Previous studies with mutant transport-deficient rats (TR(-)), in which the multidrug resistance protein 2 (Mrp2) is lacking, have emphasized the importance of this transport protein in the biliary excretion of a wide variety of glutathione conjugates, glucuronides, and other organic anions. Mrp2 is
Investigation of P(VDF-TrFE)/ZrO{sub 2}-MMA polymer composites applied to radiation shielding
Energy Technology Data Exchange (ETDEWEB)
Fontainha, C.C.P. [Depto. de Engenharia Nuclear - UFMG, Av. Antonio Carlos 6627, 31270-970 Belo Horizonte, MG (Brazil); Baptista Neto, A.T.; Santos, A.P.; Faria, L.O. [Centro de Desenvolvimento da Tecnologia Nuclear, Av. Antonio Carlos 6627, C.P. 941, 30270-901, Belo Horizonte, MG (Brazil)
2015-07-01
Exposure to high radiation dose in medical diagnostic imaging procedures can lead patients to suffer tissue damaging. However, there are several studies that identify significant dose reduction with the use of radiation protective attenuators, minimizing the delivered dose in the region that covers the main beam, while preserving the diagnostic quality of the generated image. Most radiation attenuator materials are produced from shielding metal containing composites, whose efficiency is the goal of investigations around the world. In this context, polymeric materials were chosen for this investigation in order to provide light-weighted and flexible protective composites, a must in personal protective shielding. Therefore, this work is concerned to the investigation of poly(vinylidene fluoride - try-fluor-ethylene) [P(VDF-TrFE)] copolymers mixed with zirconia nanoparticles. The resulting polymer composites, prepared with 1, 2, 3, 5 and 10 at.% of ZrO{sub 2} nanoparticles, were investigated for application as protective shielding in some interventional radiology procedures. Two variety of composites were produced, one using pure ZrO{sub 2} nanoparticles and the other using sol-gel route with zirconium butoxide as the precursor for zirconium oxide nano-clusters. The P(VDFTrFE)/ ZrO2-MMA polymer composites produced by sol-gel route have provided a much better dispersion of the pure ZrO{sub 2} material into the P(VDF-TrFE) host matrix. UV-Vis and FTIR spectrometry and differential scanning calorimetry (DSC) were used to characterize the composite samples. FTIR data reveal a possible link between the MMA monomers with the P(VDF-TrFE) chain through shared C=O bonds. The radiation shielding characterization was conducted by using a 70 kV x-rays beam which is applicable, for instances, in catheter angiography. The results demonstrate that composites with 10% of ZrO{sub 2}, and only 1.0 mm thick, can attenuate 60% of the x-rays beam. The composite density was evaluated to be
P(VDF-TrFE)/ZrO{sub 2} polymer-composites for X-ray shielding
Energy Technology Data Exchange (ETDEWEB)
Fontainha, Crissia Carem Paiva [Universidade Federal de Minas Gerais (UFMG), Belo Horizonte, MG (Brazil). Dept. de Engenharia Nuclear; Baptista Neto, Annibal Theotonio; Santos, Adelina Pinheiro; Faria, Luiz Oliveira de, E-mail: farialo@cdtn.br [Centro de Desenvolvimento da Tecnologia Nuclear (CDTN/CNEN-MG), Belo Horizonte, MG (Brazil)
2016-03-15
Poly(vinylidene fluoride - tryfluorethylene) [P(VDF-TrFE)] copolymers were mixed with zirconia nanoparticles. The investigation was conducted with the intention to produce nanocompounds with potential to be used as protective patient shielding in radiological procedures. Polymer based nanocomposites with 1, 2, 3, 5 and 10 wt% of ZrO{sub 2} nanoparticles were prepared using sol-gel route with zirconium butoxide as the precursor for zirconium oxide nanoclusters. UV-Vis and FTIR spectrometry and differential scanning calorimetry (DSC) were used to characterize the composite samples. We observed a more homogeneous distribution of ZrO{sub 2} nanoparticles encapsulated by methyl methacrylate (MMA) into the polymeric matrix, when compared to composites made without the use of surface modifiers from methacrylate group. Apparently, this property is related to the absence of the strong MMA absorption band at 1745 cm{sup -1}, attributed to C=O bond, in the P(VDF-TrFE)/ZrO{sub 2} -MMA nanocomposites. The radiation damage due to high dose exposure was performed for gamma doses ranging from 100 kGy to 1,000 kGy. The radiation shielding characterization conducted using x-rays with effective energy of 40 keV has demonstrated that composites with 10% of ZrO{sub 2}, and only 1.0 mm thick, can attenuate 60% of the x-rays beam. (author)
Blog.tr.ee ei anna alla / Raigo Neudorf
Neudorf, Raigo
2007-01-01
Veebikeskkonna blog.tr.ee arengust ja majandamisest räägivad keskkonna looja Andris Reinmann ja firma OÜ Tr.ee osaniku Mobi Solutions'i esindaja Rain Rannu. Vt. samas: Mis on blog.tr.ee; Kaljundi: blog.tr.ee on hobiprojekt. Kommenteerib nagi.ee juhataja Jüri Kaljundi. Lisatud joonis: Blog.tr.ee unikaalsete külastajate arv nädalas
Directory of Open Access Journals (Sweden)
Javed Mohammed Khan
Full Text Available Understanding the basis of the binding of a T cell receptor (TR to the peptide-MHC (pMHC complex is essential due to the vital role it plays in adaptive immune response. We describe the use of computed binding (free energy (BE, TR paratope, pMHC epitope, molecular surface electrostatic potential (MSEP and calculated TR docking angle (θ to analyse 61 TR/pMHC crystallographic structures to comprehend TR/pMHC interaction. In doing so, we have successfully demonstrated a novel/rational approach for θ calculation, obtained a linear correlation between BE and θ without any "codon" or amino acid preference, provided an explanation for TR ability to scan many pMHC ligands yet specifically bind one, proposed a mechanism for pMHC recognition by TR leading to T cell activation and illustrated the importance of the peptide in determining TR specificity, challenging the "germline bias" theory.
Investigating the taste in the city : Très très bon, gourmet stroll in Paris
Directory of Open Access Journals (Sweden)
Camille BRACHET
2015-12-01
Full Text Available In this paper, will be examined the potential of television regarding the representation of food and taste. The analysis focuses on a particular TV show, Très très bon, a weekend program broadcast on the channel Paris Première. Since the success of many TV programs has already shown that cooking and television can go together, it is interesting to try to understand the terms of staging which are very specific to Très très bon. For this purpose, the apparatus behind this TV program will be analysed in order to understand how the TV show seduces the viewer for whom any form of tasting remains technically impossible.
Businnes Model of Cors-Tr Tusaga-Aktif
Bakici, S.; Erkek, B.; İlbey, A.; Kulaksiz, E.
2017-11-01
CORS-TR (TUSAGA-Aktif (Turkish National Permanent GNSS Network - Active)), serves location information at cm level accuracy in Turkey and TR Northern Cyprus in few seconds, where adequate numbers of GNSS satellites are observed and communication possibilities are present. No ground control points and benchmarks are necessary. There are 146 permanent GNSS stations within the CORS-TR System. Station data are transferred online to the main control center located in the Mapping Department of the General Directorate of Land Registry and Cadastre. CORS-TR System was established in 2008 and has been updated in software, hardware, communication and pricing areas from technical and administrative point of view in order to improve the system and provide better service to the users. Thus, the added value obtained from the CORS-TR System has been increased and contributed to the more efficient use of country resources. In this paper, how the technical, administrative and financial studies in the operation of the CORS-TR System were managed with a sustainable business model, studies for solving problems encountered in operating of the system, the cost / benefit analysis of the system and the sharing of experience gained from the perspective of how web-based applications are managed and the business model of the CORS-TR System are explained in detail.
Status and results from the TR30 cyclotron centre region model
International Nuclear Information System (INIS)
Kleeven, W.; Lanz, P.; McDonald, M.; Milton, B.F.; Schmor, P.W.; Schneider, H.R.; Jayamanna, K.; Sura, J.; Uzat, W.; Gyles, W.
1990-06-01
A full scale model for the centre region of the compact 30 MeV, 350 μA H - cyclotron (TR30) has been constructed, to test the design of critical components and to study beam properties and space charge effects out to the 5. turn (1 MeV). The ion source and injection line system duplicates that used in the TR30. The centre region can be accessed with diagnostic probes at four different angles. The normalized circulating emittances as estimated from beam profile measurements are 1.7π mm-mrad (radially) and 1.8π mm-mrad (vertically). The radial centering error of the beam is less than 1.5 mm. After initial tests the maximum intensity achieved at the 5. turn is 650 μA. This corresponds with a transmission efficiency of 12.5% for a continuous (non-bunched) input beam. No significant space charge effects are observed up to 650 μA. For the TR30 bunching is not a must because of the high current available from the source. Nevertheless, it was considered useful to study beam bunching for the Centre Region Cyclotron (CRC). Some of these results are described. (Author) 11 refs., 6 figs
Energy Technology Data Exchange (ETDEWEB)
NONE
2002-02-01
For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Sen'nan City, Osaka Prefecture, a new energy vision was worked out, and a version of the outline was made. The policy on new energy introduction was described as follows: to make a great use of solar energy; to promote the spread of low-emission car and other new energy; to construct a system for spread that is connected to cooperation with citizen and education/enlightenment. Concretely, the following were cited: introduction of photovoltaic power generation to the city office/elementary school/junior high school; study of preferential treatment for introduction of solar energy; introduction of low-emission car to official vehicle; study of preferential treatment for introduction of low-emission car; promotion of car sharing by low-emission car; introduction of natural gas cogeneration and fuel cell to the city office; installation of street light using small wind power generation; potential study of small- and medium-size power generation; support for class for new energy experience at elementary/junior high school; potential study of utilization of biomass energy such as bamboo charcoal; study of preferential treatment for new energy to be given to citizen and enterprises in the city; construction/support of energy utilization system using waste, etc. (NEDO)
BUSINNES MODEL OF CORS-TR (TUSAGA-AKTIF
Directory of Open Access Journals (Sweden)
S. Bakici
2017-11-01
Full Text Available CORS-TR (TUSAGA-Aktif (Turkish National Permanent GNSS Network – Active, serves location information at cm level accuracy in Turkey and TR Northern Cyprus in few seconds, where adequate numbers of GNSS satellites are observed and communication possibilities are present. No ground control points and benchmarks are necessary. There are 146 permanent GNSS stations within the CORS-TR System. Station data are transferred online to the main control center located in the Mapping Department of the General Directorate of Land Registry and Cadastre. CORS-TR System was established in 2008 and has been updated in software, hardware, communication and pricing areas from technical and administrative point of view in order to improve the system and provide better service to the users. Thus, the added value obtained from the CORS-TR System has been increased and contributed to the more efficient use of country resources. In this paper, how the technical, administrative and financial studies in the operation of the CORS-TR System were managed with a sustainable business model, studies for solving problems encountered in operating of the system, the cost / benefit analysis of the system and the sharing of experience gained from the perspective of how web-based applications are managed and the business model of the CORS-TR System are explained in detail.
Energy Technology Data Exchange (ETDEWEB)
Hillwig, Todd C.; Schaub, S. C. [Department of Physics and Astronomy, Valparaiso University, Valparaiso, IN 46383 (United States); Bond, Howard E. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Frew, David J. [Department of Physics, The University of Hong Kong, Pokfulam Road (Hong Kong); Bodman, Eva H. L., E-mail: todd.hillwig@valpo.edu [Southeastern Association for Research in Astronomy (SARA) (United States)
2016-08-01
We explore the photometrically variable central stars of the planetary nebulae HaTr 4 and Hf 2-2. Both have been classified as close binary star systems previously based on their light curves alone. Here, we present additional arguments and data confirming the identification of both as close binaries with an irradiated cool companion to the hot central star. We include updated light curves, orbital periods, and preliminary binary modeling for both systems. We also identify for the first time the central star of HaTr 4 as an eclipsing binary. Neither system has been well studied in the past, but we utilize the small amount of existing data to limit possible binary parameters, including system inclination. These parameters are then compared to nebular parameters to further our knowledge of the relationship between binary central stars of planetary nebulae and nebular shaping and ejection.
Group Authentication Scheme for Neighbourhood Area Networks (NANs in Smart Grids
Directory of Open Access Journals (Sweden)
Bashar Alohali
2016-05-01
Full Text Available A Neighbourhood Area Network is a functional component of the Smart Grid that interconnects the end user domain with the Energy Services Provider (ESP domain. It forms the “edge” of the provider network, interconnecting homes instrumented with Smart Meters (SM with the ESP. The SM is a dual interface, wireless communication device through which information is transacted across the user (a home and ESP domains. The security risk to the ESP increases since the components within the home, interconnected to the ESP via the SM, are not managed by the ESP. Secure operation of the SM is a necessary requirement. The SM should be resilient to attacks, which might be targeted either directly or via the network in the home. This paper presents and discusses a security scheme for groups of SMs in a Neighbourhood Area Network that enable entire groups to authenticate themselves, rather than one at a time. The results show that a significant improvement in terms of resilience against node capture attacks, replay attacks, confidentiality, authentication for groups of SMs in a NAN that enable entire groups to authenticate themselves, rather than one at a time.
NanTroSEIZE in 3-D: Creating a Virtual Research Experience in Undergraduate Geoscience Courses
Reed, D. L.; Bangs, N. L.; Moore, G. F.; Tobin, H.
2009-12-01
Marine research programs, both large and small, have increasingly added a web-based component to facilitate outreach to K-12 and the public, in general. These efforts have included, among other activities, information-rich websites, ship-to-shore communication with scientists during expeditions, blogs at sea, clips on YouTube, and information about daily shipboard activities. Our objective was to leverage a portion of the vast collection of data acquired through the NSF-MARGINS program to create a learning tool with a long lifespan for use in undergraduate geoscience courses. We have developed a web-based virtual expedition, NanTroSEIZE in 3-D, based on a seismic survey associated with the NanTroSEIZE program of NSF-MARGINS and IODP to study the properties of the plate boundary fault system in the upper limit of the seismogenic zone off Japan. The virtual voyage can be used in undergraduate classes at anytime, since it is not directly tied to the finite duration of a specific seagoing project. The website combines text, graphics, audio and video to place learning in an experiential framework as students participate on the expedition and carry out research. Students learn about the scientific background of the program, especially the critical role of international collaboration, and meet the chief scientists before joining the sea-going expedition. Students are presented with the principles of 3-D seismic imaging, data processing and interpretation while mapping and identifying the active faults that were the likely sources of devastating earthquakes and tsunamis in Japan in 1944 and 1948. They also learn about IODP drilling that began in 2007 and will extend through much of the next decade. The website is being tested in undergraduate classes in fall 2009 and will be distributed through the NSF-MARGINS website (http://www.nsf-margins.org/) and the MARGINS Mini-lesson section of the Science Education Resource Center (SERC) (http
2002-01-01
Trükitööstuste TOP 50. Käibe TOP 30. Käibe kasum TOP 30. Kasvu TOP 30. Kasumi kasvu TOP 30. Rentaabluse TOP. Varade tootlikkuse TOP. Trükitööstusettevõtete üldandmed. Trükitööstusettevõtete finantsandmed
1956-08-10
Complete ...................................... 2-59 O ld Station (L eft ) .......................................................................... 2-44...TE~M V. HT.CKY. 2 - iSAY.806] EQUIP, TAP T AFSAM-339 AIif--/ F-G- - CKT. 11 T___AV-4 IN ELMER AREA FiT-5/001 CKT. 5a-- CKT. 5 b- Figure 2-164...AFSAM-339 A 4a NAN-AV-4 UNCLASSIFIED VOICE ANIC46 NAN-AV- 4 UNCLASSIFIED VOICE ANTC AN/ICC 50AV-4- TAP UNCLASSIFIED VOICE [ 3AWYTR-C]5 AV.4-IAP
Wang, Chun-Yan; Xu, Ye; Wang, Xu; Guo, Chuang; Wang, Tao; Wang, Zhan-You
2018-04-25
Oxidative stress and neuroinflammation play important roles in the pathology of Alzheimer's disease (AD). Thioredoxin-interacting protein (TXNIP), an endogenous inhibitor of antioxidant thioredoxin, is suspected to be an important modulator of oxidative stress and inflammation. However, the underlying mechanism involved in the abnormal homeostasis of TXNIP-thioredoxin (TrX) in AD pathogenesis remains unclear. Using the Swedish mutant form of APP (APPswe)/PSEN1dE9 transgenic mouse (APP/PS1) and human-derived neuronal cells as model systems, we disclosed the impairment of the nuclear factor erythroid 2-related factor 2 (Nrf2)-TXNIP-TrX signaling in Alzheimer's-like pathology. We observed that the immune staining of TXNIP was increased in postmortem AD brain. The chronic accumulation of inflammatory mediator in neuronal cells facilitates interactions of TXNIP-nucleotide binding oligomerization domain-like receptor family, pyrin domain containing 3 (NLRP3) and NLRP3-ASC, which increases β-amyloid (Aβ) secretion. The antioxidant Dl-3-n-butylphthalide (Dl-NBP) is commonly used for cerebral ischemia treatment. In our study, we elucidated for new mechanisms by which Dl-NBP enhanced TrX activity, suppressed TXNIP, and ameliorated neuronal apoptosis in the APP/PS1 mouse brains. In human glioblastoma A172 cells and neuroblastoma SH-SY5Y cells, we delineated the Dl-NBP-mediated signaling pathways by which Dl-NBP-dependent upregulation of Nrf2 mediated the reciprocal regulation of reducing proinflammatory cytokine and inhibiting Aβ production in the glial and neuronal cells overexpressing APPswe. Our data provide a novel insight into the molecular mechanism that impairments of Nrf2-TXNIP-TrX system may be involved in the imbalance of cellular redox homeostasis and inflammatory damage in the AD brain. Dl-NBP treatment could suppress TXNIP-NLRP3 interaction and inhibit NLRP3 inflammasome activation via upregulating Nrf2. These findings may provide an instrumental therapeutic
Desempenho de vacas Charolês e Nelore desterneiradas aos três ou sete meses
Directory of Open Access Journals (Sweden)
Restle João
2001-01-01
Full Text Available Foi avaliado o desempenho de vacas Charolês (C e Nelore (N, agrupadas em três classes de idade, jovens (3 e 4 anos, adultas (5 a 7 anos e velhas (8 ou mais anos, desmamadas aos três (precoce ou sete meses no outono (tradicional. O peso no outono das vacas desterneiradas aos três meses (T3 foi 45 kg superior ao das vacas com remoção do bezerro aos sete meses (T7. O estado corporal aos sete meses também foi melhor nas vacas do T3 (3,3 contra 2,1 pontos. Vacas do T3 apresentaram maior ganho de peso do parto ao final do período reprodutivo e apresentaram maiores porcentagem de cio (81 contra 51% e prenhez (67,2 contra 37,3% e menor intervalo do parto ao primeiro cio pós-parto (102 contra 114 dias que vacas do T7. Vacas adultas apresentaram melhor estado corporal aos sete meses e tiveram melhor desempenho reprodutivo do que vacas velhas e jovens. A diferença na porcentagem de prenhez entre o T3 e T7 foi mais evidente nas vacas jovens (42,11 contra 12,5% e velhas (51,72 contra 35,71% que nas adultas (62,50 contra 53,33%. Vacas C foram mais pesadas que as N, ao parto, aos três e sete meses pós-parto e apresentaram melhor estado corporal aos sete meses. O efeito do desmame precoce no desempenho reprodutivo foi mais evidente nas vacas C. A porcentagem de fêmeas prenhes nas C foi de 80,60% para o T3 e 41,90% para o T7, já nas N as porcentagens foram de 45,50 e 30,00%, respectivamente, para o T3 e T7. Nas vacas C, a produção de leite e a amamentação apresentaram efeito inibidor, sobre a reprodução, mais marcante que nas vacas N.
Moskvasse? - Tänan, ei! / Peeter Tulviste
Tulviste, Peeter, 1945-2017
2005-01-01
Autor analüüsib Venemaa poolt Eesti vastu õhkuva vale, vaenu ja laimu põhjuseid ning kiidab heaks president Arnold Rüütli otsuse mitte osaleda 9. mai pidustustel Moskvas. Ilmunud ka Koit, 2005/Mar/12, lk. 6 ; Nädaline, 2005/Mar/15, lk. 5 ; Pärnu Postimees, 2005/Mar/17, lk. 11 ; Hiiu Leht, 2005/Mar/18, lk. 2 ; Meie Maa, 2005/Mar/18, lk. 2
International Nuclear Information System (INIS)
Aldemir, T.; Turgut, H.M.; Bretscher, M.M.; Snelgrove, L.J.
1983-01-01
A study has been made of the feasibility of converting the 5-MW TR-2 reactor at CNAEM to use fuel with uranium enrichment of 3 O 8 -Al fuel meat with a uranium density in the range 2.3 to 3.0 g/cm 3 in the fuel meat with meat thickness varying between 0.9 and 1.00 mm, the number of plates in the LEU element being reduced from 23 in the HEU element to 19 to 20 to maintain adequate cooling. Fuels within this density range are expected to be commercially available within the next two years. From the results of the study it appears to be feasible to safely operate the TR-2 reactor using LEU fuel without increased fuel cycle costs or decreased performance using U 2 O 8 fuels with densities in the 2.3 to 3.0 gU/cm 3 range. (author)
Short TR imaging with refocusing of the steady-state transverse magnetization
International Nuclear Information System (INIS)
Zur, Y.; Stokar, S.; Bendel, P.
1987-01-01
Repetitive application of a sequence with repetition time (TR) shorter than T2 results in a steady state in which the transverse magnetization Mt reaches a nonzero value at the end of the sequence. This value depends on the TR and flip angle as well as on the frequency offset ν of each spin isochromat. The authors present a detailed analysis of the time domain and image domain signals for sequences with short TR that employ gradient reversal echoes. Because of the dependence of Mt on ν, two distinct echos appear in the time domain. With proper adjustment of the view gradients, each echo can be sampled separately. Image intensities derived for spins in a liquid (i.e., T1 -- T2) suggest enhanced signal intensity for the cerebrospinal fluid. This was confirmed experimentally
ORF Alignment: NC_005877 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available lus ... torridus DSM 9790] ... Length = 364 ... Query: 44 ... EPVSVGSYSKGTNLKNSDLDIFIVFSKKYPKNEMESIG...LSLGHYILENGVEKYAEHPYVS 103 ... EPVSVGSYSKGTNLKNSDLDIFIVFSKKYPKNEMESIGLSLGH...YILENGVEKYAEHPYVS Sbjct: 1 ... EPVSVGSYSKGTNLKNSDLDIFIVFSKKYPKNEMESIGLSLGHYILENGVEKYAEHPYVS 60 ... Query: 164 YGS
Synthesis of ternary oxide for efficient photo catalytic conversion of CO2
Wan, Lijuan
2018-01-01
Zn2GeO4 Nan rods were prepared by solution phase route. The morphology and structure of the as-prepared products were characterized by scanning electron microscopy (SEM) and Bruner-Emmett-Teller (BET) surface area measurements. The results revealed that Zn2GeO4 Nan rods with higher surface area have higher photo catalytic activity in photo reduction of CO2 than Zn2GeO4 prepared through solid-state reaction.
Directory of Open Access Journals (Sweden)
Bao Bo-Ying
2011-10-01
Full Text Available Abstract Background Successful reproductive efforts require the establishment of a situation favorable for reproduction that requires integration of both behavior and internal physiological events. TR4 nuclear receptor is known to be involved in male fertility via controlling spermatogenesis, yet its roles in regulating other biological events related to reproduction have not been completely revealed. Methods Male TR4 knockout (TR4-/- and wild type mice were used for the sexual behavior and penile dysfunction studies. Mice were sacrificed for histological examination and corresponding genes profiles were analyzed by quantitative RT-PCR. Reporter gene assays were performed. Results We describe an unexpected finding of priapism in TR4-/- mice. As a transcriptional factor, we demonstrated that TR4 transcriptionally modulates a key enzyme regulating penis erection and neuronal nitric oxide synthese NOS (nNOS. Thereby, elimination of TR4 results in nNOS reduction in both mRNA and protein levels, consequently may lead to erectile dysfunction. In addition, male TR4-/- mice display defects in sexual and social behavior, with increased fear or anxiety, as well as reduced mounting, intromission, and ejaculation. Reduction of ER alpha, ER beta, and oxytocin in the hypothalamus may contribute to defects in sexual behavior and stress response. Conclusions Together, these results provide in vivo evidence of important TR4 roles in penile physiology, as well as in male sexual behavior. In conjunction with previous finding, TR4 represents a key factor that controls male fertility via regulating behavior and internal physiological events.
Nanoporous amide networks based on tetraphenyladamantane for selective CO2capture
Zulfiqar, Sonia; Mantione, Daniele; El Tall, Omar; Sarwar, Muhammad Ilyas; Ruipé rez, Fernando; Rothenberger, Alexander; Mecerreyes, David
2016-01-01
Reduction of anthropogenic CO2 emissions and CO2 separation from post-combustion flue gases are among the imperative issues in the spotlight at present. Hence, it is highly desirable to develop efficient adsorbents for mitigating climate change with possible energy savings. Here, we report the design of a facile one pot catalyst-free synthetic protocol for the generation of three different nitrogen rich nanoporous amide networks (NANs) based on tetraphenyladamantane. Besides the porous architecture, CO2 capturing potential and high thermal stability, these NANs possess notable CO2/N2 selectivity with reasonable retention while increasing the temperature from 273 K to 298 K. The quantum chemical calculations also suggest that CO2 interacts mainly in the region of polar amide groups (-CONH-) present in NANs and this interaction is much stronger than that with N2 thus leading to better selectivity and affirming them as promising contenders for efficient gas separation. © The Royal Society of Chemistry 2016.
Nanoporous amide networks based on tetraphenyladamantane for selective CO2capture
Zulfiqar, Sonia
2016-04-19
Reduction of anthropogenic CO2 emissions and CO2 separation from post-combustion flue gases are among the imperative issues in the spotlight at present. Hence, it is highly desirable to develop efficient adsorbents for mitigating climate change with possible energy savings. Here, we report the design of a facile one pot catalyst-free synthetic protocol for the generation of three different nitrogen rich nanoporous amide networks (NANs) based on tetraphenyladamantane. Besides the porous architecture, CO2 capturing potential and high thermal stability, these NANs possess notable CO2/N2 selectivity with reasonable retention while increasing the temperature from 273 K to 298 K. The quantum chemical calculations also suggest that CO2 interacts mainly in the region of polar amide groups (-CONH-) present in NANs and this interaction is much stronger than that with N2 thus leading to better selectivity and affirming them as promising contenders for efficient gas separation. © The Royal Society of Chemistry 2016.
11 CFR 102.11 - Petty cash fund (2 U.S.C. 432(h)(2)).
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Petty cash fund (2 U.S.C. 432(h)(2)). 102.11 Section 102.11 Federal Elections FEDERAL ELECTION COMMISSION GENERAL REGISTRATION, ORGANIZATION, AND... and Congressional district) sought by such candidate. ...
Síndrome de Isaacs: relato de três casos
Directory of Open Access Journals (Sweden)
SCOLA ROSANA HERMÍNIA
1999-01-01
Full Text Available Relatamos três casos de síndrome de Isaacs, que apresentavam mioquímia clínica, cãibras, dificuldades para o relaxamento muscular, hipertrofia muscular e aumento da sudorese. A eletromiografia de agulha mostrou atividade muscular contínua involuntária, caracterizada como descargas mioquímicas. Os estudos da condução nervosa foram normais. Biópsia de músculo, realizado nos três casos, mostrou atrofia de fibras do tipo 2. Dois casos apresentaram melhora clínica com a utilização de carbamazepina e um com prednisona.
Tallinna linna- ja gümnaasiumi trükikoda ehk 380 aastat trükikunsti Tallinnas / Aija Sakova-Merivee
Sakova-Merivee, Aija, 1980-
2015-01-01
Alanud aasta alguses esitlesid Tallinna Ülikooli Akadeemiline Raamatukogu ja Tallinna Linnaarhiiv ühist trükist „Tallinna linna- ja gümnaasiumi trükikoda (1634–1828). Näituse kataloog”. Autor annab ülevaate nii näitusest kui selle kataloogist
Czech Academy of Sciences Publication Activity Database
Šimková, Ludmila; Liška, F.; Ludvík, Jiří
2011-01-01
Roč. 15, č. 17 (2011), s. 2983-2995 ISSN 1385-2728 R&D Projects: GA ČR GAP206/11/0727; GA MŠk ME09002 Institutional research plan: CEZ:AV0Z40400503 Keywords : 1,1-diamino-2,2-dinitroethene * FOX-7 * DADNE Subject RIV: CG - Electrochemistry Impact factor: 3.064, year: 2011
Involvement of TR3/Nur77 translocation to the endoplasmic reticulum in ER stress-induced apoptosis
International Nuclear Information System (INIS)
Liang Bin; Song Xuhong; Liu Gefei; Li Rui; Xie Jianping; Xiao Lifeng; Du Mudan; Zhang Qiaoxia; Xu Xiaoyuan; Gan Xueqiong; Huang Dongyang
2007-01-01
Nuclear orphan receptor TR3/Nur77/NGFI-B is a novel apoptotic effector protein that initiates apoptosis largely by translocating from the nucleus to the mitochondria, causing the release of cytochrome c. However, it is possible that TR3 translocates to other organelles. The present study was designed to determine the intracellular localization of TR3 following CD437-induced nucleocytoplasmic translocation and the mechanisms involved in TR3-induced apoptosis. In human neuroblastoma SK-N-SH cells and human esophageal squamous carcinoma EC109 and EC9706 cells, 5 μM CD437 induced translocation of TR3 to the endoplasmic reticulum (ER). This distribution was confirmed by immunofluorescence analysis, subcellular fractionation analysis and coimmunoprecipitation analysis. The translocated TR3 interacted with ER-targeting Bcl-2; initiated an early release of Ca 2+ from ER; resulted in ER stress and induced apoptosis through ER-specific caspase-4 activation, together with induction of mitochondrial stress and subsequent activation of caspase-9. Our results identified a novel distribution of TR3 in the ER and defined two parallel mitochondrial- and ER-based pathways that ultimately result in apoptotic cell death
Dose assessment around TR-2 reactor due to maximum credible accident
International Nuclear Information System (INIS)
Turgut, M. H.; Adalioglu, U.; Aytekin, A.
2001-01-01
The revision of safety analysis report of TR-2 research reactor had been initiated in 1995. The whole accident analysis and accepted scenario for maximum credible accident has been revised according to the new safety concepts and the impact to be given to the environment due to this scenario has been assessed. This paper comprises all results of these calculations. The accepted maximum credible accident scenario is the partial blockage of the whole reactor core which resulted in the release of 25% of the core inventory. The DOSER code which uses very conservative modelling of atmospheric distributions were modified for the assessment calculations. Pasquill conditions based on the local weather observations, topography, and building affects were considered. The thyroid and whole body doses for 16 sectors and up to 10 km of distance around CNAEM were obtained. Release models were puff and a prolonged one of two hours of duration. Release fractions for the active isotopes were chosen from literature which were realistic
Neuroblastomicose: registro de três casos
Directory of Open Access Journals (Sweden)
Ehrenfried O. Wittig
1968-03-01
Full Text Available São relatados três casos de neuroblastomicose de sintomatologia variada (urna forma tumoral cerebelar, urna forma abscedante troncular e cerebral e urna forma granulomatosa difusa. No caso da forma tumoral cerebelar havia associação com cisticercose cerebral. Alterações medulares não foram evidenciadas no único caso em que foi possível examinar êste setor do sistema nervoso central (caso 2.
Kronisk træthedssyndrom, en usynlig sygdom?
DEFF Research Database (Denmark)
Jentoft Olsen, Rikke Katrine; Martlev, Lasse; Fernandez Guerra, Paula
2018-01-01
Seahorse XF-teknologi kan måle cellers evne til at producere energi under stress og afslører dysfunktionelle energisystemer i kronisk træthedssyndrom......Seahorse XF-teknologi kan måle cellers evne til at producere energi under stress og afslører dysfunktionelle energisystemer i kronisk træthedssyndrom...
Probiotic Bifidobacterium breve induces IL-10-producing Tr1 cells in the colon.
Directory of Open Access Journals (Sweden)
Seong Gyu Jeon
Full Text Available Specific intestinal microbiota has been shown to induce Foxp3(+ regulatory T cell development. However, it remains unclear how development of another regulatory T cell subset, Tr1 cells, is regulated in the intestine. Here, we analyzed the role of two probiotic strains of intestinal bacteria, Lactobacillus casei and Bifidobacterium breve in T cell development in the intestine. B. breve, but not L. casei, induced development of IL-10-producing Tr1 cells that express cMaf, IL-21, and Ahr in the large intestine. Intestinal CD103(+ dendritic cells (DCs mediated B. breve-induced development of IL-10-producing T cells. CD103(+ DCs from Il10(-/-, Tlr2(-/-, and Myd88(-/- mice showed defective B. breve-induced Tr1 cell development. B. breve-treated CD103(+ DCs failed to induce IL-10 production from co-cultured Il27ra(-/- T cells. B. breve treatment of Tlr2(-/- mice did not increase IL-10-producing T cells in the colonic lamina propria. Thus, B. breve activates intestinal CD103(+ DCs to produce IL-10 and IL-27 via the TLR2/MyD88 pathway thereby inducing IL-10-producing Tr1 cells in the large intestine. Oral B. breve administration ameliorated colitis in immunocompromised mice given naïve CD4(+ T cells from wild-type mice, but not Il10(-/- mice. These findings demonstrate that B. breve prevents intestinal inflammation through the induction of intestinal IL-10-producing Tr1 cells.
Probiotic Bifidobacterium breve induces IL-10-producing Tr1 cells in the colon.
Jeon, Seong Gyu; Kayama, Hisako; Ueda, Yoshiyasu; Takahashi, Takuya; Asahara, Takashi; Tsuji, Hirokazu; Tsuji, Noriko M; Kiyono, Hiroshi; Ma, Ji Su; Kusu, Takashi; Okumura, Ryu; Hara, Hiromitsu; Yoshida, Hiroki; Yamamoto, Masahiro; Nomoto, Koji; Takeda, Kiyoshi
2012-01-01
Specific intestinal microbiota has been shown to induce Foxp3(+) regulatory T cell development. However, it remains unclear how development of another regulatory T cell subset, Tr1 cells, is regulated in the intestine. Here, we analyzed the role of two probiotic strains of intestinal bacteria, Lactobacillus casei and Bifidobacterium breve in T cell development in the intestine. B. breve, but not L. casei, induced development of IL-10-producing Tr1 cells that express cMaf, IL-21, and Ahr in the large intestine. Intestinal CD103(+) dendritic cells (DCs) mediated B. breve-induced development of IL-10-producing T cells. CD103(+) DCs from Il10(-/-), Tlr2(-/-), and Myd88(-/-) mice showed defective B. breve-induced Tr1 cell development. B. breve-treated CD103(+) DCs failed to induce IL-10 production from co-cultured Il27ra(-/-) T cells. B. breve treatment of Tlr2(-/-) mice did not increase IL-10-producing T cells in the colonic lamina propria. Thus, B. breve activates intestinal CD103(+) DCs to produce IL-10 and IL-27 via the TLR2/MyD88 pathway thereby inducing IL-10-producing Tr1 cells in the large intestine. Oral B. breve administration ameliorated colitis in immunocompromised mice given naïve CD4(+) T cells from wild-type mice, but not Il10(-/-) mice. These findings demonstrate that B. breve prevents intestinal inflammation through the induction of intestinal IL-10-producing Tr1 cells.
11 CFR 100.11 - State (2 U.S.C. 431(12)).
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false State (2 U.S.C. 431(12)). 100.11 Section 100.11 Federal Elections FEDERAL ELECTION COMMISSION GENERAL SCOPE AND DEFINITIONS (2 U.S.C. 431) General Definitions § 100.11 State (2 U.S.C. 431(12)). State means each State of the United States, the District of...
Monitoração de tráfego par-a-par em tempo real
Tiago Alves Macambira
2005-01-01
O tráfego devido a aplicações P2P tem aumentado consideravelmente nos últimos anos e, apesar de ser hoje o responsável pela maior parte de todo o tráfego da Internet, não existem muitas ferramentas que auxiliem na monitoração e portanto no entendimento desse tráfego, tanto sob um ponto de vista acadêmico como sob um ponto de vista prático. Nesse trabalho abordamos as dificuldades em se construir umasolução que viabilize a análise e a caracterização de tráfego de aplicações em tempo real, tend...
National Oceanic and Atmospheric Administration, Department of Commerce — Surface temperatures and salinities were collected in the Barents Sea, Sea of Japan, North Atlantic Ocean, Philippine Sea, Red Sea, and South China Sea (Nan Hai)...
A ironia trágica de Machado de Assis
Directory of Open Access Journals (Sweden)
Patrick Pessoa
2007-04-01
Full Text Available O texto defende, a partir de uma análise das Memórias póstumas de Brás Cubas, de Machado de Assis, que a ironia do autor deve ser lida como uma espécie de ironia trágica. A fundamentação dessa hipótese é realizada em três etapas: na primeira, apresenta-se o conceito de ironia trágica, como tematizado por Christoph Menke e Wayne Booth; na segunda, mostra-se como a noção de ironia trágica permite compreender a célebre definição de Lukács de que “a ironia é a objetividade do romance”; finalmente, o texto discute como o conceito de ironia trágica ao mesmo tempo esclarece e subverte as interpretações tradicionais da obra de Machado de Assis.
Aasta trükise 2000 võitjad selgunud
2000-01-01
Rahvusvaheline žürii valis välja 6 raamatut, reklaam- ja väiketrükist ning etiketiseeria. Parimad trükised, trükikojad, kujundajad. Publikuauhinna võitsid üliõpilased Terje Homutov, Monika Eensalu, Tim Kolk
TR146 cells grown on filters as a model of human buccal epithelium
DEFF Research Database (Denmark)
Mørck Nielsen, H; Rømer Rassing, M; Nielsen, Hanne Mørck
2000-01-01
cell culture model, and human and porcine buccal epithelium were compared. The esterase activity in the intact cell culture model and in the porcine buccal mucosa was compared. Further, the TR146 cell culture model was used to study the permeability rate and metabolism of leu-enkephalin. The activity...... of the three enzymes in the TR146 homogenate supernatants was in the same range as the activity in homogenate supernatants of human buccal epithelium. In the TR146 cell culture model, the activity of aminopeptidase (13.70+/-2.10 nmol/min per mg protein) was approx. four times the activity of carboxypeptidase...
Air quality assessment by contingent valuation in Ji'nan, China.
Wang, Yan; Zhang, Yi-Sheng
2009-02-01
Along with urbanization and environmental deterioration within China, many residents' desire for improved air quality has increased. To address this topic, this study focuses on the relationship between poor air quality and residents' willingness to pay for improved air quality in the city of Ji'nan. As a means of quantifying an individual's willingness to pay (WTP) for improved air quality, a contingent valuation method (CVM) was employed. A sample of 1500 residents was chosen, based on the stratified sampling method. The respondents' WTP was then elicited through a series of face-to-face interviews, conducted using a range of hypothetical, open-ended scenario questions. The results showed that 59.7% of respondents were able to express a positive WTP, and that the average WTP was 100 Chinese Yuan (CNY) per person, per year. In order to establish the relationship between endogenous variables and WTP, both a Probit model on the probability of a positive WTP, and a stepwise regression model were constructed. Most parameters in the econometric analysis demonstrated the expected results. It was found that annual household income, expenditure on the treatment of respiratory diseases and workers in the family significantly influenced WTP. The rates of positive WTP and the monetary amount were also larger for men than for women. Unlike developed countries, most respondents regard air quality improvement as a government responsibility in that more than 40% of respondents had no incentive to bear the costs of attempting to achieve better air quality, indicating a relatively low environmental consciousness.
Lee, N-Y; Choi, H-M; Kang, Y-S
2009-04-01
Choline is an essential nutrient for phospholipids and acetylcholine biosynthesis in normal development of fetus. In the present study, we investigated the functional characteristics of choline transport system and inhibitory effect of cationic drugs on choline transport in rat conditionally immortalized syncytiotrophoblast cell line (TR-TBT). Choline transport was weakly Na(+) dependent and significantly influenced by extracellular pH and by membrane depolarization. The transport process of choline is saturable with Michaelis-Menten constants (K(m)) of 68microM and 130microM in TR-TBT 18d-1 and TR-TBT 18d-2 respectively. Choline uptake in the cells was inhibited by unlabeled choline and hemicholinium-3 as well as various organic cations including guanidine, amiloride and acetylcholine. However, the prototypical organic cation tetraethylammonium and cimetidine showed very little inhibitory effect of choline uptake in TR-TBT cells. RT-PCR revealed that choline transporter-like protein 1 (CTL1) and organic cation transporter 2 (OCT2) are expressed in TR-TBT cells. The transport properties of choline in TR-TBT cells were similar or identical to that of CTL1 but not OCT2. CTL1 was also detected in human placenta. In addition, several cationic drugs such as diphenhydramine and verapamil competitively inhibited choline uptake in TR-TBT 18d-1 with K(i) of 115microM and 55microM, respectively. Our results suggest that choline transport system, which has intermediate affinity and weakly Na(+) dependent, in TR-TBT seems to occur through a CTL1 and this system may have relevance with the uptake of pharmacologically important organic cation drugs.
Regulation of mitosis-meiosis transition by the ubiquitin ligase β-TrCP in male germ cells.
Nakagawa, Tadashi; Zhang, Teng; Kushi, Ryo; Nakano, Seiji; Endo, Takahiro; Nakagawa, Makiko; Yanagihara, Noriko; Zarkower, David; Nakayama, Keiko
2017-11-15
The mitosis-meiosis transition is essential for spermatogenesis. Specific and timely downregulation of the transcription factor DMRT1, and consequent induction of Stra8 expression, is required for this process in mammals, but the molecular mechanism has remained unclear. Here, we show that β-TrCP, the substrate recognition component of an E3 ubiquitin ligase complex, targets DMRT1 for degradation and thereby controls the mitosis-meiosis transition in mouse male germ cells. Conditional inactivation of β-TrCP2 in male germ cells of β-TrCP1 knockout mice resulted in sterility due to a lack of mature sperm. The β-TrCP-deficient male germ cells did not enter meiosis, but instead underwent apoptosis. The induction of Stra8 expression was also attenuated in association with the accumulation of DMRT1 at the Stra8 promoter in β-TrCP-deficient testes. DMRT1 contains a consensus β-TrCP degron sequence that was found to bind β-TrCP. Overexpression of β-TrCP induced the ubiquitylation and degradation of DMRT1. Heterozygous deletion of Dmrt1 in β-TrCP-deficient spermatogonia increased meiotic cells with a concomitant reduction of apoptosis. Collectively, our data indicate that β-TrCP regulates the transition from mitosis to meiosis in male germ cells by targeting DMRT1 for degradation. © 2017. Published by The Company of Biologists Ltd.
Directory of Open Access Journals (Sweden)
Benedikt B Kaufer
2011-10-01
Full Text Available Telomerase reverse transcriptase (TERT and telomerase RNA (TR represent the enzymatically active components of telomerase. In the complex, TR provides the template for the addition of telomeric repeats to telomeres, a protective structure at the end of linear chromosomes. Human TR with a mutation in the template region has been previously shown to inhibit proliferation of cancer cells in vitro. In this report, we examined the effects of a mutation in the template of a virus encoded TR (vTR on herpesvirus-induced tumorigenesis in vivo. For this purpose, we used the oncogenic avian herpesvirus Marek's disease virus (MDV as a natural virus-host model for lymphomagenesis. We generated recombinant MDV in which the vTR template sequence was mutated from AATCCCAATC to ATATATATAT (vAU5 by two-step Red-mediated mutagenesis. Recombinant viruses harboring the template mutation replicated with kinetics comparable to parental and revertant viruses in vitro. However, mutation of the vTR template sequence completely abrogated virus-induced tumor formation in vivo, although the virus was able to undergo low-level lytic replication. To confirm that the absence of tumors was dependent on the presence of mutant vTR in the telomerase complex, a second mutation was introduced in vAU5 that targeted the P6.1 stem loop, a conserved region essential for vTR-TERT interaction. Absence of vTR-AU5 from the telomerase complex restored virus-induced lymphoma formation. To test if the attenuated vAU5 could be used as an effective vaccine against MDV, we performed vaccination-challenge studies and determined that vaccination with vAU5 completely protected chickens from lethal challenge with highly virulent MDV. Taken together, our results demonstrate 1 that mutation of the vTR template sequence can completely abrogate virus-induced tumorigenesis, likely by the inhibition of cancer cell proliferation, and 2 that this strategy could be used to generate novel vaccine candidates
Cross check of the new economic and mass balance feature of the fuel cycle scenario code TR-EVOL
International Nuclear Information System (INIS)
Merino-Rodriguez, I.; Garcia-Martinez, M.; Alvarez-Velarde, F.; Lopez, D.
2016-01-01
Versatile computational tools with up to date capabilities are needed to assess current nuclear fuel cycles or the transition from the current status of the fuel cycle to the more advanced and sustainable ones. The TR-EVOL module, that is devoted to fuel cycle mass balance, simulates diverse nuclear power plants (PWR, SFR, ADS, etc.), having possibly different types of fuels (UO_2, MOX, etc.), and the associated fuel cycle facilities (enrichment, fuel fabrication, processing, interim storage, waste storage, geological disposal). This work is intended to cross check the new capabilities of the fuel cycle scenario code TR-EVOL.This process has been divided in 2 stages. The first stage is dedicated to check the improvements in the nuclear fuel mass balance estimation using the available data for the Spanish nuclear fuel cycle. The second stage has been focused in verifying the validity of the TR-EVOL economic module, comparing results to data published by the ARCAS EU project. A specific analysis was required to evaluate the back-end cost. Data published by the waste management responsible institutions was used for the validation of the methodology. Results were highly satisfactory for both stages. In particular, the economic assessment provides a difference smaller than 3% regarding results published by the ARCAS project (NRG estimations). Furthermore, concerning the back-end cost, results are highly acceptable (7% difference for a final disposal in a once-through scenario and around 11% for a final disposal in a reprocessing strategy) given the significant uncertainties involved in design concepts and related unit costs. (authors)
Catalytic conversion of 11CO2 and 11CO into synthesis precursors for 11C labelling
International Nuclear Information System (INIS)
Patt, J.T.
1994-03-01
The positron emitter carbon-11 (T 1/2 =20.3 min) is an ideal radio nuclide for tracers in positron emission tomography (PET). In this study catalytic methods for the synthesis of [ 11 C]alcohols have been investigated. The formation of [ 11 C]methanol has been studied on Pd/Al 2 O 3 and Cu/ZnO/Al 2 O 3 catalysts with respect to CO and CO 2 carrier addition to the synthesis gas. Carbon monoxide was identified as the precursor of methanol formation on the Pd/Al 2 O 3 -catalyst. In contrast on the Cu/ZnO/Al 2 O 3 -catalyst methanol was formed on a reaction pathway via an adsorbed CO 2 -species. A n.c.a.-[ 11 C]methanol synthesis basing on the Cu/ZnO/Al 2 O 3 -catalyst has been developed by substitution of the oxygen containing components CO and CO 2 in the synthesis gas by N 2 O. The radiochemical yield, the low selectivity of [ 11 C]methanol production and the rather slow kinetics of this process were arguments against the practical use of this process in the synthesis of 11 C-labelling agents. (orig.)
Directory of Open Access Journals (Sweden)
Rafael da Costa Sotero
2011-04-01
Full Text Available OBJETIVO: Analisar a possibilidade de se determinar a velocidade de lactato mínimo (LM em corredores adolescentes utilizando-se apenas três estágios incrementais. MÉTODOS: Onze indivíduos (13,7 ± 1,0 anos; 47,3 ± 12,1kg; 160,0 ± 1,0cm; 18,3 ± 1,8kg/m² realizaram três testes de corrida em pista de atletismo em dias distintos: 1 desempenho de 3.000m (Vm3.000; 2 teste de LM que consistiu de um sprint de 500m para indução a hiperlactatemia, seguido de 10min de recuperação e seis séries de 800m em intensidades de 83, 86, 89, 92, 95 e 98% da Vm3.000; 3 teste de LM com três estágios (LMp3 semelhante ao protocolo anterior, porém, com três séries de 800m em intensidades de 83, 89 e 98% da Vm3.000. Durante o primeiro minuto de recuperação entre os estágios dos testes dois e três foram coletadas amostras de sangue para dosagem de lactato sanguíneo. Para determinação do LM foram empregadas: a inspeção visual (LM e b função polinomial de segunda ordem para identificar o LM em seis estágios (LMp e três estágios (LMp3. RESULTADOS: ANOVA demonstrou não haver diferenças entre as velocidades de lactato mínimo (m.min-1 identificadas pelos diferentes métodos (LM = 221,7 ± 15,4 vs. LMp = 227,1 ± 10,8 vs. LMp3 = 224,1 ± 11,2;. Altas correlações foram observadas entre os protocolos estudados e destes com a Vm3.000 (p < 0,01. CONCLUSÃO: Foi possível identificar a velocidade de corrida correspondente ao LM em adolescentes mesmo utilizando-se de apenas três estágios incrementais (LMp3.
Directory of Open Access Journals (Sweden)
Moe Kyaw Thu
2008-07-01
Full Text Available The Nankai Trough Seismogenic Zone Experiment (NanTroSEIZE is a multi-expedition IODP drilling project aimed at drilling, coring, logging, and instrumenting the seismogenic zone of an active subduction margin , in a region thought to generate megathrust earthquakes of magnitude >8.0 on the moment-magnitude scale (Tobin and Kinoshita, 2006. The Nankai Trough, offshore of the Kii Peninsula, Honshu, Japan (Fig. 1 was chosen as the location for thisproject based on a number of scientific drilling proposals to IODP. These reviewed existing drilling data in the region, the long-term historical and recent record of great earthquakes, the social and societal relevance of the area, and the accessibility of the seismogenic zone to present drilling technology. The first stage of this multi-stage project was intended to accomplish a broad characterization of the shallow geology, geophysics, physical properties, heat flow, and fluid flow in a transect across the downgoing Philippine Sea Plate, the toe of the Nankai accretionary prism, the megasplay fault zone region on the continental slope, and the Kumano Basin that lies between the accretionary prism and the KiiPeninsula, on the continental shelf (Fig. 2.
Directory of Open Access Journals (Sweden)
Fernando R. Spilki
2004-09-01
Full Text Available This study aimed the in vitro growth characterization of a previously constructed Brazilian bovine herpesvirus 1.2a with a deletion in the glycoprotein E gene (BHV-1.2a gE-. The plaque sizes, penetration and growth kinetics of the Brazilian BHV-1.2a gE- were studied and compared with the parental virus, as well as with a BHV-1.1 gE- recombinant derived from an European BHV-1.1 strain. No statistical differences were observed between the gE- recombinants and the respective parental viruses penetration assays were performed. When single step growth curves were studied, no statistical differences were observed between gE- and parental viruses. However, it was observed that both gE- viruses were excreted from cells in significantly higher titres at 11 hours post infection in comparison with parental viruses. No statistical differences were observed when plaque sizes of parental viruses or gE- viruses we analyzed separately in each cell type. However, both gE- recombinants displayed a significantly reduced plaque areas on three different cell cultures, in comparison with parental viruses, indicating that the lack of gE had the same effect on both BHV-1 subtypes, manifested by a restricted cell-to-cell spread in infected cells.O presente estudo teve como objetivo a caracterização das propriedades de crescimento in vitro de uma amostra brasileira de herpesvírus bovino tipo 1.2a que apresenta uma deleção no gene que codifica a glicoproteína E (BHV-1.2a gE-. Os tamanhos de placa, cinética de penetração e cinética de multiplicação do vírus BHV-1.2a gE- foram estudados e comparados com o vírus parental, bem como com um vírus BHV-1.1 gE- recombinante, o qual é derivado de uma amostra européia de BHV-1.1. Em termos de cinética de penetração, não foram observadas diferenças significativas quando comparados os vírus gE- com os parentais. A determinação da cinética de multiplicação não demonstrou diferenças significativas entre os
19 CFR 11.2 - Manufactured tobacco.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Manufactured tobacco. 11.2 Section 11.2 Customs... PACKING AND STAMPING; MARKING Packing and Stamping § 11.2 Manufactured tobacco. (a) If the invoice and entry presented for manufactured tobacco specify all the information necessary for prompt determination...
29 CFR 2.11 - General principles.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true General principles. 2.11 Section 2.11 Labor Office of the Secretary of Labor GENERAL REGULATIONS Audiovisual Coverage of Administrative Hearings § 2.11 General principles. The following general principles will be observed in granting or denying requests for permission...
TrED: the Trichophyton rubrum Expression Database
Directory of Open Access Journals (Sweden)
Liu Tao
2007-07-01
Full Text Available Abstract Background Trichophyton rubrum is the most common dermatophyte species and the most frequent cause of fungal skin infections in humans worldwide. It's a major concern because feet and nail infections caused by this organism is extremely difficult to cure. A large set of expression data including expressed sequence tags (ESTs and transcriptional profiles of this important fungal pathogen are now available. Careful analysis of these data can give valuable information about potential virulence factors, antigens and novel metabolic pathways. We intend to create an integrated database TrED to facilitate the study of dermatophytes, and enhance the development of effective diagnostic and treatment strategies. Description All publicly available ESTs and expression profiles of T. rubrum during conidial germination in time-course experiments and challenged with antifungal agents are deposited in the database. In addition, comparative genomics hybridization results of 22 dermatophytic fungi strains from three genera, Trichophyton, Microsporum and Epidermophyton, are also included. ESTs are clustered and assembled to elongate the sequence length and abate redundancy. TrED provides functional analysis based on GenBank, Pfam, and KOG databases, along with KEGG pathway and GO vocabulary. It is integrated with a suite of custom web-based tools that facilitate querying and retrieving various EST properties, visualization and comparison of transcriptional profiles, and sequence-similarity searching by BLAST. Conclusion TrED is built upon a relational database, with a web interface offering analytic functions, to provide integrated access to various expression data of T. rubrum and comparative results of dermatophytes. It is devoted to be a comprehensive resource and platform to assist functional genomic studies in dermatophytes. TrED is available from URL: http://www.mgc.ac.cn/TrED/.
Ma, Xiaohua
2017-07-24
Two novel carbocyclic pseudo-Tröger’s base-derived dianhydrides, 5,6,11,12-tetrahydro-5,11-methanodibenzo[a,e][8]annulene-2,3,8,9-tetracarboxylic anhydride (CTB1) and its dione-substituted analogue 6,12-dioxo-5,6,11,12-tetrahydro-5,11-methanodibenzo[a,e][8]annulene-2,3,8,9-tetracarboxylic dianhydride (CTB2), were made and used for the synthesis of soluble polyimides of intrinsic microporosity with 3,3′-dimethylnaphthidine (DMN). The polyimides CTB1-DMN and CTB2-DMN exhibited excellent thermal stability of ∼500 °C and high BET surface areas of 580 and 469 m2 g–1, respectively. A freshly made dione-substituted CTB2-DMN membrane demonstrated promising gas separation performance with O2 permeability of 206 barrer and O2/N2 selectivity of 5.2. A higher O2 permeability of 320 barrer and lower O2/N2 selectivity of 4.2 were observed for a fresh CTB1-DMN film due to its higher surface area and less tightly packed structure as indicated by weaker charge-transfer complex interactions. Physical aging over 60 days resulted in reduction in gas permeability and moderately enhanced selectivity. CTB2-DMN exhibited notable performance with gas permeation data located between the 2008 and 2015 permeability/selectivity upper bounds for O2/N2 and H2/CH4.
Whole grain intakes in Irish adults: findings from the National Adults Nutrition Survey (NANS).
O'Donovan, Clare B; Devlin, Niamh F; Buffini, Maria; Walton, Janette; Flynn, Albert; Gibney, Michael J; Nugent, Anne P; McNulty, Breige A
2018-01-20
Observational studies link high whole grain intakes to reduced risk of many chronic diseases. This study quantified whole grain intakes in the Irish adult population and examined the major contributing sources. It also investigated potential dietary strategies to improve whole grain intakes. Whole grain intakes were calculated in a nationally representative sample of 1500 Irish adults using data from the most recent national food survey, the National Adult Nutrition Survey (NANS). Food consumption was assessed, at brand level where possible, using a 4-day semi-weighed food diary with whole grain content estimated from labels on a dry matter basis. Mean daily whole grain intakes were 27.8 ± 29.4 g/day, with only 19% of the population meeting the quantity-specific recommendation of 48 g per day. Wheat was the highest contributor to whole grain intake at 66%, followed by oats at 26%. High whole grain intakes were associated with higher dietary intakes of fibre, magnesium, potassium, phosphorus, and a higher alternative Mediterranean Diet Score. Whole grain foods were most frequently eaten at breakfast time. Regression analysis revealed that consumption of an additional 10 g of whole grain containing 'ready-to-eat breakfast cereals', 'rice or pastas', or 'breads' each day would increase intake of whole grains by an extra 5, 3.5, and 2.7 g, respectively. This study reveals low intakes of whole grains in Irish adults. Recommending cereals, breads, and grains with higher whole grain content as part of public health campaigns could improve whole grain intakes.
Mortalidad por accidentes de tránsito en Bayamo, Cuba 2011
Directory of Open Access Journals (Sweden)
Arlines Piña-Tornés
Full Text Available Con el objetivo de describir la mortalidad por accidentes de tránsito en Bayamo, Cuba, en el año 2011 se realizó una revisión de los pacientes lesionados y fallecidos a causa de accidentes de tránsito, registrados en Hospital Carlos M. de Céspedes. Se atendieron en emergencias 1365 lesionados, predominando el grupo etario de 25 a 44 años con 372 pacientes (27,3%, y el sexo masculino con 1071 (78,5%. Fallecieron 46 personas, en su mayoría del mismo grupo de edad y de sexo masculino. Los traumatismos múltiples (52,6% y cráneofaciales (34,2% fueron las localizaciones predominantes. Se destacaron los atropellos por vehículo de motor con mortalidad del 26,3%. En conclusión, la mortalidad por accidentes de tránsito predomina en adultos jóvenes masculinos; cuyas consecuencias fatales son debido a traumatismos múltiples por atropellos.
Energy Technology Data Exchange (ETDEWEB)
NONE
2002-02-01
For the purpose of promoting the introduction of new energy and enhancing the awareness of it in Sen'nan City, Osaka Prefecture, an investigational study was conducted of the structure of energy demand, existence amount of new energy, project for new energy introduction, etc. The energy consumption amount of the city in FY 1999 was estimated at 4,971TJ. It consisted of 40.6% in the industrial sector, 29.7% in the transportation sector and 29.6% in the commercial/residential sector. The rate of energy source was 48.8% of petroleum, 32.1% of electric power and 19.1% of gas. As the project for new energy introduction, the following were studied: introduction of photovoltaic power generation and solar heat utilization facilities to the city office/elementary school/junior high school/municipal dwelling houses; street light combinedly using photovoltaic power generation and wind power generation; introduction of clean energy vehicle to official vehicle; preferential treatment for introduction of low-emission car for citizen; introduction of natural gas cogeneration and fuel cell to the city office, etc.; introduction of small-size wind power generation/small- and medium-size hydraulic power generation to public facilities, park, etc.; construction of the waste energy utilization system. (NEDO)
Kompleksnost vzvodov strategije prodajnih poti v izvoznem trženju
Tominc, Polona; Jurše, Milan; Jager, Jerneja
2015-01-01
Distribucije v raziskavi ne obravnavamo zgolj kot ene od sestavin trženjskega spleta podjetja, temveč kot strateško razsežnost razvoja tržne pozicije na izbranih tujih trgih, katere cilj ni zagotoviti zgolj prodajo izdelkov podjetja, temveč ustvariti distribucijski sistem, ki bo podjetju zagotavljal rast prodaje in krepil konkurenčne prednosti na trgu. Na izbranem vzorcu slovenskih proizvodnih podjetij smo preverjali povezanost med izvozno tržno naravnanostjo podjetja, inovativnostjo, odnosi ...
NEK11: linking CHK1 and CDC25A in DNA damage checkpoint signaling
DEFF Research Database (Denmark)
Sørensen, Claus Storgaard; Melixetian, Marina; Klein, Ditte Kjaersgaard
2010-01-01
The DNA damage induced G(2)/M checkpoint is an important guardian of the genome that prevents cell division when DNA lesions are present. The checkpoint prevents cells from entering mitosis by degrading CDC25A, a key CDK activator. CDC25A proteolysis is controlled by direct phosphorylation events...... is required for beta-TrCP mediated CDC25A polyubiquitylation and degradation. The activity of NEK11 is in turn controlled by CHK1 that activates NEK11 via phosphorylation on serine 273. Since inhibition of NEK11 activity forces checkpoint-arrested cells into mitosis and cell death, NEK11 is, like CHK1...
Energy Technology Data Exchange (ETDEWEB)
Supelano, G.I., E-mail: ivan.supelano@uptc.edu.co [Grupo de Superficies Electroquímica y Corrosión, Universidad Pedagógica y Tecnológica de Colombia (Colombia); Sarmiento Santos, A. [Grupo de Superficies Electroquímica y Corrosión, Universidad Pedagógica y Tecnológica de Colombia (Colombia); Parra Vargas, C.A. [Grupo de Física de Materiales, Universidad Pedagógica y Tecnológica de Colombia (Colombia)
2014-12-15
In this work, we report the production of TR{sub 3}Ba{sub 5}Cu{sub 8}O{sub δ} (TR=Ho, Y and Yb) superconducting system using a usual solid state reaction method. The irreversibility line and the analysis of magnetization fluctuations for TR{sub 3}Ba{sub 5}Cu{sub 8}O{sub δ} (TR=Ho, Y and Yb) system were investigated. The curves of magnetization ZFC–FC were measured in magnetic fields of the 100–4000 Oe to obtain the values for T{sup ⁎} and T{sub C} temperatures. The penetration depth and the coherence length parameters as a function of the applied magnetic field were obtained. The data of the magnetization excess ΔM(T, H) was analyzed from the curves of magnetization as a function of logarithm of applied field for different values of temperature in the corresponding range. The Bulavskii, Ledvij and Kogan theory was employed for this purpose which considers fluctuations effects in the free energy and into the equilibrium magnetization.
Mortes no trânsito do Rio de Janeiro, Brasil
Directory of Open Access Journals (Sweden)
Klein Carlos Henrique
1994-01-01
Full Text Available A evolução urbana do município do Rio de Janeiro durante o século XX, especialmente a partir da sua segunda metade, é fortemente marcada por crescentes privilégios concedidos ao crescimento da utilização dos meios de transporte de massa e, principalmente, individuais, feitos por veículos a motor de explosão. Uma das conseqüências desta política é a ascenção da mortalidade por acidentes de trânsito, verificada durante a década de 80, entre homens e mulheres de todas as idades. Neste trabalho demonstra-se também que, em 1990, apenas cerca de 1/3 das vítimas fatais nos acidentes de trânsito estavam "embarcadas" nos veículos. Portanto, a maioria dos óbitos por este tipo de acidente, cerca de 2/3, ocorreu por atropelamentos. Isto indica a necessidade de o poder público reverter a prioridade na prevenção das mortes por acidentes de trânsito em favor de medidas eficazes que protejam os pedestres.
Mortes no trânsito do Rio de Janeiro, Brasil
Directory of Open Access Journals (Sweden)
Carlos Henrique Klein
Full Text Available A evolução urbana do município do Rio de Janeiro durante o século XX, especialmente a partir da sua segunda metade, é fortemente marcada por crescentes privilégios concedidos ao crescimento da utilização dos meios de transporte de massa e, principalmente, individuais, feitos por veículos a motor de explosão. Uma das conseqüências desta política é a ascenção da mortalidade por acidentes de trânsito, verificada durante a década de 80, entre homens e mulheres de todas as idades. Neste trabalho demonstra-se também que, em 1990, apenas cerca de 1/3 das vítimas fatais nos acidentes de trânsito estavam "embarcadas" nos veículos. Portanto, a maioria dos óbitos por este tipo de acidente, cerca de 2/3, ocorreu por atropelamentos. Isto indica a necessidade de o poder público reverter a prioridade na prevenção das mortes por acidentes de trânsito em favor de medidas eficazes que protejam os pedestres.
Canal de Mensagens de Trânsito
Egon Cervieri Guterres
2010-01-01
Informe Setorial: O Canal de Mensagens de Trânsito (Traffic Message Channel - TMC) é uma padronização internacional para a distribuição de informações (conteúdo) sobre a situação do trânsito urbano local e inter-regional, em tempo real, de forma eletrônica e diretamente aos motoristas. Traz para os cidadãos, em mensagens eletrônicas simples e acessíveis, informações sobre congestionamentos, acidentes, obras na pista, problemas climáticos (alagamentos, asfalto escorregadio, nevoeiro...) e desv...
Directory of Open Access Journals (Sweden)
Sean Toczko
2010-09-01
Full Text Available The Nankai Trough Seismogenic Zone Experiment (NanTroSEIZE is a major drilling project designed to investigate fault mechanics and the seismogenic behavior of subduction zone plate boundaries. Expedition 319 is the first riser drilling operation within scientific ocean drilling. Operations included riser drilling at Site C0009 in the forearc basin above the plate boundary fault, non-riser drilling at Site C0010 across the shallow part of the megasplay faultsystem—which may slip during plate boundary earthquakes—and initial drilling at Site C0011 (incoming oceanic plate for Expedition 322. At Site C0009, new methods were tested, including analysis of drill mud cuttings and gas, and in situ measurements of stress, pore pressure, and permeability. These results, in conjunction with earlier drilling, will provide a the history of forearc basin development (including links to growth of the megasplay fault system and modern prism, b the first in situ hydrological measurements of the plate boundary hanging wall, and c integration of in situ stress measurements (orientation and magnitude across the forearc and with depth. A vertical seismic profile (VSP experiment provides improved constraints on the deeper structure of the subduction zone. At Site C0010, logging-while-drilling measurements indicate significantchanges in fault zone and hanging wall properties over short (<5 km along-strike distances, suggesting different burial and/or uplift history. The first borehole observatory instruments were installed at Site C0010 to monitor pressure and temperature within the megasplay fault zone, and methods of deployment of more complex observatoryinstruments were tested for future operations.
Energy Technology Data Exchange (ETDEWEB)
Torres-Huerta, A. M.; Dominguez-Crespo, M. A.; Ramirez-Meneses, E.; Yanez-Zamora, C. [CICATA, IPN, Altamira, Tamaulipas (Mexico); Avila-Garcia, I. [IPN, ESIQIE, UPALM, Mexico, D.F. (Mexico)]. E-mail: mdominguezc@ipn.mx; adcrespo2000@yahoo.com.mx
2009-09-15
At the industrial level, the use of fuel cell technology is still limited because of the high costs of its parts and costs related to its operations. Although the electrode material with greater electroactivity is Pt, because of its high cost, alternative electrocatalysts have been sought that balance cost and activity. One of the materials that have been most widely used is nickel, along with some of its alloys. This material has shown good performance using low overpotentials in traditional reactions such as hydrogen (HER) and oxygen (OER) evolution, as well as high resistance to corrosion and low costs. In particular, binary and ternary alloys have shown significant increases in HER activity when compared to materials in the pure or massive state. Therefore, in the search for new alternatives with acceptable efficiency and low-cost, this work obtained Ni-TR (TR = La, Ce) using solid-state reaction with metallic acetylacetonates and metallic powder. These materials were synthesized for 3 h at different temperatures (795 or 920, 1000 and 1200 degrees Celsius) in order to evaluate the effect on the electrochemical performance of the electrocatalysts. The structural and morphological characterization of materials was performed with XRD and SEM techniques, respectively. In addition, the electrochemical performance of electrode materials was evaluated with HER using cyclic voltametry (CV) and potentiodynamic curves. The results obtained show that a combination of oxides was obtained (NiO, CeO{sub 2} and LaNiO{sub 3}) at low temperatures; nonetheless, as the synthesis temperatures increase, NiO-CeO{sub 2} and NiO-LaNiO{sub 3} alloys are formed, respectively. A clear dependence was also observed between electrocatalytic activity and the source for obtaining these materials(Ni-TR). [Spanish] A nivel industrial, el uso de la tecnologia de celdas de combustible esta todavia limitada debido sobre todo a los altos costos de las partes que la constituyen y los costos
Uhlig, Benjamin Langsæter; Sand, Trond; Odegård, Siv Steinsmo; Hagen, Knut
2014-06-01
Many studies have assessed the prevalence of insomnia, but the influence of non-participants has largely been ignored. The objective of the present study was to estimate the prevalence and associated factors of insomnia in a large adult population using DSM-V (diagnostic and statistical manual of mental disorders, 5th ed.) criteria, also taking non-participants into account. This cross-sectional study used data from a questionnaire in The Nord-Trøndelag Health Study (HUNT 3) performed in 2006-2008, and a subsequent non-participant study. The total adult population (n=93,860 aged > or =20 years) of Nord-Trøndelag County, Norway, was invited. Of these, 40,535 responded to the insomnia questionnaire. Among 42,024 eligible non-participants, 6918 (17%) responded to two insomnia questions. Insomnia was diagnosed by applying modified DSM-V criteria. The age-adjusted insomnia prevalence was estimated using the age distribution of all adult inhabitants of Nord-Trøndelag. Supplementary prevalence data were estimated by extrapolating data from the non-participant study. Additionally, the association between insomnia and self-reported health was estimated, adjusting for known confounders. The total age-adjusted prevalence of insomnia was 7.1% (95% confidence interval [CI], 6.9-7.4) (8.6% for women, 5.5% for men). Adjusting for non-participants, the prevalence estimate changed to 7.9% (95% CI, 7.3-8.6) (9.4% for women, 6.4% for men). Insomnia was more than eight times more likely (OR, 8.3; 95% CI, 6.2-11.1) among individuals with very poor versus very good self-reported health, adjusting for age, gender, employment status, chronic musculoskeletal complaints, anxiety and depression. The adjusted insomnia prevalence estimate in Nord-Trøndelag was 7.9%. Insomnia was strongly associated with poor self-reported health. Copyright © 2014 Elsevier B.V. All rights reserved.
Genetic diversity of the 3ꞌ and 5ꞌ untranslated regions of the ...
African Journals Online (AJOL)
Zuhal GÜNDÜZ
2017-05-18
May 18, 2017 ... Global warming affects climate change negatively, and has become a threat to .... UTR: Untranslated region; Pi: Nucleotide diversity; YGS: Yerli Güney ..... Analysis of heat-shock protein 70 gene polymorphisms and the risk of ...
Czech Academy of Sciences Publication Activity Database
Kosinová, Lucie; Veverka, Václav; Novotná, P.; Collinsová, Michaela; Urbanová, M.; Moody, N. R.; Turkenburg, J. P.; Jiráček, Jiří; Brzozowski, A. M.; Žáková, Lenka
2014-01-01
Roč. 53, č. 21 (2014), s. 3392-3402 ISSN 0006-2960 R&D Projects: GA ČR GPP207/11/P430; GA ČR GAP208/11/0105; GA MŠk(CZ) LK11205 Institutional support: RVO:61388963 Keywords : insulin * structure * N-terminus * B-chain * T/R transition Subject RIV: CE - Biochemistry Impact factor: 3.015, year: 2014
Ma, Xiaohua
2017-12-04
Two intrinsically microporous polyimides (PIM-PIs) were synthesized by the polycondensation reaction of 4,4′-(hexafluoroisopropylidene)diphthalic anhydride (6FDA) and 3,3,3′,3′-tetramethylspirobisindane-6,7,6′,7′-tetracarboxylic dianhydride (SBI) with a newly designed o-hydroxyl-functionalized Tröger’s base diamine, 1,7-diamino-6H,12H-5,11-methanodibenzo[1,5]diazocine-2,8-diol (HTB). Both amorphous PIM-PIs were soluble in aprotic solvents and showed excellent thermal stability with onset decomposition temperature of ∼380 °C. SBI-HTB displayed a higher CO2 permeability (466 vs 67 barrer) than 6FDA-HTB but a significantly lower selectivity for CO2/CH4 (29 vs 73), H2/CH4 (29 vs 181), O2/N2 (4.6 vs 6.0), and N2/CH4 (1 vs 2.5). 6FDA-HTB displayed the highest gas-pair permselectivity values of all reported OH-functionalized PIM-PIs to date. The high permselectivity of 6FDA-HTB resulted primarily from exceptional diffusion selectivity due to strong size-sieving properties caused by hydrogen bonding between the proton of the hydroxyl group and the nitrogen atoms in the tertiary amine of the Tröger’s base (O–H···N).
Risseti, R M; Zastempowska, E; Twarużek, M; Lassa, H; Pantoja, J C F; de Vargas, A P C; Guerra, S T; Bolaños, C A D; de Paula, C L; Alves, A C; Colhado, B S; Portilho, F V R; Tasca, C; Lara, G H B; Ribeiro, M G
2017-08-01
Trueperella pyogenes is an opportunistic pathogen that causes diverse pyogenic infections in livestock. The genes that encode the exotoxin pyolysin (plo) and other putative factors that promote adhesion of pathogen to host cells (fimbriae fimA, fimC, fimE, fimG, neuraminidases nanH, nanP, and collagen-binding protein cbpA) have been associated with virulence, particularly in mastitis and uterus infections of dairy cows. However, the role of these virulence markers in the pathogenicity of the agent in domestic animals infections still is incompletely understood. The genes plo, fimA, fimC, fimE, fimG, nanH, nanP, and cbpA were investigated in 71 T. pyogenes strains recovered from cattle, sheep, goats, dogs, equines, and a pig, recovered from mastitis (n = 35), and non-mastitis (n = 36) cases (abscesses, reproductive tract diseases, pneumonia, lymphadenitis, encephalitis). The most common genes harboured by the isolates were: plo (71/71 = 100·0%), fimA (70/71 = 98·6%), nanP (56/71 = 78·9%), fimE (53/71 = 74·6%), fimC (46/71 = 64·8%) and nanH (45/71 = 63·4%), whereas cbpA (6/71 = 8·4%) and fimG (4/71 = 5·6%) were uncommon. The most frequent genotypes were plo/fimA/fimE/fimC/nanH/nanP (17/71 = 23·9%), plo/fimA/fimE/nanH/nanP (13/71 = 18·3%), and plo/fimA/fimE/fimC/nanP (11/71 = 15·5%). No association was observed between the presence of genes vs clinical signs or host species. To the best of our knowledge, this is the first report on aforementioned virulence factors of pathogen detected in diseased horses and dogs. The role of particular virulence factors of Trueperella pyogenes that determine different pyogenic infections among domestic animals is poorly understood. Eight putative virulence genes and genotype profiles of 71 isolates were investigated among different clinical manifestations in domestic animals. The most common genes were plo (71/71 = 100·0%), fimA (70/71 = 98·6%), nanP (56/71 = 78·9%), fimE (53/71 = 74·6
Avaliação do desenvolvimento motor de escolares com três baterias motoras: EDM, MABC-2 e TGMD-2
Directory of Open Access Journals (Sweden)
Rozana Aparecida da Silveira
2014-10-01
Full Text Available Objetivo: o presente estudo visou avaliar o desempenho das habilidades motoras de crianças com 9 e 10 anos de idade. Método: consistiu em pesquisa qualiquantitativa, de campo, representativa embora não probabilística, descritiva correlacional com delineamento entre e intra participantes conforme os objetivos traçados. Foram avaliados 172 escolares, sendo 67 meninos e 105 meninas, regularmente matriculados. Totalizou 516 coletas, uma vez que cada criança foi avaliada pelas três baterias motoras. Resultados: na análise do desenvolvimento motor das crianças por meio da aplicação das baterias motoras, verificou-se que, segundo a EDM, em geral os participantes apresentaram déficit no desenvolvimento motor geral, com relação à idade cronológica, apresentando idade motora de 109 meses ou aproximadamente 9 anos e obtendo melhor desempenho em organização temporal e desempenho mais fraco em organização espacial, possivelmente em decorrência à dificuldade com a noção de direito-esquerdo. Os meninos apresentaram desempenho superior às meninas em todas as habilidades motoras, exceto em esquema corporal. De acordo com o MABC-2, os participantes classificaram-se na faixa “limítrofe” de desenvolvimento motor, apresentando melhores escores em equilíbrio e escores fracos em destreza manual. Considerações Finais: conforme a classificação do TGMD-2, as crianças obtiveram resultado médio nas habilidades de locomoção e abaixo da média nas habilidades de controle de objetos. Em relação às diferenças entre os sexos, os meninos, de um modo geral, obtiveram melhor desempenho do que as meninas nas três baterias motoras.
Directory of Open Access Journals (Sweden)
Regina Sánchez
2013-06-01
Full Text Available Menidia humboldtiana es una especie nativa muy apreciada por su delicado sabor. Se determinó el espectro trófico, selectividad y solapamiento trófico de ésta, durante 1995 (épocas del año, se obtuvieron muestras de zooplancton e identificaron a nivel genérico. Los peces capturados se agruparon en intervalos de longitud estándar para cada época. Se analizaron los contenidos estomacales (método volumétrico, Laevastu, selectividad (Chesson y solapamiento trófico (Morisita. Se registraron 14 géneros de zooplancton; Bosmina el más abundante (29 625ind/10L seguido por Cyclops (9 496ind/10L ambos en primavera. Los peces pequeños (1-4.9cm consumen a Cyclops en altos porcentajes en primavera e invierno, 61.24-69.82% respectivamente. Ceriodaphnia es consumida por peces de 3-10.9cm y de 13-14.9cm con 72.41-95.5% en verano; en otoño las tallas pequeñas ingieren a Mastigodiaptomus y Ceriodaphnia; Daphnia y Bosmina por peces de 5-8.9cm y los más grandes (9-14.9cm a Ceriodaphnia. M. humboldtiana realiza una depredación selectiva por Ceriodaphnia, Daphnia, Mastigodiaptomus, Bosmina y Cyclops. El solapamiento trófico fue muy marcado entre todas las tallas en primavera, otoño e invierno, a diferencia en verano los peces de 1-2.9 y 11-12.9cm no registraron un solapamiento con otros intervalos de longitud. M. humboldtiana es una especie zooplanctófaga, que realiza una depredación selectiva y un marcado solapamiento trófico entre los intervalos de longitud.
Rapid labelling of radiopharmaceuticals using 11CO2 and 11CH4
International Nuclear Information System (INIS)
Crouzel, C.
1988-07-01
In the past two decades, much effort has been devoted to the development of new molecules, labelled with β+ emitters usable for Positron Emission Tomography. Gaseous forms of 11 C ( 11 CO 2 or 11 CH 4 ) must be converted to a reactive form known as a ''radioactive precursor'': 11 C-methanol, 11 C-formaldehyde, 11 C-acetone, 11 C-phosgene, 11 C-diazomethane, 11 C-methylamine. These precursors are used to label radiopharmaceuticals. Few examples are given: 11 C-prazosin, 11 C-CGP 12177, 11 C-pindolol. Such synthesis procedures require strong initial activity (1.5 Ci). The processes are therefore remotely controlled or automated, and confined to shielded cells. Small laboratory robots have lately been introduced for this type of production
Directory of Open Access Journals (Sweden)
Waleska Antunes da Porciúncula Pereira
2006-09-01
Full Text Available OBJETIVO: identificar as ocorrências atendidas por um serviço de atendimento pré-hospitalar e caracterizar as decorrentes de corte acidente de trânsito em relação ao horário, dia da semana e configuração da equipe envolvida no atendimento. MÉTODOS: estudo descritivo transversal, com análise de 6.430 ocorrências de solicitação de socorro atendidas de julho a setembro de 2003. RESULTADOS: a incidência de trauma foi 35,2% sendo 57,9% decorrentes de acidentes de trânsito. A maioria das ocorrências aconteceu à tarde, em todos os dias da semana. A equipe de suporte básico, constituída por auxiliar ou técnico de enfermagem e motorista, foi a que mais realizou atendimentos (84,5%. A enfermeira participou em 11,2% das ocorrências, sendo 4,3% na equipe de suporte avançado e o médico em 8,3%. CONCLUSÃO: os resultados destacam o envolvimento da equipe de suporte básico no atendimento pré-hospitalar e indicam a necessidade de prevenção desses agravos e de qualificação dos trabalhadores para estruturação do trabalho baseado na interdisciplinaridade.OBJETIVO: identificar las ocurrencias atendidas en un servicio de atención prehospitalaria y caracterizar las consecuentes de accidente de tránsito en relación al horario, día de la semana y configuración del equipo involucrado en la atención. MÉTODOS: estudio descriptivo de corte transversal, con análisis de 6,430 ocurrencias de solicitud de socorro atendidas de julio a septiembre del 2003. RESULTADOS: la incidencia de trauma fue del 35.2% de los cuales 57.9% a causa de accidentes de tránsito. La mayoría de las ocurrencias suceden en la tarde de todos los días de la semana. El equipo de soporte básico, constituido por el auxiliar o técnico de enfermería y el chofer, es el que más atenciones realiza (84.5%. La enfermera participa en el 11.2% de las ocurrencias, siendo un 4.27% en el equipo de soporte avanzado y el médico en el 8.32%. CONCLUSIÓN: Los resultados
The Test Reactor Embrittlement Data Base (TR-EDB)
International Nuclear Information System (INIS)
Stallmann, F.W.; Kam, F.B.K.; Wang, J.A.
1993-01-01
The Test Reactor Embrittlement Data Base (TR-EDB) is part of an ongoing program to collect test data from materials irradiations to aid in the research and evaluation of embrittlement prediction models that are used to assure the safety of pressure vessels in power reactors. This program is being funded by the US Nuclear Regulatory Commission (NRC) and has resulted in the publication of the Power Reactor Embrittlement Data Base (PR-EDB) whose second version is currently being released. The TR-EDB is a compatible collection of data from experiments in materials test reactors. These data contain information that is not obtainable from surveillance results, especially, about the effects of annealing after irradiation. Other information that is only available from test reactors is the influence of fluence rates and irradiation temperatures on radiation embrittlement. The first version of the TR-EDB will be released in fall of 1993 and contains published results from laboratories in many countries. Data collection will continue and further updates will be published
The anti-inflammatory effect of TR6 on LPS-induced mastitis in mice.
Hu, Xiaoyu; Fu, Yunhe; Tian, Yuan; Zhang, Zecai; Zhang, Wenlong; Gao, Xuejiao; Lu, Xiaojie; Cao, Yongguo; Zhang, Naisheng
2016-01-01
[TRIAP]-derived decoy peptides have anti-inflammatory properties. In this study, we synthesized a TRIAP-derived decoy peptide (TR6) containing, the N-terminal portion of the third helical region of the [TIRAP] TIR domain (sequence "N"-RQIKIWFQNRRMKWK and -KPGFLRDPWCKYQML-"C"). We evaluated the effects of TR6 on lipopolysaccharide-induced mastitis in mice. In vivo, the mastitis model was induced by LPS administration for 24h, and TR6 treatment was initiated 1h before or after induction of LPS. In vitro, primary mouse mammary epithelial cells and neutrophils were used to investigate the effects of TR6 on LPS-induced inflammatory responses. The results showed that TR6 significantly inhibited mammary gland hisopathologic changes, MPO activity, and LPS-induced production of TNF-α, IL-1β and IL-6. In vitro, TR6 significantly inhibited LPS-induced TNF-α and IL-6 production and phosphorylation of NF-κB and MAPKs. In conclusion, this study demonstrated that the anti-inflammatory effect of TR6 against LPS-induced mastitis may be due to its ability to inhibit TLR4-mediated NF-κB and MAPK signaling pathways. TR6 may be a promising therapeutic reagent for mastitis treatment. Copyright © 2015. Published by Elsevier B.V.
β-TrCP1 Is a Vacillatory Regulator of Wnt Signaling.
Long, Marcus John; Lin, Hong-Yu; Parvez, Saba; Zhao, Yi; Poganik, Jesse Richard; Huang, Paul; Aye, Yimon
2017-08-17
Simultaneous hyperactivation of Wnt and antioxidant response (AR) are often observed during oncogenesis. However, it remains unclear how the β-catenin-driven Wnt and the Nrf2-driven AR mutually regulate each other. The situation is compounded because many players in these two pathways are redox sensors, rendering bolus redox signal-dosing methods uninformative. Herein we examine the ramifications of single-protein target-specific AR upregulation in various knockdown lines. Our data document that Nrf2/AR strongly inhibits β-catenin/Wnt. The magnitude and mechanism of this negative regulation are dependent on the direct interaction between β-catenin N terminus and β-TrCP1 (an antagonist of both Nrf2 and β-catenin), and independent of binding between Nrf2 and β-TrCP1. Intriguingly, β-catenin positively regulates AR. Because AR is a negative regulator of Wnt regardless of β-catenin N terminus, this switch of function is likely sufficient to establish a new Wnt/AR equilibrium during tumorigenesis. Copyright © 2017 Elsevier Ltd. All rights reserved.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Pilot program. 11.2 Section 11.2 Judicial... Pilot program. The Assistant Attorney General for Administration, in consultation with the Executive Office for United States Attorneys, shall designate the districts that will participate in the pilot...
GPS data til undersøgelse af trængsel
DEFF Research Database (Denmark)
Andersen, Ove; Krogh, Benjamin Bjerre; Torp, Kristian
GPS data fra køretøjer er i en årrække blevet brugt som grundlag for beregning af køretider [1] [2] og estimering af trængsel [3] . Fælles for de tidligere tiltag er, at der typisk er anvendt både kommercielt software og et kommercielt digitalt kort. Sådanne kommercielle løsninger kræver, at brug......GPS data fra køretøjer er i en årrække blevet brugt som grundlag for beregning af køretider [1] [2] og estimering af trængsel [3] . Fælles for de tidligere tiltag er, at der typisk er anvendt både kommercielt software og et kommercielt digitalt kort. Sådanne kommercielle løsninger kræver....... Open-source og creative-commons licenserne gør, at information frit kan distribueres. Som et eksempel anvendes køretidskortet til at estimere køretider for flex-transport for store dele af Danmark. Artiklen er struktureret som følgende. Først præsenteres, hvorledes GPS data og OSM kortet er anvendt til...... at skabe et hastigheds- og trængselskort for hele Danmark. Herefter vises det, hvorledes GPS data inddelt i ture kan anvendes til at analysere kortere strækninger (nogle kilometer) f.eks. hvor der skal være grønne bølger. Slutteligt vises, hvordan GPS data kan anvendes til at nærstudere et enkelt kryds...
TR32DB - Management of Research Data in a Collaborative, Interdisciplinary Research Project
Curdt, Constanze; Hoffmeister, Dirk; Waldhoff, Guido; Lang, Ulrich; Bareth, Georg
2015-04-01
The management of research data in a well-structured and documented manner is essential in the context of collaborative, interdisciplinary research environments (e.g. across various institutions). Consequently, set-up and use of a research data management (RDM) system like a data repository or project database is necessary. These systems should accompany and support scientists during the entire research life cycle (e.g. data collection, documentation, storage, archiving, sharing, publishing) and operate cross-disciplinary in interdisciplinary research projects. Challenges and problems of RDM are well-know. Consequently, the set-up of a user-friendly, well-documented, sustainable RDM system is essential, as well as user support and further assistance. In the framework of the Transregio Collaborative Research Centre 32 'Patterns in Soil-Vegetation-Atmosphere Systems: Monitoring, Modelling, and Data Assimilation' (CRC/TR32), funded by the German Research Foundation (DFG), a RDM system was self-designed and implemented. The CRC/TR32 project database (TR32DB, www.tr32db.de) is operating online since early 2008. The TR32DB handles all data, which are created by the involved project participants from several institutions (e.g. Universities of Cologne, Bonn, Aachen, and the Research Centre Jülich) and research fields (e.g. soil and plant sciences, hydrology, geography, geophysics, meteorology, remote sensing). Very heterogeneous research data are considered, which are resulting from field measurement campaigns, meteorological monitoring, remote sensing, laboratory studies and modelling approaches. Furthermore, outcomes like publications, conference contributions, PhD reports and corresponding images are regarded. The TR32DB project database is set-up in cooperation with the Regional Computing Centre of the University of Cologne (RRZK) and also located in this hardware environment. The TR32DB system architecture is composed of three main components: (i) a file-based data
Directory of Open Access Journals (Sweden)
Tongchai Thitiphuree
2013-01-01
Full Text Available Seasonal cultivation in northern part of Thailand leads to widely uses of agrochemicals especially atrazine herbicide. To examine whether an intensive use of atrazine could lead to contamination in aquatic environment, sediment and water were collected from an agricultural catchment in Nan Province during 2010-2011 and subjected to analysis for atrazine by GC-MS. The results showed that detectable levels of atrazine were found in water (0.16 µg/ml and sediment (0.23 µg/g of the catchment. To monitor potential effects of atrazine on aquatic animals, a freshwater mussel Uniandra contradens was used as a sentinel species for bioaccumulation and potential health effects. Mussels collected from the catchment during 2010-2011 were subjected to analysis for atrazine residue in tissue and condition factor based on body weight and shell length. The results showed that detectable levels of atrazine were found in mussel tissue with the highest level (8.40 2.06 ng/g in late wet season when runoff from heavy rain was evidenced. Condition factor, an indicative of overall health, showed a significant negative correlation with atrazine residue in the tissue. This information could be used as part of the monitoring program for herbicide contamination and potential health effects in agricultural environment.
Image synchronization for 3D application using the NanEye sensor
Sousa, Ricardo M.; Wäny, Martin; Santos, Pedro; Dias, Morgado
2015-03-01
Based on Awaiba's NanEye CMOS image sensor family and a FPGA platform with USB3 interface, the aim of this paper is to demonstrate a novel technique to perfectly synchronize up to 8 individual self-timed cameras. Minimal form factor self-timed camera modules of 1 mm x 1 mm or smaller do not generally allow external synchronization. However, for stereo vision or 3D reconstruction with multiple cameras as well as for applications requiring pulsed illumination it is required to synchronize multiple cameras. In this work, the challenge to synchronize multiple self-timed cameras with only 4 wire interface has been solved by adaptively regulating the power supply for each of the cameras to synchronize their frame rate and frame phase. To that effect, a control core was created to constantly monitor the operating frequency of each camera by measuring the line period in each frame based on a well-defined sampling signal. The frequency is adjusted by varying the voltage level applied to the sensor based on the error between the measured line period and the desired line period. To ensure phase synchronization between frames of multiple cameras, a Master-Slave interface was implemented. A single camera is defined as the Master entity, with its operating frequency being controlled directly through a PC based interface. The remaining cameras are setup in Slave mode and are interfaced directly with the Master camera control module. This enables the remaining cameras to monitor its line and frame period and adjust their own to achieve phase and frequency synchronization. The result of this work will allow the realization of smaller than 3mm diameter 3D stereo vision equipment in medical endoscopic context, such as endoscopic surgical robotic or micro invasive surgery.
Directory of Open Access Journals (Sweden)
Jihong Li
2011-12-01
Full Text Available Clostridium perfringens type B or D isolates, which cause enterotoxemias or enteritis in livestock, produce epsilon toxin (ETX. ETX is exceptionally potent, earning it a listing as a CDC class B select toxin. Most C. perfringens strains also express up to three different sialidases, although the possible contributions of those enzymes to type B or D pathogenesis remain unclear. Type D isolate CN3718 was found to carry two genes (nanI and nanJ encoding secreted sialidases and one gene (nanH encoding a cytoplasmic sialidase. Construction in CN3718 of single nanI, nanJ and nanH null mutants, as well as a nanI/nanJ double null mutant and a triple sialidase null mutant, identified NanI as the major secreted sialidase of this strain. Pretreating MDCK cells with NanI sialidase, or with culture supernatants of BMC206 (an isogenic CN3718 etx null mutant that still produces sialidases enhanced the subsequent binding and cytotoxic effects of purified ETX. Complementation of BMC207 (an etx/nanH/nanI/nanJ null mutant showed this effect is mainly attributable to NanI production. Contact between BMC206 and certain mammalian cells (e.g., enterocyte-like Caco-2 cells resulted in more rapid sialidase production and this effect involved increased transcription of BMC206 nanI gene. BMC206 was shown to adhere to some (e.g. Caco-2 cells, but not all mammalian cells, and this effect was dependent upon sialidase, particularly NanI, expression. Finally, the sialidase activity of NanI (but not NanJ or NanH could be enhanced by trypsin. Collectively these in vitro findings suggest that, during type D disease originating in the intestines, trypsin may activate NanI, which (in turn could contribute to intestinal colonization by C. perfringens type D isolates and also increase ETX action.
Stratigraphie et structure de Trás-os-Montes oriental (Portugal)
Ribeiro, Antonio; Almeida Rebelo, Jose
1967-01-01
Rocks in the eastern part of the province of Trás-os-Montes, N. Portugal belong to five units: 1: a complex of pre-Ordovician schists and greywackes; 2: Ordovician and Silurian sediments; 3: a low-grade metamorphic scries of Silurian age; 4: two complexes of probably Precambrian, predominantly meso-
Nakamura, Yasuhiro; Hattangady, Namita G; Ye, Ping; Satoh, Fumitoshi; Morimoto, Ryo; Ito-Saito, Takako; Sugawara, Akira; Ohba, Koji; Takahashi, Kazuhiro; Rainey, William E; Sasano, Hironobu
2014-03-25
Aberrant expression of gonadotropin-releasing hormone receptor (GnRHR) has been reported in human adrenal tissues including aldosterone-producing adenoma (APA). However, the details of its expression and functional role in adrenals are still not clear. In this study, quantitative RT-PCR analysis revealed the mean level of GnRHR mRNA was significantly higher in APAs than in human normal adrenal (NA) (P=0.004). GnRHR protein expression was detected in human NA and neoplastic adrenal tissues. In H295R cells transfected with GnRHR, treatment with GnRH resulted in a concentration-dependent increase in CYP11B2 reporter activity. Chronic activation of GnRHR with GnRH (100nM), in a cell line with doxycycline-inducible GnRHR (H295R-TR/GnRHR), increased CYP11B2 expression and aldosterone production. These agonistic effects were inhibited by blockers for the calcium signaling pathway, KN93 and calmidazolium. These results suggest GnRH, through heterotopic expression of its receptor, may be a potential regulator of CYP11B2 expression levels in some cases of APA. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.
C1-2 vertebral anomalies in 22q11.2 microdeletion syndrome
Energy Technology Data Exchange (ETDEWEB)
Konen, Osnat; Armstrong, Derek; Padfield, Nancy; Blaser, Susan [Hospital for Sick Children, Diagnostic Imaging, Toronto (Canada); Clarke, Howard [Hospital for Sick Children, Plastic Surgery, Toronto (Canada); Weksberg, Rosanna [Hospital for Sick Children, Clinical and Metabolic Genetics, Toronto (Canada)
2008-07-15
Chromosome 22q11.2 microdeletion syndrome (22q11DS) is characterized by cleft palate, cardiac anomalies, characteristic facies, high prevalence of skeletal anomalies and learning disability. To evaluate the prevalence of craniovertebral junction anomalies in children with 22q11DS and compare these findings to those in nonsyndromic children with velopharyngeal insufficiency (VPI). Sequential CT scans performed for presurgical carotid assessment in 76 children (45 children positive for chromosome 22q11.2 deletion and 31 negative for the deletion) with VPI were retrospectively evaluated for assessment of C1-2 anomalies. C1-2 vertebral anomalies, specifically midline C1 defects, uptilted or upswept posterior elements of C2 and fusions of C2-3, were nearly universal in our cohort of 22q11DS patients with VPI. They were strikingly absent in the majority of non-22q11DS patients with VPI. C1-2 vertebral anomalies, particularly those listed above, are important radiographic markers for 22q11DS. (orig.)
C1-2 vertebral anomalies in 22q11.2 microdeletion syndrome
International Nuclear Information System (INIS)
Konen, Osnat; Armstrong, Derek; Padfield, Nancy; Blaser, Susan; Clarke, Howard; Weksberg, Rosanna
2008-01-01
Chromosome 22q11.2 microdeletion syndrome (22q11DS) is characterized by cleft palate, cardiac anomalies, characteristic facies, high prevalence of skeletal anomalies and learning disability. To evaluate the prevalence of craniovertebral junction anomalies in children with 22q11DS and compare these findings to those in nonsyndromic children with velopharyngeal insufficiency (VPI). Sequential CT scans performed for presurgical carotid assessment in 76 children (45 children positive for chromosome 22q11.2 deletion and 31 negative for the deletion) with VPI were retrospectively evaluated for assessment of C1-2 anomalies. C1-2 vertebral anomalies, specifically midline C1 defects, uptilted or upswept posterior elements of C2 and fusions of C2-3, were nearly universal in our cohort of 22q11DS patients with VPI. They were strikingly absent in the majority of non-22q11DS patients with VPI. C1-2 vertebral anomalies, particularly those listed above, are important radiographic markers for 22q11DS. (orig.)
Directory of Open Access Journals (Sweden)
Toshimasa Suzuka
2017-04-01
Full Text Available Primary aromatic amides are valuable compounds, which are generally prepared via Beckmann rearrangement of oximes and the hydration of nitriles in organic solvents. We investigated the environmentally friendly catalytic aminocarbonylation in water. Thus, a novel heterogeneous transition-metal catalyst, a polymer-supported terpyridine–palladium(II complex, was prepared and found to promote azidocarbonylation of aryl iodides with NaN3 and to reduce the generated benzoyl azides in water under CO gas to yield primary aryl amides with high to excellent yield in a one-pot reaction. The catalyst was recovered and reused several times with no loss of catalytic activity.
International Nuclear Information System (INIS)
Thomas, Maria; Bayha, Christine; Klein, Kathrin; Müller, Simon; Weiss, Thomas S.; Schwab, Matthias; Zanger, Ulrich M.
2015-01-01
The peroxisome proliferator-activated receptor alpha (PPARα) controls lipid/energy homeostasis and inflammatory responses. The truncated splice variant PPARα-tr was suggested to exert a dominant negative function despite being unable to bind consensus PPARα DNA response elements. The distribution and variability factor of each PPARα variant were assessed in the well-characterized cohort of human liver samples (N = 150) on the mRNA and protein levels. Specific siRNA-mediated downregulation of each transcript as well as specific overexpression with subsequent qRT-PCR analysis of downstream genes was used for investigation of specific functional roles of PPARα-wt and PPARα-tr forms in primary human hepatocytes. Bioinformatic analyses of genome-wide liver expression profiling data suggested a possible role of PPARα-tr in downregulating proliferative and pro-inflammatory genes. Specific gene silencing of both forms in primary human hepatocytes showed that induction of metabolic PPARα-target genes by agonist WY14,643 was prevented by PPARα-wt knock-down but neither prevented nor augmented by PPARα-tr knock-down. WY14,643 treatment did not induce proliferative genes including MYC, CDK1, and PCNA, and knock-down of PPARα-wt had no effect, while PPARα-tr knock-down caused up to 3-fold induction of these genes. Similarly, induction of pro-inflammatory genes IL1B, PTGS2, and CCL2 by IL-6 was augmented by knock-down of PPARα-tr but not of PPARα-wt. In contrast to human proliferative genes, orthologous mouse genes were readily inducible by WY14,643 in PPARα-tr non-expressing AML12 mouse hepatocytes. Induction was augmented by overexpression of PPARα-wt and attenuated by overexpression of PPARα-tr. Pro-inflammatory genes including IL-1β, CCL2 and TNFα were induced by WY14,643 in mouse and human cells and both PPARα forms attenuated induction. As potential mechanism of PPARα-tr inhibitory action we suggest crosstalk with WNT/β-catenin pathway. Finally
Utjecaj liberalizacije na tržište stočarskih proizvoda
Directory of Open Access Journals (Sweden)
Ružica Lončarić
2004-01-01
Full Text Available Ulaskom u Svjetsku trgovinsku organizaciju Republika Hrvatska je dokazala spremnost za izazove liberalizacije i globalizacije svjetskoga tržišta. Ovom je koraku prethodilo i potpisivanju drugih značajnih dokumenata za uključenje u europski integracijski proces, kao što je Pakt o stabilizaciji u istočnoj Europi, Sporazum o stabilizaciji i Pridruživanju EU i RH, službeno priključenje CEFTA-i, te službena prijava za članstvo u EU, koji na provođenje određenih reformi i prilagodbu u političkome, gospodarskom i pravnom smislu. Kako se hrvatska poljoprivreda, pogotovo grana stočarstva, od osamostaljenja i prihvaćanja tržišnog sustava gospodarenja, nalazi u velikoj krizi, u radu se analizira položaj stočarstva s obzirom na uvjete proizvodnje i brojno stanje stoke, tržište stočarskih proizvoda uz pomoć dinamičke raščlambe sustava proizvodnje stočarskih proizvoda, te se daju prognoze na koji će se način odvijati adaptacija stočarstva u uvjetima EU s obzirom na konkurentnost naših stočarskih proizvoda u europskom okruženju tes obzirom na liberalizacijske obveze. Rezultati analizirani u radu pokazuju kako je hrvatska proizvodnja i tržište stočarskih proizvoda u dubokoj krizi, te da bi bilo potrebno poduzeti niz tržišno-cjenovnih mjera agrarne politike koje bi uredilo navedeno tržište s obzirom na obveze i pravila o liberalizaciji trgovine unutar europskog tržišta.
11 CFR 110.11 - Communications; advertising; disclaimers (2 U.S.C 441d).
2010-01-01
... 11 Federal Elections 1 2010-01-01 2010-01-01 false Communications; advertising; disclaimers (2 U.S... AND EXPENDITURE LIMITATIONS AND PROHIBITIONS § 110.11 Communications; advertising; disclaimers (2 U.S... through radio or television, or through any broadcast, cable, or satellite transmission, must comply with...
Cross checking of the new capabilities of the fuel cycle scenario code TR-EVOL - 5229
International Nuclear Information System (INIS)
Merino-Rodriguez, I.; Garcia-Martinez, M.; Alvarez-Velarde, F.
2015-01-01
This work is intended to cross check the new capabilities of the fuel cycle scenario code TR-EVOL by means of comparing its results with those published in bibliography. This process has been divided in two stages as follows. The first stage is dedicated to check the improvements in the material management part of the fuel cycle code (the nuclear fuel mass balance estimation). The Spanish nuclear fuel cycle has been chosen as the model for the mass balance comparison given that the fuel mass per reactor is available in bibliography. The second stage has been focused in verifying the validity of the TR-EVOL economic module. The economic model verification has been carried out by making use of the ARCAS EU project and its economic assessments for advanced reactors and scenarios involving fast reactors and ADS. As conclusions, the main finding from the first stage includes that TR-EVOL provides a prediction of mass values quite accurate after the improvements and when using the proper parameters as input for the code. For the second stage, results were highly satisfactory since a difference smaller than 3% can be found regarding results published by the ARCAS project (NRG estimations). Furthermore, concerning the Decommissioning, Dismantling and Disposal cost, results are highly acceptable (7% difference in the comparison with the final disposal in a once-through scenario and around 11% in a final disposal with a reprocessing strategy) given the difficulties to find in bibliography detailed information about the costs of the final disposals and the significant uncertainties involved in design concepts and related unit costs
International Nuclear Information System (INIS)
Taylor, R.P.; Finch, A.A.; Mosselmans, J.F.W.; Quinn, P.D.
2013-01-01
We describe the design and capabilities of a new Continuous Wave X-ray Excited Optical Luminescence (CW-XEOL) and Time Resolved X-ray Excited Optical Luminescence (TR-XEOL) facility on the I18 beamline at the DIAMOND light source, the UK national synchrotron facility. Experimental data from a suite of framework silicates are presented to illustrate the capabilities of the system. Experiments studied include simple (CW-XEOL) spectroscopy, (TR XEOL) lifetime experiments dose and dose rate dependence (CW-XEOL) experiments, spatial (TR XEOL) on heterogeneous sample, wavelength resolved (TR XEOL), Optically Derived X-ray Absorption Spectroscopy, (OD XAS). - Highlights: ► We describe the capabilities of a new CW-XEOL and TR-XEOL detection system for a hard X-ray beamline. ► We model TR XEOL with luminescence lifetimes from ∼25 ps to ∼400 ps from framework silicates. ► CW XEOL, 200–900 nm with a resolution of ∼0.9 nm is used to complete dose and dose rate experiments. ► Micro-beam high spatial resolution XEOL within X-ray excitation energies 2–20 keV.
Diversity and ecology of ground dwelling ants at Khao Nan National Park, southern Thailand
Directory of Open Access Journals (Sweden)
Suparoek Watanasit
2008-10-01
Full Text Available Khao Nan National Park (KNNP is located in the southern part of Thailand. Its flora and fauna are diverse, however there is little information about the diversity of ants. The aim of this study was to determine species diversity and ecology of ants at KNNP. Three study sites (Baucheak Trail, Pra Forest and Sunantha Trail were chosen and at each three permanent plots of 30x30 m were selected at least 500 m apart. The ant sampling was extracted from leaf litter by the Winkler bag method. Physical factors of precipitation, humidity, air temperature, and soil temperature were recorded during the collection of ants every two months between January 2006 and January 2007. A total number of 172 species and 43 genera belonging to 9 subfamilies were identified. The top five dominant genera of ants were Pheidole (27 species following by Tetramorium (14 species, Camponotus (13 species, Pachycondyla (12 species, and Crematogaster (9 species. The influence of the study sites on the species number of ants in this study indicated that the study sites had an affect on the species number. Regarding the environmental factors, the results showed that the individual numbers of Pheidole was significantly negatively correlated to precipitation, whereas Pachycondyla was significantly negatively correlated to humidity, while both genera were significantly positively correlated to air temperature and soil temperature. Moreover, Camponotus was the only genus significantly positively correlated to the air temperature.
DEFF Research Database (Denmark)
Nielsen, Peter Vilhelm
2002-01-01
Nye ventilationsprincipper som naturlig ventilation er med til at sætte fokus på de strømningselementer, der skal anvendes til dimensionering af luftfordelingen i et rum. Artiklen anviser, hvordan træk fra vinduer og tagåbninger i rum med naturlig ventilation kan beregnes ved hjælp af...
Forbruget af træer og buske i Danmark
DEFF Research Database (Denmark)
Jensen, Jan Svejgaard; Laursen, Allan Bach; Kjær, Erik Dahl
Træer og buske er vigtige elementer i byen og landskabet, og i Danmark bruges der mellem 60 og 80 millioner vedplanter hvert år. Forbruget har været konstant stigende og der er sket store forskydninger i forbrugsmønstret i retning af større fokus på mangfoldighed og autencitet. Undersøgelsen...... klarlægger forbrugsmønstret for træer og buske og undersøger, hvad brugerne lægger vægt på i deres valg af planter....
Diversidade de formigas epígeas em três ambientes no noroeste do Paraná - Brasil
Halison Correia Golias
2008-01-01
As formigas são insetos que exercercem importante papel como bioindicadores, pragas agrícolas, controle biológico, polinizadores e dispersores de sementes. Este trabalho objetivou conhecer e comparar a diversidade de formigas em três ambientes (fragmento florestal, pomar de laranja e pomar de limão) do noroeste do Paraná. As coletas foram realizadas com armadilhas pitfall, sendo utilizados copos plástico com 7,5 cm de diâmetro por 11,5 cm de altura, enterrados totalmente no, solo. Foram insta...
Directory of Open Access Journals (Sweden)
Luilma Albuquerque Gurgel
Full Text Available O presente trabalho tem como propósito avaliar uma possível atividade inibitória do látex do Croton urucurana Baill. sobre o trânsito gastrintestinal de camundongos, bem como tentar esclarecer os possíveis mecanismos de ação envolvidos em sua atividade. Foram utilizados os modelos de trânsito gastrintestinal normal e trânsito gastrintestinal estimulado por fisostigmina em camundongos. Os resultados obtidos mostram que o látex inibiu o trânsito gastrintestinal de camundongos, e, muito embora seu mecanismo de ação ainda não seja claro, seu efeito é independente da participação de mecanismo opióide, colinérgico, α2-adrenérgico ou nitriérgico.
International Nuclear Information System (INIS)
Kwok, W.M.; Zhao Cunyuan; Li Yunliang; Guan Xiangguo; Phillips, David Lee
2004-01-01
Picosecond time-resolved resonance Raman (ps-TR 3 ) spectroscopy was used to obtain the first definitive spectroscopic observation of an isopolyhalomethane O-H insertion reaction with water. The ps-TR 3 spectra show that isobromoform is produced within several picoseconds after photolysis of CHBr 3 and then reacts on the hundreds of picosecond time scale with water to produce a CHBr 2 OH reaction product. Photolysis of low concentrations of bromoform in aqueous solution resulted in noticeable formation of HBr strong acid. Ab initio calculations show that isobromoform can react with water to produce a CHBr 2 (OH) O-H insertion reaction product and a HBr leaving group. This is consistent with both the ps-TR 3 experiments that observe the reaction of isobromoform with water to form a CHBr 2 (OH) product and photolysis experiments that show HBr acid formation. We briefly discuss the implications of these results for the phase dependent behavior of polyhalomethane photochemistry in the gas phase versus water solvated environments
45 CFR 1626.11 - H-2 agricultural workers.
2010-10-01
...) Other employment rights as provided in the worker's specific contract under which the nonimmigrant... 45 Public Welfare 4 2010-10-01 2010-10-01 false H-2 agricultural workers. 1626.11 Section 1626.11... ON LEGAL ASSISTANCE TO ALIENS § 1626.11 H-2 agricultural workers. (a) Nonimmigrant agricultural...
Wu, Hui; Jin, Jun; Wang, Ying; Li, Ming-Yuan; He, Song-Jie; Xu, Meng; Sun, Yi-Ming
2014-04-01
Brominated flame retardants (BFRs) are widely used in industrial and commercial products and are frequently detected in various environmental media. It might be potential harm to the environment and the human body. This study reported the levels of 8 kinds of polybrominated diphenyl ethers (PBDEs: BDE-28, -47, -100, -99, -154, -153, -183, -209) and 3 kinds of new brominated flame retardants (NBFRs: PBT, PBEB, HBB) in the atmosphere of Binhai Development Zone, Weifang City, Shandong Province, which was taken as a BFR production source area and of Nanning City, Guangxi Province, which was taken as a contrast area. The results showed that the average concentrations of sigma8 PBDEs in the atmosphere of Weifang and Nanning were 1.4 x 10(5) pg x m(-3) and 323.0 pg x m(-3), respectively, and the average concentrations of sigma3 NBFRs were 4.2 x 10(3) pg x m(-3) and 11.9 pg x m(-3), respectively. Compared with other cities, the concentrations of BFRs in the atmosphere of the production area were at a high level in the globe, and the concentrations of BFRs in Nanning were similar with other cities in China. The distribution characteristics of PBDEs and NBFRs in the atmosphere of the production area were different from those of Nanning, and the correlations between PBEB, PBT, HBB and BDE-209 were different between Weifang and Nanning.
Gåsetrekket i Vesterålen og Nord-Trøndelag 2004
DEFF Research Database (Denmark)
Tombre, I.; Madsen, J.; Bakken, J.
for the goose species pink-footed goose Anser brachyrhynchus, barnacle goose Branta leucopsis and greylag goose Anser anser. The present report summarises goose registrations in some of the municipalities involved; Steinkjer and Inderøy in Nord-Trøndelag, Mid-Norway (pink-footed goose), and Sortland...... in Vesterålen, Northern Norway (pink-footed goose and barnacle goose). Registrations in the Nord-Trøndelag municipalities, Verdal and Levanger, are also included. Pink-footed and barnacle geese stage in Norway during spring on their way to their breeding grounds in Svalbard. In Trøndelag, the spring...... estimate of 43 000). This is probably an underestimate due to all hiding possibilities in the region, and it is assumed that at least 75 % of the Svalbard population of pink-footed goose stayed in Nord-Trøndelag in early May. Intensive scaring of geese registered at several locations in the county...
Radiosynthesis of the D2/3 agonist [3-11C]-(+)-PHNO using [11C]iodomethane
International Nuclear Information System (INIS)
Francisco Garcia-Arguello, Segundo; Fortt, Robin; Steel, Colin J.; Brickute, Diana; Glaser, Matthias; Turton, David R.; Robins, Edward G.; Årstad, Erik; Luthra, Sajinder K.
2013-01-01
We report here a radiosynthesis for the D 2/3 agonist (+)-4-([3- 11 C]propyl)-3,4,4a,5,6,10b-hexahydro-2H-naphtho[1,2-b][1,4] oxazin-9-ol (3-[ 11 C]-(+)-PHNO) labelled at the terminal carbon of the N-propyl chain. The protocol is based on 11 C-methylation of an N-acetyl precursor. This initial step is followed by a reduction with LiAlH 4 to give ([3- 11 C]-(+)-PHNO). We first applied the method for the synthesis of a model compound, N-3-([ 11 C]propyl)-1,2,3,4-tetrahydroisoquinoline, which we obtained in 77–97% analytical radiochemical yield (n=6) in 20 min. Similarly, we prepared ([3- 11 C]-(+)-PHNO) in 55–60% analytical radiochemical yield (n=5) using a one-pot procedure. We have also been able to implement the complete process on a semi-automated module. This platform delivered purified and formulated [3- 11 C]PHNO with an average radiochemical yield of 9% (n=13, range 2–30%, non-decay corrected), a radiochemical purity >95%, and a specific radioactivity of 26.8–81.1 GBq/μmol in a total time of 63–65 min. - Highlights: ► We report an alternative method to obtain carbon-11 labelled PHNO. ► The method is based on readily available [ 11 C]methyl iodide as starting material. ► We have automated the alkylation/reduction protocol including purification and formulation
Optimization and Verification of the TR-MAC Protocol for Wireless Sensor Networks
Morshed, S.; Heijenk, Geert
2015-01-01
Energy-efficiency is an important requirement in the design of communication protocols for wireless sensor networks (WSN). TR-MAC is an energy-efficient medium access control (MAC) layer protocol for low power WSN that exploits transmitted-reference (TR) modulation in the physical layer. The
Kitapcı, Olgun; Dörtyol, İbrahim Taylan; Gülmez, Mustafa
2018-01-01
SosyalPazarlama kavramının doğduğu tarihten günümüze yazılmış ve Web of Science (WOS)veri tabanında yayınlanmış makalelerin, Lee ve Kotler’in 2011 yılındayazdıkları kitapta yer alan sınıflandırma çerçevesinde yorumlanmasını amaçlayanbu çalışma sözkonusu alanda zaman içerisinde hakim olan araştırma eğilimlerini ortayakoymaktadır. Bu kapsamda, ilgili veri tabanında yer alan makalelerin tamamıtaranmış ve sınıflandırılmıştır. Makalelerin temel odakları sosyal pazarlamabağlamında ele alınan temel ...
Duplication of 17(p11.2p11.2) in a male child with autism and severe language delay.
Nakamine, Alisa; Ouchanov, Leonid; Jiménez, Patricia; Manghi, Elina R; Esquivel, Marcela; Monge, Silvia; Fallas, Marietha; Burton, Barbara K; Szomju, Barbara; Elsea, Sarah H; Marshall, Christian R; Scherer, Stephen W; McInnes, L Alison
2008-03-01
Duplications of 17(p11.2p11.2) have been associated with various behavioral manifestations including attention deficits, obsessive-compulsive symptoms, autistic traits, and language delay. We are conducting a genetic study of autism and are screening all cases for submicroscopic chromosomal abnormalities, in addition to standard karyotyping, and fragile X testing. Using array-based comparative genomic hybridization analysis of data from the Affymetrix GeneChip(R) Human Mapping Array set, we detected a duplication of approximately 3.3 Mb on chromosome 17p11.2 in a male child with autism and severe expressive language delay. The duplication was confirmed by measuring the copy number of genomic DNA using quantitative polymerase chain reaction. Gene expression analyses revealed increased expression of three candidate genes for the Smith-Magenis neurobehavioral phenotype, RAI1, DRG2, and RASD1, in transformed lymphocytes from Case 81A, suggesting gene dosage effects. Our results add to a growing body of evidence suggesting that duplications of 17(p11.2p11.2) result in language delay as well as autism and related phenotypes. As Smith-Magenis syndrome is also associated with language delay, a gene involved in acquisition of language may lie within this interval. Whether a parent of origin effect, gender of the case, the presence of allelic variation, or changes in expression of genes outside the breakpoints influence the resultant phenotype remains to be determined. (c) 2007 Wiley-Liss, Inc.
In-site coatings to reduce H and Tr permeation
International Nuclear Information System (INIS)
Stoever, D.; Buchkremer, H.P.; Hecker, R.; Jonas, H.; Schaefer, J.; Zink, U.; Forsyth, N.; Thiele, W.
1982-01-01
The main goal of this project is the development of protective coatings to reduce or prevent Tr and H permeation through the heat exchanger walls of HTR components. The tasks of the project are: Measurement of the permeation inhibition efficiency of oxidic coatings on the high-temperature- resistant heat exchanger walls; establishing the parameters influencing permeation by variation of the process gas and steam parameters, temperature and mechanical stress; characterisation of coatings and correlation of coating characteristics with permeation measurements; investigation of permeation and corrosion mechanisms; quantitative description of H and Tr permeation by means of mathematical/physical models. (orig./IHOE) [de
Institute of Scientific and Technical Information of China (English)
ZHANG Wensheng; KUANG Chunxiang; YANG Qing
2009-01-01
A novel method for the stereoselective synthesis of(Z)-4-(2-bromovinyl)benzenesulfonyl azide by simultaneous azidation and debrorninative decarboxylation of anti-2,3-dibromo-3-(4-chlorosulfonylphenyl)propanoic acid using NaN3 only was developed.Facile transformation of(Z)-4-(2-bromovinyl)benzenesulfonyl azide to(Z)-N-[4(2-bromovinyl)benzenesulfonyl]imidates was also achieved by Cu-catalyzed three-component coulping of (Z)-4-(2-bromovinyi)benzenesulfonyl azide,terminal alkynes and alcohols/phenols.
Realization of an integrated VDF/TrFE copolymer-on-silicon pyroelectric sensor
Setiadi, D.; Setiadi, D.; Regtien, Paulus P.L.; Sarro, P.M.
1995-01-01
An integrated pyroelectric sensor based on a vinylidene fluoride trifluoroethylene (VDF/TrFE) copolymer is presented. A silicon substrate that contains FET readout electronics is coated with the VDF/TrFE copolymer film using a spin-coating technique. On-chip poling of the copolymer has been applied
Directory of Open Access Journals (Sweden)
Mimi Suharti Mimi Suharti
2015-11-01
Full Text Available Learning to read and write at primary school level is the main staple for Indonesian lessons, if students do not have the ability to read and write at an early stage, it will be very difficult for any lesson. Results of preliminary observations at 12 Nan Primary School Sabaris shows that there are some constraints faced by teachers in the learning process. One problem is difficult to instill the concept of reading and writing in students. The purpose of this action research are (1 to determine the extent to which the use of learning resources in the form of cards of letters and syllables and words can influence the level of student ability in assembling verbatim and read (2 to improve the ability of students to practice reading by using the card shared-card teacher said. Data obtained through tests and usage observation guide, the data is processed by a percentage. Results of the analysis of the data obtained in the first cycle of learning success; 61.00%, and the second cycle; amounting to 81.50%. So it showed no increase student learning from the first cycle to the second cycle. Thus the letter card usage can improve the understanding of stringing words and reading in students. This is evident from the enthusiasm with studentsmenyususun verbatim via encrypted card.
Directory of Open Access Journals (Sweden)
Udi Gluschnaider
2010-02-01
Full Text Available Prostate cancer is a common and heterogeneous disease, where androgen receptor (AR signaling plays a pivotal role in development and progression. The initial treatment for advanced prostate cancer is suppression of androgen signaling. Later on, essentially all patients develop an androgen independent stage which does not respond to anti hormonal treatment. Thus, alternative strategies targeting novel molecular mechanisms are required. beta-TrCP is an E3 ligase that targets various substrates essential for many aspects of tumorigenesis.Here we show that beta-TrCP depletion suppresses prostate cancer and identify a relevant growth control mechanism. shRNA targeted against beta-TrCP reduced prostate cancer cell growth and cooperated with androgen ablation in vitro and in vivo. We found that beta-TrCP inhibition leads to upregulation of the aryl hydrocarbon receptor (AhR mediating the therapeutic effect. This phenomenon could be ligand independent, as the AhR ligand 2,3,7,8-Tetrachlorodibenzo-p-Dioxin (TCDD did not alter prostate cancer cell growth. We detected high AhR expression and activation in basal cells and atrophic epithelial cells of human cancer bearing prostates. AhR expression and activation is also significantly higher in tumor cells compared to benign glandular epithelium.Together these observations suggest that AhR activation may be a cancer counteracting mechanism in the prostate. We maintain that combining beta-TrCP inhibition with androgen ablation could benefit advanced prostate cancer patients.
Effekter af træstøv; inflammation, gentoksicitet og cancer
DEFF Research Database (Denmark)
Lange, Jette Bornholdt
2008-01-01
lokaliseret i næse og bihuler. Især erhvervsmæssig udsæt-telse for hårde træsorter som eg, birk, bøg eller teak er associeret med sinonasal cancer og luftvejssymptomer. Trods talrige epidemiologiske studier af træstøvs helbredseffekter er forståelsen af de bagvedliggende mekanismer meget begrænset. I år 2000...
Data model and relational database design for the New Jersey Water-Transfer Data System (NJWaTr)
Tessler, Steven
2003-01-01
The New Jersey Water-Transfer Data System (NJWaTr) is a database design for the storage and retrieval of water-use data. NJWaTr can manage data encompassing many facets of water use, including (1) the tracking of various types of water-use activities (withdrawals, returns, transfers, distributions, consumptive-use, wastewater collection, and treatment); (2) the storage of descriptions, classifications and locations of places and organizations involved in water-use activities; (3) the storage of details about measured or estimated volumes of water associated with water-use activities; and (4) the storage of information about data sources and water resources associated with water use. In NJWaTr, each water transfer occurs unidirectionally between two site objects, and the sites and conveyances form a water network. The core entities in the NJWaTr model are site, conveyance, transfer/volume, location, and owner. Other important entities include water resource (used for withdrawals and returns), data source, permit, and alias. Multiple water-exchange estimates based on different methods or data sources can be stored for individual transfers. Storage of user-defined details is accommodated for several of the main entities. Many tables contain classification terms to facilitate the detailed description of data items and can be used for routine or custom data summarization. NJWaTr accommodates single-user and aggregate-user water-use data, can be used for large or small water-network projects, and is available as a stand-alone Microsoft? Access database. Data stored in the NJWaTr structure can be retrieved in user-defined combinations to serve visualization and analytical applications. Users can customize and extend the database, link it to other databases, or implement the design in other relational database applications.
The design of an asynchronous Tiny RISC TM/TR4101 microprocessor core
DEFF Research Database (Denmark)
Christensen, Kåre Tais; Jensen, P.; Korger, P.
1998-01-01
This paper presents the design of an asynchronous version of the TR4101 embedded microprocessor core developed by LSI Logic Inc. The asynchronous processor, called ARISC, was designed using the same CAD tools and the same standard cell library that was used to implement the TR4101. The paper repo...
du Toit, Therina; Bloem, Liezl M; Quanson, Jonathan L; Ehlers, Riaan; Serafin, Antonio M; Swart, Amanda C
2017-02-01
Adrenal C 19 steroids serve as precursors to active androgens in the prostate. Androstenedione (A4), 11β-hydroxyandrostenedione (11OHA4) and 11β-hydroxytestosterone (11OHT) are metabolised to potent androgen receptor (AR) agonists, dihydrotestosterone (DHT), 11-ketotestosterone (11KT) and 11-ketodihydrotestosterone (11KDHT). The identification of 11OHA4 metabolites, 11KT and 11KDHT, as active androgens has placed a new perspective on adrenal C11-oxy C 19 steroids and their contribution to prostate cancer (PCa). We investigated adrenal androgen metabolism in normal epithelial prostate (PNT2) cells and in androgen-dependent prostate cancer (LNCaP) cells. We also analysed steroid profiles in PCa tissue and plasma, determining the presence of the C 19 steroids and their derivatives using ultra-performance liquid chromatography (UHPLC)- and ultra-performance convergence chromatography tandem mass spectrometry (UPC 2 -MS/MS). In PNT2 cells, sixty percent A4 (60%) was primarily metabolised to 5α-androstanedione (5αDIONE) (40%), testosterone (T) (10%), and androsterone (AST) (10%). T (30%) was primarily metabolised to DHT (10%) while low levels of A4, 5αDIONE and 3αADIOL (≈20%) were detected. Conjugated steroids were not detected and downstream products were present at <0.05μM. Only 20% of 11OHA4 and 11OHT were metabolised with the former yielding 11keto-androstenedione (11KA4), 11KDHT and 11β-hydroxy-5α-androstanedione (11OH-5αDIONE) and the latter yielding 11OHA4, 11KT and 11KDHT with downstream products <0.03μM. In LNCaP cells, A4 (90%) was metabolised to AST-glucuronide via the alternative pathway while T was detected as T-glucuronide with negligible conversion to downstream products. 11OHA4 (80%) and 11OHT (60%) were predominantly metabolised to 11KA4 and 11KT and in both assays more than 50% of 11KT was detected in the unconjugated form. In tissue, we detected C11-oxy C 19 metabolites at significantly higher levels than the C 19 steroids, with
Directory of Open Access Journals (Sweden)
Mingjia Tan
2006-12-01
Full Text Available Skp1-cullin-F-box protein (SCF is a multicomponent E3 ubiquitin (Ub ligase that ubiquitinates a number of important biologic molecules such as p27, β-catenin, and lκB for proteasomal degradation, thus regulating cell proliferation and survival. One SCF component, SAG/ROC2/Rbx2/Hrt2, a RING finger protein, was first identified as a redox-inducible protein, which, when overexpressed, inhibited apoptosis both in vitro and in vivo. We report here that sensitive to apoptosis gene (SAG, as well as its family member ROC1/Rbxi, bound to the proinactive form of caspase-3 (pro-caspase-3. Binding was likely mediated through F-box protein, β-transducin repeat-containing protein (β-TrCP, which binds to the first 38 amino acids of pro-caspase-3. Importantly, β-TrCP1 expression significantly shortened the protein half-life of pro-caspase-3, whereas expression of a dominant-negative β-TrCP1 mutant with the F-box domain deleted extended it. An in vitro ubiquitination assay showed that SAG/ROC-SCF -Trcp promoted ubiquitination of pro-caspase-3. Furthermore, endogenous levels of pro-caspase-3 were decreased by overexpression of SAG/ROC-SCFβ-TrCP E3 Ub ligases, but increased on siRNA silencing of SAG, regulator of cullin-1 (ROC1, or β-TrCPs, leading to increased apoptosis by etoposide and TNF-related apoptosis-inducing ligand through increased activation of caspase-3. Thus, pro-caspase-3 appears to be a substrate of SAG/ROC-SCFβ-TrCP E3 Ub ligase, which protects cells from apoptosis through increased apoptosis threshold by reducing the basal level of pro-caspase-3.
McDonald-McGinn, Donna M.; Sullivan, Kathleen E.; Marino, Bruno; Philip, Nicole; Swillen, Ann; Vorstman, Jacob A. S.; Zackai, Elaine H.; Emanuel, Beverly S.; Vermeesch, Joris R.; Morrow, Bernice E.; Scambler, Peter J.; Bassett, Anne S.
2016-01-01
22q11.2 deletion syndrome (22q11.2DS) is the most common chromosomal microdeletion disorder, estimated to result mainly from de novo non-homologous meiotic recombination events occurring in approximately 1 in every 1,000 fetuses. The first description in the English language of the constellation of findings now known to be due to this chromosomal difference was made in the 1960s in children with DiGeorge syndrome, who presented with the clinical triad of immunodeficiency, hypoparathyroidism and congenital heart disease. The syndrome is now known to have a heterogeneous presentation that includes multiple additional congenital anomalies and later-onset conditions, such as palatal, gastrointestinal and renal abnormalities, autoimmune disease, variable cognitive delays, behavioural phenotypes and psychiatric illness — all far extending the original description of DiGeorge syndrome. Management requires a multidisciplinary approach involving paediatrics, general medicine, surgery, psychiatry, psychology, interventional therapies (physical, occupational, speech, language and behavioural) and genetic counselling. Although common, lack of recognition of the condition and/or lack of familiarity with genetic testing methods, together with the wide variability of clinical presentation, delays diagnosis. Early diagnosis, preferably prenatally or neonatally, could improve outcomes, thus stressing the importance of universal screening. Equally important, 22q11.2DS has become a model for understanding rare and frequent congenital anomalies, medical conditions, psychiatric and developmental disorders, and may provide a platform to better understand these disorders while affording opportunities for translational strategies across the lifespan for both patients with 22q11.2DS and those with these associated features in the general population. PMID:27189754
11β-Hydroxysteroid Dehydrogenase 2 in Preeclampsia
Directory of Open Access Journals (Sweden)
Katarzyna Kosicka
2016-01-01
Full Text Available Preeclampsia is a serious medical problem affecting the mother and her child and influences their health not only during the pregnancy, but also many years after. Although preeclampsia is a subject of many research projects, the etiology of the condition remains unclear. One of the hypotheses related to the etiology of preeclampsia is the deficiency in placental 11β-hydroxysteroid dehydrogenase 2 (11β-HSD2, the enzyme which in normal pregnancy protects the fetus from the excess of maternal cortisol. The reduced activity of the enzyme was observed in placentas from pregnancies complicated with preeclampsia. That suggests the overexposure of the developing child to maternal cortisol, which in high levels exerts proapoptotic effects and reduces fetal growth. The fetal growth restriction due to the diminished placental 11β-HSD2 function may be supported by the fact that preeclampsia is often accompanied with fetal hypotrophy. The causes of the reduced function of 11β-HSD2 in placental tissue are still discussed. This paper summarizes the phenomena that may affect the activity of the enzyme at various steps on the way from the gene to the protein.
Hanna, Amir
2012-06-01
Organic ferroelectrics polymers have recently received much interest for use in nonvolatile memory devices. The ferroelectric copolymer poly(vinylidene fluoride- trifluoroethylene) , P(VDF-TrFE), is a promising candidate due to its relatively high remnant polarization, low coercive field, fast switching times, easy processability, and low Curie transition. However, no detailed study of charge injection and current transport properties in P(VDF-TrFE) have been reported in the literature yet. Charge injection and transport are believed to affect various properties of ferroelectric films such as remnant polarization values and polarization fatigue behavior.. Thus, this thesis aims to study charge injection in P(VDF-TrFE) and its transport properties as a function of electrode material. Injection was studied for Al, Ag, Au and Pt electrodes. Higher work function metals such as Pt have shown less leakage current compared to lower work function metals such as Al for more than an order of magnitude. That implied n-type conduction behavior for P(VDF-TrFE), as well as electrons being the dominant injected carrier type. Charge transport was also studied as a function of temperature, and two major transport regimes were identified: 1) Thermionic emission over a Schottky barrier for low fields (E < 25 MV/m). 2) Space-Charge-Limited regime at higher fields (25 < E <120 MV/m). We have also studied the optical imprint phenomenon, the polarization fatigue resulting from a combination of broad band optical illumination and DC bias near the switching field. A setup was designed for the experiment, and validated by reproducing the reported effect in polycrystalline Pb(Zr,Ti)O3 , PZT, film. On the other hand, P(VDF-TrFE) film showed no polarization fatigue as a result of optical imprint test, which could be attributed to the large band gap of the material, and the low intensity of the UV portion of the arc lamp white light used for the experiment. Results suggest using high work
7 CFR 2.11 - New principles and periodic reviews.
2010-01-01
... 7 Agriculture 1 2010-01-01 2010-01-01 false New principles and periodic reviews. 2.11 Section 2.11... Agriculture § 2.11 New principles and periodic reviews. In the exercise of authority delegated by the Secretary, the application of new principles of major importance or a departure from principles established...
A case report and brief literature review of Klippel-Trénaunay syndrome
Directory of Open Access Journals (Sweden)
Choudhary MG
2012-05-01
Full Text Available Madan Gopal Choudhary, Zia Ul Haq, Ram Narayan Sehra, Chandra Kumar ChaharDepartment of Paediatrics, Sardar Patel Medical College and P.B.M Hospital, Rajasthan, IndiaAbstract: Klippel-Trénaunay syndrome is a rare disorder characterized by the triad of vascular malformations, venous varicosities, and bone and soft-tissue hypertrophy. We present a case of Klippel-Trénaunay syndrome with limb hypertrophy, port-wine stains, angiokeratoma, and venous varicosities in the limbs.Keywords: Klippel-Trénaunay syndrome, sporadic, venous varicosities, port-wine stain, angiokeratoma
Directory of Open Access Journals (Sweden)
Jon Mark Praga Xavier De Brito
2011-01-01
Full Text Available OBJETIVO: Analisar as vítimas de acidentes de trânsito que apresentam incapacidade decorrente de lesão medular. MÉTODOS: Foram avaliados os prontuários de 719 vítimas de acidentes de trânsito que solicitaram benefício devido as lesões decorrentes e selecionadas as que sofreram traumatismo raquimedular. As variáveis idade, sexo, tipo de acidente, lesões decorrentes, e grau de incapacidade de acordo com a Classificação Internacional de Funcionalidade, Incapacidade e Saúde foram então analisadas. RESULTADOS: Dos 32 casos de incapacidade total (4,5%, 11 pacientes eram portadores de traumatismo raquimedular (34,37% (RR=13,245, IC 95% de 0,267 a 0,966. Incapacidade funcional foi obervada em 360 pacientes (50,1%, e destes sete possuiam TRM (1,9% (RR=0,508; IC 95% de 0,267 a 0,966. Houve incapacidade leve em 327 pacientes (45,48%, sendo que seis destas vítimas sofreram TRM (1,83% (RR=0,398, IC 95% de 0,211 a 0,765. Os automóveis foram responsáveis por 70,83% das lesões medulares, a motocicleta 20,83 e o atropelamento 12,5%. CONCLUSÕES: O TRM incapacita mais adultos jovens do sexo masculino, constituindo a segunda maior causa de incapacidade total entre os sobreviventes de acidentes de trânsito e ocupando um segundo plano em relação a incapacidade funcional. A incidência de sequela por TRM foi de 0,38%, a maioria em ocupantes de automóveis (70,83%.OBJETIVO: Analizar las víctimas de accidentes de tráfico que sufrieron discapacidad debida a un traumatismo raquimedular. MÉTODOS: Se evaluaron los registros de 719 víctimas de accidentes de tráfico que se reclamó el beneficio derivados de los daños corporales debido a accidentes de tráfico, y seleccionadas las víctimas que sufrieron lesiones de la médula espinal. Las variables edad, sexo, tipo de accidente, lesión resultante, y el grado de discapacidad de acuerdo a la Clasificación Internacional del Funcionamiento, Discapacidad y Salud fueron entonces analizadas. RESULTADOS
Mito & música: o trágico no jovem Nietzsche
Lotério, Rafael Antônio dos Santos
2011-01-01
O objetivo desta dissertação é perseguir o conceito de trágico na filosofia do jovem Friedrich Wilhelm Nietzsche. Através do estudo das suas primeiras obras dedicadas à reflexão filosófica, percebemos que a ideia do “trágico” se afirma como ponto central e ganha destaque para as perspectivas de trabalho vindouro para o professor de filologia clássica que se tornaria um dos mais importantes nomes da filosofia contemporânea. Entretanto, mesmo resguardando o valor que as reflexões...
Nisar, Madiha; Wong, Lawrence W Y; Sung, Herman H Y; Haynes, Richard K; Williams, Ian D
2018-06-01
The stoichiometry, X-ray structures and stability of four pharmaceutical cocrystals previously identified from liquid-assisted grinding (LAG) of 11-azaartemisinin (11-Aza; systematic name: 1,5,9-trimethyl-14,15,16-trioxa-11-azatetracyclo[10.3.1.0 4,13 .0 8,13 ]hexadecan-10-one) with trans-cinnamic (Cin), maleic (Mal) and fumaric (Fum) acids are herein reported. trans-Cinnamic acid, a mono acid, forms 1:1 cocrystal 11-Aza:Cin (1, C 15 H 23 NO 4 ·C 9 H 8 O 2 ). Maleic acid forms both 1:1 cocrystal 11-Aza:Mal (2, C 15 H 23 NO 4 ·C 4 H 4 O 4 ), in which one COOH group is involved in self-catenation, and 2:1 cocrystal 11-Aza 2 :Mal (3, 2C 15 H 23 NO 4 ·C 4 H 4 O 4 ). Its isomer, fumaric acid, only affords 2:1 cocrystal 11-Aza 2 :Fum (4). All cocrystal formation appears driven by acid-lactam R 2 2 (8) heterosynthons with short O-H...O=C hydrogen bonds [O...O = 2.56 (2) Å], augmented by weaker C=O...H-N contacts. Despite a better packing efficiency, cocrystal 3 is metastable with respect to 2, probably due to a higher conformational energy for the maleic acid molecule in its structure. In each case, the microcrystalline powders from LAG were useful in providing seeding for the single-crystal growth.
Almagro-Moreno, Salvador; Boyd, E. Fidelma
2009-01-01
Sialic acids comprise a family of nine-carbon ketosugars that are ubiquitous on mammalian mucous membranes. However, sialic acids have a limited distribution among Bacteria and are confined mainly to pathogenic and commensal species. Vibrio pathogenicity island 2 (VPI-2), a 57-kb region found exclusively among pathogenic strains of Vibrio cholerae, contains a cluster of genes (nan-nag) putatively involved in the scavenging (nanH), transport (dctPQM), and catabolism (nanA, nanE, nanK, and nagA) of sialic acid. The capacity to utilize sialic acid as a carbon and energy source might confer an advantage to V. cholerae in the mucus-rich environment of the gut, where sialic acid availability is extensive. In this study, we show that V. cholerae can utilize sialic acid as a sole carbon source. We demonstrate that the genes involved in the utilization of sialic acid are located within the nan-nag region of VPI-2 by complementation of Escherichia coli mutants and gene knockouts in V. cholerae N16961. We show that nanH, dctP, nanA, and nanK are highly expressed in V. cholerae grown on sialic acid. By using the infant mouse model of infection, we show that V. cholerae ΔnanA strain SAM1776 is defective in early intestinal colonization stages. In addition, SAM1776 shows a decrease in the competitive index in colonization-competition assays comparing the mutant strain with both O1 El Tor and classical strains. Our data indicate an important relationship between the catabolism of sialic acid and bacterial pathogenesis, stressing the relevance of the utilization of the resources found in the host's environment. PMID:19564383
Kirjastamine 21. sajandil - trüki oma raamat ise / Rivo Sarapik, Andres Kütt, Stanislav Sinyagin
Sarapik, Rivo, 1981-
2008-01-01
Väikesetiraa̓iliste trükiste kirjastamise etappidest ja soovitusi trükifirmade valikul internetis ning erinevate inimeste kogemusi fotoraamatu või fotoajakirja trükkimisel, kasutades Blurb.com või Lulu.com teenust. Kuni väljatrükini on teenus valdavalt tasuta
La Universidad de Costa Rica en tránsito
Directory of Open Access Journals (Sweden)
Badilla Saxe, Eleonora
2012-02-01
Full Text Available Resumen. La Universidad de Costa Rica en Tránsito es un artículo que pretende dar cuenta del tránsito que ha iniciado la institución en su camino hacia la transdisciplinariedad. Se presenta, en primera instancia, un contexto histórico y referentes teóricos que apuntan a que la Universidad en el Siglo XXI debe iniciar un tránsito, por una parte, de regreso a reflejar el significado de su origen: UNIVERSUS-A-UM (“todo”, “entero”, “universal” superando fragmentaciones y departamentalizaciones y, por otro, hacia una visión transdisciplinar, un pensamiento complejo en sintonía con las realidades biológicas, sociales y culturales del mundo en el siglo XXI. Y, ya que la transdisciplinariedad no se puede llevar a cabo más que en la acción y en la interacción con otros, se reporta sobre una serie de estrategias interconectadas que se están promoviendo Universidad de Costa Rica para ayudar a la institución a iniciar ese tránsito.Abstract. University of Costa Rica in Transit is an article that reports on the journey the institution has started on its path towards transdisciplinarity. On one way, back to the origen: universus (all, whole, universal, overcoming fragmentation and departamentalization. On the other towards a transdisciplinary vision and complex thinking in accordance with the new biological, social and cultural realities of our world. Interactive and interrelated strategies that are currently beeing promoted to stimulate the institution towards transdisciplinarity are reported here. It is important to remember that transdisciplinarity can only be reflected in action, and in the interaction with others.
Muster, Aleksandra
2016-01-01
Namen raziskave je bil na vzorcu podjetij slovenske predelovalne industrije ugotoviti, kako dejavniki kot so odzivna tržna naravnanost, organizacijsko učenje, proaktivna tržna naravnanost in inovativna organizacijska kultura vplivajo na tržni uspeh novih izdelkov ob pogojih uporabe sodobnih metod v okviru procesa razvoja novih izdelkov, tržnih in tehnoloških sprememb in uporabe zunanjih virov za inovacije v okviru procesa razvoja novih izdelkov. Večina ugotovitev iz empirične raziskave na ...
Transactivation of the proximal promoter of human oxytocin gene by TR4 orphan receptor
International Nuclear Information System (INIS)
Wang, C.-P.; Lee, Y.-F.; Chang, C.; Lee, H.-J.
2006-01-01
The human testicular receptor 4 (TR4) shares structural homology with members of the nuclear receptor superfamily. Some other members of this superfamily were able to regulate the transcriptional activity of the human oxytocin (OXT) promoter by binding to the first DR0 regulatory site. However, little investigation was conducted systematically in the study of the second dDR4 site of OXT proximal promoter, and the relationship between the first and the second sites of OXT promoter. Here, we demonstrated for the first time that TR4 could increase the proximal promoter activity of the human OXT gene via DR0, dDR4, and OXT (both DR0 and dDR4) elements, respectively. TR4 might induce OXT gene expression through the OXT element in a dose-dependent manner. However, there is no synergistic effect between DR0 and dDR4 elements during TR4 transactivation. Taken together, these results suggested that TR4 should be one of important regulators of OXT gene expression
Marinization concept for the TRICEPT TR600 robot
Energy Technology Data Exchange (ETDEWEB)
Meyer, A.; Aust, E.; Niemann, H.R.; Santos, J.F. dos [GKSS-Forschungszentrum Geesthacht GmbH (Germany). Inst. fuer Materialforschung; Hammerin, R.; Neumann, K.E. [Neos Robotics AB, Taeby (Sweden); Gibson, D. [National Hyperbaric Centre, Aberdeen (United Kingdom)
1998-11-01
The need for automated welding repair systems of marine structures, ship hulls and nuclear installations had lead to an increasing demand for subsea robots. Considering the application of friction welding to perform underwater repairs, a TRICEPT TR600 robot has been identified as the most suitable system to withstand the high reaction forces characteristic of this process. This study reviews initially the research and development work carried out at GKSS to modify and test a Siemens-MANUTEC robot. After a description of the TRICEPT TR600 robot a marinization concept is presented and discussed in detail. Problems of galvanic corrosion in seawater are addressed in a separate chapter. The deflection of the robot in subsea water currents is estimated with a worst-case calculation. (orig.) [Deutsch] Der Wunsch, Roboter auch unter Wasser einsetzen zu koennen, waechst mit steigendem Interesse nach automatisierten Schweissverfahren fuer Reparaturen an marinen Bauwerken, Schiffsruempfen und in Kernenergieanlagen. Fuer den Einsatz von Reibschweissverfahren fuer diese Reparaturen wurde der TRICEPT TR600-Roboter ausgewaehlt, da dieser auch den charakteristisch hohen Prozesskraeften widerstehen kann. Die notwendigen Modifikationen und Pruefungen werden beispielhaft anhand des bei der GKSS modifizierten Siemens-MANUTEC-Roboters vorgestellt. Nach einer Beschreibung des TRICEPT-Roboters werden die notwendigen Umbaumassnahmen detailliert dargestellt und diskutiert. Auf die Problematik der galvanischen Korrosion in Seewasser wird in einem gesonderten Kapitel naeher eingegangen. Zusaetzlich wird eine moegliche Ablenkung des Roboters durch Wasserstroemung ueberschlaegig berechnet. (orig.)
Nicotine permeability across the buccal TR146 cell culture model and porcine buccal mucosa in vitro
DEFF Research Database (Denmark)
Nielsen, Hanne Mørck; Rassing, Margrethe Rømer
2002-01-01
The present study was conducted to investigate and compare the effect of pH and drug concentration on nicotine permeability across the TR146 cell culture model and porcine buccal mucosa in vitro. As a further characterization of the TR146 cell culture model, it was explored whether the results were...... comparable for bi-directional and uni-directional transport in the presence of a transmembrane pH gradient. Nicotine concentrations between 10(-5) and 10(-2) M were applied to the apical side of the TR146 cell culture model or the mucosal side of porcine buccal mucosa. Buffers with pH values of 5.5, 7.......4 and 8.1 were used to obtain different fractions of non- and mono-ionized nicotine. The apparent permeability (P(app)) of nicotine across both models increased significantly with increasing pH, and the P(app) values obtained with the two models could be correlated in a linear manner. With increasing...
The Evolution of NR TrA (Nova TrA 2008) from 2008 through 2017
Walter, Frederick M.; Burwitz, Vadim; Kafka, Stella
2018-06-01
The classical nova NR TrA was discovered as an O-type optically-thick classical nova. There is no evidence that it formed dust. Within four years the envelope became sufficiently thin to reveal an eclipsing accretion disk-dominated system with orbitally-modulated permitted lines of C IV, N V, and O VI. XMM observations reveal a non-eclipsing soft X-ray source and a deeply-eclipsing UV continuum. We will present the first ten years of optical spectral evolution of this system accompanied by ten years of BVRIJHK photometry, with an eye to deciphering the current nature of the system.
Counsellors Respond to the DSM-IV-TR
Strong, Tom; Gaete, Joaquin; Sametband, Ines N.; French, Jared; Eeson, Jen
2012-01-01
The Diagnostic and Statistical Manual of Mental Disorders (DSM-IV-TR) is an administrative fact for many counsellors. This psychiatric approach to formulating client concerns runs counter to those used by counsellors of many approaches (e.g., systemic, feminist). Using an online survey of counsellors (N = 116), invited contributions to a website…
International Nuclear Information System (INIS)
Thorell, J.-O.; Stone-Elander, S.
1993-01-01
A method for the production of two new carbon-11 labelled difunctional radiolabelling precursors, [ 11 C]diethyl oxalate,2, and [ 11 C]oxalic acid, 3 is described. Methyl chloroformate was reacted with no-carrier-added [ 11 C]cyanide to generate the intermediate nitrile, methyl [ 11 C]cyanoformate. Alcoholysis with HC1 in ethanol generated 2, which could subsequently be converted to 3 with aqueous acid. The total time of preparation from end-or-trapping of [ 11 C]cyanide was 6-7 min using combined microwave and thermal treatment or, by exclusively thermal treatment, 15 and 20 min for 2 and 3, respectively. The radiochemical conversion of [ 11 C]cyanide to 2 and 3 was ∼ 80% and ∼ 70%, respectively. Both 2 and 3 were used in a model reaction with 1,2-phenylenediamine to synthesize the heterocyclic compound, 2,3-dihydroxyquinoxaline, a basic structural unit in antagonists for the excitatory amino acid receptor system. (Author)
A 3x1 integrated pyroelectric sensor based on VDF/TrFE copolymer
Setiadi, D.; Setiadi, D.; Sarro, P.M.; Regtien, Paulus P.L.
1996-01-01
This paper presents an integrated pyroelectric sensor based on a vinylidene fluoride¿trifluoroethylene (VDF/TrFE) copolymer. A silicon substrate that contains field-effect transistor (FET) readout electronics is coated with the VDF/TrFE copolymer film using a spin-coating technique. On-chip poling
Modelling of three-dimensional structures of cytochromes P450 11B1 and 11B2.
Belkina, N V; Lisurek, M; Ivanov, A S; Bernhardt, R
2001-12-15
The final steps of the biosynthesis of glucocorticoids and mineralocorticoids in the adrenal cortex require the action of two different cytochromes P450--CYP11B1 and CYP11B2. Homology modelling of the three-dimensional structures of these cytochromes was performed based on crystallographic coordinates of two bacterial P450s, CYP102 (P450BM-3) and CYP108 (P450terp). Principal attention was given to the modelling of the active sites and a comparison of the active site structures of CYP11B1 and CYP11B2 was performed. It can be demonstrated that key residue contacts within the active site appear to depend on the orientation of the heme. The obtained 3D structures of CYP11B1 and CYP11B2 were used for investigation of structure-function relationships of these enzymes. Previously obtained results on naturally occurring mutants and on mutants obtained by site-directed mutagenesis are discussed.
SU-F-I-58: Image Quality Comparisons of Different Motion Magnitudes and TR Values in MR-PET
International Nuclear Information System (INIS)
Patrick, J; Thompson, R; Tavallaei, M; Drangova, M; Stodilka, R; Gaede, S
2016-01-01
Purpose: The aim of this work is to evaluate the accuracy and sensitivity of a respiratory-triggered MR-PET protocol in detecting four different sized lesions at two different magnitudes of motion, with two different TR values, using a novel PET-MR-CT compatible respiratory motion phantom. Methods: The eight-compartment torso phantom was setup adjacent to the motion stage, which moved four spherical compartments (28, 22, 17, 10 mm diameter) in two separate (1 and 2 cm) linear motion profiles, simulating a 3.5 second respiratory cycle. Scans were acquired on a 3T MR-PET system (Biograph mMR; Siemens Medical Solutions, Germany). MR measurements were taken with: 1) Respiratory-triggered T2-weighted turbo spin echo (BLADE) sequence in coronal orientation, and 2) Real-time balanced steady-state gradient echo sequence (TrueFISP) in coronal and sagittal planes. PET was acquired simultaneously with MR. Sphere geometries and motion profiles were measured and compared with ground truths for T2 BLADE-TSE acquisitions and real time TrueFISP images. PET quantification and geometry measurements were taken using standardized uptake values, voxel intensity plots and were compared with known values, and examined alongside MR-based attenuation maps. Contrast and signal-to-noise ratios were also compared for each of the acquisitions as functions of motion range and TR. Results: Comparison of lesion diameters indicate the respiratory triggered T2 BLADE-TSE was able to maintain geometry within −2 mm for 1 cm motion for both TR values, and within −3.1 mm for TR = 2000 ms at 2 cm motion. Sphere measurements in respiratory triggered PET images were accurate within +/− 5 mm for both ranges of motion for 28, 22, and 17 mm diameter spheres. Conclusion: Hybrid MR-PET systems show promise in imaging lung cancer in non-compliant patients, with their ability to acquire both modalities simultaneously. However, MR-based attenuation maps are still susceptible to motion derived artifacts and
SU-F-I-58: Image Quality Comparisons of Different Motion Magnitudes and TR Values in MR-PET
Energy Technology Data Exchange (ETDEWEB)
Patrick, J; Thompson, R [Lawson Health Research Institute, London, Ontario (Canada); Tavallaei, M; Drangova, M [Robarts Research Institute, London, Canada, London, Ontario (Canada); Stodilka, R [Western University, Canada, London, Ontario (Canada); Gaede, S [London Regional Cancer Program, London, Ontario (Canada)
2016-06-15
Purpose: The aim of this work is to evaluate the accuracy and sensitivity of a respiratory-triggered MR-PET protocol in detecting four different sized lesions at two different magnitudes of motion, with two different TR values, using a novel PET-MR-CT compatible respiratory motion phantom. Methods: The eight-compartment torso phantom was setup adjacent to the motion stage, which moved four spherical compartments (28, 22, 17, 10 mm diameter) in two separate (1 and 2 cm) linear motion profiles, simulating a 3.5 second respiratory cycle. Scans were acquired on a 3T MR-PET system (Biograph mMR; Siemens Medical Solutions, Germany). MR measurements were taken with: 1) Respiratory-triggered T2-weighted turbo spin echo (BLADE) sequence in coronal orientation, and 2) Real-time balanced steady-state gradient echo sequence (TrueFISP) in coronal and sagittal planes. PET was acquired simultaneously with MR. Sphere geometries and motion profiles were measured and compared with ground truths for T2 BLADE-TSE acquisitions and real time TrueFISP images. PET quantification and geometry measurements were taken using standardized uptake values, voxel intensity plots and were compared with known values, and examined alongside MR-based attenuation maps. Contrast and signal-to-noise ratios were also compared for each of the acquisitions as functions of motion range and TR. Results: Comparison of lesion diameters indicate the respiratory triggered T2 BLADE-TSE was able to maintain geometry within −2 mm for 1 cm motion for both TR values, and within −3.1 mm for TR = 2000 ms at 2 cm motion. Sphere measurements in respiratory triggered PET images were accurate within +/− 5 mm for both ranges of motion for 28, 22, and 17 mm diameter spheres. Conclusion: Hybrid MR-PET systems show promise in imaging lung cancer in non-compliant patients, with their ability to acquire both modalities simultaneously. However, MR-based attenuation maps are still susceptible to motion derived artifacts and
TR146 cells grown on filters as a model of human buccal epithelium
DEFF Research Database (Denmark)
Nielsen, H M; Rassing, M R; Nielsen, Hanne Mørck
2000-01-01
The objective of the present study was to evaluate the TR146 cell culture model as an in vitro model of human buccal epithelium. For this purpose, the permeability of water, mannitol and testosterone across the TR146 cell culture model was compared to the permeability across human, monkey...
Energy Technology Data Exchange (ETDEWEB)
Herbert, M; Pichat, L [Commissariat a l' Energie Atomique, Saclay (France).Centre d' Etudes Nucleaires
1961-07-01
A description of the synthesis of dimethyl-1,1 guanylguanidine-{sup 14}C-2,4 hydrochloride passing through the {sup 14}C{sub 2} dicyandiamide. The overall yield with respect to Ba{sup 14}CO{sub 3} is 38 per cent. (author) [French] Description de la synthese du chlorhydrate de dimethyl-1,1 guanylguanidine {sup 14}C-2,4 par l'intermediaire de la dicyandiamide {sup 14}C{sub 2}. Le rendement global par rapport a {sup 14}CO{sub 3}Ba est de 38 pour cent. (auteur)
76 FR 60014 - Combined Notice of Filings #2
2011-09-28
.... Description: Attachment A to Petition Amendment of ORNI 14 LLC. Filed Date: 09/20/2011. Accession Number...: PacifiCorp submits tariff filing per 35.13(a)(2)(iii: Bountiful City Amended and Restated Parrish Sub...)(2)(iii: TrAILCo submits revisions to PJM Tariff Attachment H- 18 to be effective 11/19/2011. Filed...
Oracle JDeveloper 11gR2 Cookbook
Haralabidis, Nick
2012-01-01
"Oracle JDeveloper 11gR2 Cookbook" is a practical cookbook which goes beyond the basics with immediately applicable recipes for building ADF applications at an intermediate-to-advanced level. If you are a JavaEE developer who wants to go beyond the basics of building ADF applications with Oracle JDeveloper 11gR2 and get hands on with practical recipes, this book is for you. You should be comfortable with general Java development principles, the JDeveloper IDE, and ADF basics
Huang, Liyi; Xuan, Yi; Koide, Yuichiro; Zhiyentayev, Timur; Tanaka, Masamitsu; Hamblin, Michael R
2012-08-01
Antimicrobial photodynamic therapy (APDT) employs a non-toxic photosensitizer (PS) and visible light, which in the presence of oxygen produce reactive oxygen species (ROS), such as singlet oxygen ((1) O(2), produced via Type II mechanism) and hydroxyl radical (HO(.), produced via Type I mechanism). This study examined the relative contributions of (1) O(2) and HO(.) to APDT killing of Gram-positive and Gram-negative bacteria. Fluorescence probes, 3'-(p-hydroxyphenyl)-fluorescein (HPF) and singlet oxygen sensor green reagent (SOSG) were used to determine HO(.) and (1) O(2) produced by illumination of two PS: tris-cationic-buckminsterfullerene (BB6) and a conjugate between polyethylenimine and chlorin(e6) (PEI-ce6). Dimethylthiourea is a HO(.) scavenger, while sodium azide (NaN(3)) is a quencher of (1) O(2). Both APDT and killing by Fenton reaction (chemical generation of HO(.)) were carried out on Gram-positive bacteria (Staphylococcus aureus and Enterococcus faecalis) and Gram-negative bacteria (Escherichia coli, Proteus mirabilis, and Pseudomonas aeruginosa). Conjugate PEI-ce6 mainly produced (1) O(2) (quenched by NaN(3)), while BB6 produced HO(.) in addition to (1) O(2) when NaN(3) potentiated probe activation. NaN(3) also potentiated HPF activation by Fenton reagent. All bacteria were killed by Fenton reagent but Gram-positive bacteria needed a higher concentration than Gram-negatives. NaN(3) potentiated Fenton-mediated killing of all bacteria. The ratio of APDT killing between Gram-positive and Gram-negative bacteria was 2 or 4:1 for BB6 and 25:1 for conjugate PEI-ce6. There was a NaN(3) dose-dependent inhibition of APDT killing using both PEI-ce6 and BB6 against Gram-negative bacteria while NaN(3) almost failed to inhibit killing of Gram-positive bacteria. Azidyl radicals may be formed from NaN(3) and HO(.). It may be that Gram-negative bacteria are more susceptible to HO(.) while Gram-positive bacteria are more susceptible to (1) O(2). The differences in NaN
Métodos de regulación de tráfico para redes urbanas
Canca Ortiz, José David
1996-01-01
En esta tesis se analiza el problema de la regulación de señales semafóricas en redes urbanas y su integración en un sistema de control del tráfico. La clasificación más habitual de los sistemas de control de tráfico se basa en la posibilidad de respuesta de los mismos frente a los continuos cambios en la evolución del comportamiento d el tráfico. Desde este punto de vista se pueden distinguir sistemas a tiempo fijo, semidinámicos y dinámicos (de segunda y tercera generación). El objetivo de ...
Xylan oligosaccharides and cellobiohydrolase I (TrCel7A interaction and effect on activity
Directory of Open Access Journals (Sweden)
Baumann Martin J
2011-10-01
Full Text Available Abstract Background The well-studied cellulase mixture secreted by Trichoderma reesei (anamorph to Hypocrea jecorina contains two cellobiohydolases (CBHs, cellobiohydrolase I (TrCel7A and cellobiohydrolase II (TrCeI6A, that are core enzymes for the solubilisation of cellulose. This has attracted significant research interest because of the role of the CBHs in the conversion of biomass to fermentable sugars. However, the CHBs are notoriously slow and susceptible to inhibition, which presents a challenge for the commercial utilisation of biomass. The xylans and xylan fragments that are also present in the biomass have been suggested repeatedly as one cause of the reduced activity of CHBs. Yet, the extent and mechanisms of this inhibition remain poorly elucidated. Therefore, we studied xylan oligosaccharides (XOSs of variable lengths with respect to their binding and inhibition of both TrCel7A and an enzyme variant without the cellulose-binding domain (CBM. Results We studied the binding of XOSs to TrCel7A by isothermal titration calorimetry. We found that XOSs bind to TrCel7A and that the affinity increases commensurate with XOS length. The CBM, on the other hand, did not affect the affinity significantly, which suggests that XOSs may bind to the active site. Activity assays of TrCel7A clearly demonstrated the negative effect of the presence of XOSs on the turnover number. Conclusions On the basis of these binding data and a comparison of XOS inhibition of the activity of the two enzyme variants towards, respectively, soluble and insoluble substrates, we propose a competitive mechanism for XOS inhibition of TrCel7A with phosphoric swollen cellulose as a substrate.
Organisation and standardisation of information in SWISS-PROT and TrEMBL
Directory of Open Access Journals (Sweden)
Michele Magrane
2006-01-01
Full Text Available SWISS-PROT is a curated, non-redundant protein sequence database which provides a high level of annotation and is integrated with a large number of other biological databases. It is supplemented by TrEMBL, a computer-annotated database which contains translations of all coding sequences in the EMBL Nucleotide Sequence Database which are not yet in SWISS-PROT. Each fully curated SWISS-PROT entry contains as much up-to-date information as possible from a variety of sources and the high quality of the annotation in SWISS-PROT provides the basis for the procedure which is used to automatically annotate the TrEMBL database. The large amounts of different data types found in both databases are stored in a highly structured and uniform manner and this structured organisation means that SWISS-PROT and TrEMBL together provide a comprehensive resource with data that are readily accessible for users and easily retrievable by computer programs.
Supraconductivity of TR-Ru3Si2 compounds (TR = La, Ce)
International Nuclear Information System (INIS)
Godart, C.; Gupta, L.C.; Parks, R.D.; Rauschwalbe, U.; Alheim, U.; Gottwick, U.; Lieke, W.; Steglich, F.
1984-01-01
A new family of superconducting ternary silicides MRu 3 Si 2 with M = La (Tsub(s) approximately 7 K), Y and Th was discovered by Barz and Vandenberg. Same compounds with M from Nd to Tm are magnetic and not superconductors. We studied superconductivity in the solid solution Cesub(1-x)Lasub(x)Ru 3 Si 2 of hexagonal structure from x = 0 to 1. CeRu 3 Si 2 is type II superconductor (Tsub(s) approximately 1 K), like LaRu 3 Si 2 , and is mixed valent (M.V.). Spin fluctuations temperature (Tsub(sf) approximately 440 K) is between these of non superconducting M.V. like CeSn 3 (Tsub(sf) approximately 270) and these of superconducting M.V. like CeRu 2 (Tsub(sf) approximately 770 K). Cesub(1-x)Lasub(x)Ru 3 Si 2 is the first M.V. system of Ce which is superconductor from x = 0 to 1 [fr
Simulasi Kinerja Jaringan Nirkabel IEEE-802.11a dan IEEE-802.11g Menggunakan NS-2
Directory of Open Access Journals (Sweden)
Helm Fitriawan
2014-03-01
Full Text Available Wireless network uses transmission media based on radio waves. This type of networks is mainly useddue to its efficiency and mobility in data exchanging. This paper reports the modeling and simulation of wirelessnetworks based on Cisco Aironet 1130ag access point devices with IEEE 802.11a and IEEE 802.11g standards. Themodeling and simulation are performed using network simulator version 2 (NS-2 that is installed on operationsystem Linux Ubuntu v.10.10. The NS-2 is commonly used and works well in numerous types of network simulation. From simulation, we obtain quality of service parameters by employing several simulation scenarios in terms ofnumber of nodes, distances, and packet data sizes. It can be concluded from simulation results that the IEEE 802.11gnetworks transfer data with better quality than those of IEEE 802.11a networks. Furthermore, the IEEE 802.11gnetworks provide a higher throughput, with smaller amount of delay and packet loss percentage compared to thoseof IEEE 802.11a networks.
1,1′-Binaphthyl-2,2′-dicarboxylic acid–urea (1/1
Directory of Open Access Journals (Sweden)
Edwin Weber
2008-10-01
Full Text Available In the title co-crystal, C22H14O4·CH4N2O, the 1,1′-binaphthyl-2,2′-dicarboxylic acid (BNDA and urea molecules are connected via a system of hydrogen bonds into a chiral two-dimensional polymeric structure parallel to the (001 plane. As the crystal is centrosymmetric, it consists of alternately stacked BNDA–urea layers of opposite chirality. The urea H atoms trans to the C=O group are bonded in a chelating mode [R12(6] to the carbonyl O atom from one of the carboxylic acid groups which, in turn, acts as the donor of an O—H...O hydrogen bond to another urea molecule. The [010] chains thus formed are further connected via an R22(8 hydrogen-bond motif formed between urea and the second carboxylic acid group of BNDA.
Henseler, Jörg
2006-01-01
In Wissenschaft und Praxis wird die Trägheit der Konsumenten als Ursache der geringen Wechselrate im deutschen Strommarkt für Haushaltskunden diskutiert. Der vorliegende Beitrag arbeitet heraus, dass es sich bei dieser Argumentation entweder um eine Tautologie oder ein Synomym für den Verbleib in
MR imaging of intracranial hemorrhage in neonates and infants at 2.35 Tesla
International Nuclear Information System (INIS)
Zuerrer, M.; Martin, E.; Boltshauser, E.
1991-01-01
The variations of the relative signal intensity and the time dependent changing contrast of intracranial hemorrhages on high-field spin-echo magnetic resonance images (MRI) were studied in 28 pediatric patients. For T1-weighted images, a repetition time (TR) of 500 ms and an echo time (TE) of 30 or 23 ms was used. The corresponding times for T2-weighted images were TR 3000 ms and TE 120 ms. Intracranial hematomas, less than 3 days old, were iso- to mildly hypointense on short TR/TE scans and markedly hypointense on long TR/TE scans (acute stage). In the following four days the signal of the hematomas became hyperintense on short TR/TE scans, beginning in the periphery and proceeding towards the center. On long TR/TE scans the signal remained markedly hypointense (early subacute stage). 7-14 days old hematomas were of high signal intensity on short TR/TE scans. On long TR/TE scans they appeared hypointense in the center and hyperintense in the periphery (late subacute stage). By the end of the second week the hematomas were of high signal intensity on all pulse sequences (chronic stage). Chronic hematomas were surrounded by a parenchymal rim of hypointensity on long TR/TE scans. 28 neonates and infants (with 11 follow-up examinations) of 31.5-70.6 weeks postconceptional age (PCA), with an intracranial hemorrhage were examined. The etiologies of the hemorrhages were: Asphyxia (17 cases), brain infarct (2), thrombocytopenia (1), clotting disorder (1) and unknown origin (7). The aim of this study was to describe the appearance of intracranial hemorrhages in neonates and infants with MRI at 2.35 Tesla using spin-echo sequences. (orig.)
Trükitud majad : korterelamu Pariisis / Triin Ojari
Ojari, Triin, 1974-
1998-01-01
Tänaste fassaadide keerukusest, paindlikkusest, vastuolulisusest. Trükitud klaasist fassaadi näiteks toodud elamu uue Pariisi Rahvusraamatukogu kõrval. Hoone pinna moodustavad suured värvitrükis klaaspaneelid, molle motiivid on laenatud renessanssmaalidelt. Katkematu lindina jooksevad ümber maja etteulatuvad metallrõdud.
Tempo e Trânsito na Experiência Subjetiva de Motoristas
Ana Inez Oka Elvas de Lima; Sylvia Cavalcante
2015-01-01
Esta pesquisa investiga como são percebidos e vivenciados o tempo e a pressa no trânsito por motoristas de Fortaleza, identificando e analisando seus estados subjetivos e comportamentos associados a essa experiência. Para a coleta de dados, organizaram-se quatro grupos focais, a partir dos quais emergiram diversos elementos relacionados ao tempo e à pressa e à incidência de comportamentos inadequados no trânsito, segundo o sexo e a idade dos participantes. Para analisar os dados obtidos nas d...
Assessment of lnternational Space Station (ISS) Lithium-ion Battery Thermal Runaway (TR)
Graika, Jason
2017-01-01
This task was developed in the wake of the Boeing 787 Dreamliner lithium-ion battery TR incidents of January 2013 and January 2014. The Electrical Power Technical Discipline Team supported the Dreamliner investigations and has followed up by applying lessons learned to conduct an introspective evaluation of NASA's risk of similar incidents in its own lithium-ion battery deployments. This activity has demonstrated that historically NASA, like Boeing and others in the aerospace industry, has emphasized the prevention of TR in a single cell within the battery (e.g., cell screening) but has not considered TR severity-reducing measures in the event of a single-cell TR event. center dotIn the recent update of the battery safety standard (JSC 20793) to address this paradigm shift, the NASA community included requirements for assessing TR severity and identifying simple, low-cost severity reduction measures. This task will serve as a pathfinder for meeting those requirements and will specifically look at a number of different lithium-ion batteries currently in the design pipeline within the ISS Program batteries that, should they fail in a Dreamliner-like incident, could result in catastrophic consequences. This test is an abuse test to understand the heat transfer properties of the cell and ORU in thermal runaway, with radiant barriers in place in a flight like test in on orbit conditions. This includes studying the heat flow and distribution in the ORU. This data will be used to validate the thermal runaway analysis. This test does not cover the ambient pressure case. center dotThere is no pass/ fail criteria for this test.
Analysis of Risk and Burden of Dysentery Associated with Floods from 2004 to 2010 in Nanning, China.
Liu, Zhidong; Ding, Guoyong; Zhang, Ying; Xu, Xin; Liu, Qiyong; Jiang, Baofa
2015-11-01
This study aimed to examine the association between floods and the morbidity of dysentery and to quantify the burden of dysentery due to floods in Nanning, China. A generalized additive mixed model was conducted to assess the relationship between monthly morbidity of dysentery and floods from 2004 to 2010. The years lived with disability (YLDs) of dysentery attributable to floods were then estimated based on the WHO framework of the burden of disease study for calculating the potential impact fraction. The relative risk (RR) of floods on the morbidity of dysentery was 1.44 (95% confidence interval [CI] = 1.18-1.75). The models suggest that a potential 1-day rise in flood duration may lead to 8% (RR = 1.08, 95% CI = 1.04-1.12) increase in the morbidity of dysentery. The average attributable YLD per 1,000 of dysentery caused by floods were 0.013 in males, 0.005 in females, and 0.009 in persons. Our study confirms that floods have significantly increased the risk and the burden of dysentery in the study area. Public health action should be taken to prevent and control the potential risk of dysentery after floods. Vulnerable groups such as males and children should be paid more attention. © The American Society of Tropical Medicine and Hygiene.
Almagro-Moreno, Salvador; Boyd, E Fidelma
2009-09-01
Sialic acids comprise a family of nine-carbon ketosugars that are ubiquitous on mammalian mucous membranes. However, sialic acids have a limited distribution among Bacteria and are confined mainly to pathogenic and commensal species. Vibrio pathogenicity island 2 (VPI-2), a 57-kb region found exclusively among pathogenic strains of Vibrio cholerae, contains a cluster of genes (nan-nag) putatively involved in the scavenging (nanH), transport (dctPQM), and catabolism (nanA, nanE, nanK, and nagA) of sialic acid. The capacity to utilize sialic acid as a carbon and energy source might confer an advantage to V. cholerae in the mucus-rich environment of the gut, where sialic acid availability is extensive. In this study, we show that V. cholerae can utilize sialic acid as a sole carbon source. We demonstrate that the genes involved in the utilization of sialic acid are located within the nan-nag region of VPI-2 by complementation of Escherichia coli mutants and gene knockouts in V. cholerae N16961. We show that nanH, dctP, nanA, and nanK are highly expressed in V. cholerae grown on sialic acid. By using the infant mouse model of infection, we show that V. cholerae DeltananA strain SAM1776 is defective in early intestinal colonization stages. In addition, SAM1776 shows a decrease in the competitive index in colonization-competition assays comparing the mutant strain with both O1 El Tor and classical strains. Our data indicate an important relationship between the catabolism of sialic acid and bacterial pathogenesis, stressing the relevance of the utilization of the resources found in the host's environment.
Modeller forudsiger klimarespons hos træer og buske
DEFF Research Database (Denmark)
Meilby, Henrik
2015-01-01
Modeller baseret på målinger af træer og buskes årringe afslører, hvilke klimatiske faktorer der lokalt er afgørende for deres vækst. Det kan hjælpe os med at forstå nogle af de ændringer, der sker i vegetationen, for eksempel i Grønland og i alpine områder. Med udgangspunkt i klimafrem- skrivnin......Modeller baseret på målinger af træer og buskes årringe afslører, hvilke klimatiske faktorer der lokalt er afgørende for deres vækst. Det kan hjælpe os med at forstå nogle af de ændringer, der sker i vegetationen, for eksempel i Grønland og i alpine områder. Med udgangspunkt i klimafrem...
Kinoshita, M.; Kawamura, K.; Lin, W.
2015-12-01
During the Nankai Trough Seismogenic Zone Experiments (NanTroSEIZE) of the Integrated Ocean Drilling Program (IODP), the advanced piston corer temperature (APC-T) tool was used to determine in situ formation temperatures while piston coring down to ~200 m below sea floor. When the corer is fired into the formation, temperature around the shoe abruptly increases due to the frictional heating. The temperature rise due to the frictional heat at the time of penetration is 10 K or larger. We found that the frictional temperature rise (=maximum temperature) increases with increasing depth, and that its intersection at the seafloor seems non-zero. Frictional heat energy is proportional to the maximum temperature rise, which is confirmed by a FEM numerical simulation of 2D cylindrical system. Here we use the result of numerical simulation to convert the observed temperature rise into the frictional heat energy. The frictional heat energy is represented as the product of the shooting length D and the shear stress (τ) between the pipe and the sediment. Assuming a coulomb slip regime, the shear stress is shows as: τ= τ0 + μ*(Sv-Pp), where τ0 is the cohesive stress, μ the dynamic frictional coefficient between the pipe and the sediment, Sv the normal stress at the pipe, and Pp the pore pressure. This can explain the non-zero intersection as well as depth-dependent increase for the frictional heating observed in the APC-T data. Assuming a hydrostatic state and by using the downhole bulk density data, we estimated the friction coefficient for each APC-T measurement. For comparison, we used the vane-shear strength measured on core samples to estimate the friction coefficients. The frictional coefficients μ were estimated as ranging 0.01 - 0.06, anomalously lower than expected for shallow marine sediments. They were lower than those estimated from vane-shear data, which range 0.05 to 0.2. Still, both estimates exhibit a significant increase in the friction coefficient at
Blimp-1-Dependent IL-10 Production by Tr1 Cells Regulates TNF-Mediated Tissue Pathology.
Directory of Open Access Journals (Sweden)
Marcela Montes de Oca
2016-01-01
Full Text Available Tumor necrosis factor (TNF is critical for controlling many intracellular infections, but can also contribute to inflammation. It can promote the destruction of important cell populations and trigger dramatic tissue remodeling following establishment of chronic disease. Therefore, a better understanding of TNF regulation is needed to allow pathogen control without causing or exacerbating disease. IL-10 is an important regulatory cytokine with broad activities, including the suppression of inflammation. IL-10 is produced by different immune cells; however, its regulation and function appears to be cell-specific and context-dependent. Recently, IL-10 produced by Th1 (Tr1 cells was shown to protect host tissues from inflammation induced following infection. Here, we identify a novel pathway of TNF regulation by IL-10 from Tr1 cells during parasitic infection. We report elevated Blimp-1 mRNA levels in CD4+ T cells from visceral leishmaniasis (VL patients, and demonstrate IL-12 was essential for Blimp-1 expression and Tr1 cell development in experimental VL. Critically, we show Blimp-1-dependent IL-10 production by Tr1 cells prevents tissue damage caused by IFNγ-dependent TNF production. Therefore, we identify Blimp-1-dependent IL-10 produced by Tr1 cells as a key regulator of TNF-mediated pathology and identify Tr1 cells as potential therapeutic tools to control inflammation.
DEFF Research Database (Denmark)
Larsen, Birgit Tine; Læssøe, Uffe; Kjær, Thomas
forstærker denne risiko. Formål: Gennem effektiv og sikker træning at øge RA patienters aerob kapacitet og muskel styrke for dermed atlette patienternes daglige aktiviteter. Patienter: Voksne patienter (> 18 år) med diagnosen reumatoid artrit ifølge ARA eller ACR/EULAR kriterierne,funktionsklasserne I, II og...... III, i primær eller sekundær sektoren. Intervention/er: Kortvarig land- eller vandbaseret højintensitets træning af aerob kapacitet, kortvarig eller længerevarendeland-baseret høj-intensitets træning af aerob kapacitet i kombination med muskelstyrke træning oglængerevarende land-baseret høj......-intensitets styrke træning. Inkluderet studier: Èt systematisk review og to randomiseret klinisk kontrolleret studier (RCT). Outcomes: Aerob kapacitet, maksimal muskelstyrke, selv-rapporteret smerte, funktionsevne, sygdomsaktivitet,radiologisk ledskade og uønskede bivirkninger. Søgestrategi:Følgende databaser blev...
Nano-structured variable capacitor based on P(VDF-TrFE) copolymer and carbon nanotubes
Lakbita, I.; El-Hami, K.
2018-02-01
A newly organic capacitor was conceived with a variable capacitance using the inverse piezoelectric effect. The device consists of two parallel plates of carbon nanotubes (CNTs), known for their large surface area, high sensitivity and high electric conductivity, separated by a thin film of a dielectric layer of Polyinylidene fluoride and trifluoroehtylene (P(VDF-TrFE)) promising material for piezoelectric and ferroelectric properties. The obtained architecture is the CNT/PVDF-TrFE/CNT capacitor device. In this study, an ultra-thin film of P(VDF-TrFE) (54/46) with thickness of 20 nm was elaborated on highly oriented pyrolytic graphite (HOPG) by spin-coating. The morphology of the ultra-thin film and the mechanical behavior of CNT/P(VDF-TrFE)/CNT system were studied using the atomic force microscopy (AFM) combined with a lock-in amplifier in contact mode. All changes in applied voltage induce a change in thin film thickness according to the inverse piezoelectric effect that affect, consequently the capacitance. The results showed that the ratio of capacitance change ΔC to initial capacitance C0 is ΔC/C0=5%. This value is sufficient to use P(VDF-TrFE) as variable organic capacitor.
Nadležnost upravnih sudova u zaštiti tržišnog natjecanja
Directory of Open Access Journals (Sweden)
Lidija Rostaš-Beroš
2014-01-01
Full Text Available U radu se razmatra nadležnost upravnih sudova kroz do sada donesene zakone o zaštiti tržišnog natjecanja u Republici Hrvatskoj. Kako su se mijenjali propisi kojima je uređivana zaštita tržišnog natjecanja, hrvatsko pravo tržišnog natjecanja sve se više usklađivalo s europskim pravom, što je bila i namjera s obzirom na pripreme, a zatim i ulazak Republike Hrvatske u članstvo Europske unije. Međutim, iz istog razloga je provedena i reorganizacija upravnog sudovanja pa su se mijenjali i upravni sudovi nadležni za ocjenjivanje zakonitosti akata donesenih u postupcima kontrole poštovanja pravila o tržišnom natjecanju.
DEFF Research Database (Denmark)
Rosengren, Anna; Hägglund, Per; Anderson, Lars Steen
2012-01-01
The N-terminal catalytic module of beta-mannanase TrMan5A from the filamentous fungus Trichoderma reesei is classified into family 5 of glycoside hydrolases. It is further classified in clan A with a (beta/alpha)(8) barrel configuration and has two catalytic glutamates (E169 and E276). It has at ...
Kinematic MRI using short TR single shot fast spin echo (SSFSE) in evaluating swallowing
Energy Technology Data Exchange (ETDEWEB)
Isogai, Satoshi; Takehara, Yasuo; Isoda, Haruo; Kodaira, Nami; Masunaga, Hatsuko; Ozawa, Fukujirou; Kaneko, Masao [Hamamatsu Univ. School of Medicine, Shizuoka (Japan); Nozaki, Atsushi; Kabasawa, Hiroyuki
1999-03-01
The utility of short TR single shot fast spin echo (SSFSE) MR imaging for evaluating swallowing was determined. Five healthy volunteers underwent kinematic MR imaging of swallowing with a 1.5 T MR scanner using the short TR (300 ms) SSFSE sequence. Twenty phases of sagittal sections were acquired within 6 sec, where the temporal resolution was 300 ms. For oral contrast medium, we used prune yogurt juice with Fe added. The image contrast of short TR SSFSE was found to be somewhere like that of T1-weighted images. In all cases, both the buccal and pharyngeal stages of swallowing were successfully depicted. The Fe-added prune yogurt juice performed as a positive contrast medium and helped determine anatomical structures in the buccal stage. Short TR (300 ms) SSFSE was useful in evaluating swallowing. The combined use of Fe-added prune yogurt juice was helpful in enhancing the surface of the oropharynx. (author)
Kinematic MRI using short TR single shot fast spin echo (SSFSE) in evaluating swallowing
International Nuclear Information System (INIS)
Isogai, Satoshi; Takehara, Yasuo; Isoda, Haruo; Kodaira, Nami; Masunaga, Hatsuko; Ozawa, Fukujirou; Kaneko, Masao; Nozaki, Atsushi; Kabasawa, Hiroyuki
1999-01-01
The utility of short TR single shot fast spin echo (SSFSE) MR imaging for evaluating swallowing was determined. Five healthy volunteers underwent kinematic MR imaging of swallowing with a 1.5 T MR scanner using the short TR (300 ms) SSFSE sequence. Twenty phases of sagittal sections were acquired within 6 sec, where the temporal resolution was 300 ms. For oral contrast medium, we used prune yogurt juice with Fe added. The image contrast of short TR SSFSE was found to be somewhere like that of T1-weighted images. In all cases, both the buccal and pharyngeal stages of swallowing were successfully depicted. The Fe-added prune yogurt juice performed as a positive contrast medium and helped determine anatomical structures in the buccal stage. Short TR (300 ms) SSFSE was useful in evaluating swallowing. The combined use of Fe-added prune yogurt juice was helpful in enhancing the surface of the oropharynx. (author)
¿Puede la música expresar lo trágico?
Directory of Open Access Journals (Sweden)
Enrico Fubini
2013-12-01
Full Text Available [ES] Este trabajo parte de la pregunta sobre si el arte musical es capaz de expresar realmente el sentimiento trágico, e intenta clarificar la relación que existe (si existe entre el concepto de lo trágico y el lenguaje de la música. En concreto, se trata de reconstruir la historia de esta relación empezando por sus raíces, hundidas en la tragedia griega, para llegar a sus más cercanas expresiones en el siglo XX. Se pone el acento en el valor trágico del propio contenido musical, destacando con atención, en el caso del melodrama, la relación que surge entre una emoción expresada en palabras y aquella que nace de la música misma, así como la contradicción aparente entre la belleza de la armonía de la música polifónica con el sentimiento de lo verdaderamente trágico. ; [EN] This writing raises the question if the musical art is able to really express the feeling of the tragic, and tries to clarify the relation that exist (if it exists between the concept of the tragic and the language of music. In particular, it aims to reconstruct the history of this relation beginning by its roots, sunk in Greek tragedy, to arrive at its nearer expressions in the XX century. The accent is on the tragic value of the musical content itself, emphasizing in particular, in the case of the melodrama, the relation that arise between an emotion expressed in words and that that is born of music itself, as well as the apparent contradiction between the beauty of the harmony of polyphonic music and the feeling of the truly tragic.
Trauma-Informed Guilt Reduction (TrIGR) Intervention
2017-10-01
and maintenance of posttraumatic distress and a range of adverse outcomes, including posttraumatic stress disorder (PTSD), depression and suicidality ...posttraumatic distress and a range of adverse outcomes, including posttraumatic stress disorder (PTSD), depression and suicidality , and alcohol/substance use...PTSD symptoms, and depression with medium to large effect sizes. The overall objective of this study is to examine the efficacy of TrIGR in
Identity by descent fine mapping of familial adult myoclonus epilepsy (FAME) to 2p11.2-2q11.2.
Henden, Lyndal; Freytag, Saskia; Afawi, Zaid; Baldassari, Sara; Berkovic, Samuel F; Bisulli, Francesca; Canafoglia, Laura; Casari, Giorgio; Crompton, Douglas Ewan; Depienne, Christel; Gecz, Jozef; Guerrini, Renzo; Helbig, Ingo; Hirsch, Edouard; Keren, Boris; Klein, Karl Martin; Labauge, Pierre; LeGuern, Eric; Licchetta, Laura; Mei, Davide; Nava, Caroline; Pippucci, Tommaso; Rudolf, Gabrielle; Scheffer, Ingrid Eileen; Striano, Pasquale; Tinuper, Paolo; Zara, Federico; Corbett, Mark; Bahlo, Melanie
2016-10-01
Familial adult myoclonus epilepsy (FAME) is a rare autosomal dominant disorder characterized by adult onset, involuntary muscle jerks, cortical myoclonus and occasional seizures. FAME is genetically heterogeneous with more than 70 families reported worldwide and five potential disease loci. The efforts to identify potential causal variants have been unsuccessful in all but three families. To date, linkage analysis has been the main approach to find and narrow FAME critical regions. We propose an alternative method, pedigree free identity-by-descent (IBD) mapping, that infers regions of the genome between individuals that have been inherited from a common ancestor. IBD mapping provides an alternative to linkage analysis in the presence of allelic and locus heterogeneity by detecting clusters of individuals who share a common allele. Succeeding IBD mapping, gene prioritization based on gene co-expression analysis can be used to identify the most promising candidate genes. We performed an IBD analysis using high-density single nucleotide polymorphism (SNP) array data followed by gene prioritization on a FAME cohort of ten European families and one Australian/New Zealander family; eight of which had known disease loci. By identifying IBD regions common to multiple families, we were able to narrow the FAME2 locus to a 9.78 megabase interval within 2p11.2-q11.2. We provide additional evidence of a founder effect in four Italian families and allelic heterogeneity with at least four distinct founders responsible for FAME at the FAME2 locus. In addition, we suggest candidate disease genes using gene prioritization based on gene co-expression analysis.
Bajpai, Arun K; Park, Jeong-Hoh; Moon, Ik-Jae; Kang, Hyungu; Lee, Yun-Han; Doh, Kyung-Oh; Suh, Seong-Il; Chang, Byeong-Churl; Park, Jong-Gu
2005-09-29
Ribbon antisense (RiAS) to the hTR RNA, a component of the telomerase complex, was employed to inhibit telomerase activity and cancer cell growth. The antisense molecule, hTR-RiAS, combined with enhanced cellular uptake was shown to effectively inhibit telomerase activity and cause rapid cell death in various cancer cell lines. When cancer cells were treated with hTR-RiAS, the level of hTR RNA was reduced by more than 90% accompanied with reduction in telomerase activity. When checked for cancer cell viability, cancer cell lines treated with hTR-RiAS using DNA+Peptide+Lipid complex showed 70-80% growth inhibition in 3 days. The reduced cell viability was due to apoptosis as the percentage of cells exhibiting the sub-G0 arrest and DNA fragmentation increased after antisense treatment. Further, when subcutaneous tumors of a colon cancer cell line (SW480) were treated intratumorally with hTR-RiAS, tumor growth was markedly suppressed with almost total ablation of hTR RNA in the tumor tissue. Cells in the tumor tissue were also found to undergo apoptosis after hTR-RiAS treatment. These results suggest that hTR-RiAS is an effective anticancer reagent, with a potential for broad efficacy to diverse malignant tumors.
Tempo e Trânsito na Experiência Subjetiva de Motoristas
Directory of Open Access Journals (Sweden)
Ana Inez Oka Elvas de Lima
2015-03-01
Full Text Available Esta pesquisa investiga como são percebidos e vivenciados o tempo e a pressa no trânsito por motoristas de Fortaleza, identificando e analisando seus estados subjetivos e comportamentos associados a essa experiência. Para a coleta de dados, organizaram-se quatro grupos focais, a partir dos quais emergiram diversos elementos relacionados ao tempo e à pressa e à incidência de comportamentos inadequados no trânsito, segundo o sexo e a idade dos participantes. Para analisar os dados obtidos nas discussões grupais utilizaram-se os critérios da Análise Clássica de Conteúdo. Os resultados levaram à conclusão de que a questão do tempo e da pressa constitui um potencial gerador de erros e violações na condução de veículos, pois exerce influência decisiva sobre os comportamentos dos motoristas e configura uma realidade importante para se compreender os fatores humanos envolvidos na dinâmica do trânsito e do ambiente urbano como um todo.
Ajast ja arust trükikoda Kultuuritehases / Merit Kask
Kask, Merit
2006-01-01
Tallinna Kultuuritehase trükikojas toimunud kõrgtrükitehnikas käsilao õpikojast. Juhendaja inglise kunstnik Pete Nevin, osa võtsid Eesti Kunstiakadeemia tudengid (nimed), kelle tehtud tööd on samas näitusel
Directory of Open Access Journals (Sweden)
Hussin WA
2014-07-01
Full Text Available Warda A Hussin,1,2,*,† Mohamed A Ismail,1,3,* Abdullah M Alzahrani,1 Wael M El-Sayed,1,4 1King Faisal University, College of Science, Departments of Chemistry and Biological Sciences, Hofuf, Saudi Arabia; 2Al-Azhr University, Faculty of Science, Department of Botany and Microbiology, Cairo, Egypt; 3Department of Chemistry, Faculty of Science, Mansoura University, Mansoura, Egypt; 4University of Ain Shams, Faculty of Science, Department of Zoology, Abbassia, Cairo, Egypt *These authors contributed equally to this work †Warda A Hussin passed away on May 21, 2014 Abstract: A series of bichalcophene fluorobenzamidines 5a–e was synthesized from the corresponding mononitriles 4a–e via a direct reaction with lithium bis(trimethylsilylamide LiN(TMS2 followed by de-protection with ethanolic HCl (gas. Bichalcophene fluorobenzonitriles 4a–e were prepared adopting a Stille coupling reaction between the bromo compounds 3a–c and 2-(tri-n-butylstannylfuran or analogues. As an approach to drug discovery, the structure–antimutagenicity relationship of novel fluoroarylbichalcophenes was examined using the Ames Salmonella/microsomal assay. At nontoxic concentrations (10 and 20 µM, all derivatives alone or in combination with sodium azide (NaN3; 2 µg/plate or benzo[a]pyrene (B[a]P; 20 µM in the presence of S9 mix were not mutagenic. The fluoroaryl derivatives significantly reduced the NaN3-induced and B[a]P-induced mutagenicity under pre-exposure and co-exposure conditions. The recorded antimutagenic activity of fluoroaryl derivatives varied depending on the kind of mutagen and the exposure regimen. Monocationic fluoroarylbichalcophenes were superior to the corresponding mononitriles in reducing B[a]P-induced mutagenicity. Nevertheless, mononitriles were more active against NaN3, especially at low concentrations and under pre-exposure treatments. The antimutagenic activity was congruent with a high antioxidant activity that could promote the DNA
Korroderede trådbindere i murværk
DEFF Research Database (Denmark)
Hansen, Klavs Feilberg
Denne SBi-anvisning omdhandler korroderede trådbindere i hule mure og skalmure, og den nedstyrtningsfare som korrosionen kan medføre. Anvisningen beskriver metoder til at undersøge og vurdere problemet, og hvordan man kan eftermontere nye bindere. Anvisningen er rettet mod rådgivende ingeniører....
Synthesis of 2-iodo- and 2-phenyl-[11C]melatonin: potential PET tracers for melatonin binding sites
International Nuclear Information System (INIS)
Chen Jiajun; Fiehn-Schulze, Brita; Firnau, Guenter; Brough, Paul A.; Snieckus, Victor
1998-01-01
Two 11 C-labelled melatonin derivatives, 2-iodo-[ 11 C]melatonin (2-iodo-5-methoxy-N[ 11 C-acetyl]-tryptamine, an agonist) and 2-phenyl-[ 11 C]melatonin (2-phenyl-5-methoxy-N[ 11 C-acetyl]tryptamine, a putative antagonist) were synthesized from [ 11 C]carbon dioxide. The reaction sequence was common to both compounds and consisted of three steps: (i) carbonylation of methyl magnesium bromide with [ 11 C]carbon dioxide, (ii) conversion of the adduct to [ 11 C]acetyl chloride, (iii) acetylation of the amine precursors (2-iodo-5-methoxy-tryptamine or 2-phenyl-5-methoxy-tryptamine) with [ 11 C]acetyl chloride. The precursors were especially prepared. The radiochemical yield was 19% for 2-iodomelatonin and 32% for 2-phenymelatonin, based on [ 11 C]carbon dioxide; the specific activity ranged from 300 to 600 mCi/μmol. Both labelled 2-substituted-melatonins are intended to be used as radiotracers to study melatonin binding sites in man with positron emission tomography
Maviş, Ilknur; Özbabalik Adapinar, Belgin Demet; Yenilmez, Çinar; Aydin, Ayşe; Olgun, Engin; Bal, Cengiz
2015-01-01
The test your memory (TYM) is reported to be a sensitive cognitive function assessment scale for people with dementia. The aim of the present study was to investigate the reliability and validity of an adapted Turkish version of the TYM (TYM-TR) among Turkish dementia patients. The TYM-TR was given to 59 patients with dementia aged 60+ and 336 normal controls aged 23-75+. The diagnostic utility of the TYM-TR was compared with that of the mini-mental state examination (MMSE) to validate it. The internal consistency of the TYM-TR was a = 0.85. The test-retest reliability was 0.97 (P reliability and validity to distinguish dementia in the Turkish population.
DW4TR: A Data Warehouse for Translational Research.
Hu, Hai; Correll, Mick; Kvecher, Leonid; Osmond, Michelle; Clark, Jim; Bekhash, Anthony; Schwab, Gwendolyn; Gao, De; Gao, Jun; Kubatin, Vladimir; Shriver, Craig D; Hooke, Jeffrey A; Maxwell, Larry G; Kovatich, Albert J; Sheldon, Jonathan G; Liebman, Michael N; Mural, Richard J
2011-12-01
The linkage between the clinical and laboratory research domains is a key issue in translational research. Integration of clinicopathologic data alone is a major task given the number of data elements involved. For a translational research environment, it is critical to make these data usable at the point-of-need. Individual systems have been developed to meet the needs of particular projects though the need for a generalizable system has been recognized. Increased use of Electronic Medical Record data in translational research will demand generalizing the system for integrating clinical data to support the study of a broad range of human diseases. To ultimately satisfy these needs, we have developed a system to support multiple translational research projects. This system, the Data Warehouse for Translational Research (DW4TR), is based on a light-weight, patient-centric modularly-structured clinical data model and a specimen-centric molecular data model. The temporal relationships of the data are also part of the model. The data are accessed through an interface composed of an Aggregated Biomedical-Information Browser (ABB) and an Individual Subject Information Viewer (ISIV) which target general users. The system was developed to support a breast cancer translational research program and has been extended to support a gynecological disease program. Further extensions of the DW4TR are underway. We believe that the DW4TR will play an important role in translational research across multiple disease types. Copyright © 2011 Elsevier Inc. All rights reserved.
Building on TR-24 success. Advanced Cyclotron Systems Inc. launches a new cyclotron model
International Nuclear Information System (INIS)
Russell Watt; William Gyles; Alexander Zyuzin
2015-01-01
ACSI is designing a new 30 MeV cyclotron based on the TR-24. While minimizing changes from the proven TR-24, including maintaining the same outer dimensions, the energy of the cyclotron will be increased to 30 MeV, which will make it the most compact, non-superconducting, 30 MeV cyclotron design to date. Maximum beam current will match the TR-24 at 1 mA. With the size and footprint of a typical low energy PET cyclotron, this system will offer users a cost effective solution for a diversified facility capable of producing a wide spectrum of PET and SPECT radioisotopes for research and commercial distribution. (author)
In-situ hybridization based quantification of hTR: a possible biomarker in malignant melanoma
DEFF Research Database (Denmark)
Vagner, Josephine; Steiniche, Torben; Stougaard, Magnus
2015-01-01
thickness suggesting that hTR might be a valuable biomarker in MM. Furthermore, as ISH-based detection requires presence of both hTR and the reverse transcriptase (hTERT) it might be an indicator of active telomerase and thus have future relevance as a predictive biomarker for anti-telomerase treatment....
Liu, Xinke; Lu, Youming; Yu, Wenjie; Wu, Jing; He, Jiazhu; Tang, Dan; Liu, Zhihong; Somasuntharam, Pannirselvam; Zhu, Deliang; Liu, Wenjun; Cao, Peijiang; Han, Sun; Chen, Shaojun; Seow Tan, Leng
2015-01-01
Effect of a polarized P(VDF-TrFE) ferroelectric polymer gating on AlGaN/GaN metal-oxide-semiconductor high-electron-mobility transistors (MOS-HEMTs) was investigated. The P(VDF-TrFE) gating in the source/drain access regions of AlGaN/GaN MOS-HEMTs was positively polarized (i.e., partially positively charged hydrogen were aligned to the AlGaN surface) by an applied electric field, resulting in a shift-down of the conduction band at the AlGaN/GaN interface. This increases the 2-dimensional electron gas (2-DEG) density in the source/drain access region of the AlGaN/GaN heterostructure, and thereby reduces the source/drain series resistance. Detailed material characterization of the P(VDF-TrFE) ferroelectric film was also carried out using the atomic force microscopy (AFM), X-ray Diffraction (XRD), and ferroelectric hysteresis loop measurement. PMID:26364872
Análise dos acidentes de trânsito ocorridos em uma Capital do Nordeste Brasileiro, em 2006.
Directory of Open Access Journals (Sweden)
Francisco José de Paula Júnior
2013-06-01
Full Text Available Este trabalho teve como objetivo descrever os acidentes de trânsito ocorridos na cidade de Fortaleza, capital do Ceará, no ano de 2006. Foi realizado um estudo descritivo, transversal, a partir de dados do Sistema de Informação de Acidentes de Trânsito de Fortaleza, que agrega todas as informações pertinentes aos acidentes de trânsito ocorridos na capital cearense, além de informações do Sistema de Informações Hospitalares. Esses dados foram analisados utilizando o software EPI INFO®. Em 2006, foram registrados 23.443 acidentes de trânsito. Desses, houve uma proporção de 2:1, entre homens e mulheres e os óbitos ocorreram principalmente na faixa etária de 30 a 59 anos, liderados por pedestres 141 (41,34% e motociclistas com 76 (22,28%. Entre os tipos de acidentes 14.267 (60,85% registraram-se colisões, tendo o mês de dezembro e o intervalo de 18 às 20 horas apresentado o maior número de registros. Em relação aos ferimentos, os motociclistas foram os mais lesionados, atingindo 5.634 (40,57% pessoas. Parte significativa dos acidentes e óbitos envolveu adolescentes e adultos jovens, resultando em 341 (0,71% vitimas que evoluíram para óbito. É fundamental estimular políticas públicas para melhoria nas condições de trânsito e um maior investimento para os sistemas que coletam informações sobre os acidentes.
Reconstruction of sound source signal by analytical passive TR in the environment with airflow
Wei, Long; Li, Min; Yang, Debin; Niu, Feng; Zeng, Wu
2017-03-01
In the acoustic design of air vehicles, the time-domain signals of noise sources on the surface of air vehicles can serve as data support to reveal the noise source generation mechanism, analyze acoustic fatigue, and take measures for noise insulation and reduction. To rapidly reconstruct the time-domain sound source signals in an environment with flow, a method combining the analytical passive time reversal mirror (AP-TR) with a shear flow correction is proposed. In this method, the negative influence of flow on sound wave propagation is suppressed by the shear flow correction, obtaining the corrected acoustic propagation time delay and path. Those corrected time delay and path together with the microphone array signals are then submitted to the AP-TR, reconstructing more accurate sound source signals in the environment with airflow. As an analytical method, AP-TR offers a supplementary way in 3D space to reconstruct the signal of sound source in the environment with airflow instead of the numerical TR. Experiments on the reconstruction of the sound source signals of a pair of loud speakers are conducted in an anechoic wind tunnel with subsonic airflow to validate the effectiveness and priorities of the proposed method. Moreover the comparison by theorem and experiment result between the AP-TR and the time-domain beamforming in reconstructing the sound source signal is also discussed.
International Nuclear Information System (INIS)
Endo, Hideho; Wada, Mitsuyoshi; Shiotani, Seiji; Niitsu, Mamoru; Itai, Yuji
2000-01-01
The purpose of this study was to compare short-TE-long-TR images with T1-weighed images in knee MR examinations. Sagittal MR images of the knee were obtained in 31 patients with knee pain. T1-weighted images were obtained by the spin-echo technique (TR/TE =350/15), and short-TE-long-TR images by fast spin-echo (TR/TE =1300/15) with an echo-train length of 5. Contrast-to-noise-ratios (CNRs) of the anterior cruciate ligament and synovial space, meniscus and articular cartilage, and meniscal lesion and normal meniscus were compared between short-TE-long-TR images and T1-weighted images. On each of the three examinations, short-TE-long-TR images provided significantly higher CNRs than T1-weighted images. It was concluded that short-TE-long-TR images can be a useful alternative to T1-weighted images in evaluating the anterior cruciate ligament and meniscal lesions. (author)
Energy Technology Data Exchange (ETDEWEB)
Endo, Hideho; Wada, Mitsuyoshi; Shiotani, Seiji [Tsukuba Medical Center Hospital, Ibaraki (Japan); Niitsu, Mamoru; Itai, Yuji
2000-11-01
The purpose of this study was to compare short-TE-long-TR images with T1-weighed images in knee MR examinations. Sagittal MR images of the knee were obtained in 31 patients with knee pain. T1-weighted images were obtained by the spin-echo technique (TR/TE =350/15), and short-TE-long-TR images by fast spin-echo (TR/TE =1300/15) with an echo-train length of 5. Contrast-to-noise-ratios (CNRs) of the anterior cruciate ligament and synovial space, meniscus and articular cartilage, and meniscal lesion and normal meniscus were compared between short-TE-long-TR images and T1-weighted images. On each of the three examinations, short-TE-long-TR images provided significantly higher CNRs than T1-weighted images. It was concluded that short-TE-long-TR images can be a useful alternative to T1-weighted images in evaluating the anterior cruciate ligament and meniscal lesions. (author)
Huerta, Amarela Varela
2016-01-01
Resumen Este texto aborda un ejemplo concreto de organización de migrantes, el Movimiento Migrante Mesoamericano, que trabaja por los derechos de los migrantes en tránsito por México, de forma coordinada con organizaciones y familiares de migrantes víctimas de desaparición en su tránsito hacia Estados Unidos. Este estudio de caso es un ejemplo de luchas migrantes en contextos de tránsito, tipo específico de movimiento social que ha sido poco abordado en la literatura que piensa la acción cole...
Capturing [11C]CO2 for use in aqueous applications
International Nuclear Information System (INIS)
Vandehey, Nicholas T.; O’Neil, James P.
2014-01-01
We present a simple method for trapping [ 11 C]CO 2 gas and releasing it into a buffered solution using an ion-exchange cartridge. Sodium hydroxide cartridges captured >99% of [ 11 C]CO 2 following NaOH activation. A sodium bicarbonate solution eluted >99% of trapped radioactivity. Trapping [ 11 C]CO 2 directly in small volumes of several solutions was less effective than cartridge methods. The recommended methods allow for fast and simple production of highly concentrated carbon-11 containing aqueous solutions for use in filling phantoms, calibrating detectors, or (bio)geochemical experiments. - Highlights: • An ion exchange resin can trap [ 11 C]CO 2 gas and release it with saturated bicarbonate. • Elution from cartridge requires as little as 300 µL volume, with eluant at pH=10. • SPE trap-and-release provided better results than trapping in solution
International Nuclear Information System (INIS)
Navid, Ashcon; Pilon, Laurent
2011-01-01
This paper is concerned with the direct conversion of heat into electricity using pyroelectric materials. The Olsen (or Ericsson) cycle was experimentally performed on three different types of 60/40 poly(vinylidene fluoride-trifluoroethylene) [P(VDF-TrFE)] copolymer samples, namely commercial, purified, and porous films. This cycle consists of two isoelectric field and two isothermal processes. The commercial and purified films were about 50 µm thick and produced a maximum energy density of 521 J l −1 and 426 J l −1 per cycle, respectively. This was achieved by successively dipping the films in cold and hot silicone oil baths at 25 and 110 °C under low and high applied electric fields of about 200 and 500 kV cm −1 , respectively. The 11 µm thick porous films achieved a maximum energy density of 188 J l −1 per cycle between 25 and 100 °C and electric field between 200 and 400 kV cm −1 . The performance of the purified and porous films suffered from their lower electrical resistivity and electric breakdown compared with commercial thin films. However, the energy densities of all 60/40 P(VDF-TrFE) films considered matched or exceeded those reported recently for 0.9Pb(Mg 1/3 Nb 2/3 )O 3 –0.10PbTiO 3 (0.9PMN–0.1PT) (186 J l −1 ) and Pb(Zn 1/3 Nb 2/3 ) 0.955 Ti 0.045 O 3 (243 J l −1 ) bulk ceramics. Furthermore, the results are discussed in light of recently proposed figures of merit for energy harvesting applications
Measuring heat transfer through TR-0 reactor fuel element
International Nuclear Information System (INIS)
Nemec, V.; Turzik, Z.; Vitek, M.
1977-05-01
The time course of temperatures of the peripheral and the central fuel pins of the TR-O reactor was studied during moderator temperature changes using a model. The formula T=Tsub(e)+(Tsub(o)-Tsub(e)).exp(-t/tsub(e)) applies, where T is the pin temperature, Tsub(o) the initial pin temperature, Tsub(e) is the steady-state bath temperature, tsub(e) the time constant of temperature equilibration and t the time required for a temperature change from value Tsub(o) to T. For the bath level height H=1 m the tsub(e) value for the central pin was determined to be 1.05 hours, for the peripheral pin 0.96 hour; for level height H=2 m the values were 2.1 and 2.12 hours, respectively. The dependence found will allow correcting the experimental results in measurements with heated moderator for fuel temperature changes. (Ha)
National Aeronautics and Space Administration — This dataset contains the RapidScat Level 2B 12.5km Version 1.1 science-quality ocean surface wind vectors. The Level 2B wind vectors are binned on a 12.5 km Wind...
Photocatalytic disinfection of spoilage bacteria gram-negative (G-) P. fluorescens and gram-positive (G+) M. caseolyticus by nano-TiO2 under different experimental conditions and the disinfection mechanism were investigated. The experimental conditions included the initial bacterial populations, nan...
Taxa de mortalidade por acidentes de trâsito e frota de veículos
Directory of Open Access Journals (Sweden)
Samuel Kilsztajn
2001-06-01
Full Text Available OBJETIVO: A taxa de mortalidade específica por acidentes de trânsito de veículos a motor é usualmente utilizada para efeito das políticas de saúde pública. Para mensurar o grau de violência no trânsito, foi realizado estudo com o objetivo de analisar o número de óbitos por acidentes de trânsito por veículo a motor. MÉTODOS: Com base nos dados sobre frota de veículos, população e óbitos por acidente de trânsito, publicados no Statiscal Yearbook (1999, Demografic Yearbook (1997, Denatran (1999, Ministério da Saúde (2000 e Fundação IBGE (2000, foram estudados 61 países e 51 localidades brasileiras.A taxa de mortalidade específica foi decomposta em número de veículos por habitante e número de óbitos por veículo. Numa primeira aproximação, cada uma das amostras (internacional e brasileira foi subdividida em três grupos, de acordo com o número de veículos por habitante, para estudo da relação entre os três índices. Para testar a significância dessa relação, foi estimada uma função de regressão log-linear. RESULTADOS: Os resultados para as estimativas internacionais, assim como as do Brasil, demonstraram que, quanto maior o número de veículos por habitante, menor o número de óbitos por acidentes de trânsito por veículo, tendo-se elasticidade da ordem de -1,067, para as estimativas internacionais, e de -0,515, para as do Brasil. CONCLUSÕES: Para uma política de prevenção dos acidentes de trânsito, os resultados encontrados indicam a necessidade de estudar os fatores que possam explicar o maior número de óbitos por veículo nas regiões com menor número de veículos por habitante.
FGF‐2 promotes osteocyte differentiation through increased E11/podoplanin expression
Ikpegbu, Ekele; Basta, Lena; Clements, Dylan N.; Fleming, Robert; Vincent, Tonia L.; Buttle, David J.; Pitsillides, Andrew A.; Farquharson, Colin
2018-01-01
E11/podoplanin is critical in the early stages of osteoblast‐to‐osteocyte transitions (osteocytogenesis), however, the upstream events which regulate E11 expression are unknown. The aim of this study was to examine the effects of FGF‐2 on E11‐mediated osteocytogenesis and to reveal the nature of the underlying signaling pathways regulating this process. Exposure of MC3T3 osteoblast‐like cells and murine primary osteoblasts to FGF‐2 (10 ng/ml) increased E11 mRNA and protein expression (p 70% reduction of basal E11 mRNA expression (p < 0.05) and effectively abrogated FGF‐2‐related changes in E11 expression and dendrite formation. FGF‐2 strongly activated the ERK signaling pathway in osteoblast‐like cells but inhibition of this pathway did not block the ability of FGF‐2 to enhance E11 expression or to promote acquisition of the osteocyte phenotype. The results of this study highlight a novel mechanism by which FGF‐2 can regulate osteoblast differentiation and osteocyte formation. Specifically, the data suggests that FGF‐2 promotes osteocytogenesis through increased E11 expression and further studies will identify if this regulatory pathway is essential for bone development and maintenance in health and disease. PMID:29215722
9 CFR 2.11 - Denial of initial license application.
2010-01-01
... have violated any Federal, State, or local laws or regulations pertaining to animal cruelty within 1... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Denial of initial license application. 2.11 Section 2.11 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT...
International Nuclear Information System (INIS)
Garg, Gunjal; Spitzer, Dirk; Gibbs, Jesse; Belt, Brian; Powell, Matthew A; Mutch, David G; Goedegebuure, Peter; Collins, Lynne; Piwnica-Worms, David; Hawkins, William G
2014-01-01
The targeted delivery of cancer therapeutics represents an ongoing challenge in the field of drug development. TRAIL is a promising cancer drug but its activity profile could benefit from a cancer-selective delivery mechanism, which would reduce potential side effects and increase treatment efficiencies. We recently developed the novel TRAIL-based drug platform TR3, a genetically fused trimer with the capacity for further molecular modifications such as the addition of tumor-directed targeting moieties. MUC16 (CA125) is a well characterized biomarker in several human malignancies including ovarian, pancreatic and breast cancer. Mesothelin is known to interact with MUC16 with high affinity. In order to deliver TR3 selectively to MUC16-expressing cancers, we investigated the possibility of targeted TR3 delivery employing the high affinity mesothelin/MUC16 ligand/receptor interaction. Using genetic engineering, we designed the novel cancer drug Meso-TR3, a fusion protein between native mesothelin and TR3. The recombinant proteins were produced with mammalian HEK293T cells. Meso-TR3 was characterized for binding selectivity and killing efficacy against MUC16-positive cancer cells and controls that lack MUC16 expression. Drug efficacy experiments were performed in vitro and in vivo employing an intraperitoneal xenograft mouse model of ovarian cancer. Similar to soluble mesothelin itself, the strong MUC16 binding property was retained in the Meso-TR3 fusion protein. The high affinity ligand/receptor interaction was associated with a selective accumulation of the cancer drug on MUC16-expressing cancer targets and directly correlated with increased killing activity in vitro and in a xenograft mouse model of ovarian cancer. The relevance of the mesothelin/MUC16 interaction for attaching Meso-TR3 to the cancer cells was verified by competitive blocking experiments using soluble mesothelin. Mechanistic studies using soluble DR5-Fc and caspase blocking assays confirmed
Posters y trípticos (Brochures) en LATEX con Beamer y Leaflet
Borbón, Alexánder
2013-01-01
Resumen. En este artículo se muestra la manera en que se puede realizar posters y trípticos (panfletos o brochures) con LATEX. Para realizar los posters se utiliza la clase beamer que usualmente se utiliza para hacer presentaciones, se utiliza el paquete beamerposter para poder utilizarla para posters. Los trípticos se realizan de dos formas, la primera utilizando la clase beamer con el paquete geometry y la segunda utilizando la clase leaflet que es una clase especializada para hacer este ti...
Energy Technology Data Exchange (ETDEWEB)
Thorell, J -O; Stone-Elander, S [Karolinska Pharmacy, Stockholm (Sweden) Karolinska Hospital and Institute, Stockholm (Sweden). Dept. of Clinical Neurophysiology; Elander, N [Manne Siegbahn Inst. of Physics, Stockholm (Sweden)
1993-11-01
A method for the production of two new carbon-11 labelled difunctional radiolabelling precursors, [[sup 11]C]diethyl oxalate,2, and [[sup 11]C]oxalic acid, 3 is described. Methyl chloroformate was reacted with no-carrier-added [[sup 11]C]cyanide to generate the intermediate nitrile, methyl [[sup 11]C]cyanoformate. Alcoholysis with HC1 in ethanol generated 2, which could subsequently be converted to 3 with aqueous acid. The total time of preparation from end-or-trapping of [[sup 11]C]cyanide was 6-7 min using combined microwave and thermal treatment or, by exclusively thermal treatment, 15 and 20 min for 2 and 3, respectively. The radiochemical conversion of [[sup 11]C]cyanide to 2 and 3 was [approx] 80% and [approx] 70%, respectively. Both 2 and 3 were used in a model reaction with 1,2-phenylenediamine to synthesize the heterocyclic compound, 2,3-dihydroxyquinoxaline, a basic structural unit in antagonists for the excitatory amino acid receptor system. (Author).
International Nuclear Information System (INIS)
Ilyushin, G.D.; Dem'yanets, L.N.
2008-01-01
One performed the computerized (the TOPOS 4.0 software package) geometric and topological analyses of all known types of K, TR-germanates (TR = La-Lu, Y, Sc, In). The skeleton structure are shown as three-dimensional 3D, K, TR, Ge-patterns (graphs) with remote oxygen atoms. TR 4 3 3 4 3 3 + T 4 3 4 3, K 2 YbGe 4 O 14 (OH) pattern, TR 6 6 3 6 + T1 6 8 6 + T2 3 6 8, K 2 Sc 2 Ge 2 O 7 (OH) 2 , TR 6 4 6 4 + T 6 4 6 and KScGe 2 O 6 - TR 6 6 3 6 3 4 + T1 6 3 6 + T2 6 4 3 patterns served as crystal-forming 2D TR,Ge-patterns for K 2 Nd 4 Ge 4 O 13 (OH) 4 . One performed the 3D-simulation of the mechanism of self-arrangement of the crystalline structures: cluster-precursor - parent chain - microlayer - microskeleton (super-precursor). Within K 2 Nd 4 Ge 4 O 13 (OH) 4 , K 2 Sc 2 Ge 2 O 7 (OH) 2 and KScGe 2 O 6 one identified the invariant type of the cyclic hexapolyhedral cluster-precursor consisting of TR-octahedrons linked by diorthogroups stabilized by K atoms. For K 2 Nd 4 Ge 4 O 13 (OH) 4 one determined the type of the cyclic tetrapolyhedral cluster-precursor consisting of TR-octavertices linked by tetrahedrons. The cluster CN within the layer just for KScGe 2 O 6 water-free germanate (the PYR pyroxene analog) is equal to 6 (the maximum possible value), while in the rest OH-containing germanates it constitutes 4. One studied the formation mechanism of Ge-radicals in the form of Ge 2 O 7 and Ge 4 O 13 groupings, GeO 3 chain and the tubular structure consisting of Ge 8 O 20 fixed cyclic groupings [ru
Dynamics of Shape Memory Alloy Systems, Phase 2
2015-12-22
Nonlinear Dynamics and Chaos in Systems with Discontinuous Support Using a Switch Model”, DINAME 2005 - XI International Conference on Dynamic Problems in...AFRL-AFOSR-CL-TR-2016-0003 Dynamics of Shape Memory Alloy Systems , Phase 2 Marcelo Savi FUNDACAO COORDENACAO DE PROJETOS PESQUISAS E EEUDOS TECNOL...release. 2 AFOSR FINAL REPORT Grant Title: Nonlinear Dynamics of Shape Memory Alloy Systems , Phase 2 Grant #: FA9550-11-1-0284 Reporting Period
Aplicaciones del modelo On/Off al tráfico agregado en las redes de comunicaciones
Parra León, Andrés; Piedrahita, Elkin M; Salcedo, Octavio
2011-01-01
Los modelos que permiten recrear trazas de tráfico generadas en una red de comunicaciones, pueden utilizarse en predicciones y estimaciones de tráfico a fin de optimizar el uso de los recursos de la red; uno de estos es el modelo On/Off, el cual permite describir el comportamiento del tráfico agregado por una o más fuentes de información. La importancia de este artículo se centra en la incidencia que dicho modelo ha tenido al aplicarse en diversas tecnologías de comunicaciones, para esto se e...
Directory of Open Access Journals (Sweden)
Epigmenio Castillo Gallegos
2014-01-01
Full Text Available Se introdujo la leguminosa Arachis pintoi CIAT 17434 (AP en una pastura de gramas nativas, para estudiar su efecto sobre la conducta de ingestión del animal al pastar, en la época lluviosa del trópico húmedo del estado de Veracruz. Los tratamientos fueron gramas nativas (PN, testigo y AP asociado a gramas nativas (PNA. La rotación fue 1 día de pastoreo/20 días de recuperación con carga de 3.2 vacas F1 (Holstein x Cebú/ha. Las diferencias se probaron a P <0.05, presentándose primero las medias ± error estandar de PNA y luego de PN. Hubo diferencias entre tratamientos en cantidad de materia seca (MS presente antes del pastoreo (4,225 ± 212 vs 3,314 ± 212 kg/ha, así como en proteína cruda (15.1 ± 0.45 vs 10.6 ± 0.5 % y materia orgánica (MO digestible (67.65 ± 1.7 vs 64.1 ± 2.4 % de la extrusa esofágica. El tiempo de pastoreo (367 ± 11 vs 380 ± 11 min/24 h fue similar entre tratamientos y el de rumia diferente (291 ± 8 vs 379 ± 8 min/24 h. No hubo diferencias en consumo de MO calculado por Cr-indigestibilidad in situ (2.09 ± 0.11 vs 2.16 ± 0.11 kg MO/100 kg PV, pero por comportamiento ingestivo, si las hubo (1.54 ± 0.12 vs 2.02 ± 0.12. La producción diaria (kg/vaca de leche ordeñada (6.8 ± 0.4 vs 6.1 ± 0.4 y consumida por el becerro (4.4 ± 0.4 vs 3.8 ± 0.5 fueron similares, pero la producción total fue diferente (9.0 ± 0.6 vs 7.2 ± 0.6 kg/animal/ día.
10 CFR 960.5-2-11 - Tectonics.
2010-01-01
... REPOSITORY Preclosure Guidelines Ease and Cost of Siting, Construction, Operation, and Closure § 960.5-2-11... of active faulting within the geologic setting. (2) Historical earthquakes or past man-induced... repository construction, operation, and closure may be larger then predicted from historical seismicity. (d...
Tráfico de drogas: uma opção entre escolhas escassas
Directory of Open Access Journals (Sweden)
Ana Amélia Cypreste Faria
2011-12-01
Full Text Available Este trabalho procura compreender os aspectos psicossociais que permeiam a adesão de pessoas ao tráfico de drogas em seu contexto histórico e econômico-social, por meio de pesquisa realizada no ambiente carcerário, onde foram recolhidas histórias de vida de pessoas envolvidas com o tráfico. Em um ambiente socioeconômico caracterizado pela precarização das relações de trabalho, pelo desemprego e pelo apelo consumista afinados com as premissas econômicas neoliberais tem-se uma situação de exclusão social e de cidadania. Assim, o tráfico se mostra como uma atividade econômica possibilitadora de inclusão, mesmo que marginal, na ordem capitalista. Uma opção a ser feita entre escolhas limitadas.
FGF-2 promotes osteocyte differentiation through increased E11/podoplanin expression.
Ikpegbu, Ekele; Basta, Lena; Clements, Dylan N; Fleming, Robert; Vincent, Tonia L; Buttle, David J; Pitsillides, Andrew A; Staines, Katherine A; Farquharson, Colin
2018-07-01
E11/podoplanin is critical in the early stages of osteoblast-to-osteocyte transitions (osteocytogenesis), however, the upstream events which regulate E11 expression are unknown. The aim of this study was to examine the effects of FGF-2 on E11-mediated osteocytogenesis and to reveal the nature of the underlying signaling pathways regulating this process. Exposure of MC3T3 osteoblast-like cells and murine primary osteoblasts to FGF-2 (10 ng/ml) increased E11 mRNA and protein expression (p 70% reduction of basal E11 mRNA expression (p < 0.05) and effectively abrogated FGF-2-related changes in E11 expression and dendrite formation. FGF-2 strongly activated the ERK signaling pathway in osteoblast-like cells but inhibition of this pathway did not block the ability of FGF-2 to enhance E11 expression or to promote acquisition of the osteocyte phenotype. The results of this study highlight a novel mechanism by which FGF-2 can regulate osteoblast differentiation and osteocyte formation. Specifically, the data suggests that FGF-2 promotes osteocytogenesis through increased E11 expression and further studies will identify if this regulatory pathway is essential for bone development and maintenance in health and disease. © 2017 The Authors. Journal of Cellular Physiology Published by Wiley Periodicals, Inc.
Dawkins, Tamara; Meyer, Allison T; Van Bourgondien, Mary E
2016-10-01
The Childhood Autism Rating Scale, Second Edition (CARS2; 2010) includes two rating scales; the CARS2-Standard Version (CARS2-ST) and the newly developed CARS2-High Functioning Version (CARS2-HF). To assess the diagnostic agreement between the CARS2 and DSM-IV-TR versus DSM-5 criteria for Autism Spectrum Disorder (ASD), clinicians at community based centers of the University of North Carolina TEACCH Autism Program rated participants seen for a diagnostic evaluation on symptoms of autism using both the DSM-IV-TR and DSM-5 criteria and either the CARS2-HF or the CARS2-ST. Findings suggest that overall, the diagnostic agreement of the CARS2 remains high across DSM-IV and DSM-5 criteria for autism.
Directory of Open Access Journals (Sweden)
Andréa Fernandes Magalhães
2011-08-01
Full Text Available OBJETIVO: Estimar a prevalência de acidentes de trânsito auto-referidos e identificar fatores associados. MÉTODOS: Estudo transversal de base populacional realizado de setembro de 2007 a agosto de 2008, nas zonas urbana e rural de Rio Branco, AC. Foram analisados dados referentes aos adultos (18 a 96 anos, n = 1.516 do inquérito Saúde e Nutrição de Adultos e Crianças de Rio Branco, obtidos em entrevistas domiciliares. As relações entre acidente de trânsito auto-referido e variáveis socioeconômicas e comportamentais foram analisadas por meio de razões de prevalência e intervalos de 95% de confiança; foi efetuada análise de regressão múltipla de Poisson. RESULTADOS: A prevalência de acidente de trânsito auto-referido foi de 36%. Na análise de Poisson, os indivíduos do sexo masculino (RP=1,45 e IC95%: 1,12;1,87, que relatavam consumo de bebida alcoólica (RP=1,25 e IC95%: 0,97;1,62, com renda acima de cinco salários mínimos (RP=1,88 e IC95%: 1,25;2,83, idade entre 18 e 25 anos (RP=1,45 e IC95%: 1,02;2,05 apresentaram maior probabilidade de referir envolvimento em acidente de trânsito. As variáveis idade e escolaridade mostraram associação inversa com o desfecho, enquanto renda apresentou associação positiva, todas elas com tendência significativa. CONCLUSÕES: A prevalência dos acidentes de trânsito auto-referidos aponta risco mais elevado para homens, com renda mais elevada, menor escolaridade e que ingerem bebida alcoólica, os quais devem ser alvo das campanhas preventivas.OBJETIVO: Estimar la prevalencia de accidentes de tránsito auto-referidos e identificar factores asociados. MÉTODOS: Estudio transversal de base poblacional realizado de septiembre de 2007 a agosto de 2008, en las zonas urbana y rural de Rio Branco, Norte de Brasil. Se analizaron datos referentes a los adultos (18 a 96 años, n=1.516 de la Pesquisa Salud y Nutrición de Adultos y Niños de Rio Branco, obtenidos en entrevistas domiciliares
International Nuclear Information System (INIS)
Kawabata, T; Akimune, H; Fujita, H; Fujita, Y; Fujiwara, M; Hara, K; Hatanaka, K; Itoh, M; Kanada-En'yo, Y; Kishi, S; Nakanishi, K; Sakaguchi, H; Shimbara, Y; Tamii, A; Terashima, S; Uchida, M; Wakasa, T; Yasuda, Y; Yoshida, H P; Yosoi, M
2006-01-01
The cluster structures of the excited states in 11 B are studied by analyzing the isoscalar monopole and quadrupole strengths in the 11 B(d, d') reaction at E d = 200 MeV. The excitation strengths are compared with the theoretical predictions by the antisymmetrized molecular-dynamics (AMD) calculations. It is found that the large monopole strength for the 3/2 - 3 state at E x = 8.56 MeV is well described by the AMD wave function with a dilute 2α + tcluster structure
Evolução dos acidentes de trânsito em um grande centro urbano, 1991-2000
Oliveira,Zenaide Calazans de; Mota,Eduardo Luiz Andrade; Costa,Maria da Conceição N.
2008-01-01
Este estudo descreve a evolução dos acidentes de trânsito em Salvador, Bahia, Brasil, entre 1991 e 2000, utilizando-se dados do Departamento Estadual de Trânsito do Estado da Bahia. Calculou-se taxas globais dos acidentes de trânsito, vítimas e taxas padronizadas de mortalidade por habitante e por veículos, e comparou-se médias destes indicadores para antes (1991 a 1994) e após (1995 a 2000) a adoção de medidas de intervenção como o uso do cinto de segurança e o Código Nacional de Trânsito. A...
Onodera, Rie; Kurita, Emi; Taniguchi, Kikuyo; Karakawa, Shuhei; Okada, Satoshi; Kihara, Hirotaka; Fujii, Teruhisa; Kobayashi, Masao
2017-11-01
Anti-human neutrophil antigen (HNA) antibodies have been implicated in the development of neonatal alloimmune neutropenia (NAN) and autoimmune neutropenia (AIN). There are many conventional assay methods that detect anti-HNA antibodies. However, a method to measure multiple samples and detect several anti-HNA antibodies simultaneously is needed. We developed a new method, the extracted granulocyte antigen immunofluorescence assay (EGIFA), to analyze anti-HNA-1a, -1b, and -2 antibodies in sera. The results obtained by EGIFA were evaluated in comparison with those from several standard assay methods. Anti-HNA antibodies in serum samples from nine familial cases with suspected NAN (n = 19) and children with suspected AIN (n = 88) were also measured by EGIFA. The evaluation of nine serum samples with anti-HNA antibodies suggested that EGIFA demonstrated equivalent specificity and superior sensitivity to monoclonal antibody-specific immobilization of granulocyte antigens and had comparable sensitivity to the granulocyte indirect immunofluorescence test. EGIFA successfully detected anti-HNA-1a or -1b antibodies in seven of nine familial cases with suspected NAN. EGIFA detected anti-HNA antibodies in 40.9% of children with suspected AIN. Among them, isolated anti-HNA-1a or -1b antibody was detected in 4.5 or 12.5% of children, respectively, and anti-HNA-2 antibody was identified in 3.4% of children. The 30.8% (16 of 52) of children negative for anti-HNA antibody by EGIFA were positive for anti-HLA antibody. EGIFA facilitated the measurement of anti-HNA-1a, -1b, and/or -2 antibodies in sera. The prompt measurement of anti-HNA antibodies will improve the diagnosis and clinical management of patients with suspected NAN or AIN. © 2017 AABB.
van Leeuwen, M A; Costes, L M M; van Berkel, L A; Simons-Oosterhuis, Y; du Pré, M F; Kozijn, A E; Raatgeep, H C; Lindenbergh-Kortleve, D J; van Rooijen, N; Koning, F; Samsom, J N
2017-05-01
Celiac disease is caused by inflammatory T-cell responses against the insoluble dietary protein gliadin. We have shown that, in humanized mice, oral tolerance to deamidated chymotrypsin-digested gliadin (CT-TG2-gliadin) is driven by tolerogenic interferon (IFN)-γ- and interleukin (IL)-10-secreting type 1 regulatory T-like cells (Tr1-like cells) generated in the spleen but not in the mesenteric lymph nodes. We aimed to uncover the mechanisms underlying gliadin-specific Tr1-like-cell differentiation and hypothesized that proteolytic gliadin degradation by splenic macrophages is a decisive step in this process. In vivo depletion of macrophages caused reduced differentiation of splenic IFN-γ- and IL-10-producing Tr1-like cells after CT-TG2-gliadin but not gliadin peptide feed. Splenic macrophages, rather than dendritic cells, constitutively expressed increased mRNA levels of the endopeptidase Cathepsin D; macrophage depletion significantly reduced splenic Cathepsin D expression in vivo and Cathepsin D efficiently degraded recombinant γ-gliadin in vitro. In response to CT-TG2-gliadin uptake, macrophages enhanced the expression of Il27p28, a cytokine that favored differentiation of gliadin-specific Tr1-like cells in vitro, and was previously reported to increase Cathepsin D activity. Conversely, IL-27 neutralization in vivo inhibited splenic IFN-γ- and IL-10-secreting Tr1-like-cell differentiation after CT-TG2-gliadin feed. Our data infer that endopeptidase mediated gliadin degradation by macrophages and concomitant IL-27 production drive differentiation of splenic gliadin-specific Tr1-like cells.
Inre och yttre motivation till träning : en kvalitativ studie bland regebundet aktiva kvinnor
Jonsson, Johanna
2015-01-01
Bakgrund: Regelbunden träning är viktig för både fysiskt och psykisktvälbefinnande. För att bibehålla en regelbundenhet i träningen krävs det ettengagemang och en motivation. En person kan motiveras av både inre ochyttre faktorer beroende på personens intresse. Trots att människor tenderaratt vara mer stillasittande, tycks intresset för träning och hälsa öka. Inteminst syns detta på sociala medier, där bilder och inlägg medträningsbudskap förmedlas frekvent. Syfte: Studiens syfte är att under...
Photometric investigation of hot exoplanets: TrES-3b and Qatar-1b
Püsküllü, Ç.; Soydugan, F.; Erdem, A.; Budding, E.
2017-08-01
New photometric follow-up observations of transitting 'hot Jupiters' TrES-3b and Qatar-1b are presented. Weighted mean values of the solutions of light curves in R-filter for both planetary systems are reported and compared with the previous results. The transit light curves were analysed using the WINFITTER code. The physical properties of the planets were estimated. The planet radii are found to be Rp = 1.381 ± 0.033RJ for TrES-3b and Rp = 1.142 ± 0.025RJ for Qatar-1b. Transit times and their uncertainties were also determined and a new linear ephemeris was computed for both systems. Analysis of transit times showed that a significant signal could not be determined for TrES-3b, while weak evidence was found for Qatar-1b, which might be tested using more precise future transit times.
Comparing personality disorder models: cross-method assessment of the FFM and DSM-IV-TR.
Samuel, Douglas B; Widiger, Thomas W
2010-12-01
The current edition of the Diagnostic and Statistical Manual of Mental Disorders (DSM-IV-TR; American Psychiatric Association, 2000) defines personality disorders as categorical entities that are distinct from each other and from normal personality traits. However, many scientists now believe that personality disorders are best conceptualized using a dimensional model of traits that span normal and abnormal personality, such as the Five-Factor Model (FFM). However, if the FFM or any dimensional model is to be considered as a credible alternative to the current model, it must first demonstrate an increment in the validity of the assessment offered within a clinical setting. Thus, the current study extended previous research by comparing the convergent and discriminant validity of the current DSM-IV-TR model to the FFM across four assessment methodologies. Eighty-eight individuals receiving ongoing psychotherapy were assessed for the FFM and the DSM-IV-TR personality disorders using self-report, informant report, structured interview, and therapist ratings. The results indicated that the FFM had an appreciable advantage over the DSM-IV-TR in terms of discriminant validity and, at the domain level, convergent validity. Implications of the findings and directions for future research are discussed.
Hans Georg Trüper (1936–2016 and His Contributions to Halophile Research
Directory of Open Access Journals (Sweden)
Aharon Oren
2016-05-01
Full Text Available Prof. Hans Georg Trüper, one of the most important scientists in the field of halophile research, passed away on 9 March 2016 at the age of 79. I here present a brief obituary with special emphasis on Prof. Trüper’s contributions to our understanding of the halophilic prokaryotes and their adaptations to life in hypersaline environments. He has pioneered the study of the halophilic anoxygenic phototrophic sulfur bacteria of the Ectothiorhodospira—Halorhodospira group. Some of the species he and his group isolated from hypersaline and haloalkaline environments have become model organisms for the study of the mechanisms of haloadaptation: the functions of three major organic compounds – glycine betaine, ectoine, and trehalose – known to serve as “compatible solutes” in halophilic members of the Bacteria domain, were discovered during studies of these anoxygenic phototrophs. Prof. Trüper’s studies of hypersaline alkaline environments in Egypt also led to the isolation of the first known extremely halophilic archaeon (Natronomonas pharaonis. The guest editors dedicate this special volume of Life to the memory of Prof. Hans Georg Trüper.
DB2 11 the ultimate database for cloud, analytics, and mobile
Campbell, John; Jones, Gareth; Parekh, Surekha; Yothers, Jay
2014-01-01
Building on the prior book ""DB2 11: The Database for Big Data and Analytics,"" published in 2013, this book is written particularly for new and existing DB2 for z/OS customers and users who want to learn as much as they can about the new software version before migrating their organizations to DB2 11 for z/OS. The book begins with a technical overview of DB2 11 features and explains how the new functions in DB2 11 can help enterprise customers address the challenges they face with the explosion of data and information. There has been rapid growth in the variety, volume, and velocity of dat
Hartman, J. D.; Quinn, S. N.; Bakos, G. Á.; Torres, G.; Kovács, G.; Latham, D. W.; Noyes, R. W.; Shporer, A.; Fulton, B. J.; Esquerdo, G. A.; Everett, M. E.; Penev, K.; Bhatti, W.; Csubry, Z.
2018-03-01
We report the discovery by the HATNet survey of HAT-TR-318-007, a P=3.34395390+/- 0.00000020 day period detached double-lined M dwarf binary with total secondary eclipses. We combine radial velocity (RV) measurements from TRES/FLWO 1.5 m and time-series photometry from HATNet, FLWO 1.2 m, BOS 0.8 m, and NASA K2 Campaign 5, to determine the masses and radii of the component stars: MA=0.448+/-0.011 M⊙N, MB=0.2721-0.0042+0.0041 M⊙N, RA=0.4548-0.0036+0.0035 R⊙N, and RB=0.2913-0.0024+0.0023 R⊙N. We obtained a FIRE/Magellan near-infrared spectrum of the primary star during a total secondary eclipse, and we use this to obtain disentangled spectra of both components. We determine spectral types of STA=M 3.71+/- 0.69 and STB=M 5.01+/- 0.73 and effective temperatures of Teff, A= 3190+/-110 K and Teff, B=3100+/- 110 K for the primary and secondary star, respectively. We also measure a metallicity of [Fe/H] = +0.298+/- 0.080 for the system. We find that the system has a small, but significant, nonzero eccentricity of 0.0136+/- 0.0026. The K2 light curve shows a coherent variation at a period of 3.41315-0.00032+0.00030 days, which is slightly longer than the orbital period, and which we demonstrate comes from the primary star. We interpret this as the rotation period of the primary. We perform a quantitative comparison between the Dartmouth stellar evolution models and the seven systems, including HAT-TR-318-007, that contain M dwarfs with 0.2 M⊙N< M< 0.5 M⊙N, have metallicity measurements, and have masses and radii determined to better than 5% precision. Discrepancies between the predicted and observed masses and radii are found for three of the systems.
Lovasz, Erwin-Christian; Hüsing, Mathias
2015-01-01
This volume deals with topics such as mechanism and machine design, biomechanics and medical engineering, gears, mechanical transmissions, mechatronics, computational and experimental methods, dynamics of mechanisms and machines, micromechanisms and microactuators, and history of mechanisms and transmissions. Following MeTrApp 2011 and 2013, held under the auspices of the IFToMM, these proceedings of the 3rd Conference on Mechanisms, Transmissions and Applications offer a platform for original research presentations for researchers, scientists, industry experts and students in the fields of mechanisms and transmissions with special emphasis on industrial applications in order to stimulate the exchange of new and innovative ideas.
Katritzky, Alan R; Jain, Ritu; Xu, Yong-Jiang; Steel, Peter J
2002-11-15
Condensation reactions of benzotriazole and 2-(pyrrol-1-yl)-1-ethylamine (1) with formaldehyde and glutaric dialdehyde, respectively, afforded intermediates 2 and 6. Subsequent nucleophilic substitutions of the benzotriazole group in 2 and 6 with Grignard reagents, sodium cyanide, and sodium borohydride gave 1,2,3,4-tetrahydropyrrolo[1,2-a]pyrazines 3a-e, 4, 5 and 5,6,9,10,11,11a-hexahydro-8H-pyrido[1,2-a]pyrrolo[2,1-c]pyrazines 7a-c, 8, 9, respectively, in good yields.
11 CFR 9003.2 - Candidate certifications.
2010-01-01
... funds under 11 CFR 9003.2(c)(3) shall not count against such candidate's $50,000 expenditure limitation... expenditures. (8) Expenditures made using a credit card for which the candidate is jointly or solely liable will count against the limits of this section to the extent that the full amount due, including any...
Pemetaan Pusat Pelayanan Terpadu Pemberdayaan Perempuan dan Anak (P2TP2A Provinsi Sumatera Bar
Directory of Open Access Journals (Sweden)
Hallen Abu Bakar
2017-09-01
Full Text Available The Center of Integrated Service for Women and Children Empowerment (P2TP2A is established by the government based community in order to eliminate the violence towards women and children. It also aims to empower the position of women and children. The purpose of the study is to describe comprehensively the existance of P2TP2A in sub-district, district, city, and province in West Sumatra. Descriptive qualitative research was used where the data taken from questionnaire and in-deepthinterview. The study found that the Center of Integrated Service for Women and Children Empowerment was established by following certain procedure, legality and personnel structure. It also found that the majority of P2TP2A in West Sumatra has insufficient infrastructures. Meanwhile, it is only P2TP2A Limpapeh Rumah Nan Gadang of West Sumatera, and P2TP2A Luhak Nan Tuo Batusangkar has sufficient infrastructures. Many of them were located at the corner of Community Empowerment and Women and Family Planning office (BPMPKB. Every P2TP2A in those district and city have made their programs, but they faced some difficulties in realize them doe to financial problems. The human resources were recruited from SKPD, academician, professional, society figures, LSM who concern on gender meanstreaming. They play the role more on providing the service than giving information and empowerment. The last finding of the study showed that the involvement of local government, Health offices, social services, police, ministry of religion, prosecutors and social services have been effective.
Directory of Open Access Journals (Sweden)
J. Y. Tang
2013-01-01
Full Text Available To improve regional and global biogeochemistry modeling and climate predictability, we have developed a generic reactive transport module for the land model CLM4 (called CLM4-BeTR (Biogeochemical Transport and Reactions. CLM4-BeTR represents the transport, interactions, and biotic and abiotic transformations of an arbitrary number of tracers (aka chemical species in an arbitrary number of phases (e.g., dissolved, gaseous, sorbed, aggregate. An operator splitting approach was employed and consistent boundary conditions were derived for each modeled sub-process. Aqueous tracer fluxes, associated with hydrological processes such as surface run-on and run-off, belowground drainage, and ice to liquid conversion were also computed consistently with the bulk water fluxes calculated by the soil physics module in CLM4. The transport code was evaluated and found in good agreement with several analytical test cases using a time step of 30 min. The model was then applied at the Harvard Forest site with a representation of depth-dependent belowground biogeochemistry. The results indicated that, at this site, (1 CLM4-BeTR was able to simulate soil–surface CO2 effluxes and soil CO2 profiles accurately; (2 the transient surface CO2 effluxes calculated based on the tracer transport mechanism were in general not equal to the belowground CO2 production rates with the magnitude of the difference being a function of averaging timescale and site conditions: differences were large (−20 ~ 20% on hourly, smaller (−5 ~ 5% at daily timescales, and persisted to the monthly timescales with a smaller magnitude (<4%; (3 losses of CO2 through processes other than surface gas efflux were less than 1% of the overall soil respiration; and (4 the contributions of root respiration and heterotrophic respiration have distinct temporal signals in surface CO2 effluxes and soil CO2 concentrations. The
Reposição de nutrientes durante três cultivos de alface em hidroponia
Directory of Open Access Journals (Sweden)
Backes Fernanda Alice A.L.
2003-01-01
Full Text Available O experimento foi realizado em estufa plástica na UFSM, de agosto a novembro/99. Avaliou-se cinco formas de reposição de nutrientes na solução nutritiva com base na condutividade elétrica (CE, no sistema 'NFT' (Nutrient Film Technique e duas cultivares de alface: Regina e Deisy, cultivadas em bancadas de sustentação formadas por telhas de fibro-cimento revestidas com tinta betuminosa Neutrolâ. Foram dispostas 14 plantas por canal para cada repetição e uma cultivar em cada três canais, totalizando 84 plantas por bancada de produção. Comparou-se a eficiência de métodos de reposição de nutrientes na produção de alface, assim como a utilização da mesma solução, com reposição de nutrientes, durante três cultivos consecutivos. O delineamento experimental foi de blocos casualizados, com três repetições, em esquema fatorial 5x2. Os resultados demonstraram que o desempenho das cultivares avaliadas não foi influenciado pelos métodos de reposição de nutrientes. A ausência de reposição de nutrientes na solução nutritiva, durante um cultivo, permitiu maior produtividade da cultura, não se recomendando a reposição quando o objetivo for renovar a solução ao final do cultivo. As formas de reposição de nutrientes na solução nutritiva, durante o primeiro e segundo cultivos, não alteraram a produtividade da cultura em relação à renovação completa da solução nutritiva ao final do cultivo hidropônico. Para a reutilização de solução nutritiva, recomenda-se a reposição de nutrientes sempre que a CE diminuir 50% da inicial, possibilitando a produção por pelo menos três cultivos.
Yan, Hongxia; Zhang, Ping; Kong, Xue; Hou, Xianglian; Zhao, Li; Li, Tianhang; Yuan, Xiaozhou; Fu, Hongjun
2017-04-01
In malignant melanoma, tumor-associated macrophages play multiple roles in promoting tumor growth, such as inducing the transformation of melanocytes under ultraviolet irradiation, increasing angiogenesis in melanomas, and suppressing antitumor immunity. Because granzyme B- and perforin-expressing Tr1 cells could specifically eliminate antigen-presenting cells of myeloid origin, we examined whether Tr1 cells in melanoma could eliminate tumor-promoting macrophages and how the interaction between Tr1 cells and macrophages could affect the growth of melanoma cells. Tr1 cells were characterized by high interleukin 10 secretion and low Foxp3 expression and were enriched in the CD4 + CD49b + LAG-3 + T-cell fraction. Macrophages derived from peripheral blood monocytes in the presence of modified melanoma-conditioned media demonstrated tumor-promoting capacity, exemplified by improving the proliferation of cocultured A375 malignant melanoma cells. But when primary Tr1 cells were present in the macrophage-A375 coculture, the growth of A375 cells was abrogated. The conventional CD25 + Treg cells, however, were unable to inhibit macrophage-mediated increase in tumor cell growth. Further analyses showed that Tr1 cells did not directly eliminate A375 cells, but mediated the killing of tumor-promoting macrophages through the secretion of granzyme B and perforin. The tumor-infiltrating interleukin 10 + Foxp3 - CD4 + T cells expressed very low levels of granzyme B and perforin, possibly suggested the downregulation of Tr1 cytotoxic capacity in melanoma tumors. Together, these data demonstrated an antitumor function of Tr1 cells through the elimination of tumor-promoting macrophages, which was not shared by conventional Tregs.
Fermentation of Foc TR4-infected bananas and Trichoderma spp.
Yang, J; Li, B; Liu, S W; Biswas, M K; Liu, S; Wei, Y R; Zuo, C W; Deng, G M; Kuang, R B; Hu, C H; Yi, G J; Li, C Y
2016-10-17
Fusarium wilt (also known as Panama disease) is one of the most destructive banana diseases, and greatly hampers the global production of bananas. Consequently, it has been very detrimental to the Chinese banana industry. An infected plant is one of the major causes of the spread of Fusarium wilt to nearby regions. It is essential to develop an efficient and environmentally sustainable disease control method to restrict the spread of Fusarium wilt. We isolated Trichoderma spp from the rhizosphere soil, roots, and pseudostems of banana plants that showed Fusarium wilt symptoms in the infected areas. Their cellulase activities were measured by endoglucanase activity, β-glucosidase activity, and filter paper activity assays. Safety analyses of the Trichoderma isolates were conducted by inoculating them into banana plantlets. The antagonistic effects of the Trichoderma spp on the Fusarium pathogen Foc tropical Race 4 (Foc TR4) were tested by the dual culture technique. Four isolates that had high cellulase activity, no observable pathogenicity to banana plants, and high antagonistic capability were identified. The isolates were used to biodegrade diseased banana plants infected with GFP-tagged Foc TR4, and the compost was tested for biological control of the infectious agent; the results showed that the fermentation suppressed the incidence of wilt and killed the pathogen. This study indicates that Trichoderma isolates have the potential to eliminate the transmission of Foc TR4, and may be developed into an environmentally sustainable treatment for controlling Fusarium wilt in banana plants.
Energy Technology Data Exchange (ETDEWEB)
Ernest A. Mancini
2004-09-24
The principal research effort for Year 1 of the project has been T-R cycle characterization and modeling. The research focus for the first nine (9) months of Year 1 was on outcrop study, well log analysis, seismic interpretation and data integration and for the remainder of the year the emphasis has been on T-R cycle model development. Information regarding the characteristics of T-R cycles has been assembled from the study of outcrops, from well log analyses, and from seismic reflection interpretation. From these studies, stratal boundaries separating T-R cycles have been found to be useful for the recognition and delineation of these cycles. The key stratal surfaces include subaerial unconformities, shoreface ravinement surfaces, transgressive surfaces, surfaces of maximum regression, and surfaces of maximum transgression. These surfaces can be identified and mapped in surface exposures and can be recognized in well log signatures and seismic reflection profiles as discontinuities. The findings from the study of outcrop, well log, and seismic reflection data are being integrated into a database for use in constructing a model for T-R cycle development.
B11 NMR in the layered diborides OsB2 and RuB2
Suh, B. J.; Zong, X.; Singh, Y.; Niazi, A.; Johnston, D. C.
2007-10-01
B11 nuclear magnetic resonance (NMR) measurements have been performed on B11 enriched OsB2 and RuB2 polycrystalline powder samples in an external field of 4.7T and in the temperature range, 4.2KOsB2 and RuB2 , respectively. The experimental results indicate that a p character dominates the conduction electron wave function at the B site with a negligibly small s character in both compounds.
El cuento en Colombia. Viento de trópico
Directory of Open Access Journals (Sweden)
Javier Arias Ramírez
1961-01-01
Full Text Available No sería "Viento de Trópico", sino Cuentos Intensos, el nombre del libro que acaba de publicar José Francisco Socarrás. Hay tal dramatismo y tal densidad psicológica, propios de quien ha vivido en continuo y fatigoso indagar de la conciencia.
Mashraqui, S.H.; Patil, M.B.; Sangvikar, Y.; Ashraf, M.; Mistry, H.D.; Daub, E.T.H.; Meetsma, A.
2005-01-01
Synthesis of biaryl type systems, 11-aryl/heteroarylnaphtho[2,1-b]furans 8-11 has been described with a view to studying the conformational orientation of C-11 aryl/heteroaryl groups. Synthesis of 8-11 was accomplished by a two-step sequence involving O-alkylation of 2-naphthol with appropriate
Investigation of two different anoxia models by 2-dimensional gel electrophoresis
DEFF Research Database (Denmark)
Wulff, Tune; Jessen, Flemming; Hoffmann, Else Kay
2006-01-01
anoxia obtained by NaN3 is a widely used model for simulating anoxia (Ossum et al., 2004). The effects of anoxia were studied by protein expression analysis using 2-dimensional gel electrophoresis followed by MS/MS. In this way we were able to separate more than 1500 protein spots with an apparent range...
Recurrent microdeletions at 15q11.2 and 16p13.11 predispose to idiopathic generalized epilepsies
DEFF Research Database (Denmark)
de Kovel, Carolien G F; Trucks, Holger; Helbig, Ingo
2010-01-01
could be examined in 14 families. While 10 microdeletions were inherited (seven maternal and three paternal transmissions), four microdeletions occurred de novo at 15q13.3 (n = 1), 16p13.11 (n = 2) and 22q11.2 (n = 1). Eight of the transmitting parents were clinically unaffected, suggesting...... syndromes. The candidate microdeletions were assessed by high-density single nucleotide polymorphism arrays in 1234 patients with idiopathic generalized epilepsy from North-western Europe and 3022 controls from the German population. Microdeletions were validated by quantitative polymerase chain reaction.......2 (odds ratio = 4.9; 95% confidence interval 1.8-13.2; P = 4.2 x 10(-4)) and 16p13.11 (odds ratio = 7.4; 95% confidence interval 1.3-74.7; P = 0.009). Including nine patients with idiopathic generalized epilepsy in this cohort with known 15q13.3 microdeletions (IGE/control: 9/0), parental transmission...
Du, Xiaoqiu; Xiao, Qiying; Zhao, Ran; Wu, Feng; Xu, Qijiang; Chong, Kang; Meng, Zheng
2008-06-01
In many temperate perennial plants, floral transition is initiated in the first growth season but the development of flower is arrested during the winter to ensure production of mature flowers in the next spring. The molecular mechanisms of the process remain poorly understood with few well-characterized regulatory genes. Here, a MADS-box gene, named as TrMADS3, was isolated from the overwintering inflorescences of Taihangia rupestris, a temperate perennial in the rose family. Phylogenetic analysis reveals that TrMADS3 is more closely related to the homologs of the FLOWERING LOCUS C lineage than to any of the other MIKC-type MADS-box lineages known from Arabidopsis. The TrMADS3 transcripts are extensively distributed in inflorescences, roots, and leaves during the winter. In controlled conditions, the TrMADS3 expression level is upregulated by a chilling exposure for 1 to 2 weeks and remains high for a longer period of time in warm conditions after cold treatment. In situ hybridization reveals that TrMADS3 is predominantly expressed in the vegetative and reproductive meristems. Ectopic expression of TrMADS3 in Arabidopsis promotes seed germination on the media containing relatively high NaCl or mannitol concentrations. These data indicate that TrMADS3 in a perennial species might have its role in both vegetative and reproductive meristems in response to cold.
Xylan oligosaccharides and cellobiohydrolase I (TrCeI7A) interaction and effect on activity
DEFF Research Database (Denmark)
Baumann, Martin Johannes; Borch, Kim; Westh, Peter
2011-01-01
and an enzyme variant without the cellulose-binding domain (CBM). Results We studied the binding of XOSs to TrCel7A by isothermal titration calorimetry. We found that XOSs bind to TrCel7A and that the affinity increases commensurate with XOS length. The CBM, on the other hand, did not affect the affinity...
Space-charge-mediated anomalous ferroelectric switching in P(VDF-TrEE) polymer films
Hu, Weijin
2014-11-12
We report on the switching dynamics of P(VDF-TrEE) copolymer devices and the realization of additional substable ferroelectric states via modulation of the coupling between polarizations and space charges. The space-charge-limited current is revealed to be the dominant leakage mechanism in such organic ferroelectric devices, and electrostatic interactions due to space charges lead to the emergence of anomalous ferroelectric loops. The reliable control of ferroelectric switching in P(VDF-TrEE) copolymers opens doors toward engineering advanced organic memories with tailored switching characteristics.
VizieR Online Data Catalog: TrES-2b multi-band transit observations (Mislis+, 2010)
Mislis, D.; Schroeter, S.; Schmitt, J. H. M. M.; Cordes, O.; Reif, K.
2010-02-01
The OLT data were taken on 11 April 2009 using a 3Kx3K CCD with a 1x1 FOV and an I-band filter as in our previous observing run (Paper I, Mislis & Schmitt, 2009, Cat. ). The Calar Alto data were taken on 28 May 2009 using BUSCA and the 2.2m telescope. (1 data file).
The Traffic Adaptive Data Dissemination (TrAD Protocol for both Urban and Highway Scenarios
Directory of Open Access Journals (Sweden)
Bin Tian
2016-06-01
Full Text Available The worldwide economic cost of road crashes and injuries is estimated to be US$518 billion per year and the annual congestion cost in France is estimated to be €5.9 billion. Vehicular Ad hoc Networks (VANETs are one solution to improve transport features such as traffic safety, traffic jam and infotainment on wheels, where a great number of event-driven messages need to be disseminated in a timely way in a region of interest. In comparison with traditional wireless networks, VANETs have to consider the highly dynamic network topology and lossy links due to node mobility. Inter-Vehicle Communication (IVC protocols are the keystone of VANETs. According to our survey, most of the proposed IVC protocols focus on either highway or urban scenarios, but not on both. Furthermore, too few protocols, considering both scenarios, can achieve high performance. In this paper, an infrastructure-less Traffic Adaptive data Dissemination (TrAD protocol which takes into account road traffic and network traffic status for both highway and urban scenarios will be presented. TrAD has double broadcast suppression techniques and is designed to adapt efficiently to the irregular road topology. The performance of the TrAD protocol was evaluated quantitatively by means of realistic simulations taking into account different real road maps, traffic routes and vehicular densities. The obtained simulation results show that TrAD is more efficient in terms of packet delivery ratio, number of transmissions and delay in comparison with the performance of three well-known reference protocols. Moreover, TrAD can also tolerate a reasonable degree of GPS drift and still achieve efficient data dissemination.
The Traffic Adaptive Data Dissemination (TrAD) Protocol for both Urban and Highway Scenarios.
Tian, Bin; Hou, Kun Mean; Zhou, Haiying
2016-06-21
The worldwide economic cost of road crashes and injuries is estimated to be US$518 billion per year and the annual congestion cost in France is estimated to be €5.9 billion. Vehicular Ad hoc Networks (VANETs) are one solution to improve transport features such as traffic safety, traffic jam and infotainment on wheels, where a great number of event-driven messages need to be disseminated in a timely way in a region of interest. In comparison with traditional wireless networks, VANETs have to consider the highly dynamic network topology and lossy links due to node mobility. Inter-Vehicle Communication (IVC) protocols are the keystone of VANETs. According to our survey, most of the proposed IVC protocols focus on either highway or urban scenarios, but not on both. Furthermore, too few protocols, considering both scenarios, can achieve high performance. In this paper, an infrastructure-less Traffic Adaptive data Dissemination (TrAD) protocol which takes into account road traffic and network traffic status for both highway and urban scenarios will be presented. TrAD has double broadcast suppression techniques and is designed to adapt efficiently to the irregular road topology. The performance of the TrAD protocol was evaluated quantitatively by means of realistic simulations taking into account different real road maps, traffic routes and vehicular densities. The obtained simulation results show that TrAD is more efficient in terms of packet delivery ratio, number of transmissions and delay in comparison with the performance of three well-known reference protocols. Moreover, TrAD can also tolerate a reasonable degree of GPS drift and still achieve efficient data dissemination.
Hematological abnormalities and 22q11.2 deletion syndrome
Directory of Open Access Journals (Sweden)
Rafael Fabiano Machado Rosa
2011-01-01
Full Text Available The 22q11.2 deletion syndrome (22q11DS is a common genetic disease characterized by broad phenotypic variability. Despite the small number of studies describing hematological alterations in individuals with 22q11DS, it appears that these abnormalities are more frequent than previously imagined. Thus, the objective of our study was to report on a patient with 22q11DS presenting thrombocytopenia and large platelets and to review the literature. The patient, a 13-year-old boy, was originally evaluated due to craniofacial dysmorphia and speech delay. He also had a history of behavioral changes, neuropsychomotor delay and recurrent otitis/sinusitis. The identification of a 22q11.2 microdeletion by fluorescent in situ hybridization diagnosed the syndrome. Despite his hematological alterations, he only had a history of epistaxis and bruising of the upper and lower limbs. Assessments of the prothrombin time, thrombin time, partial thromboplastin time, bleeding time, fibrinogen levels and platelet aggregation (including the ristocetin induced platelet aggregation test were all normal. Hematological alterations observed in 22q11DS are directly related to the genetic disorder itself (especially in respect to deletion of the GPIb gene and secondary to some clinical findings, such as immunodeficiency. Macrothrombocytopenia is increasingly being considered a feature of the broad spectrum of 22q11DS and may potentially be a clinical marker for the syndrome.
Diagnostic Distribution of eating disorders: Comparison between DSMIV- TR and DSM-5.
Serrano-Troncoso, Eduardo; Cañas, Laura; Carbonell, Xavier; Carulla, Marta; Palma, Carolina; Matalí, Josep; Dolz, Montse
2017-01-01
The fifth edition of Diagnostic and Statistical Manual of Mental Disorders (DSM-5) includes a significant revision of Eating Disorders (ED). The objective of this study is to compare the distribution of diagnosis of ED in adolescents according to DSM-VI-TR and DSM-5 criteria. A second objective is to study the psychopathological differences between patients with ED (based on DSM-IV-TR) and those whose diagnosis changed by applying DSM-5 criteria. One hundred and one adolescents diagnosed with ED (mean: 14.68 years; SD: 1.46) were evaluated with clinical interviews and scales for eating psychopathology, perfectionism, anxiety, and depression. Applying the DSM-5 criteria led to a significant decrease in the diagnosed cases of Eating Disorders Not Otherwise Specified (EDNOS) (from 34.7% to 23.8%; p<0.001) and to a significant increase in those of anorexia nervosa (AN) (from 58.4% to 66.3%; p<0.001) and of bulimia nervosa (BN) (from 6.9% to 8.9%; p<0.001). No significant psychopathological differences were found between patients diagnosed with AN and BN based on DSM-IV-TR criteria and those newly diagnosed with AN and BN based on DSM-5 criteria. Using DSM-5 criteria for adolescents with ED leads to a significant decrease in the frequency of an EDNOS diagnosis. As similar psychopathological characteristics were observed between ED patients diagnosed based on DSM-IV-TR and those who were switched from EDNOS to AN or BN based on DSM-5, we conclude that the new criteria for ED in DSM-5 are valid for an adolescent population.
Nordeman, Patrik; Friis, Stig D; Andersen, Thomas L; Audrain, Hélène; Larhed, Mats; Skrydstrup, Troels; Antoni, Gunnar
2015-12-01
Herein, we present a new rapid, efficient, and low-cost radiosynthetic protocol for the conversion of (11) CO2 to (11) CO and its subsequent application in Pd-mediated reactions of importance for PET applications. This room-temperature methodology, using readily available chemical reagents, is carried out in simple glass vials, thus eliminating the need for expensive and specialized high-temperature equipment to access (11) CO. With this fast and near-quantitative conversion of (11) CO2 into (11) CO, aryl and heteroaryl iodides were easily converted into a broad selection of biologically active amides in radiochemical yields ranging from 29-84 %. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Simultaneous spectral and photometric observations of the beat Cepheid U TrA
International Nuclear Information System (INIS)
Niva, G.D.; Schmidt, E.G.
1981-01-01
It was suggested that U TrA was a Cepheid with a modulated light curve. Further photometric and radial-velocity observations have confirmed this behaviour. Unfortunately, the radial velocities are too few in number and too scattered to allow a detailed analysis. This paper presents further photometric and spectroscopic observations of U TrA. The original intent was to obtain enough simultaneous observations to perform a Wesselink analysis similar to the one made for another beat Cepheid, TU Cas. Unfortunately, this has not been possible. However, the data obtained are of high quality and are clearly useful in studies of the modal content and period stability of the star. (author)
RNA-Seq-Based Transcript Structure Analysis with TrBorderExt.
Wang, Yejun; Sun, Ming-An; White, Aaron P
2018-01-01
RNA-Seq has become a routine strategy for genome-wide gene expression comparisons in bacteria. Despite lower resolution in transcript border parsing compared with dRNA-Seq, TSS-EMOTE, Cappable-seq, Term-seq, and others, directional RNA-Seq still illustrates its advantages: low cost, quantification and transcript border analysis with a medium resolution (±10-20 nt). To facilitate mining of directional RNA-Seq datasets especially with respect to transcript structure analysis, we developed a tool, TrBorderExt, which can parse transcript start sites and termination sites accurately in bacteria. A detailed protocol is described in this chapter for how to use the software package step by step to identify bacterial transcript borders from raw RNA-Seq data. The package was developed with Perl and R programming languages, and is accessible freely through the website: http://www.szu-bioinf.org/TrBorderExt .
Childhood cognitive development in 22q11.2 deletion syndrome: case-control study.
Chawner, Samuel J R A; Doherty, Joanne L; Moss, Hayley; Niarchou, Maria; Walters, James T R; Owen, Michael J; van den Bree, Marianne B M
2017-10-01
Background 22q11.2 deletion syndrome (22q11.2DS) is associated with a high risk of childhood as well as adult psychiatric disorders, in particular schizophrenia. Childhood cognitive deterioration in 22q11.2DS has previously been reported, but only in studies lacking a control sample. Aims To compare cognitive trajectories in children with 22q11.2DS and unaffected control siblings. Method A longitudinal study of neurocognitive functioning (IQ, executive function, processing speed and attention) was conducted in children with 22q11.2DS ( n = 75, mean age time 1 ( T 1 ) 9.9, time 2 ( T 2 ) 12.5) and control siblings ( n = 33, mean age T 1 10.6, T 2 13.4). Results Children with 22q11.2DS exhibited deficits in all cognitive domains. However, mean scores did not indicate deterioration. When individual trajectories were examined, some participants showed significant decline over time, but the prevalence was similar for 22q11.2DS and control siblings. Findings are more likely to reflect normal developmental fluctuation than a 22q11.2DS-specific abnormality. Conclusions Childhood cognitive deterioration is not associated with 22q11.2DS. Contrary to previous suggestions, we believe it is premature to recommend repeated monitoring of cognitive function for identifying individual children with 22q11.2DS at high risk of developing schizophrenia. © The Royal College of Psychiatrists 2017.
A tríade “Verdadeiro-Bom-Belo”: O lugar da beleza na Idade Média
Directory of Open Access Journals (Sweden)
Jan A. Aertsen
2008-06-01
Full Text Available Neste artigo, Jan Aertsen discute a compreensão da tríade “Verdadeiro-Belo-Bom” como representante de um conjunto de questões clássicas em filosofia, a qual corresponderia, do ponto de vista moderno, à suposição de que o sujeito possui três modos distintos de se relacionar com o mundo: cognitivo, estético e prático. O autor sugere que a tríade foi formulada explicitamente pela primeira vez na Idade Média; neste período, entretanto, a beleza não era considerada um problema “estético”.
Įvairių trąšų įtaka ekologiškai auginamiems žieminiams rugiams
Stelmokas, Svajūnas
2009-01-01
Lietuvos žemės ūkio universiteto Agroekologijos centro ekologinės gamybos ūkyje 2007-2008 m. atlikus fosforo ir kalio trąšų įtakos ekologiškai auginamiems žieminiams rugiams tyrimus nustatyta, kad didžiausias žieminių rugių derlingumas gautas tręšiant P60 fosforitmilčių norma. Didinant normą žieminių rugių derlingumas mažėjo. Lyginant fosforitmilčių normas tarpusavyje bei su netręštais žieminiais rugiais, esminių grūdų derlingumo skirtumų nenustatyta. Tręšimas fosforitmilčiais neturėjo esminė...
Directory of Open Access Journals (Sweden)
Ângela Maria Mendes Abreu
2010-06-01
Full Text Available Trata-se de estudo exploratório descritivo. O objetivo foi correlacionar os níveis de alcoolemia, detectados nas vítimas fatais por acidentes de trânsito, na cidade do Rio de Janeiro, a partir dos registros do Instituto Medico Legal -IML, com o perfil da vítima e as características dos acidentes. Os dados foram levantados no arquivo do IML, por meio dos prontuários de vítimas fatais por acidentes de trânsito, compilados e tabulados Poe meio do programa estatístico SPSS, no período compreendido entre janeiro e maio de 2005. Avaliaram-se 348 prontuários de vítimas fatais por acidentes de trânsito. Desses, apenas 94 realizaram o exame de alcoolemia, sendo que 83 apresentaram alcoolemia positiva e 60,2% níveis acima de 0,6g/l. Evidenciou-se o envolvimento do álcool com vítimas fatais nos acidentes de trânsito em níveis acima e abaixo de 0,6g/l de álcool por litro de sangue.Se trata de estudio epidemiológico exploratorio y descriptivo. El objetivo fue correlacionar los niveles de alcoholemia detectados en las víctimas fatales por accidentes de tránsito, en la ciudad de Río de Janeiro (datos de los registros del Instituto Médico Legal/IML con el perfil de la víctima y las características de los accidentes. Los datos fueron recolectados del archivo del IML, a través de los registros que constaban en las fichas de víctimas fatales por accidentes de tránsito; fueron compilados y se elaboraron tablas con el Programa estadístico SPSS, en el período comprendido entre enero y mayo de 2005. Fueron levantados datos sobre 348 víctimas fatales por accidentes de tránsito, de estos, apenas 94 realizaron el examen de alcoholemia, siendo que en 83 fueron detectados niveles de alcoholemia; el 60,2% presentó niveles por encima de 0,6g de alcohol por litro de sangre. Se mostró evidente el envolvimiento del alcohol en accidentes de tránsito con víctimas fatales, en niveles por encima y por debajo de 0,6g de alcohol por litro de
Tidlig struktureret mobilisering og træning af kritisk syge patienter på et dansk intensivafsnit
DEFF Research Database (Denmark)
Astrup Sørensen, Katrine; Hvid, Sidsel; Rolving, Nanna
2015-01-01
derimod anvendelig i forhold til at tilpasse niveauet for mobilisering og træning. Relevans for klinisk praksis: Tidlig mobilisering og træning er mulig at indføre med en simpel algoritme, dog med hensyntagen til individuelle screeningskriterier fra sted til sted, da disse åbenbart ikke er nemme...
Træernes rolle i et landbrugslandskab i Senegal
DEFF Research Database (Denmark)
Pedersen, Jens Christian
2010-01-01
Ved at gå ind i et eksisterende projektsamarbejde er det lykkedes Steen Christensen at gennemføre et vellykket feltarbejde i Senegal inden for et 6-måneders speciale. Resultaterne fra projektet vil kunne indgå som grundlag for en lokal forvaltning som tager sigte på at beskytte træerne som er en...
Modelo ARIMA para pronosticar valores de tráfico en una red de datos Wi-Fi
Directory of Open Access Journals (Sweden)
Cesar Augusto Hernández Suarez
2009-05-01
Full Text Available El presente artículo de investigación científica y tecnológica tiene por objetivo demostrar que las series de tiempo son una exce- lente herramienta para el modelamiento de tráfico de datos en redes Wi-Fi. Para lograr este objetivo se utilizó la metodología de Box-Jenkins, la cual se describe. El modelamiento de tráfico Wi-Fi a través de modelos correlacionados como las series de tiem- po, permiten ajustar gran parte de la dinámica del comportamiento de los datos en una ecuación y con base en esto estimar va- lores futuros de tráfico. Lo anterior es una ventaja para la planeación de cobertura, reservación de recursos y la realización de un control más oportuno y eficiente en forma integrada a diferentes niveles de la jerarquía funcional de la red de datos Wi-Fi. Como resultado de la investigación se obtuvo un modelo de tráfico ARIMA de orden 6, el cual realizó pronósticos de tráfico con valores del error cuadrático medio relativamente pequeños, para un periodo de 18 días.
Akuli, Amitava; Pal, Abhra; Ghosh, Arunangshu; Bhattacharyya, Nabarun; Bandhopadhyya, Rajib; Tamuly, Pradip; Gogoi, Nagen
2011-09-01
Quality of black tea is generally assessed using organoleptic tests by professional tea tasters. They determine the quality of black tea based on its appearance (in dry condition and during liquor formation), aroma and taste. Variation in the above parameters is actually contributed by a number of chemical compounds like, Theaflavins (TF), Thearubigins (TR), Caffeine, Linalool, Geraniol etc. Among the above, TF and TR are the most important chemical compounds, which actually contribute to the formation of taste, colour and brightness in tea liquor. Estimation of TF and TR in black tea is generally done using a spectrophotometer instrument. But, the analysis technique undergoes a rigorous and time consuming effort for sample preparation; also the operation of costly spectrophotometer requires expert manpower. To overcome above problems an Electronic Vision System based on digital image processing technique has been developed. The system is faster, low cost, repeatable and can estimate the amount of TF and TR ratio for black tea liquor with accuracy. The data analysis is done using Principal Component Analysis (PCA), Multiple Linear Regression (MLR) and Multiple Discriminate Analysis (MDA). A correlation has been established between colour of tea liquor images and TF, TR ratio. This paper describes the newly developed E-Vision system, experimental methods, data analysis algorithms and finally, the performance of the E-Vision System as compared to the results of traditional spectrophotometer.
International Nuclear Information System (INIS)
Philippe, C.; Haeusler, D.; Mitterhauser, M.; Ungersboeck, J.; Viernstein, H.; Dudczak, R.; Wadsak, W.
2011-01-01
[ 11 C]PIB is still the standard PET compound for Alzheimer imaging targeting beta-amyloid plaques. We aimed to establish a fully-automated procedure for the synthesis and purification of [ 11 C]PIB with a high degree of reliability and improved specific activity as well as a suitable and fast quality control assay. The optimum reaction conditions were 75 deg. C, 4 mg/mL precursor yielding at 48.0±2.7% (EOS, based on [ 11 C]CH 3 OTf, corrected for decay), 183±14 GBq/μmol specific activity and >99% radiochemical purity. Time consumption was kept to a minimum (40 min from EOB) and overall yields were enough to serve 2 consecutive patients with a single preparation. - Highlights: → Optimized radiosynthesis of [ 11 C]PIB in 40 min. → Optimum reaction conditions were 75 deg. C and 4 mg/mL precursor. → Radiochemical yields were 4.2±1.1 GBq. → The specific activity was 183±14 GBq/μmol.
Preparation of no-carrier-added [1-11C]ethylene and [1-11C]1,2-dibromoethane as new labelling agents
International Nuclear Information System (INIS)
Shah, F.; Pike, V.W.; Dowsett, K.
1997-01-01
A method is described for the preparation of NCA [1- 11 C] ethylene based on the passage of [1- 11 C]ethanol over heated (550 o C) quartz glass in a stainless steel tube (in preference to dehydration by catalysis on γ-alumina or pyrolysis). The [1- 11 C]ethanol is prepared from cyclotron-produced NCA [ 11 C]carbon dioxide by 11 C-carboxylation of methylmagnesium bromide, freshly prepared in dibutyl ether, and reduction of the adduct with lithium aluminium hydride in diglyme. The use of involatile solvents avoids the formation of carrier ethylene and radioactive and stable diethyl ether by cracking processes over the heated catalyst. The preparation takes 21 min from the end of radionuclide production and has a radiochemical yield of 44%, decay-corrected from [ 11 C]carbon dioxide. NCA [1- 11 C] ethylene is converted quantitatively into [1- 11 C]1,2-dibromoethane when collected in a solution of bromine in carbon tetrachloride. The NCA [1- 11 C]ethylene and [1- 11 C]1,2-dibromoethane may serve as new and useful labelling agents. (Author)
FIVE NEW TRANSIT EPOCHS OF THE EXOPLANET OGLE-TR-111b
International Nuclear Information System (INIS)
Hoyer, S.; Rojo, P.; Lopez-Morales, M.; DIaz, R. F.; Chambers, J.; Minniti, D.
2011-01-01
We report five new transit epochs of the extrasolar planet OGLE-TR-111b, observed in the v-HIGH and Bessell I bands with the FORS1 and FORS2 at the ESO Very Large Telescope between 2008 April and May. The new transits have been combined with all previously published transit data for this planet to provide a new transit timing variations (TTVs) analysis of its orbit. We find no TTVs with amplitudes larger than 1.5 minutes over a four-year observation time baseline, in agreement with the recent result by Adams et al. Dynamical simulations fully exclude the presence of additional planets in the system with masses greater than 1.3, 0.4, and 0.5 M + at the 3:2, 1:2, and 2:1 resonances, respectively. We also place an upper limit of about 30 M + on the mass of potential second planets in the region between the 3:2 and 1:2 mean-motion resonances.
TrSDB: a proteome database of transcription factors
Hermoso, Antoni; Aguilar, Daniel; Aviles, Francesc X.; Querol, Enrique
2004-01-01
TrSDB—TranScout Database—(http://ibb.uab.es/trsdb) is a proteome database of eukaryotic transcription factors based upon predicted motifs by TranScout and data sources such as InterPro and Gene Ontology Annotation. Nine eukaryotic proteomes are included in the current version. Extensive and diverse information for each database entry, different analyses considering TranScout classification and similarity relationships are offered for research on transcription factors or gene expression. PMID:14681387
Morphdynamics of Beaches in the Tróia-Sines Littoral Ribbon (SW Portugal)
Gama, Cristina; Andrade, César; Taborda, Rui; Freitas, Conceição
2006-01-01
In the Tróia-Sines littoral ribbon five beaches were monitored in order to evaluate morphological and textural changes. The textural analysis reveals a southward coarsening trend that reflects an increase in the wave energy. The morphodynamic data indicate that the modal stages are intermediate to reflective, and that the available beach volume increases southwards. During storm periods the volumetric changes reach 15% to 82% of the beach envelope corresponding to magnitudes of 6x10 3 to 2x10...
Directory of Open Access Journals (Sweden)
Grabe Hans
2010-06-01
Full Text Available Abstract Background Obsessive-compulsive disorder (OCD is a clinically and etiologically heterogeneous syndrome. The high frequency of obsessive-compulsive symptoms reported in subjects with the 22q11.2 deletion syndrome (DiGeorge/velocardiofacial syndrome or Prader-Willi syndrome (15q11-13 deletion of the paternally derived chromosome, suggests that gene dosage effects in these chromosomal regions could increase risk for OCD. Therefore, the aim of this study was to search for microrearrangements in these two regions in OCD patients. Methods We screened the 15q11-13 and 22q11.2 chromosomal regions for genomic imbalances in 236 patients with OCD using multiplex ligation-dependent probe amplification (MLPA. Results No deletions or duplications involving 15q11-13 or 22q11.2 were identified in our patients. Conclusions Our results suggest that deletions/duplications of chromosomes 15q11-13 and 22q11.2 are rare in OCD. Despite the negative findings in these two regions, the search for copy number variants in OCD using genome-wide array-based methods is a highly promising approach to identify genes of etiologic importance in the development of OCD.
The dimensional structure of psychopathology in 22q11.2 Deletion Syndrome.
Niarchou, Maria; Moore, Tyler M; Tang, Sunny X; Calkins, Monica E; McDonald-McGuinn, Donna M; Zackai, Elaine H; Emanuel, Beverly S; Gur, Ruben C; Gur, Raquel E
2017-09-01
22q11.2 Deletion Syndrome (22q11.2DS) is one of the strongest known genetic risk factors for developing schizophrenia. Individuals with 22q11.2DS have high rates of neurodevelopmental disorders in childhood, while in adulthood ∼25% develop schizophrenia. Similar to the general population, high rates of comorbidity are common in 22q11.2DS. Employing a dimensional approach where psychopathology is examined at the symptom-level as complementary to diagnostic categories in a population at such high genetic risk for schizophrenia can help gain a better understanding of how psychopathology is structured as well as its genetic underpinnings. This is the first study to examine the dimensional structure of a wide spectrum of psychopathology in the context of a homogeneous genetic etiology like 22q11.2DS. We evaluated 331 individuals with 22q11.2DS, mean age (SD) = 16.9(8.7); 51% males, who underwent prospective comprehensive phenotyping. We sought to replicate previous findings by examining a bi-factor model that derives a general factor of psychopathology in addition to more specific dimensions of psychopathology (i.e., internalizing, externalizing and thought disorder). Psychopathology in 22q11.2DS was divided into one 'general psychopathology' factor and four specific dimensions (i.e., 'anxiety', 'mood', 'ADHD' and 'psychosis'). The 'psychosis' symptoms loaded strongly on the 'general psychopathology' factor. The similarity of the symptom structure of psychopathology between 22q11.2DS and community and clinical populations without the deletion indicate that 22q11.2DS can provide a model to explore alternative approaches to our current nosology. Our findings add to a growing literature indicating the need to reorganize current diagnostic classification systems. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Amarela Varela Huerta
Full Text Available Resumen Este texto aborda un ejemplo concreto de organización de migrantes, el Movimiento Migrante Mesoamericano, que trabaja por los derechos de los migrantes en tránsito por México, de forma coordinada con organizaciones y familiares de migrantes víctimas de desaparición en su tránsito hacia Estados Unidos. Este estudio de caso es un ejemplo de luchas migrantes en contextos de tránsito, tipo específico de movimiento social que ha sido poco abordado en la literatura que piensa la acción colectiva de los migrantes. En el trabajo se analizan los actores, las prácticas, las alianzas y el contexto al que se enfrentan los activistas del movimiento en cuestión.
Comparing Diagnostic Outcomes of Autism Spectrum Disorder Using DSM-IV-TR and DSM-5 Criteria.
Harstad, Elizabeth B; Fogler, Jason; Sideridis, Georgios; Weas, Sarah; Mauras, Carrie; Barbaresi, William J
2015-05-01
Controversy exists regarding the DSM-5 criteria for ASD. This study tested the psychometric properties of the DSM-5 model and determined how well it performed across different gender, IQ, and DSM-IV-TR sub-type, using clinically collected data on 227 subjects (median age = 3.95 years, majority had IQ > 70). DSM-5 was psychometrically superior to the DSM-IV-TR model (Comparative Fit Index of 0.970 vs 0.879, respectively). Measurement invariance revealed good model fit across gender and IQ. Younger children tended to meet fewer diagnostic criteria. Those with autistic disorder were more likely to meet social communication and repetitive behaviors criteria (p < .001) than those with PDD-NOS. DSM-5 is a robust model but will identify a different, albeit overlapping population of individuals compared to DSM-IV-TR.
Schmidt Reaction of E-3-Benzylidenechromanones and E-3-Benzylidenethiochromanones
Directory of Open Access Journals (Sweden)
Tapas K. Mandal
2013-01-01
Full Text Available On treatment with NaN3/c. H2SO4-HOAc or NaN3/TFA, E-3-benzylidenechromanones are mostly converted to E-β-aminobenzylidenechromanones while E-3-benzylidenethiochromanones are converted to 3-benzoylthiochromones. A structurally new type of product has been isolated for the reaction of E-3-benzylidene-4′-methoxychromanone with NaN3/TFA. Mechanistic paths have been suggested for formation of the products.
Nested Inversion Polymorphisms Predispose Chromosome 22q11.2 to Meiotic Rearrangements.
Demaerel, Wolfram; Hestand, Matthew S; Vergaelen, Elfi; Swillen, Ann; López-Sánchez, Marcos; Pérez-Jurado, Luis A; McDonald-McGinn, Donna M; Zackai, Elaine; Emanuel, Beverly S; Morrow, Bernice E; Breckpot, Jeroen; Devriendt, Koenraad; Vermeesch, Joris R
2017-10-05
Inversion polymorphisms between low-copy repeats (LCRs) might predispose chromosomes to meiotic non-allelic homologous recombination (NAHR) events and thus lead to genomic disorders. However, for the 22q11.2 deletion syndrome (22q11.2DS), the most common genomic disorder, no such inversions have been uncovered as of yet. Using fiber-FISH, we demonstrate that parents transmitting the de novo 3 Mb LCR22A-D 22q11.2 deletion, the reciprocal duplication, and the smaller 1.5 Mb LCR22A-B 22q11.2 deletion carry inversions of LCR22B-D or LCR22C-D. Hence, the inversions predispose chromosome 22q11.2 to meiotic rearrangements and increase the individual risk for transmitting rearrangements. Interestingly, the inversions are nested or flanking rather than coinciding with the deletion or duplication sizes. This finding raises the possibility that inversions are a prerequisite not only for 22q11.2 rearrangements but also for all NAHR-mediated genomic disorders. Copyright © 2017. Published by Elsevier Inc.
Insights into the evolution of sialic acid catabolism among bacteria
Directory of Open Access Journals (Sweden)
Almagro-Moreno Salvador
2009-05-01
Full Text Available Abstract Background Sialic acids comprise a family of nine-carbon amino sugars that are prevalent in mucus rich environments. Sialic acids from the human host are used by a number of pathogens as an energy source. Here we explore the evolution of the genes involved in the catabolism of sialic acid. Results The cluster of genes encoding the enzymes N-acetylneuraminate lyase (NanA, epimerase (NanE, and kinase (NanK, necessary for the catabolism of sialic acid (the Nan cluster, are confined 46 bacterial species, 42 of which colonize mammals, 33 as pathogens and 9 as gut commensals. We found a putative sialic acid transporter associated with the Nan cluster in most species. We reconstructed the phylogenetic history of the NanA, NanE, and NanK proteins from the 46 species and compared them to the species tree based on 16S rRNA. Within the NanA phylogeny, Gram-negative and Gram-positive bacteria do not form distinct clades. NanA from Yersinia and Vibrio species was most closely related to the NanA clade from eukaryotes. To examine this further, we reconstructed the phylogeny of all NanA homologues in the databases. In this analysis of 83 NanA sequences, Bacteroidetes, a human commensal group formed a distinct clade with Verrucomicrobia, and branched with the Eukaryotes and the Yersinia/Vibrio clades. We speculate that pathogens such as V. cholerae may have acquired NanA from a commensal aiding their colonization of the human gut. Both the NanE and NanK phylogenies more closely represented the species tree but numerous incidences of incongruence are noted. We confirmed the predicted function of the sialic acid catabolism cluster in members the major intestinal pathogens Salmonella enterica, Vibrio cholerae, V. vulnificus, Yersinia enterocolitica and Y. pestis. Conclusion The Nan cluster among bacteria is confined to human pathogens and commensals conferring them the ability to utilize a ubiquitous carbon source in mucus rich surfaces of the human body
Zhang, H.-P.; Craddock, W.H.; Lease, R.O.; Wang, W.-T.; Yuan, D.-Y.; Zhang, P.-Z.; Molnar, P.; Zheng, D.-W.; Zheng, W.-J.
2012-01-01
Magnetostratigraphy of sedimentary rock deposited in the Chaka basin (north-eastern Tibetan Plateau) indicates a late Miocene onset of basin formation and subsequent development of the adjacent Qinghai Nan Shan. Sedimentation in the basin initiated at ~11Ma. In the lower part of the basin fill, a coarsening-upward sequence starting at ~9Ma, as well as rapid sedimentation rates, and northward paleocurrents, are consistent with continued growth of the Ela Shan to the south. In the upper section, several lines of evidence suggest that thrust faulting and topographic development of the Qinghai Nan Shan began at ~6.1Ma. Paleocurrent indicators, preserved in the basin in the proximal footwall of the Qinghai Nan Shan, show a change from northward to southward flow between 6.5 and 3.8Ma. At the same location, sediment derived from the Qinghai Nan Shan appears at 6.1Ma. Finally, the initiation of progressively shallowing dips observed in deformed basin strata and a change to pebbly, fluvial deposits at 6.1Ma provide a minimum age for the onset of slip on the thrust fault that dips north-east beneath the Qinghai Nan Shan. We interpret a decrease in sediment accumulation rates since ~6Ma to indicate a reduction in Chaka basin accommodation space due to active faulting and folding along the Qinghai Nan Shan and incorporation of the basin into the wedge-top depozone. Declination anomalies indicate the beginning of counter-clockwise rotation since 6.1Ma, which we associate with local deformation, not regional block rotation. The emergence of the Qinghai Nan Shan near the end of the Miocene Epoch partitioned the once contiguous Chaka-Gonghe and Qinghai basin complex. In a regional framework, our study adds to a growing body of evidence that points to widespread initiation and/or reactivation of fault networks during the late Miocene across the north-eastern Tibetan Plateau. ?? 2011 The Authors. Basin Research ?? 2011 Blackwell Publishing Ltd, European Association of Geoscientists
Akram, Muhammad; Waratchareeyakul, Watcharee; Haupenthal, Joerg; Hartmann, Rolf W.; Schuster, Daniela
2017-12-01
Cortisol synthase (CYP11B1) is the main enzyme for the endogenous synthesis of cortisol and its inhibition is a potential way for the treatment of diseases associated with increased cortisol levels, such as Cushing’s syndrome, metabolic diseases, and delayed wound healing. Aldosterone synthase (CYP11B2) is the key enzyme for aldosterone biosynthesis and its inhibition is a promising approach for the treatment of congestive heart failure, cardiac fibrosis, and certain forms of hypertension. Both CYP11B1 and CYP11B2 are structurally very similar and expressed in the adrenal cortex. To facilitate the identification of novel inhibitors of these enzymes, ligand-based pharmacophore models of CYP11B1 and CYP11B2 inhibition were developed. A virtual screening of the SPECS database was performed with our pharmacophore queries. Biological evaluation of the selected hits lead to the discovery of three potent novel inhibitors of both CYP11B1 and CYP11B2 in the submicromolar range (compounds 8-10), one selective CYP11B1 inhibitor (Compound 11, IC50 = 2.5 µM), and one selective CYP11B2 inhibitor (compound 12, IC50 = 1.1 µM), respectively. The overall success rate of this prospective virtual screening experiment is 20.8% indicating good predictive power of the pharmacophore models.
TR{alpha}- and TSH-mRNA levels after temporal exposition with methimazole in zebrafish, Danio rerio
Energy Technology Data Exchange (ETDEWEB)
Schulz, A.E.I.; Stocker, A.; Hollosi, L.; Schramm, K.W. [Inst. of Ecological Chemistry, GSF - National Research Center for Environment and Health (Germany)
2004-09-15
The group of dioxin and dioxin-like substances are highly persistent in the environment. There are evidences from present investigations that a variety of substances are capable of disrupting the endocrine system in the aquatic environment. These substances are called endocrine disruptors. Dioxin and related compounds can act as endocrine disruptors. Aquatic animals like amphibian and fish are especially affected of the impact of these compounds. Investigations concerned so far in particular the domain of reproduction biology and the thyroid axis especially. Recent investigations showed that the TR{alpha}-mRNA level change after a short temporal expression with T3, methimazole and amiodarone. The objective of the project is to identify effects of thyroid endocrine disruptors on the regulation of gene expression of the thyroid receptors TR{alpha}a, TR{beta} and thyroid stimulating hormone TSH and associated effects on other system. In preliminary studies the effects of the drug methimazole as model substance on gene expression of TR{alpha} and TSH were investigated. Methimazole is an inhibitor of the thyroid peroxidase so that the formation of thyroid hormones is disrupted.
Mariyam Mendonça, Vanda; Raffaelli, David; Boyle, Peter; Emes, Chas
2007-01-01
Se estudió el ecosistema de la laguna Culbin Sands, NE Escocia, durante un periodo de tres años (1994-1996) con objeto de identificar los principales acoplamientos tróficos desde invertebrados bentónicos a depredadores epibentónicos, y para evaluar el impacto de los peces que pasan el invierno sobre las comunidades de sus presas. Cada 2-4 semanas, la fauna móvil se muestreó para estudiar su dieta. Las principales interacciones tróficas identificadas, entre invertebrados bentóncos y depredador...
Tráfico de drogas: uma opção entre escolhas escassas
Faria, Ana Amélia Cypreste; Barros, Vanessa de Andrade
2011-01-01
Este trabalho procura compreender os aspectos psicossociais que permeiam a adesão de pessoas ao tráfico de drogas em seu contexto histórico e econômico-social, por meio de pesquisa realizada no ambiente carcerário, onde foram recolhidas histórias de vida de pessoas envolvidas com o tráfico. Em um ambiente socioeconômico caracterizado pela precarização das relações de trabalho, pelo desemprego e pelo apelo consumista afinados com as premissas econômicas neoliberais tem-se uma situação de exclu...
Mapping 22q11.2 Gene Dosage Effects on Brain Morphometry.
Lin, Amy; Ching, Christopher R K; Vajdi, Ariana; Sun, Daqiang; Jonas, Rachel K; Jalbrzikowski, Maria; Kushan-Wells, Leila; Pacheco Hansen, Laura; Krikorian, Emma; Gutman, Boris; Dokoru, Deepika; Helleman, Gerhard; Thompson, Paul M; Bearden, Carrie E
2017-06-28
Reciprocal chromosomal rearrangements at the 22q11.2 locus are associated with elevated risk of neurodevelopmental disorders. The 22q11.2 deletion confers the highest known genetic risk for schizophrenia, but a duplication in the same region is strongly associated with autism and is less common in schizophrenia cases than in the general population. Here we conducted the first study of 22q11.2 gene dosage effects on brain structure in a sample of 143 human subjects: 66 with 22q11.2 deletions (22q-del; 32 males), 21 with 22q11.2 duplications (22q-dup; 14 males), and 56 age- and sex-matched controls (31 males). 22q11.2 gene dosage varied positively with intracranial volume, gray and white matter volume, and cortical surface area (deletion control > duplication). Widespread differences were observed for cortical surface area with more localized effects on cortical thickness. These diametric patterns extended into subcortical regions: 22q-dup carriers had a significantly larger right hippocampus, on average, but lower right caudate and corpus callosum volume, relative to 22q-del carriers. Novel subcortical shape analysis revealed greater radial distance (thickness) of the right amygdala and left thalamus, and localized increases and decreases in subregions of the caudate, putamen, and hippocampus in 22q-dup relative to 22q-del carriers. This study provides the first evidence that 22q11.2 is a genomic region associated with gene-dose-dependent brain phenotypes. Pervasive effects on cortical surface area imply that this copy number variant affects brain structure early in the course of development. SIGNIFICANCE STATEMENT Probing naturally occurring reciprocal copy number variation in the genome may help us understand mechanisms underlying deviations from typical brain and cognitive development. The 22q11.2 genomic region is particularly susceptible to chromosomal rearrangements and contains many genes crucial for neuronal development and migration. Not surprisingly
[22q11.2DS Syndrome as a Genetic Subtype of Schizophrenia].
Huertas-Rodríguez, Cindy Katherin; Payán-Gómez, César; Forero-Castro, Ruth Maribel
2015-01-01
The 22q11.2 deletion syndrome (22q11.2DS) is associated with the microdeletion of this chromosomal region, and represents the second most common genetic syndrome after Down's syndrome. In patients with schizophrenia, 22q11.2DS has a prevalence of 2%, and in selected groups can be increased to between 32-53%. To describe the generalities of 22q11.2DS syndrome as a genetic subtype of schizophrenia, its clinical characteristics, molecular genetic aspects, and frequency in different populations. A review was performed from 1967 to 2013 in scientific databases, compiling articles about 22q11.2DS syndrome and its association with schizophrenia. The 22q11.2 DS syndrome has a variable phenotype associated with other genetic syndromes, birth defects in many tissues and organs, and a high rate of psychiatric disorders, particularly schizophrenia. Likewise, it has been identified in clinical populations with schizophrenia selected by the presence of common syndromic characteristics. FISH, qPCR and MLPA techniques, and recently, aCGH and NGS technologies, are being used to diagnose this microdeletion. It is important in clinical practice to remember that people suffering the 22q11.2DS have a high genetic risk for developing schizophrenia, and it is considered that the simultaneous presence of this disease and 22q11.2DS represents a genetic subtype of schizophrenia. There are clear phenotypic criteria, molecular and cytogenetic methods to diagnose this group of patients, and to optimize a multidisciplinary approach in their monitoring. Copyright © 2014 Asociación Colombiana de Psiquiatría. Publicado por Elsevier España. All rights reserved.
Orphan nuclear receptor TR3 acts in autophagic cell death via mitochondrial signaling pathway.
Wang, Wei-jia; Wang, Yuan; Chen, Hang-zi; Xing, Yong-zhen; Li, Feng-wei; Zhang, Qian; Zhou, Bo; Zhang, Hong-kui; Zhang, Jie; Bian, Xue-li; Li, Li; Liu, Yuan; Zhao, Bi-xing; Chen, Yan; Wu, Rong; Li, An-zhong; Yao, Lu-ming; Chen, Ping; Zhang, Yi; Tian, Xu-yang; Beermann, Friedrich; Wu, Mian; Han, Jiahuai; Huang, Pei-qiang; Lin, Tianwei; Wu, Qiao
2014-02-01
Autophagy is linked to cell death, yet the associated mechanisms are largely undercharacterized. We discovered that melanoma, which is generally resistant to drug-induced apoptosis, can undergo autophagic cell death with the participation of orphan nuclear receptor TR3. A sequence of molecular events leading to cellular demise is launched by a specific chemical compound, 1-(3,4,5-trihydroxyphenyl)nonan-1-one, newly acquired from screening a library of TR3-targeting compounds. The autophagic cascade comprises TR3 translocation to mitochondria through interaction with the mitochondrial outer membrane protein Nix, crossing into the mitochondrial inner membrane through Tom40 and Tom70 channel proteins, dissipation of mitochondrial membrane potential by the permeability transition pore complex ANT1-VDAC1 and induction of autophagy. This process leads to excessive mitochondria clearance and irreversible cell death. It implicates a new approach to melanoma therapy through activation of a mitochondrial signaling pathway that integrates a nuclear receptor with autophagy for cell death.
Directory of Open Access Journals (Sweden)
Cheng Hu
2009-10-01
Full Text Available Recent advance in genetic studies added the confirmed susceptible loci for type 2 diabetes to eighteen. In this study, we attempt to analyze the independent and joint effect of variants from these loci on type 2 diabetes and clinical phenotypes related to glucose metabolism.Twenty-one single nucleotide polymorphisms (SNPs from fourteen loci were successfully genotyped in 1,849 subjects with type 2 diabetes and 1,785 subjects with normal glucose regulation. We analyzed the allele and genotype distribution between the cases and controls of these SNPs as well as the joint effects of the susceptible loci on type 2 diabetes risk. The associations between SNPs and type 2 diabetes were examined by logistic regression. The associations between SNPs and quantitative traits were examined by linear regression. The discriminative accuracy of the prediction models was assessed by area under the receiver operating characteristic curves. We confirmed the effects of SNPs from PPARG, KCNJ11, CDKAL1, CDKN2A-CDKN2B, IDE-KIF11-HHEX, IGF2BP2 and SLC30A8 on risk for type 2 diabetes, with odds ratios ranging from 1.114 to 1.406 (P value range from 0.0335 to 1.37E-12. But no significant association was detected between SNPs from WFS1, FTO, JAZF1, TSPAN8-LGR5, THADA, ADAMTS9, NOTCH2-ADAM30 and type 2 diabetes. Analyses on the quantitative traits in the control subjects showed that THADA SNP rs7578597 was association with 2-h insulin during oral glucose tolerance tests (P = 0.0005, empirical P = 0.0090. The joint effect analysis of SNPs from eleven loci showed the individual carrying more risk alleles had a significantly higher risk for type 2 diabetes. And the type 2 diabetes patients with more risk allele tended to have earlier diagnostic ages (P = 0.0006.The current study confirmed the association between PPARG, KCNJ11, CDKAL1, CDKN2A-CDKN2B, IDE-KIF11-HHEX, IGF2BP2 and SLC30A8 and type 2 diabetes. These type 2 diabetes risk loci contributed to the disease additively.
A atualidade dos acidentes de trânsito na era da velocidade: uma visão geral
Directory of Open Access Journals (Sweden)
Marín Letícia
2000-01-01
Full Text Available Este artigo focaliza, numa perspectiva interdisciplinar, os estudos sobre acidentes de trânsito em escala nacional e internacional. Ele começa analisando o aumento da produção e consumo de veículos motorizados em todo o mundo e as transformações sociais que esse fato acarretou. Atenção especial é dada à degradação do meio ambiente urbano e ao enorme custo social representado pelos acidentes de trânsito. Em seguida, é apresentado um panorama epidemiológico sobre as vítimas do trânsito. A relação entre personalidade e acidente de trânsito mereceu atenção especial, principalmente no que se refere ao comportamento infrator e ao consumo de bebidas alcoólicas e de outras drogas. O artigo conclui enfatizando a necessidade de o Estado implementar políticas públicas específicas consistentes, a fim de se poder controlar o problema.
Dilute 2α+t cluster structure in 11B
International Nuclear Information System (INIS)
Kawabata, T.; Akimune, H.; Fujita, H.; Fujita, Y.; Fujiwara, M.; Hara, K.; Hatanaka, K.; Itoh, M.; Kanada-En'yo, Y.; Kishi, S.; Nakanishi, K.; Sakaguchi, H.; Shimbara, Y.; Tamii, A.; Terashima, S.; Uchida, M.; Wakasa, T.; Yasuda, Y.; Yoshida, H.P.; Yosoi, M.
2007-01-01
The cluster structures of the excited states in 11 B are studied by analyzing the isoscalar monopole and quadrupole strengths in the 11 B(d,d') reaction at E d =200 MeV. The excitation strengths are compared with the predictions by the shell-model and antisymmetrized molecular-dynamics (AMD) calculations. It is found that the large monopole strength for the 3/2 3 - state at E x =8.56 MeV is well described by the AMD calculation and is an evidence for a developed 2α+t cluster structure
Directory of Open Access Journals (Sweden)
Sintia Iole Nogueira Belangero
2009-04-01
Full Text Available FUNDAMENTO: A síndrome da deleção 22q11.2 é a mais freqüente síndrome de microdeleção humana. O fenótipo é altamente variável e caracterizado por defeito cardíaco conotruncal, dismorfias faciais, insuficiência velofaríngea, dificuldade de aprendizagem e retardo mental. OBJETIVO: O objetivo deste trabalho foi investigar a freqüência da deleção 22q11.2 em uma amostra brasileira de indivíduos portadores de cardiopatia conontrucal isolada e do fenótipo da síndrome da deleção 22q11.2. MÉTODOS: Vinte e nove pacientes foram estudados por meio de citogenética clássica, por hibridação in situ fluorescente (FISH e por técnicas moleculares. RESULTADOS: A análise citogenética por meio de bandamento G revelou cariótipo normal em todos os pacientes, com exceção de um que apresentou cariótipo 47,XX,+idic(22(q11.2. Com o uso de técnicas moleculares, a deleção foi observada em 25% dos pacientes, todos portadores do fenótipo da síndrome da deleção 22q11.2. Em nenhum dos casos, a deleção foi herdada dos pais. A freqüência da deleção 22q11.2 foi maior no grupo de pacientes portadores do espectro clínico da síndrome da deleção 22q11.2 do que no grupo de pacientes com cardiopatia conotruncal isolada. CONCLUSÃO: A investigação da presença da deleção e sua correlação com os dados clínicos dos pacientes podem auxiliar os pacientes e suas famílias a terem um melhor aconselhamento genético e um seguimento clínico mais adequado.FUNDAMENTO: El síndrome de la deleción 22q11.2 es el más frecuente síndrome de microdeleción humana. El fenotipo, altamente variable, se caracteriza por defecto cardiaco conotruncal, dismorfias faciales, insuficiencia velofaríngea, dificultad de aprendizaje y retardo mental. OBJETIVO: El objetivo de este trabajo fue investigar la frecuencia tanto de la deleción 22q11.2 en una muestra brasileña de individuos portadores de cardiopatía conotrucal aislada, como del fenotipo del s
La metafilosofía de Eugenio Trías
Directory of Open Access Journals (Sweden)
Jonatan Caro Rey
2016-01-01
Full Text Available El artículo propone interpretar la metafilosofía de Eugenio Trías como un proyecto de liberación de la identidad (frente al subjetivismo paralelo a la liberación del discurso metafísico (frente a las actitudes antimetafísicas de la Teoría marxista —ortodoxa— de las ideologías y del positivismo lógico. En este intento mostraremos la íntima relación que con esta temática guardarían dos obras que no suelen asociarse al programa metafilosófico triasiano como son Filosofía y Carnaval (1970 (con su propuesta de la concepción de la identidad como profusión de máscaras y de la sociabilidad como Carnaval y La dispersión (1971 (desde su pensamiento fragmentario, aforístico. Ambas obras responderían a una misma estrategia caracterizada por el propio Trías de «mágica» y por nosotros (en un sentido que aclaramos al final del artículo de «cínica».
Leser-Trélat sign presenting in a patient with ovarian cancer: a case report
Directory of Open Access Journals (Sweden)
Bölke Edwin
2009-07-01
Full Text Available Abstract Introduction Seborrheic keratoses are very common findings in elderly patients. However, a sudden onset and dramatic increase in the number and size of these benign lesions deserves special attention, since this may represent the Leser Trélat sign, a rare paraneoplastic cutaneous syndrome. Case presentation A 92-year-old female presented to our clinic with multiple eruptive seborrheic keratoses, which had dramatically increased in size and number over the past two years. A diagnostic work-up revealed an ovarian carcinoma. Hence, cutaneous findings in our patient were consistent with the diagnosis of the Leser-Trélat sign. Conclusion The Leser-Trélat sign may coincide with the diagnosis of occult cancer or follow or precede it by months or years. Practitioners should take cases of eruptive seborrheic keratoses seriously and perform thorough patient examinations.
Lifescience Database Archive (English)
Full Text Available ides f... 35 0.20 sp|Q9NRI5|DISC1_HUMAN Disrupted in schizophrenia 1 protein OS=Ho... 34 0.34 sp|O94386|YGS9...EL----QAHADEVEELRRKMAQ-KISEYEEQLEALLNKCSSLEKQKSR 258 Query: 145 L 143 L Sbjct: 259 L 259 >sp|Q9NRI5|DISC1_HUMAN Disrupted in schizoph...renia 1 protein OS=Homo sapiens GN=DISC1 PE=1 SV=3 Length = 854 Score = 34.3 bits (
Niu, Gengming; Ye, Taiyang; Qin, Liuliang; Bourbon, Pierre M; Chang, Cheng; Zhao, Shengqiang; Li, Yan; Zhou, Lei; Cui, Pengfei; Rabinovitz, Issac; Mercurio, Arthur M; Zhao, Dezheng; Zeng, Huiyan
2015-01-01
Tissue repair/wound healing, in which angiogenesis plays an important role, is a critical step in many diseases including chronic wound, myocardial infarction, stroke, cancer, and inflammation. Recently, we were the first to report that orphan nuclear receptor TR3/Nur77 is a critical mediator of angiogenesis and its associated microvessel permeability. Tumor growth and angiogenesis induced by VEGF-A, histamine, and serotonin are almost completely inhibited in Nur77 knockout mice. However, it is not known whether TR3/Nur77 plays any roles in wound healing. In these studies, skin wound-healing assay was performed in 3 types of genetically modified mice having various Nur77 activities. We found that ectopic induction of Nur77 in endothelial cells of mice is sufficient to improve skin wound healing. Although skin wound healing in Nur77 knockout mice is comparable to the wild-type control mice, the process is significantly delayed in the EC-Nur77-DN mice, in which a dominant negative Nur77 mutant is inducibly and specifically expressed in mouse endothelial cells. By a loss-of-function assay, we elucidate a novel feed-forward signaling pathway, integrin β4 → PI3K → Akt → FAK, by which TR3 mediates HUVEC migration. Furthermore, TR3/Nur77 regulates the expression of integrin β4 by targeting its promoter activity. In conclusion, expression of TR3/Nur77 improves wound healing by targeting integrin β4. TR3/Nur77 is a potential candidate for proangiogenic therapy. The results further suggest that TR3/Nur77 is required for pathologic angiogenesis but not for developmental/physiologic angiogenesis and that Nur77 and its family members play a redundant role in normal skin wound healing. © FASEB.
International Nuclear Information System (INIS)
Tang Shuo; Li Jingfeng; Teng Yu; Guo Xiaodong; Zhao Jingjing; Xu Shuyun; Quan Daping
2012-01-01
Bone morphogenetic protein 2 (BMP-2) is the most powerful osteogenic factor; its effectiveness in enhancing osteoblastic activation has been confirmed both in vitro and in vivo. We developed a novel peptide (designated P24) derived from the ‘knuckle’ epitope of BMP-2 and found it also had osteogenic bioactivity to some extent. The main objective of this study was to develop a controlled release system based on poly(trimethylene carbonate)–F127–poly(trimethylene carbonate) (PTMC 11 -F127-PTMC 11 ) hydrogels for the P24 peptide, to promote bone formation. By varying the copolymer concentrations, we demonstrated that P24/PTMC 11 -F127-PTMC 11 hydrogels were an efficient system for the sustained release of P24 over 21–35 days. The P24-loaded hydrogels elevated alkaline phosphatase activity and promoted the expression of osteocalcin mRNA in bone marrow stromal cells (BMSCs) in vitro. Radiographic and histological examination showed that P24-loaded hydrogels could induce more effective ectopic bone formation in vivo than P24-free hydrogels. These results indicate that the PTMC 11 -F127-PTMC 11 hydrogel is a suitable carrier for the controlled release of P24, and is a promising injectable biomaterial for the induction of bone regeneration. (paper)
Yaylaci, Ferhat; Miral, Suha
2017-01-01
Aim of this study was to compare children diagnosed with Pervasive Developmental Disorder (PDD) according to DSM-IV-TR and DSM-5 diagnostic systems. One hundred fifty children aged between 3 and 15 years diagnosed with PDD by DSM-IV-TR were included. PDD symptoms were reviewed through psychiatric assessment based on DSM-IV-TR and DSM-5 criteria.…
International Nuclear Information System (INIS)
Zador, E.; Jones, D.
1986-01-01
A new tobacco alkaloid from section Repandae is highly toxic to an insect (Manduca sexta) unsusceptible to previously described nicotine alkaloids (1). They have localized the alkaloid, HO-N-acylnornicotine (HO-NAN) nearly entirely to the exudate secreted by the epidermal trichomes of N. stocktonii. Only the nicotine and nornicotine were found in abundance inside the trichomes, while primarily nicotine was present inside the aerial vegetative parts and root. These results suggest that the HO-NAN is synthesized by the trichomes. When unlabelled nicotine was fed to isolated leaves there was an increase in internal nicotine, nornicotine and secretion of HO-NAN. Feeding leaves with 2'-C 14 nicotine resulted in labelling of both nornicotine and HO-NAN. These data strongly suggest synthesis of HO-NAN from nicotine via nornicotine in the trichomes, followed by rapid secretion. The possible evolutionary significance of this pathway of synthesis and secretion is discussed
Vanamölder, Kaarel, 1981-
2011-01-01
Trükkal Christoph Brendekenist. Trükkali sissetulekutest ja töö est küsitavast tasust. Plakatite tiraažist. Kindralkuberneri kantselei publitseerimisrutiinist ning korralduste edastamise kiirusest
Magnetic resonance imaging of the pulleys of the flexor tendons of the toes at 11.7 T
Energy Technology Data Exchange (ETDEWEB)
Tafur, Monica; Iwasaki, Kenyu; Statum, Sheronda; Szeverenyi, Nikolaus M.; Bydder, Graeme M. [University of California, San Diego, School of Medicine, Department of Radiology, San Diego, CA (United States); Chung, Christine B. [Department of Radiology, Veterans Administration San Diego Healthcare System, San Diego, CA (United States); University of California, San Diego, School of Medicine, Department of Radiology, San Diego, CA (United States)
2015-01-15
We obtained high-resolution 11.7-T MR images of the pulleys of the flexor tendons in cadaveric toe specimens. A detailed understanding of toe pulley anatomy as seen with MR is likely to be of benefit in recognizing disease and the effects of trauma. Six cadaveric toes were imaged with an 11.7-T small-bore MR imaging system using optimized coils. Two-dimensional dual-echo SE scans were obtained in three planes (40 x 40 x 400-μm{sup 3} voxel size, TE = 7/14 ms, TR = 3,500 ms, fat saturation). Three-dimensional spoiled gradient echo scans were obtained (90-150 μm{sup 3} isotropic voxel size, TE = 6 ms, TR = 25 ms, with and without fat saturation). Specimen orientation was with the long axis of the toe either parallel or perpendicular to B{sub 0}. All the annular (A) pulleys were demonstrated in the great and lesser toes. The A2 pulley in the great and lesser toes and the A4 pulley in the lesser toes were the most substantial pulleys. The A5 pulley, which has not previously been described in the toes, was demonstrated. The cruciform pulleys were also seen and were smaller and thinner. Three tissue layers were seen, and there was evidence of different fiber directions in annular pulleys producing different magic angle effects. Detailed anatomy of the pulley system of the flexor tendons was seen on the 11.7-T MR images showing new features and providing a basis for image interpretation. Similarities and differences between the pulley systems in the toes and the fingers were identified. (orig.)
Evolução dos acidentes de trânsito em um grande centro urbano, 1991-2000
Oliveira, Zenaide Calazans de; Mota, Eduardo Luiz Andrade; Costa, Maria da Conceição Nascimento
2008-01-01
p. 364-372, fev, 2008 Este estudo descreve a evolução dos acidentes de trânsito Salvador, Bahia, Brasil, entre 1991 e 2000, utilizando- se dados do Departamento Estadual de Trânsito do Estado da Bahia. Calculou-se taxas globais dos acidentes de trânsito, vítimas e taxas padronizadas de mortalidade por habitante e por veículos, e comparou-se médias destes indicadores para antes (1991 a 1994) e após (1995 a 2000) a adoção de medidas de intervenção como o uso do cinto de segurança e o Código ...
A violência no trânsito : um estudo de cado do PVT - Recife/PE 2000-2004
de Sá Gondim, Getúlio
2004-01-01
A violência no trânsito tem se constituído em uma séria problemática para todos, cuja solução deve ser tratada no âmbito das políticas públicas. Este Trabalho de Conclusão de Mestrado teve como objeto de análise a violência no trânsito na cidade do Recife, no período de 2000 a 2004. Definiu como objetivo analisar se o Projeto Vida no Trânsito contribuiu para reduzir os índices de acidentes, a multiinstitucionalidade e a ação educativa conscientizadora por meio dos arte-educadores. A metodolog...
Porto de Trás: etnicidade, turismo e patrimonialização
Directory of Open Access Journals (Sweden)
Patrícia de Araújo Brandão Couto
2011-05-01
Full Text Available The article describes the process by which cultural heritage of Porto de Trás, a neigborhood in Itacaré on the southern coast of Bahia, Brazil, has gained recognition. Porto de Trás is an ethnic community of African Brazilians with a tradition of artisanal fishing. Historically, its residents, organized in family groupings, have been segregated for their race and socioeconomic status.Even with the arrival of the tourist industry in the 1990s and concomitant urban developments, it maintained its traditional cultural practices, gaining recognition as an enclave of “authenticity” referred to local culture. Interactions between the different spheres of heritage operating in this space are discussed especially the construction of ethnicity by local residents.
Porto\tde Trás: etnicidade, turismo e patrimonialização
Directory of Open Access Journals (Sweden)
Patrícia de Araújo Brandão Couto
2011-01-01
Full Text Available The article describes the process by which cultural heritage of Porto de Trás, a neigborhood in Itacaré on the southern coast of Bahia, Brazil, has gained recognition. Porto de Trás is an ethnic community of African Brazilians with a tradition of artisanal fishing. Historically, its residents, organized in family groupings, have been segregated for their race and socioeconomic status. Even with the arrival of the tourist industry in the 1990s and concomitant urban developments, it maintained its traditional cultural practices, gaining recognition as an enclave of "authenticity" referred to local culture. Interactions between the different spheres of heritage operating in this space are discussed especially the construction of ethnicity by local residents
22q11.2 deletion carriers and schizophrenia-associated novel variants.
Balan, S; Iwayama, Y; Toyota, T; Toyoshima, M; Maekawa, M; Yoshikawa, T
2014-01-01
The penetrance of schizophrenia risk in carriers of the 22q11.2 deletion is high but incomplete, suggesting the possibility of additional genetic defects. We performed whole exome sequencing on two individuals with 22q11.2 deletion, one with schizophrenia and the other who was psychosis-free. The results revealed novel genetic variants related to neuronal function exclusively in the person with schizophrenia (frameshift: KAT8, APOH and SNX31; nonsense: EFCAB11 and CLVS2). This study paves the way towards a more complete understanding of variant dose and genetic architecture in schizophrenia.
Ideal shear strength and deformation behaviours of L10 TiAl from ...
Indian Academy of Sciences (India)
Guangxi Teachers Education University, Nanning 530023, China. MS received 18 October 2014; accepted 11 April 2016. Abstract. The stress–strain relationships for four different shear processes of L10 TiAl have been .... aThis work; bRef.
Mateus Habermann; Nelson Gouveia
2012-01-01
OBJETIVO: Analisar a associação entre indicadores de exposição à poluição por tráfego veicular e mortalidade por doenças do aparelho circulatório em homens adultos. MÉTODOS: Foram analisadas informações sobre vias e volume de tráfego no ano de 2007 fornecidas pela companhia de engenharia de tráfego local. Mortalidade por doenças do aparelho circulatório no ano de 2005 entre homens > 40 anos foram obtidas do registro de mortalidade do Programa de Aprimoramento de Informações de Mortalidade do ...
Congenital Arthrogryposis: An Extension of the 15q11.2 BP1-BP2 Microdeletion Syndrome?
Directory of Open Access Journals (Sweden)
K. M. Usrey
2014-01-01
Full Text Available The proximal 15q11–q13 region contains 5 breakpoints (BP1–BP5. The BP1-BP2 region spans approximately 500 kb and contains four evolutionarily conserved genes. The genes in this region are known to play a role in central nervous system development and/or function. Microdeletions within the 15q11.2 BP1-BP2 region have been reported in patients with neurological dysfunction, developmental delays, behavioral problems, and dysmorphic features. We report two unrelated subjects with the 15q11.2 BP1-BP2 microdeletion and presenting with congenital arthrogryposis, a feature which has not been previously reported as part of this newly recognized microdeletion syndrome. While arthrogryposis seen in these two subjects may be coincidental, we propose that congenital arthrogryposis may result from neurological dysfunction and involvement of the microdeletion of the 15q11.2 BP1-BP2 region, further expanding the phenotype of this microdeletion syndrome. We encourage others to report patients with this chromosome microdeletion and neurological findings to further characterize the clinical phenotype.
Directory of Open Access Journals (Sweden)
Paula Ximena Pavia
2007-02-01
Full Text Available Trypanosoma rangeli is non pathogenic for humans but of important medical and epidemiological interest because it shares vertebrate hosts, insect vectors, reservoirs and geographic areas with T. cruzi, the etiological agent of Chagas disease. Therefore, in this work, we set up two PCR reactions, TcH2AF/R and TrFR2, to distinguish T. cruzi from T. rangeli in mixed infections of vectors based on amplification of the histone H2A/SIRE and the small nucleolar RNA Cl1 genes, respectively. Both PCRs were able to appropriately detect all T. cruzi or T. rangeli experimentally infected-triatomines, as well as the S35/S36 PCR which amplifies the variable region of minicircle kDNA of T. cruzi. In mixed infections, whereas T. cruzi DNA was amplified in 100% of samples with TcH2AF/R and S35/S36 PCRs, T. rangeli was detected in 71% with TrF/R2 and in 6% with S35/S36. In a group of Rhodnius colombiensis collected from Coyaima (Colombia, T. cruzi was identified in 100% with both PCRs and T. rangeli in 14% with TrF/R2 and 10% with S35/S36 PCR. These results show that TcH2AF/R and TrF/R2 PCRs which are capable of recognizing all T. cruzi and T. rangeli strains and lineages could be useful for diagnosis as well as for epidemiological field studies of T. cruzi and T. rangeli vector infections.Embora o Trypanosoma rangeli não seja patogênico para o homem, sua importância médica e epidemiológica reside no fato de compartilhar vetores, reservatórios e áreas geográficas com o Trypanosoma cruzi, agente causal da Doença de Chagas. Neste estudo, para distinguir T. cruzi de T. rangeli em vetores com infecções mistas, se utilizaram duas amplificações de PCR; TcH2AF/R para o gen da histona H2A/SIRE e TrFR2, para um gen repetitivo de ARN nucleolar Cl1 (sno-RNA-Cl1. Assim como a PCR S35/S36, ambas as reações foram capazes de detectar corretamente a presença de T. cruzi ou T. rangeli em triatomíneos infectados experimentalmente. Nas infecções mistas, o ADN de
Taladay, K.; Boston, B.
2015-12-01
Natural gas hydrates (NGHs) are crystalline inclusion compounds that form within the pore spaces of marine sediments along continental margins worldwide. It has been proposed that these NGH deposits are the largest dynamic reservoir of organic carbon on this planet, yet global estimates for the amount of gas in place (GIP) range across several orders of magnitude. Thus there is a tremendous need for climate scientists and countries seeking energy security to better constrain the amount of GIP locked up in NGHs through the development of rigorous exploration strategies and standardized reservoir characterization methods. This research utilizes NanTroSEIZE drilling data from International Ocean Drilling Program (IODP) Sites C0002 and C0009 to constrain 3D seismic interpretations of the gas hydrate petroleum system in the Kumano Forearc Basin. We investigate the gas source, fluid migration mechanisms and pathways, and the 3D distribution of prospective HCZs. There is empirical and interpretive evidence that deeply sourced fluids charge concentrated NGH deposits just above the base of gas hydrate stability (BGHS) appearing in the seismic data as continuous bottoms simulating reflections (BSRs). These HCZs cover an area of 11 by 18 km, range in thickness between 10 - 80 m with an average thickness of 40 m, and are analogous to the confirmed HCZs at Daini Atsumi Knoll in the eastern Nankai Trough where the first offshore NGH production trial was conducted in 2013. For consistency, we calculated a volumetric GIP estimate using the same method employed by Japan Oil, Gas and Metals National Corporation (JOGMEC) to estimate GIP in the eastern Nankai Trough. Double BSRs are also common throughout the basin, and BGHS modeling along with drilling indicators for gas hydrates beneath the primary BSRs provides compelling evidence that the double BSRs reflect a BGHS for structure-II methane-ethane hydrates beneath a structure-I methane hydrate phase boundary. Additional drilling
Referential communication abilities in children with 22q11.2 deletion syndrome.
Van Den Heuvel, Ellen; ReuterskiöLd, Christina; Solot, Cynthia; Manders, Eric; Swillen, Ann; Zink, Inge
2017-10-01
This study describes the performance on a perspective- and role-taking task in 27 children, ages 6-13 years, with 22q11.2 deletion syndrome (22q11.2DS). A cross-cultural design comparing Dutch- and English-speaking children with 22q11.2DS explored the possibility of cultural differences. Chronologically age-matched and younger typically developing (TD) children matched for receptive vocabulary served as control groups to identify challenges in referential communication. The utterances of children with 22q11.2DS were characterised as short and simple in lexical and grammatical terms. However, from a language use perspective, their utterances were verbose, ambiguous and irrelevant given the pictured scenes. They tended to elaborate on visual details and conveyed off-topic, extraneous information when participating in a barrier-game procedure. Both types of aberrant utterances forced a listener to consistently infer the intended message. Moreover, children with 22q11.2DS demonstrated difficulty selecting correct speech acts in accordance with contextual cues during a role-taking task. Both English- and Dutch-speaking children with 22q11.2DS showed impoverished information transfer and an increased number of elaborations, suggesting a cross-cultural syndrome-specific feature.
Akram, Muhammad; Waratchareeyakul, Watcharee; Haupenthal, Joerg; Hartmann, Rolf W; Schuster, Daniela
2017-01-01
Cortisol synthase (CYP11B1) is the main enzyme for the endogenous synthesis of cortisol and its inhibition is a potential way for the treatment of diseases associated with increased cortisol levels, such as Cushing's syndrome, metabolic diseases, and delayed wound healing. Aldosterone synthase (CYP11B2) is the key enzyme for aldosterone biosynthesis and its inhibition is a promising approach for the treatment of congestive heart failure, cardiac fibrosis, and certain forms of hypertension. Both CYP11B1 and CYP11B2 are structurally very similar and expressed in the adrenal cortex. To facilitate the identification of novel inhibitors of these enzymes, ligand-based pharmacophore models of CYP11B1 and CYP11B2 inhibition were developed. A virtual screening of the SPECS database was performed with our pharmacophore queries. Biological evaluation of the selected hits lead to the discovery of three potent novel inhibitors of both CYP11B1 and CYP11B2 in the submicromolar range (compounds 8 - 10 ), one selective CYP11B1 inhibitor (Compound 11 , IC 50 = 2.5 μM), and one selective CYP11B2 inhibitor (compound 12 , IC 50 = 1.1 μM), respectively. The overall success rate of this prospective virtual screening experiment is 20.8% indicating good predictive power of the pharmacophore models.
Directory of Open Access Journals (Sweden)
Muhammad Akram
2017-12-01
Full Text Available Cortisol synthase (CYP11B1 is the main enzyme for the endogenous synthesis of cortisol and its inhibition is a potential way for the treatment of diseases associated with increased cortisol levels, such as Cushing's syndrome, metabolic diseases, and delayed wound healing. Aldosterone synthase (CYP11B2 is the key enzyme for aldosterone biosynthesis and its inhibition is a promising approach for the treatment of congestive heart failure, cardiac fibrosis, and certain forms of hypertension. Both CYP11B1 and CYP11B2 are structurally very similar and expressed in the adrenal cortex. To facilitate the identification of novel inhibitors of these enzymes, ligand-based pharmacophore models of CYP11B1 and CYP11B2 inhibition were developed. A virtual screening of the SPECS database was performed with our pharmacophore queries. Biological evaluation of the selected hits lead to the discovery of three potent novel inhibitors of both CYP11B1 and CYP11B2 in the submicromolar range (compounds 8–10, one selective CYP11B1 inhibitor (Compound 11, IC50 = 2.5 μM, and one selective CYP11B2 inhibitor (compound 12, IC50 = 1.1 μM, respectively. The overall success rate of this prospective virtual screening experiment is 20.8% indicating good predictive power of the pharmacophore models.
Hajiamini, Zahra; Mohamadi, Ashraf; Ebadi, Abbas; Fathi- Ashtiani, Ali; Tavousi, Mahmoud; Montazeri, Ali
2012-07-18
The School Anxiety Scale-Teacher Report (SAS-TR) was designed to assess anxiety in children at school. The SAS-TR is a proxy rated measure and could assess social anxiety, generalized anxiety and also gives a total anxiety score. This study aimed to translate and validate the SAS-TR in Iran. The translation and cultural adaptation of the original questionnaire were carried out in accordance with the published guidelines. A sample of students participated in the study. Reliability was estimated using internal consistency and test-retest analysis. Validity was assessed using content validity. The factor structure of the questionnaire was extracted by performing both exploratory and confirmatory factor analyses. In all 200 elementary students aged 6 to 10 years were studied. Considering the recommended cut-off values, overall the prevalence of high anxiety condition in elementary students was found to be 21 %. Cronbach's alpha coefficient for the Iranian SAS-TR was 0.92 and intraclass correlation coefficient (ICC) was found to be 0.81. The principal component analysis indicated a two-factor structure for the questionnaire (generalized and social anxiety) that jointly accounted for 55.3 % of variances observed. The confirmatory factory analysis also indicated a good fit to the data for the two-latent structure of the questionnaire. In general the findings suggest that the Iranian version of SAS-TR has satisfactory reliability, and validity for measuring anxiety in 6 to 10 years old children in Iran. It is simple and easy to use and now can be applied in future studies.
Leser–Trélat syndrome in malignant mesothelioma and pulmonary adenocarcinoma
DEFF Research Database (Denmark)
Jepsen, Rikke Karlin; Skov, Anne Guldhammer; Skov, Birgit Guldhammer
2014-01-01
The syndrome of Leser–Trélat (LT) is characterized by the sudden appearance of multiple seborrhoeic keratoses (SKs) in association with internal occult malignancy. Usually, the syndrome has been associated with adenocarcinoma, most frequently of the gastrointestinal tract and breast. The pathogen...
Directory of Open Access Journals (Sweden)
Edmar A.S. de Araújo
2008-06-01
Full Text Available Primary progressive multiple sclerosis (PPMS is defined clinically with a progressive course from onset. There is no approved treatment for the PPMS. Methylprednisolone IV (MP hastens the recovery from MS relapses. We studied 11 patients that met the MacDonald's diagnostic criteria for PPMS. The dose of MP was 30 mg/kg in 250 mL of glucose solution in three consecutive days during the first week, two doses during the second and one dose in the third week. One weekly session for eight consecutive weeks was given. After, a once-a week/eight-week interval was maintained. The medium EDSS before treatment was 6.2, and after 11.2 years of treatment, the EDSS was 4.9. Although we studied a small sample of PPMS we may conclude that therapy with IVMP prevents clinical worsening of MS in the majority of patients with improvement in EDSS scores.A forma progressiva da esclerose múltipla (FPEM é definida como progressiva desde o início. Não há tratamento eficaz para esta forma. A metilprednisolona por via endovenosa (MPEV é usada para os surtos de exacerbação da EM. Estudamos 11 pacientes que preenchiam os critérios de MacDonald para FPMS. A dose inicial de MPEV foi de 30 mg/kg em 250 mL de soro glicosado por três dias consecutivos na primeira semana, duas doses na segunda e uma dose na terceira semana. Seguiu-se uma sessão semanal por oito semanas. Após manteve-se uma dose semanal a cada oito semanas. A média do EDDS foi 9,6 antes e 4,9 após 11,2 anos de tratamento. Embora tenhamos estudado número reduzido de casos, podemos dizer que o uso de MPEV impede a progressão da FPEM na maioria dos pacientes estudados com melhora do EDDS.
Elementos do trágico em Eça de Queirós: A tragédia da Rua das Flores e Os Maias
Leal, Luciana Ferreira [UNESP
2006-01-01
Esta tese analisa dois romances queirosianos vinculados ao gênero dramático, mais especificamente ao trágico. No primeiro momento, busca-se levar a efeito considerações teóricas acerca do trágico, caracterizando a sua especificidade, tanto na origem, quanto no seu desenvolvimento ulterior. Nesta busca da peculiaridade do sentido do trágico, a atenção volta-se para a evolução do gênero da Antigüidade ao Tempo Cristão, do trágico grego ao trágico moderno. Assim, elementos como Hybris, Antinomia...
International Nuclear Information System (INIS)
Kalekar, Bhupesh B.; Reddy, A.V.R.; Raje, Naina
2016-01-01
High temperature interaction behavior of nitrates is important for characterizing different intermediate products and their thermal stabilities during the calcination of nuclear waste before their immobilization in the stable glass matrix. Mixtures of UO 2 (NO 3 ) 2 .6H 2 O (UNH) with NaNO 3 (NaN) and RbNO 3 (RbN) were prepared by mixing the weighed amounts of component nitrates and grinding gently in a mortar and pestle. The mixing and grinding of individual nitrate components in a mortar with pestle showed the agglomeration of solid particles and subsequent dissolution probably in the water of crystallization of UNH. The continued grinding and mixing showed the reappearance of the solid powder. The original yellow color of the mixture was changed to greenish yellow color. The mixtures were subjected to thermal measurements using Netzsch Thermobalance (Model No.: STA 409 PC Luxx) coupled to Bruker FTIR system (Model No.: Tensor 27) via a heated Teflon capillary (1 m long, 2 mm i.d.). TG - DTG curves of equimolar mixture are displayed. The plateau was observed on TG curve in the temperature region of 31- 250 °C. It is reported that Na(UO 2 (NO 3 ) 3 ).H 2 O and Rb(UO 2 (NO 3 ) 3 ) formed around 250 °C in the equimolar nitrate mixtures of UNH-NaN and UNH-RbN. Thermal and XRD results indicated the formation of Na(UO 2 (NO 3 ) 3 ).H 2 O and Rb(UO 2 (NO) 3 ) 3 ) even by mixing the UNH, NaN and RbN in equimolar ratios at room temperature
Conservação in vitro de germoplasma indexado de três cultivares de amarílis (Hippeastrum Herb..
Directory of Open Access Journals (Sweden)
Lincoln Amaral
2007-06-01
Full Text Available Pesquisaram-se as os efeitos das concentrações de 10, 20, 30 e 40 g L-1 de sacarose, adicionadas à solução salina MS de Murashige e Skoog (1962 a 50 e 100% e das temperaturas em sala de crescimento de 18 oC e 25 oC, na conservação in vitro de três acessos do BAG-amarílis (Hippeastrum Herb., do Instituto Agronômico (IAC. Os ápices caulinares de ‘Apple Blossom’, ‘Red Lion’ e ‘Orange Souvereign’, contendo 2 primórdios foliares, foram extraídos de bulbos e submetidos a 37oC por 40 dias, para efeito de eleiminação de virus. Efetuaram-se análises de partículas virais de folhas das três cultivares cultivadas em campo e in vitro. Empregou-se o delineamento inteiramente casualizado, em esquema fatorial 2 x 3 x 2, composto de 12 tratamentos, 10 repetições e 1 explante por parcela. Verificou-se que a associação da termoterapia com a cultura in vitro reduziu a presença de partículas virais em 70, 65 e 55% em ‘Orange Souvereign’, ‘Red Lion’ e ‘Apple Blossom’, respectivamente. Explantes das três cultivares de amarílis apresentaram menor desenvolvimento quando cultivados no meio de cultura MS contendo a metade da concentração de sais, acrescido de 10 g L-1 de sacarose e incubado a 18 ºC , mantendo-se viáveis por 90 dias. Nessas condições, os explantes desenvolveram, em média, 1 bulbilho com 2,2; 2,0 e 2,3 folhas de 32,5; 27,8 e 25,8 cm de comprimento; 1,7; 2,3 e 2,0 raízes de 20,5; 16,8 e 18,2 cm e massa fresca de 3,9; 3,4 3,1g, respectivamente, para ‘Apple Blossom’, ‘Red Lion’ e ‘Orange Souvereign’.
Mackebrandt, F.; Mallonn, M.; Ohlert, J. M.; Granzer, T.; Lalitha, S.; García Muñoz, A.; Gibson, N. P.; Lee, J. W.; Sozzetti, A.; Turner, J. D.; Vaňko, M.; Strassmeier, K. G.
2017-12-01
Context. Transit events of extrasolar planets offer the opportunity to study the composition of their atmospheres. Previous work on transmission spectroscopy of the close-in gas giant (TrES)-3 b revealed an increase in absorption towards blue wavelengths of very large amplitude in terms of atmospheric pressure scale heights, too large to be explained by Rayleigh-scattering in the planetary atmosphere. Aims: We present a follow-up study of the optical transmission spectrum of the hot Jupiter TrES-3 b to investigate the strong increase in opacity towards short wavelengths found by a previous study. Furthermore, we aim to estimate the effect of stellar spots on the transmission spectrum. Methods: This work uses previously published long slit spectroscopy transit data of the Gran Telescopio Canarias (GTC) and published broad band observations as well as new observations in different bands from the near-UV to the near-IR, for a homogeneous transit light curve analysis. Additionally, a long-term photometric monitoring of the TrES-3 host star was performed. Results: Our newly analysed GTC spectroscopic transit observations show a slope of much lower amplitude than previous studies. We conclude from our results the previously reported increasing signal towards short wavelengths is not intrinsic to the TrES-3 system. Furthermore, the broad band spectrum favours a flat spectrum. Long-term photometric monitoring rules out a significant modification of the transmission spectrum by unocculted star spots. Based on (1) data obtained with the STELLA robotic telescopes in Tenerife, an AIP facility jointly operated by AIP and IAC, (2) observations collected at the German-Spanish Astronomical Center, Calar Alto, jointly operated by the Max-Planck-Institut für Astronomie Heidelberg and the Instituto de Astrofísica de Andalucía (CSIC) and (3) observations made with the Italian Telescopio Nazionale Galileo (TNG) operated on the island of La Palma by the Fundación Galileo Galilei of
La tríada oscura de la personalidad: maquiavelismo, narcisismo y psicopatía. Una mirada evolutiva
Directory of Open Access Journals (Sweden)
Fernando Renee González Moraga
2015-08-01
Full Text Available Se aborda la denominada Tríada Oscura de la Personalidad -Tríada- (maquiavelismo, narcisismo subclínico y psicopatía subclínica desde una mirada evolutiva. El objetivo de esta investigación es revisar la evidencia que han presentado los teóricos evolucionistas sobre la Tríada, desde un acercamiento a la mirada evolutiva. Para esto, se indaga en las principales características de cada uno de estos rasgos, los instrumentos que se han utilizado para evaluarlos y las principales áreas en donde se han estudiado. La mirada evolutiva plantea que los rasgos de la Tríada son dimensionales y varían de acuerdo con las diversas estrategias que utilizan los sujetos para adaptarse a las características socioambientales en las que se desarrollan. Estos rasgos se caracterizan por presentar violencia psicológica, inhibición moral, manipulación, baja amabilidad, insensibilidad, egoísmo y dificultad para mentalizar en contextos de interacción interpersonal y social.
Energy Technology Data Exchange (ETDEWEB)
Huang Yiyun E-mail: hh285@columbia.edu; Hwang, D.-R.; Zhu Zhihong; Bae, S.-A.; Guo Ningning; Sudo, Yasuhiko; Kegeles, Lawrence S.; Laruelle, Marc
2002-10-01
A new PET radioligand for the serotonin transporter (SERT), [{sup 11}C]-5-bromo-2-[2-(dimethylaminomethylphenylsulfanyl)]phenylamine ([{sup 11}C]DAPA (10), was synthesized and evaluated in vivo in rats and baboons. [{sup 11}C]DAPA (10) was prepared from its monomethylamino precursor 8 by reaction with high specific activity [{sup 11}C]methyl iodide. Radiochemical yield was 24{+-}5% based on [{sup 11}C]methyl iodide at end of bombardment (EOB, n=10) and specific activity was 1553{+-}939 Ci/mmol at end of synthesis (EOS, n=10). Binding assays indicated that [{sup 11}C]DAPA displays high affinity (Ki 1.49{+-}0.28 nM for hSERT) and good selectivity for the SERT in vitro. Biodistribution studies in rats indicated that [{sup 11}C]DAPA enters into the brain readily and localizes in brain regions known to contain high concentrations of SERT, such as the thalamus, hypothalamus, frontal cortex and striatum. Moreover, such binding in SERT-rich regions of the brain are blocked by pretreatment with either the selective serotonin reuptake inhibitor (SSRI) citalopram and by the cold compound itself, demonstrating that [{sup 11}C]DAPA binding in the rat brain is saturable and specific to SERT. Imaging experiments in baboons indicated that [{sup 11}C]DAPA binding is consistent with the known distribution of SERT in the baboon brain, with highest levels of radioactivity detected in the midbrain and thalamus, intermediate levels in the hippocampus and striatum, and lower levels in the cortical regions. Pretreatment of the baboon with citalopram 10 min before radioactivity injection blocked the binding of [{sup 11}C]DAPA in all brain regions that contain SERT. Kinetic analysis revealed that, in all brain regions examined, [{sup 11}C]DAPA specific to nonspecific distribution volume ratios (V{sub 3}'') are higher than [{sup 11}C](+)-McN 5652 and similar to [{sup 11}C]DASB. In summary, [{sup 11}C]DAPA appears to be a promising radioligand suitable for the visualization of SERT
Rac1 GTPase regulates 11β hydroxysteroid dehydrogenase type 2 and fibrotic remodeling.
Lavall, Daniel; Schuster, Pia; Jacobs, Nadine; Kazakov, Andrey; Böhm, Michael; Laufs, Ulrich
2017-05-05
The aim of the study was to characterize the role of Rac1 GTPase for the mineralocorticoid receptor (MR)-mediated pro-fibrotic remodeling. Transgenic mice with cardiac overexpression of constitutively active Rac1 (RacET) develop an age-dependent phenotype with atrial dilatation, fibrosis, and atrial fibrillation. Expression of MR was similar in RacET and WT mice. The expression of 11β hydroxysteroid dehydrogenase type 2 (11β-HSD2) was age-dependently up-regulated in the atria and the left ventricles of RacET mice on mRNA and protein levels. Statin treatment inhibiting Rac1 geranylgeranylation reduced 11β-HSD2 up-regulation. Samples of human left atrial myocardium showed a positive correlation between Rac1 activity and 11β-HSD2 expression ( r = 0.7169). Immunoprecipitation showed enhanced Rac1-bound 11β-HSD2 relative to Rac1 expression in RacET mice that was diminished with statin treatment. Both basal and phorbol 12-myristate 13-acetate (PMA)-induced NADPH oxidase activity were increased in RacET and correlated positively with 11β-HSD2 expression ( r = 0.788 and r = 0.843, respectively). In cultured H9c2 cardiomyocytes, Rac1 activation with l-buthionine sulfoximine increased; Rac1 inhibition with NSC23766 decreased 11β-HSD2 mRNA and protein expression. Connective tissue growth factor (CTGF) up-regulation induced by aldosterone was prevented with NSC23766. Cardiomyocyte transfection with 11β-HSD2 siRNA abolished the aldosterone-induced CTGF up-regulation. Aldosterone-stimulated MR nuclear translocation was blocked by the 11β-HSD2 inhibitor carbenoxolone. In cardiac fibroblasts, nuclear MR translocation induced by aldosterone was inhibited with NSC23766 and spironolactone. NSC23766 prevented the aldosterone-induced proliferation and migration of cardiac fibroblasts and the up-regulation of CTGF and fibronectin. In conclusion, Rac1 GTPase regulates 11β-HSD2 expression, MR activation, and MR-mediated pro-fibrotic signaling. © 2017 by The American Society for
Tráfego veicular e mortalidade por doenças do aparelho circulatório em homens adultos
Habermann, Mateus; Gouveia, Nelson
2011-01-01
OBJETIVO: Analisar a associação entre indicadores de exposição à poluição por tráfego veicular e mortalidade por doenças do aparelho circulatório em homens adultos. MÉTODOS: Foram analisadas informações sobre vias e volume de tráfego no ano de 2007 fornecidas pela companhia de engenharia de tráfego local. Mortalidade por doenças do aparelho circulatório no ano de 2005 entre homens > 40 anos foram obtidas do registro de mortalidade do Programa de Aprimoramento de Informações de Mortalidade do ...
Synthesis of 4-(3-t-butylamino-2-hydroxypropoxy)- benzimidazol -2 (/sup 11/C)-one (CGP 12177)
Energy Technology Data Exchange (ETDEWEB)
Boullais, C; Crouzel, C; Syrota, A
1986-05-01
4-(3-t-butylamino-2-hydroxypropoxy)-benzimidazol-2 (/sup 11/C)-one (CGP 12177) was synthesized in a short time (30 min) and with a specific activity of 130 mCi/..mu..Mo1 for ..beta.. receptor studies by the positron emission tomography. The radioactive reagent was /sup 11/C-phosgene and the starting material 1-(3-t-butylamino-2-hydroxypropoxy)-2,3-diamino benzene.
Synthesis of 2-[11C]cyano-isonicotinic acid hydrazide
International Nuclear Information System (INIS)
Somwardhana, C.W.; Sajjad, M.; Lambrecht, R.M.
1990-01-01
Isonicotinic acid hydrazide (isoniazid), a drug used in treating tuberculosis has been labelled with carbon-11 at the 2-position. The labelling synthesis starts with methyl isonicotinate treated with dimethyl sulfate. The resulting salt solution is loaded onto silica gel and dried, followed by treatment with carbon-11 labelled hydrocyanic acid. Work-up gave the labelled compound with an average 32% radiochemical yield. Subsequent treatment with hydrazine hydrate yielded isoniazid
Directory of Open Access Journals (Sweden)
Marlene Cortez-Lugo
2013-04-01
Full Text Available OBJECTIVE: To study the relationship between light absorption measurements of PM2.5 at various distances from heavy traffic roads and diesel vehicle counts in Mexico City. MATERIALS AND METHODS: PM2.5 samples were obtained from June 2003-June 2005 in three MCMA regions. Light absorption (b abs in a subset of PM2.5 samples was determined. We evaluated the effect of distance and diesel vehicle counts to heavy traffic roads on PM2.5 b abs using generalized estimating equation models. RESULTS: Median PM2.5 b abs measurements significantly decrease as distance from heavy traffic roads increases (pOBJETIVO: Evaluar la relación entre las mediciones de absorción de luz de las PM2.5 a diferentes distancias de vías de tráfico y el aforo vehicular de diesel en la Ciudad de México. MATERIAL Y MÉTODOS: Se realizaron mediciones de PM2.5 y su análisis de b abs en tres zonas de la Ciudad de México. Se usaron modelos GEE para evaluar el efecto de la distancia y el aforo vehicular de tráfico pesado sobre PM2.5 b abs. RESULTADOS: Se observó una tendencia decreciente en la mediana de PM2.5 b abs conforme se incrementó la distancia a las avenidas de alto tráfico (p<0.002; los niveles decrecen en 7% (CI95% 0.9-14 por cada 100 metros de incremento. Las mediciones de PM2.5 b abs se incrementan en 20% (CI95% 3-38 cuando el aforo vehicular a diesel es mayor de 150 en una hora. CONCLUSIONES: Las mediciones de PM2.5 b abs están significativamente asociadas con la distancia de avenidas con alto tránsito vehicular y con vehículos de diesel.
Factores tróficos en neuronas dopaminérgicas mesencefálicas
Directory of Open Access Journals (Sweden)
G. Pinzón
1994-12-01
Full Text Available Desde su descubrimiento, se ha postulado, y en algunos casos comprobado, que los factores tróficos juegan un papel importante en el desarrollo, mantenimiento y regeneración del sistema nervioso. El conocimiento y la manipulación de estas sustancias ha servido para: a formular nuevas teorías acerca de la etiología de varios desórdenes neurodebeneraivos y b desarrollar nuevas altemativas terapéuticas para estas entidades. En la presente revisión, resumimos los principales efectos de diferentes factores tróficos sobre las neuronas dopaminérgicas de la substantia nigra en desarrollo, cuya degeneración en el adulto ocasiona la mayoría de los síntomas observados en la enfermedad de Parkinson.
Directory of Open Access Journals (Sweden)
Marisa Amaro Malvestio
2002-12-01
Full Text Available O estudo descreve idade, sexo, aspectos do mecanismo e procedimentos realizados em. 643 acidentados de trânsito atendidos nas Marginais Tietê e Pinheiros, considerando os valores do Revised Trauma Score (RTS do período pré-hospitalar. As vítimas com RTS=12 somaram 90,8%, com RTS=11, 4,0% e RTSEste estudio tiene como obje tivo describer, considerando el Revised Trauma Score (RTS obtenido en el periodo pré hospitalario, edad, sexo, aspectos del mecanismo e procedimientos realizados en 643 víctimas de accidente de tránsito. Las víctimas con RTS=12 sumaron 90,8%, con RTS=11, 4,0% y RTSThis report describes age, gender, trauma mechanics aspects and procedures from 643 motor vehicle crashes, MVC, victims in Tietê and Pinheiros expressways, by considering the prehospital Revised Trauma Score (RTS. The RTS=12 victims' were 90,8%, with RTS=11 added 4,0% and in group with RTS<10, 5,2%. Among the RTS<10 victims, the pedestrians stand out (36,4%, the frontal impacts (24,2% and the projected (36,4% or trapped victims (15,1%, and those that received advanced life support procedures.The motorcyclists and the male victims with 21 with 30 years of age were predominant. This study is expected to contribute to a better assistance to MVC victims.
Directory of Open Access Journals (Sweden)
Belquiz R. Amaral Nassaralla
2003-01-01
Full Text Available OBJETIVO: Determinar a segurança, eficácia, previsibilidade e estabilidade da técnica "laser in situ keratomileusis" (LASIK, três anos após a cirurgia, para a correção de alta anisometropia em crianças, para as quais os tratamentos convencionais não obtiveram êxito. MÉTODOS: Nove olhos de nove pacientes, três meninos e 6 meninas, com idade média de 11,5 anos (variando de 8 a 15 anos, foram submetidos à técnica LASIK utilizando-se o excimer laser Chiron Technolas 217. O tempo mínimo de seguimento foi de 36 meses. RESULTADOS: Três anos após o LASIK, a acuidade visual sem correção (AVSC melhorou pelo menos 5 linhas em todos os olhos; cinco olhos (55,5% apresentavam AVSC de 20/50 ou melhor. Seis olhos (66,6%, apresentavam acuidade visual com correção (AVCC de 20/50 ou melhor e cinco olhos (55,5% ganharam pelo menos 1 linha na AVCC. Devido a ambliopia, nenhum olho apresentou AVSC de 20/20 ou melhor. A média do equivalente esférico pré-operatório foi reduzida de -7,66 (± 3,75 D para -1,02 (± 1,26 D e a do astigmatismo, de -3,11 (± 2,09 D para -0,75 (± 0,25 D. A maior anisometropia encontrada foi de 1,5 D. CONCLUSÕES: Após três anos de seguimento, a técnica LASIK parece ser opção segura e eficaz na correção de alta anisometropia em crianças entre 8 e 15 anos de idade, para os quais os tratamentos convencionais não obtiveram êxito. A progressão do erro refracional relacionada à idade não impediu o uso da correção visual adequada.PURPOSE: To determine the safety, efficacy, predictability and stability of laser in situ keratomileusis (LASIK, three years after surgery, to correct high myopia or high myopic astigmatism in children with high anisometropia in whom conventional treatments had failed. METHODS: Nine eyes of 9 patients, 3 boys and 6 girls with a mean age of 11.5 years (range, 8 to 15 years underwent LASIK using the Chiron Technolas 217 excimer laser. Minimum follow-up was 36 months. RESULTS: Three
Abordaje inmunológico del síndrome por deleción 22q11
Directory of Open Access Journals (Sweden)
Estefanía Vásquez-Echeverri
Full Text Available El síndrome por deleción 22q11 (SD22q11 es el síndrome por deleción cromosómica más frecuente en humanos y se caracteriza por la tríada clínica que incluye cardiopatía congénita, hipocalcemia e inmunodeficiencia primaria. El 85-90% de los pacientes tienen microdeleciones en el cromosoma 22q11.2. Tomando como punto cardinal la cardiopatía congénita, se diseñó una estrategia para tamización y diagnóstico de SD22q11 con énfasis en la evaluación inmune. Es imprescindible realizar una historia clínica detallada y, posteriormente, un análisis cuantitativo y funcional de las subpoblaciones de linfocitos en sangre periférica para clasificarlo en SD22q11 completo (<1% o parcial (95-99% e instaurar las pautas de tratamiento en aspectos como: aislamiento del paciente, vacunación, profilaxis contra microorganismos oportunistas, uso de productos sanguíneos irradiados y reconstitución inmunológica. Sin embargo, el abordaje del paciente debe ser multidisciplinario para detectar y prevenir complicaciones a largo plazo que pueden ser graves, especialmente en los pacientes con SD22q11 completo.
Directory of Open Access Journals (Sweden)
Erni Mayana
2016-10-01
Full Text Available Learning to write and read at the elementary level is the main staple for Indonesian lessons, if the student does not have the ability to read and write at the beginning of this level, it will be very difficult for any lesson. Result of preliminary observations in primary school 05 Nan Sabaris shows that there are several obstacles facing teachers in the learning process. One problem is difficult to instill the concept of reading and writing to students. The purpose of this action research are (1 to determine the extent of the use of learning resources in the form of cards letters and syllables and words can affect the ability of students in assembling and read it word for word (2 to improve the ability of students to practice reading by using cards are dealt teacher said. Data were obtained through tests and the use of the observation, the data is processed by a percentage. The results of the analysis of data obtained in the first cycle of learning success; 61.00 %, and the second cycle; amounted to 81.50%. So show no increase in student learning from the first cycle to cycle II. Thus the use of the letter cards can increase pemahamn stringing words and read to students. This is evident from the excited students verbatim via encrypted card.
Optimization Of PVDF-TrFE Processing Conditions For The Fabrication Of Organic MEMS Resonators.
Ducrot, Pierre-Henri; Dufour, Isabelle; Ayela, Cédric
2016-01-21
This paper reports a systematic optimization of processing conditions of PVDF-TrFE piezoelectric thin films, used as integrated transducers in organic MEMS resonators. Indeed, despite data on electromechanical properties of PVDF found in the literature, optimized processing conditions that lead to these properties remain only partially described. In this work, a rigorous optimization of parameters enabling state-of-the-art piezoelectric properties of PVDF-TrFE thin films has been performed via the evaluation of the actuation performance of MEMS resonators. Conditions such as annealing duration, poling field and poling duration have been optimized and repeatability of the process has been demonstrated.
Factors related to non-recovery from whiplash. The Nord-Trøndelag Health Study (HUNT).
Myrtveit, Solbjørg Makalani; Skogen, Jens Christoffer; Petrie, Keith J; Wilhelmsen, Ingvard; Wenzel, Hanne Gro; Sivertsen, Børge
2014-06-01
Whiplash injuries show a variable prognosis which is difficult to predict. Most individuals experiencing whiplash injuries rapidly recover but a significant proportion develop chronic symptoms and ongoing disability. By employing longitudinal data, we investigated how psychological and physical symptoms, self-rated health, use of health services and medications, health behavior and demographic factors predict recovery from whiplash. Data from two waves of a large, Norwegian, population-based study (The Nord-Trøndelag Health Study: HUNT2 and HUNT3) were used. Individuals reporting whiplash in HUNT2 (baseline) were identified in HUNT3 11 years later. The characteristics of individuals still suffering from whiplash in HUNT3 were compared with the characteristics of individuals who had recovered using Pearson's chi-squared test, independent sample t-tests and logistic regression. At follow-up, 31.6 % of those reporting whiplash at baseline had not recovered. These individuals (n = 199) reported worse health at baseline than recovered individuals (n = 431); they reported poorer self-rated health (odds ratio [OR] = 3.12; 95 % confidence interval [CI], 2.20-4.43), more symptoms of anxiety (OR = 1.70; 95 % CI, 1.15-2.50), more diffuse somatic symptoms (OR = 2.38; 95 % CI, 1.61-3.51) and more musculoskeletal symptoms (OR = 1.21; 95 % CI, 1.13-1.29). Individuals still suffering from whiplash also visited more health practitioners at baseline (OR = 1.18; 95 % CI, 1.06-1.32) and used more medications (OR = 1.24; 95 % CI, 1.09-1.40). Poor self-rated health seems to be a strong risk factor for whiplash injuries becoming chronic. Diffuse somatic symptoms, musculoskeletal symptoms and symptoms of anxiety at baseline are important prognostic risk factors. Knowledge of these maintaining risk factors enables identification of individuals at risk of non-recovery, facilitating adequate treatment for this vulnerable group.
Hvad er Erdogans næste træk i Syrien?
DEFF Research Database (Denmark)
Engen, Torben Toftgaard
2017-01-01
Hvad end Tyrkiets næste træk vil blive, kan det betyde forøgede flygtningestrømme fra Syrien til Danmark, bringe den internationale alliance mod IS i krise, vanskeliggøre samarbejdet i Nato og forværre det tyrkisk-amerikanske forhold....
Print Best jahib trükiteenuste turul liidrirolli / Toivo Tänavsuu
Tänavsuu, Toivo
2004-01-01
Konkursil Ettevõtluse auhind 2004 piirkonna edendaja nominentide hulka kuuluv Print Best on tõusnud viimase aastaga mahtudelt viie suurema poogentrükikoja hulka Eestis. Firma prioriteediks on Venemaa, mõeldud on müügiüksuse loomisele Moskvas. Lisa: Print Best Trükikoda
Johnson, Jennifer L; He, Jing; Ramadass, Mahalakshmi; Pestonjamasp, Kersi; Kiosses, William B; Zhang, Jinzhong; Catz, Sergio D
2016-02-12
The small GTPase Rab11 and its effectors control trafficking of recycling endosomes, receptor replenishment and the up-regulation of adhesion and adaptor molecules at the plasma membrane. Despite recent advances in the understanding of Rab11-regulated mechanisms, the final steps mediating docking and fusion of Rab11-positive vesicles at the plasma membrane are not fully understood. Munc13-4 is a docking factor proposed to regulate fusion through interactions with SNAREs. In hematopoietic cells, including neutrophils, Munc13-4 regulates exocytosis in a Rab27a-dependent manner, but its possible regulation of other GTPases has not been explored in detail. Here, we show that Munc13-4 binds to Rab11 and regulates the trafficking of Rab11-containing vesicles. Using a novel Time-resolved Fluorescence Resonance Energy Transfer (TR-FRET) assay, we demonstrate that Munc13-4 binds to Rab11a but not to dominant negative Rab11a. Immunoprecipitation analysis confirmed the specificity of the interaction between Munc13-4 and Rab11, and super-resolution microscopy studies support the interaction of endogenous Munc13-4 with Rab11 at the single molecule level in neutrophils. Vesicular dynamic analysis shows the common spatio-temporal distribution of Munc13-4 and Rab11, while expression of a calcium binding-deficient mutant of Munc13-4 significantly affected Rab11 trafficking. Munc13-4-deficient neutrophils showed normal endocytosis, but the trafficking, up-regulation, and retention of Rab11-positive vesicles at the plasma membrane was significantly impaired. This correlated with deficient NADPH oxidase activation at the plasma membrane in response to Rab11 interference. Our data demonstrate that Munc13-4 is a Rab11-binding partner that regulates the final steps of Rab11-positive vesicle docking at the plasma membrane. © 2016 by The American Society for Biochemistry and Molecular Biology, Inc.
Directory of Open Access Journals (Sweden)
Hajiamini Zahra
2012-07-01
Full Text Available Abstract Background The School Anxiety Scale-Teacher Report (SAS-TR was designed to assess anxiety in children at school. The SAS-TR is a proxy rated measure and could assess social anxiety, generalized anxiety and also gives a total anxiety score. This study aimed to translate and validate the SAS-TR in Iran. Methods The translation and cultural adaptation of the original questionnaire were carried out in accordance with the published guidelines. A sample of students participated in the study. Reliability was estimated using internal consistency and test-retest analysis. Validity was assessed using content validity. The factor structure of the questionnaire was extracted by performing both exploratory and confirmatory factor analyses. Results In all 200 elementary students aged 6 to 10 years were studied. Considering the recommended cut-off values, overall the prevalence of high anxiety condition in elementary students was found to be 21 %. Cronbach's alpha coefficient for the Iranian SAS-TR was 0.92 and intraclass correlation coefficient (ICC was found to be 0.81. The principal component analysis indicated a two-factor structure for the questionnaire (generalized and social anxiety that jointly accounted for 55.3 % of variances observed. The confirmatory factory analysis also indicated a good fit to the data for the two-latent structure of the questionnaire. Conclusion In general the findings suggest that the Iranian version of SAS-TR has satisfactory reliability, and validity for measuring anxiety in 6 to 10 years old children in Iran. It is simple and easy to use and now can be applied in future studies.
Yaylaci, Ferhat; Miral, Suha
2017-01-01
Aim of this study was to compare children diagnosed with Pervasive Developmental Disorder (PDD) according to DSM-IV-TR and DSM-5 diagnostic systems. One hundred fifty children aged between 3 and 15 years diagnosed with PDD by DSM-IV-TR were included. PDD symptoms were reviewed through psychiatric assessment based on DSM-IV-TR and DSM-5 criteria. Clinical severity was determined using Childhood Autism Rating Scale (CARS) and Autism Behavior Checklist (ABC). A statistically significant decrease (19.3 %) was detected in the diagnostic ratio with DSM-5. Age and symptom severity differed significantly between those who were and were not diagnosed with PDD using DSM-5. B4 criteria in DSM-5 was most common criterion. Results indicate that individuals diagnosed with PDD by DSM-IV-TR criteria may not be diagnosed using DSM-5 criteria.
Mattila, Marja-Leena; Kielinen, Marko; Linna, Sirkka-Liisa; Jussila, Katja; Ebeling, Hanna; Bloigu, Risto; Joseph, Robert M.; Moilanen, Irma
2011-01-01
Objective: The latest definitions of autism spectrum disorders (ASDs) were specified in "DSM-IV-TR" in 2000. "DSM-5" criteria are planned for 2013. Here, we estimated the prevalence of ASDs and autism according to "DSM-IV-TR," clarified confusion concerning diagnostic criteria, and evaluated "DSM-5" draft…
Control de tráfico vehicular usando ANFIS Vehicular traffic control using ANFIS
Directory of Open Access Journals (Sweden)
Luis Fernando Pedraza
2012-04-01
Full Text Available Diferentes estrategias para el control del tráfico urbano se han presentado a lo largo del tiempo. Este artículo presenta el diseño de un modelo de tráfico vehicular, el cual examina el tráfico existente en una vía a través de una serie de semáforos. A partir de este modelo se sincronizan los tiempos de duración y de desfase de los semáforos, utilizando para ello el Sistema de Inferencia Difusa Basado en Redes Adaptativas (ANFIS. El modelo es simulado y los resultados se evalúan a nivel macroscópico con el modelo de tiempos fijos, que funciona actualmente en Bogotá-Colombia.Different strategies for urban traffic control have been presented over time. This paper presents the design of a vehicular traffic model, examining the existing traffic through a serie of traffic lights on a road. From this model the times of duration and phase of the traffic lights are synchronized, using the Adaptive Network Based Fuzzy Inference Systems (ANFIS. The model is simulated and the results are evaluated at macroscopic level with the fixed time model, currently operating in Bogota-Colombia.
International Nuclear Information System (INIS)
Hong, Dun; Li, Xing-Wang; Lian, Qing-Quan; Lamba, Pankaj; Bernard, Daniel J.; Hardy, Dianne O.; Chen, Hai-Xiao; Ge, Ren-Shan
2009-01-01
Di-(2-ethylhexyl) phthalate (DEHP) and its metabolite mono-(2-ethylhexyl) phthalate (MEHP) have been classified as toxicants to the reproductive system at the testis level and DEHP may also impair reproductive axis function at the pituitary levels. However, MEHP is 10-fold more potent than DEHP in toxicity and little is known about the toxicological effect of MEHP on pituitary. In this study, we demonstrated that 11β-hydroxysteroid dehydrogenase type 2 (11β-HSD2), not 11β-HSD1, is strongly expressed in murine gonadotrope LβT2 cells. Interestingly, MEHP inhibited Hsd11b2 mRNA level and 11β-HSD2 enzyme activity in LβT2 cells at as low as 10 -7 M. Corticosterone (CORT) at a concentration of 10 -6 M significantly inhibited LβT2 cell proliferation after 2-day culture, and 10 -6 M RU486, an antagonist of glucocorticoid receptor (GR), reversed this inhibition. However, in the presence of 10 -5 or 10 -4 M MEHP, the minimal concentration of CORT to inhibit the proliferation of LβT2 cells was lowered to 10 -7 M, and 10 -6 M RU486 was not able to completely reverse the CORT effect. In conclusion, along with the regulation of GR, 11β-HSD2 may have a key role in glucocorticoid metabolism in LβT2 cells. MEHP may participate in the glucocorticoid metabolism in LβT2 cells through inhibition of 11β-HSD2 enzyme activity. Such perturbation may be of pathological significance as MEHP may interfere with the reproductive system at pituitary level through regulation of glucocorticoid metabolism, especially in neonates with higher risk of phthalates exposure.
Dawkins, Tamara; Meyer, Allison T.; Van Bourgondien, Mary E.
2016-01-01
"The Childhood Autism Rating Scale, Second Edition" (CARS2; 2010) includes two rating scales; the CARS2-Standard Version (CARS2-ST) and the newly developed CARS2-High Functioning Version (CARS2-HF). To assess the diagnostic agreement between the CARS2 and DSM-IV-TR versus DSM-5 criteria for Autism Spectrum Disorder (ASD), clinicians at…
Žieminių kviečių grūdų užterštumo mikromicetais ir mikotoksinais priklausomumas nuo tręšimo lygio
Mankevičienė, Audronė; Dabkevičius, Zenonas; Mačkinaitė, Rimutė; Cesevičienė, Jurgita
2006-01-01
Žieminių kviečių (Triticum aestivum L.) grūdų užsiteršimo mikroskopiniais grybais ir mikotoksinais tyrimai atlikti 2002-2004 m. Lietuvos žemdirbystės institute. Žieminiai kviečiai 'Ada' ir 'Zentos' tyrimų laikotarpiu buvo tręšiami 3 lygiais: netręšta (N0P0K0), vidutinis tręšimo lygis (N90P80K120S6), didžiausias tręšimo lygis (N180P80K140S13). Grūdų mikrobiologinės ir užterštumo mikotoksinais deoksinivalenoliu (DON), zearalenonu (ZEN) ir T-2 toksinu analizės atliktos tuoj po derliaus nuėmimo. ...
Permanent uncoupling of male-specific CYP2C11 transcription/translation by perinatal glutamate
Energy Technology Data Exchange (ETDEWEB)
Banerjee, Sarmistha; Das, Rajat Kumar; Giffear, Kelly A.; Shapiro, Bernard H., E-mail: shapirob@vet.upenn.edu
2015-04-01
Perinatal exposure of rats and mice to the typically reported 4 mg/g bd wt dose of monosodium glutamate (MSG) results in a complete block in GH secretion as well as obesity, growth retardation and a profound suppression of several cytochrome P450s, including CYP2C11, the predominant male-specific isoform — all irreversible effects. In contrast, we have found that a lower dose of the food additive, 2 mg/g bd wt on alternate days for the first 9 days of life results in a transient neonatal depletion of plasma GH, a subsequent permanent overexpression of CYP2C11 as well as subnormal (mini) GH pulse amplitudes in an otherwise normal adult masculine episodic GH profile. The overexpressed CYP2C11 was characterized by a 250% increase in mRNA, but only a 40 to 50% increase in CYP2C11 protein and its catalytic activity. Using freshly isolated hepatocytes as well as primary cultures exposed to the masculine-like episodic GH profile, we observed normal induction, activation, nuclear translocation and binding to the CYP2C11 promoter of the GH-dependent signal transducers required for CYP2C11 transcription. The disproportionately lower expression levels of CYP2C11 protein were associated with dramatically high expression levels of an aberrant, presumably nontranslated CYP2C11 mRNA, a 200% increase in CYP2C11 ubiquitination and a 70–80% decline in miRNAs associated, at normal levels, with a suppression of CYP2C expression. Whereas the GH-responsiveness of CYP2C7 and CYP2C6 as well as albumin was normal in the MSG-derived hepatocytes, the abnormal expression of CYP2C11 was permanent and irreversible. - Highlights: • A “low” neonatal dose of MSG causes an immediate but transient growth hormone depletion. • Adult circulating growth hormone contains mini pulses in an otherwise male profile. • CYP2C11 is permanently overexpressed > 250%; CYP2C6, 2C7 and albumin remain normal. • The bulk of the overexpressed CYP2C11 mRNA consists of an intron-retained form. • SOCS2
Permanent uncoupling of male-specific CYP2C11 transcription/translation by perinatal glutamate
International Nuclear Information System (INIS)
Banerjee, Sarmistha; Das, Rajat Kumar; Giffear, Kelly A.; Shapiro, Bernard H.
2015-01-01
Perinatal exposure of rats and mice to the typically reported 4 mg/g bd wt dose of monosodium glutamate (MSG) results in a complete block in GH secretion as well as obesity, growth retardation and a profound suppression of several cytochrome P450s, including CYP2C11, the predominant male-specific isoform — all irreversible effects. In contrast, we have found that a lower dose of the food additive, 2 mg/g bd wt on alternate days for the first 9 days of life results in a transient neonatal depletion of plasma GH, a subsequent permanent overexpression of CYP2C11 as well as subnormal (mini) GH pulse amplitudes in an otherwise normal adult masculine episodic GH profile. The overexpressed CYP2C11 was characterized by a 250% increase in mRNA, but only a 40 to 50% increase in CYP2C11 protein and its catalytic activity. Using freshly isolated hepatocytes as well as primary cultures exposed to the masculine-like episodic GH profile, we observed normal induction, activation, nuclear translocation and binding to the CYP2C11 promoter of the GH-dependent signal transducers required for CYP2C11 transcription. The disproportionately lower expression levels of CYP2C11 protein were associated with dramatically high expression levels of an aberrant, presumably nontranslated CYP2C11 mRNA, a 200% increase in CYP2C11 ubiquitination and a 70–80% decline in miRNAs associated, at normal levels, with a suppression of CYP2C expression. Whereas the GH-responsiveness of CYP2C7 and CYP2C6 as well as albumin was normal in the MSG-derived hepatocytes, the abnormal expression of CYP2C11 was permanent and irreversible. - Highlights: • A “low” neonatal dose of MSG causes an immediate but transient growth hormone depletion. • Adult circulating growth hormone contains mini pulses in an otherwise male profile. • CYP2C11 is permanently overexpressed > 250%; CYP2C6, 2C7 and albumin remain normal. • The bulk of the overexpressed CYP2C11 mRNA consists of an intron-retained form. • SOCS2
Thermal stability of polyoxometalate compound of Keggin K8[2-SiW11O39]∙nH2O supported with SiO2
Directory of Open Access Journals (Sweden)
Yunita Sari M A
2017-06-01
Full Text Available Synthesis through sol-gel method and characterization of polyoxometalate compound of K8[b2-SiW11O39]∙nH2O supported with SiO2 have been done. The functional groups of polyoxometalate compound was characterized by FT-IR spectrophotometer for the fungtional groups and the degree’s of crystalinity using XRD. The acidity of K8[b2-SiW11O39]∙nH2O/SiO2 was determined qualitative analysis using ammonia and pyridine adsorption and the quantitative analysis using potentiometric titration method. The results of FT-IR spectrum of K8[b2-SiW11O39]∙nH2O appeared at wavenumber 987.55 cm-1 (W=O, 864.11 cm-1 (W-Oe-W, 756.1 cm-1 (W-Oc-W, 3425.58 cm-1 (O-H, respectively and spectrum of K8[b2-SiW11O39]SiO2 appeared at wavenumber 956.69 cm-1 (W=O, 864.11 cm-1 (W-Oe-W, 3448.72 cm-1 (O-H, respectively. The diffraction of XRD pattern of K8[b2-SiW11O39]∙nH2O and K8[b2-SiW11O39]∙nH2O/SiO2 compounds show high crystalinity. The acidic properties showed K8[b2-SiW11O39]∙nH2O/SiO2 more acidic compared to K8[b2-The SiW11O39]∙nH2O. The qualitative analysis showed pyridine compound adsorbed more of polyoxometalate compound of K8[b2-SiW11O39]∙nH2O/SiO2. Analysis of stability showed that the K8[b2-SiW11O39]∙nH2O/SiO2 at temperature 500°C has structural changes compare to 200-400oC which was indicated from vibration at wavenumber 800-1000 cm-1. Keywords : K8[b2-SiW11O39]∙nH2O, polyoxometalate, SiO2.
International Nuclear Information System (INIS)
Hauler, Carolin; Martin, René; Knölker, Hans-Joachim; Gaus, Caroline; Mueller, Jochen F.; Vetter, Walter
2013-01-01
Polyhalogenated 1,1′-dimethyl-2,2′-bipyrroles (PDBPs) are halogenated natural products (HNPs) previously shown to bioaccumulate in marine mammals and birds. Since their discovery in 1999, six hexahalogenated and a few lesser halogenated congeners have been identified in diverse marine mammal samples. Here we report the identification of 17 additional hexahalogenated PDBPs in the blubber extract of a humpback dolphin (Sousa chinensis) from Queensland, Australia. Thirteen of these new PDBPs were also detected in an Australian sea cucumber (Holothuria sp.). Additional samples were also tested positive on several new PDBPs, including an Australian venus tuskfish (Choerodon venustus) as well as a white whale (Delphinapterus leucas) and a sperm whale (Physeter macrocephalus) from the Northern Hemisphere. GC/ECNI-MS-SIM quantification of the molecular ions was carried out with the help of synthesized standards. The sum concentration of PDBPs was 1.1 mg/kg lipid in the humpback dolphin and 0.48 mg/kg lipid in the sea cucumber. -- Highlights: •Polyhalogenated 1,1′-dimethyl-2,2′-bipyrroles (PDBPs) are natural products. •17 New hexahalogenated PDBPs were identified in marine biota from Australia. •A humpback dolphin (Sousa chinensis) contained 1.1 mg/kg lipid PDBPs. •New PDBPs were also detected in marine mammals from the Northern Hemisphere. -- Detection of new polyhalogenated 1,1′-dimethyl-2,2′-bipyrroles indicates a higher toxic risk of these halogenated natural products in the marine environment than previously known
Piezoelectricity enhancement of P(VDF/TrFE) by X-ray irradiation
Pilet, N.; Khikhlovskyi, V.; van Breemen, A.J.J.M.; Michels, J.J.; Kemerink, M.; Gelinck, G.; Warnicke, P.; Bernard, L.
2016-01-01
Organic electronics is becoming more and more important because the low level of fabrication and deposition complexity even at large scale makes it a good candidate for future low cost technological product development. P(VDF-TrFE) is a co-polymer of special interest due its ferroelectric property
International Nuclear Information System (INIS)
Patt, M.; Machulla, H.J.; Guendisch, D.; Kovar, K.A.; Wuellner, U.; Blocher, A.
1999-01-01
In order to evaluate the neurobiological mechanism causing the psychogenic effects of methylenedioxy-derivatives of amphetamine, the carbon-11 labeled analogues of 3,4-methylenedioxymethamphetamine (MDMA), 2 and 2,N-dimethyl-4,5-methylenedioxyamphetamine (MADAM-6) 4 were prepared for application in in-vivo PET studies by methylation of 3,4-methylenedioxyamphetamine (MDA) 1 and 2-methyl-4,5-methylenedioxyamphetamine 3 with [ 11 C]CH 3 I. The radiochemical yield was determined in dependence on time, temperature and amount of precursor. The best conditions for a fast labeling reaction with carbon-11 on a preparative scale were found to be a reaction time of 10 min using 1 mg of the corresponding dimethyl-precursors 1 or 3, thus obtaining radiochemical yields of 60% (based on produced [ 11 C]CH 3 I). Biodistribution studies were performed in rats, a high brain to blood ratio of 7.5 was observed for [ 11 C]MDMA in contrast to a ratio of 3.7 for [ 11 C]MADAM-6. (author)
Study on the curie transition of P(VDF-TrFE) copolymer
Eka Septiyani Arifin, Devi; Ruan, J. J.
2018-01-01
A systematic study was carried out to decipher the mechanism of Curie transition of piezoelectric crystals of poly(vinylidene fluoride trifluoroethylene) P(VDF-TrFE). The unique polarity of P(VDF-TrFE) crystalline phase below curie transition temperature is attributed to the lattice packing of all-trans molecular chains, which allocates all the substituted fluorine atoms on one side of molecular chains and hydrogen atoms on the other side. Therefore, a net dipole moment is created across the lateral packing of molecular chains. Nevertheless, due to the mutual repulsion among fluorene atoms, this all-trans conformation is not stable, and ready to change above Curie temperature, where thermal kinetic energy is sufficient to cause segmental rotation. As being illustrated by in-situ recorded X-ray diffraction and thermal analysis, the concerned curie transition is deciphered as a one-step process which is involved two process and this is different from conventional one-step solid-solid transitions. Accompanied with this one-step process during heating, the occurrence of lamellar bending is inferred for elucidating the decline of stacking regularity of crystalline lamellae, which reversibly recover during subsequent cooling. However, as the crystalline lamellae of P(VDF-TrFE) are confined in between the stacking of crystalline lamellae of PVDF, lamellar bending is restricted accordingly. As a result, a certain fraction of the piezoelectric crystalline lamellae was found to survive through the Curie transition. Thus, in addition to the suggestion of a one-step process as a new concept for understanding the Curie transition, the relationship between the lamellar stacking and transition of molecular packing is unveiled as well in this research.
Visual processing deficits in 22q11.2 Deletion Syndrome
Directory of Open Access Journals (Sweden)
Marjan Biria
2018-01-01
The reduced activity of ventral and dorsal visual areas during early stages points to an impairment in visual processing seen both in schizophrenia and 22q11.2DS. During intervals related to perceptual closure, the inverse correlation of high amplitudes with positive symptoms suggests that participants with 22q11.2DS who show an increased brain response to illusory contours during the relevant window for contour processing have less psychotic symptoms and might thus be at a reduced prodromal risk for schizophrenia.
On an integral representation of the function Tr(exp(A-lambdaB))
Energy Technology Data Exchange (ETDEWEB)
Mehta, M L [CEA Centre d' Etudes Nucleaires de Saclay, 91 - Gif-sur-Yvette (France). Service de Physique Theorique; Kumar, K
1976-02-01
The conjecture that Tr(exp(A-lambdaB)) can be written as a Laplace transform with a positive measure is proved for a certain class of matrices A and B. A few remarks are made about the undecided cases.
Directory of Open Access Journals (Sweden)
Juan Pablo Pacheco
2013-01-01
Full Text Available Los macroinvertebrados acuáticos responden a las características de su ambiente reflejando las alteraciones en el mismo. Por ello, son frecuentemente utilizados como indicadores biológicos en estudios de calidad de agua y monitoreo ambiental. El índice de estado trófico TSI-BI creado para la cuenca del río Santa Lucía, que incluye la cuenca de estudio, permite conocer el estado trófico de los arroyos mediante su composición de macroinvertebrados acuáticos. El objetivo de este trabajo es evaluar el estado trófico de los arroyos de la cuenca del embalse Paso Severino a través de la comunidad de macroinvertebrados mediante el índice TSI-BI. El embalse es utilizado como fuente de agua potable para la zona sur densamente poblada del país. La zona ha tenido un importante desarrollo de la actividad lechera en las últimas décadas. Se seleccionaron 10 subcuencas pertenecientes a arroyos de órdenes 2-4 tomándose muestras estacionales (2009-2010 de macroinvertebrados con red de mano de 500 µm. Se analizaron la abundancia relativa y composición de los macroinvertebrados, estimándose el estado trófico de los arroyos mediante el índice TSI-BI. Todos los arroyos estudiados presentaron niveles altos a muy altos de contaminación orgánica situándose en los rangos eutrófico-hipereutrófico. Los arroyos de mayor estado trófico (hipereutróficos presentaron una comunidad dominada por Hirudinea y Crustacea, mientras que en los de menor nivel trófico se observó una mayor abundancia de Ephemeroptera y presencia de Trichoptera. Los altos niveles tróficos de los arroyos indicarían la existencia de impacto por nutrientes, que llevó a cambios en la comunidad de macroinvertebrados hacia el dominio de organismos tolerantes a la contaminación. Dado los altos niveles tróficos de estos arroyos, y considerando que son afluentes del embalse de Paso Severino, el índice empleado y los resultados obtenidos constituyen una importante herramienta de
TR-EDB: Test Reactor Embrittlement Data Base, Version 1
Energy Technology Data Exchange (ETDEWEB)
Stallmann, F.W.; Wang, J.A.; Kam, F.B.K. [Oak Ridge National Lab., TN (United States)
1994-01-01
The Test Reactor Embrittlement Data Base (TR-EDB) is a collection of results from irradiation in materials test reactors. It complements the Power Reactor Embrittlement Data Base (PR-EDB), whose data are restricted to the results from the analysis of surveillance capsules in commercial power reactors. The rationale behind their restriction was the assumption that the results of test reactor experiments may not be applicable to power reactors and could, therefore, be challenged if such data were included. For this very reason the embrittlement predictions in the Reg. Guide 1.99, Rev. 2, were based exclusively on power reactor data. However, test reactor experiments are able to cover a much wider range of materials and irradiation conditions that are needed to explore more fully a variety of models for the prediction of irradiation embrittlement. These data are also needed for the study of effects of annealing for life extension of reactor pressure vessels that are difficult to obtain from surveillance capsule results.
TR-EDB: Test Reactor Embrittlement Data Base, Version 1
International Nuclear Information System (INIS)
Stallmann, F.W.; Wang, J.A.; Kam, F.B.K.
1994-01-01
The Test Reactor Embrittlement Data Base (TR-EDB) is a collection of results from irradiation in materials test reactors. It complements the Power Reactor Embrittlement Data Base (PR-EDB), whose data are restricted to the results from the analysis of surveillance capsules in commercial power reactors. The rationale behind their restriction was the assumption that the results of test reactor experiments may not be applicable to power reactors and could, therefore, be challenged if such data were included. For this very reason the embrittlement predictions in the Reg. Guide 1.99, Rev. 2, were based exclusively on power reactor data. However, test reactor experiments are able to cover a much wider range of materials and irradiation conditions that are needed to explore more fully a variety of models for the prediction of irradiation embrittlement. These data are also needed for the study of effects of annealing for life extension of reactor pressure vessels that are difficult to obtain from surveillance capsule results
Fabrication of PVDF-TrFE based bilayered PbTiO3/PVDF-TrFE films capacitor
Nurbaya, Z.; Wahid, M. H.; Rozana, M. D.; Annuar, I.; Alrokayan, S. A. H.; Khan, H. A.; Rusop, M.
2016-07-01
Development of high performance capacitor is reaching towards new generation where the ferroelectric materials take places as the active dielectric layer. The motivation of this study is to produce high capacitance device with long life cycle. This was configured by preparing bilayered films where lead titanate as an active dielectric layer and stacked with the top dielectric layer, poly(vinyledenefluoride-trifluoroethylene). Both of them are being referred that have one in common which is ferroelectric behavior. Therefore the combination of ceramic and polymer ferroelectric material could perform optimum dielectric characteristic for capacitor applications. The fabrication was done by simple sol-gel spin coating method that being varied at spinning speed property for polymer layers, whereas maintaining the ceramic layer. The characterization of PVDF-TrFE/PbTiO3 was performed according to metal-insulator-metal stacked capacitor measurement which includes structural, dielectric, and ferroelectric measurement.
Energy Technology Data Exchange (ETDEWEB)
Kodaka, Fumitoshi [National Institute of Radiological Sciences, Molecular Neuroimaging Program, Molecular Imaging Center, Chiba (Japan); Jikei University School of Medicine, Department of Psychiatry, Tokyo (Japan); Ito, Hiroshi [National Institute of Radiological Sciences, Molecular Neuroimaging Program, Molecular Imaging Center, Chiba (Japan); National Institute of Radiological Sciences, Biophysics Program, Molecular Imaging Center, Chiba (Japan); Kimura, Yasuyuki; Fujie, Saori; Takano, Harumasa; Fujiwara, Hironobu; Sasaki, Takeshi; Suhara, Tetsuya [National Institute of Radiological Sciences, Molecular Neuroimaging Program, Molecular Imaging Center, Chiba (Japan); Nakayama, Kazuhiko [Jikei University School of Medicine, Department of Psychiatry, Tokyo (Japan); Halldin, Christer; Farde, Lars [Karolinska Institutet, Department of Clinical Neuroscience, Stockholm (Sweden)
2013-04-15
Dopamine D{sub 2/3} receptors (D{sub 2/3}Rs) have two affinity states for endogenous dopamine, referred to as high-affinity state (D{sub 2/3} {sup HIGH}), which has a high affinity for endogenous dopamine, and low-affinity state (D{sub 2/3} {sup LOW}). The density of D{sub 2/3} {sup HIGH} can be measured with (R)-2-{sup 11}CH{sub 3}O-N-n-propylnorapomorphine ([{sup 11}C]MNPA), while total density of D{sub 2/3} {sup HIGH} and D{sub 2/3} {sup LOW} (D{sub 2/3}Rs) can be measured with [{sup 11}C]raclopride using positron emission tomography (PET). Thus, the ratio of the binding potential (BP) of [{sup 11}C]MNPA to that of [{sup 11}C]raclopride ([{sup 11}C]MNPA/[{sup 11}C]raclopride) may reflect the proportion of the density of D{sub 2/3} {sup HIGH} to that of D{sub 2/3}Rs. In the caudate and putamen, [{sup 11}C]MNPA/[{sup 11}C]raclopride reflects the proportion of the density of D{sub 2} {sup HIGH} to that of D{sub 2}Rs. To evaluate the reliability of the PET paradigm with [{sup 11}C]MNPA and [{sup 11}C]raclopride, we investigated the test-retest reproducibility of non-displaceable BP (BP{sub ND}) measured with [{sup 11}C]MNPA and of [{sup 11}C]MNPA/[{sup 11}C]raclopride in healthy humans. Eleven healthy male volunteers underwent two sets of PET studies on separate days that each included [{sup 11}C]MNPA and [{sup 11}C]raclopride scans. BP{sub ND} values in the caudate and putamen were calculated. Test-retest reproducibility of BP{sub ND} of [{sup 11}C]MNPA and [{sup 11}C]MNPA/[{sup 11}C]raclopride was assessed by intra-subject variability (absolute variability) and test-retest reliability (intraclass correlation coefficient: ICC). The absolute variability of [{sup 11}C]MNPA BP{sub ND} was 5.30 {+-} 3.96 % and 12.3 {+-} 7.95 % and the ICC values of [{sup 11}C]MNPA BP{sub ND} were 0.72 and 0.82 in the caudate and putamen, respectively. The absolute variability of [{sup 11}C]MNPA/[{sup 11}C]raclopride was 6.11 {+-} 3.68 % and 11.60 {+-} 5.70 % and the ICC values of [{sup
Ocular Findings in Children With 22q11.2 Deletion Syndrome.
Gokturk, Bahar; Topcu-Yilmaz, Pinar; Bozkurt, Banu; Yildirim, Mahmut Selman; Guner, Sukru Nail; Sayar, Esra Hazar; Reisli, Ismail
2016-07-01
To identify the ocular features of children diagnosed as having 22q11.2 deletion syndrome in a Turkish population, which is the most common microdeletion syndrome with a wide range of facial and ocular abnormalities. Sixteen children aged between 4 months and 18 years with a microdeletion in chromosome 22q11.2 underwent a detailed ophthalmological examination including uncorrected and best corrected visual acuity testing, stereoscopic vision examination, biomicroscopic and indirect fundus examination, and ocular motility testing. All patients had at least one ocular abnormality. The major abnormalities were eyelid abnormalities (eye hooding, narrow palpebral fissure, telecanthus, hypertelorism, sparse and thin eyebrows and eyelashes, blepharitis, and distichiasis), posterior embryotoxon, and tortuous retinal vessels in at least half of the patients. Other ophthalmological disorders were refractive errors, iris remnants, and strabismus. The chromosome 22q11.2 deletion syndrome is associated with a wide range of ocular disorders, which necessitates a comprehensive eye examination for appropriate treatment and follow-up. Ocular findings sometimes can provide a clue to the diagnosis of 22q11.2 deletion. [J Pediatr Ophthalmol Strabismus. 2016;53(4):218-222]. Copyright 2016, SLACK Incorporated.
Mortalidade por acidentes de trânsito e homicídios em Curitiba, Paraná, 1996-2011
Directory of Open Access Journals (Sweden)
Mayckel da Silva Barreto
Full Text Available Resumo OBJETIVO: descrever a tendência da mortalidade por homicídios e acidentes de trânsito de residentes em Curitiba, Paraná, Brasil, no período 1996-2011. MÉTODOS: estudo ecológico de séries temporais com dados do Sistema de Informações sobre Mortalidade; a análise de tendência foi realizada por modelos de regressão polinomial, segundo sexo. RESULTADOS: o coeficiente de mortalidade por acidentes de trânsito no sexo masculino declinou de 61,7 em 1996 para 28,4 em 2011 (-46%, e no feminino, de 16,5 para 7,3 óbitos por 100 mil habitantes (-44,2%; o coeficiente de mortalidade por homicídios entre os homens elevou-se de 32,5 para 69,3 (+113,2% e, entre as mulheres, de 4,4 para 5,3 óbitos por 100 mil habitantes (+20,4%. CONCLUSÃO: a mortalidade por homicídios aumentou; estratégias de prevenção das violências devem ser direcionadas às especificidades das causas externas e à maior exposição dos homens a esses agravos.
Mattila, Marja-Leena; Kielinen, Marko; Linna, Sirkka-Liisa; Jussila, Katja; Ebeling, Hanna; Bloigu, Risto; Joseph, Robert M; Moilanen, Irma
2011-06-01
The latest definitions of autism spectrum disorders (ASDs) were specified in DSM-IV-TR in 2000. DSM-5 criteria are planned for 2013. Here, we estimated the prevalence of ASDs and autism according to DSM-IV-TR, clarified confusion concerning diagnostic criteria, and evaluated DSM-5 draft criteria for ASD posted by the American Psychiatry Association (APA) in February 2010. This was an epidemiological study of 5,484 eight-year-old children in Finland, 4,422 (81%) of them rated via the Autism Spectrum Screening Questionnaire by parents and/or teachers, and 110 examined by using a structured interview, semi-structured observation, IQ measurement, school-day observation, and patient records. Diagnoses were assigned according to DSM-IV-TR criteria and DSM-5 draft criteria in children with a full-scale IQ (FSIQ) ≥50. Patient records were evaluated in children with an FSIQ autism 4.1 in 1,000 according to DSM-IV-TR. Of the subjects with ASDs and autism, 65% and 61% were high-functioning (FSIQ ≥70), respectively. The prevalence of pervasive developmental disorder not otherwise specified was not estimated because of inconsistency in DSM-IV-TR criteria. DSM-5 draft criteria were shown to be less sensitive in regard to identification of subjects with ASDs, particularly those with Asperger's syndrome and some high-functioning subjects with autism. DSM-IV-TR helps with the definition of ASDs only up to a point. We suggest modifications to five details of DSM-5 draft criteria posted by the APA in February 2010. Completing revision of DSM criteria for ASDs is a challenging task. Copyright © 2011 American Academy of Child and Adolescent Psychiatry. Published by Elsevier Inc. All rights reserved.
Monitoreo de tráfico vehicular en sistemas V2I mediante el uso de una red inalámbrica de sensores
Directory of Open Access Journals (Sweden)
Mario A. Ramirez Reyna
2014-01-01
reporte de eventos. En el primero, la información del tráfico es transmitida exclusivamente entre los nodos en la WSN, mientras que el segundo método hace uso de los vehículos para retransmitir la información al concentrador. Los métodos propuestos son analizados en términos del consumo de energía y retardo promedio de reporte.
Estudio del tráfico de las carreteras de la Diputació de Barcelona en la comarca del Garraf
Bengoetxea Artetxe, Andoni
2017-01-01
En este trabajo se seleccionarán varias carreteras ubicadas en la comarca del Garraf de titularidad de la Diputación de Barcelona y cuyo tráfico sea significativo. Se escogerán carreteras convencionales de dos carriles que carezcan de las características de trazado óptimas para la circulación. El objetivo de este trabajo es el de estudiar el tráfico actual y futuro en estas carreteras para saber si existen o existirán problemas de tráfico, así como proponer posibles medidas para solventar dic...
Elsinga, PH; vanWaarde, A; Jaeggi, KA; Schreiber, G; Heldoorn, M; Vaalburg, W
1997-01-01
The beta-adrenoceptor antagonist (S)-[C-11]CGP 12177 (4-(3-(tert-butylamino)-2-hydroxypropoxy)- 2H-benzimidazol-2[C-11]-one) is a generally accepted radioligand for cardiac and pulmonary PET studies. The synthesis of [C-11]CGP 12177 is a laborious and often troublesome procedure. Therefore, (S)-C GP
Directory of Open Access Journals (Sweden)
Mara Fernandes Moura
2011-10-01
Full Text Available Este trabalho objetivou verificar a influência de três porta-enxertos no comportamento da cultivar Juliana em relação à fenologia, em três épocas de poda e em relação aos caracteres físicos de cachos, de bagas e de engaços, em duas épocas de poda. Os ensaios foram avaliados em Jundiaí-SP, e as podas foram realizadas em 15-08-2007, 22-01-2008 e 16-09-2008. O delineamento experimental foi o em blocos inteiramente casualizados, com parcelas subdivididas, com três repetições, sendo as parcelas representadas pela combinação da cultivar Juliana enxertada sobre os porta-enxertos 'Ripária do Traviú', 'IAC 572' e 'IAC766', e as subparcelas, pelas épocas de poda, que corresponderam a três para os estádios fenológicos e a duas para os caracteres físicos de cachos, bagas e engaço. Não houve diferença entre os porta-enxertos para os estádios fenológicos e para os caracteres físicos de cachos e de bagas, com exceção para massa da matéria fresca de baga e massa fresca de engaço. Maior massa da matéria fresca de engaço foi obtida pela combinação da cultivar Juliana e o porta-enxerto 'IAC 572'. Para as diferentes épocas de poda, foram detectadas diferenças para todos os estádios fenológicos, havendo interação entre porta-enxerto e época de poda para os estádios E1 - período da poda ao início da brotação; E2 - período da poda ao início do florescimento, e E5 - período da poda ao início da colheita.
Directory of Open Access Journals (Sweden)
E.R. Migliaro
2001-04-01
Full Text Available In order to assess the relative influence of age, resting heart rate (HR and sedentary life style, heart rate variability (HRV was studied in two different groups. The young group (YG consisted of 9 sedentary subjects aged 15 to 20 years (YG-S and of 9 nonsedentary volunteers (YG-NS also aged 15 to 20. The elderly sedentary group (ESG consisted of 16 sedentary subjects aged 39 to 82 years. HRV was assessed using a short-term procedure (5 min. R-R variability was calculated in the time-domain by means of the root mean square successive differences. Frequency-domain HRV was evaluated by power spectrum analysis considering high frequency and low frequency bands. In the YG the effort tolerance was ranked in a bicycle stress test. HR was similar for both groups while ESG showed a reduced HRV compared with YG. Within each group, HRV displayed a negative correlation with HR. Although YG-NS had better effort tolerance than YG-S, their HR and HRV were not significantly different. We conclude that HRV is reduced with increasing HR or age, regardless of life style. The results obtained in our short-term study agree with others of longer duration by showing that age and HR are the main determinants of HRV. Our results do not support the idea that changes in HRV are related to regular physical activity.
Migliaro, E R; Contreras, P; Bech, S; Etxagibel, A; Castro, M; Ricca, R; Vicente, K
2001-04-01
In order to assess the relative influence of age, resting heart rate (HR) and sedentary life style, heart rate variability (HRV) was studied in two different groups. The young group (YG) consisted of 9 sedentary subjects aged 15 to 20 years (YG-S) and of 9 nonsedentary volunteers (YG-NS) also aged 15 to 20. The elderly sedentary group (ESG) consisted of 16 sedentary subjects aged 39 to 82 years. HRV was assessed using a short-term procedure (5 min). R-R variability was calculated in the time-domain by means of the root mean square successive differences. Frequency-domain HRV was evaluated by power spectrum analysis considering high frequency and low frequency bands. In the YG the effort tolerance was ranked in a bicycle stress test. HR was similar for both groups while ESG showed a reduced HRV compared with YG. Within each group, HRV displayed a negative correlation with HR. Although YG-NS had better effort tolerance than YG-S, their HR and HRV were not significantly different. We conclude that HRV is reduced with increasing HR or age, regardless of life style. The results obtained in our short-term study agree with others of longer duration by showing that age and HR are the main determinants of HRV. Our results do not support the idea that changes in HRV are related to regular physical activity.
Energy Technology Data Exchange (ETDEWEB)
Ernest A. Mancini
2006-08-30
Characterization of stratigraphic sequences (T-R cycles or sequences) included outcrop studies, well log analysis and seismic reflection interpretation. These studies were performed by researchers at the University of Alabama, Wichita State University and McGill University. The outcrop, well log and seismic characterization studies were used to develop a depositional sequence model, a T-R cycle (sequence) model, and a sequence stratigraphy predictive model. The sequence stratigraphy predictive model developed in this study is based primarily on the modified T-R cycle (sequence) model. The T-R cycle (sequence) model using transgressive and regressive systems tracts and aggrading, backstepping, and infilling intervals or sections was found to be the most appropriate sequence stratigraphy model for the strata in the onshore interior salt basins of the Gulf of Mexico to improve petroleum stratigraphic trap and specific reservoir facies imaging, detection and delineation. The known petroleum reservoirs of the Mississippi Interior and North Louisiana Salt Basins were classified using T-R cycle (sequence) terminology. The transgressive backstepping reservoirs have been the most productive of oil, and the transgressive backstepping and regressive infilling reservoirs have been the most productive of gas. Exploration strategies were formulated using the sequence stratigraphy predictive model and the classification of the known petroleum reservoirs utilizing T-R cycle (sequence) terminology. The well log signatures and seismic reflector patterns were determined to be distinctive for the aggrading, backstepping and infilling sections of the T-R cycle (sequence) and as such, well log and seismic data are useful for recognizing and defining potential reservoir facies. The use of the sequence stratigraphy predictive model, in combination with the knowledge of how the distinctive characteristics of the T-R system tracts and their subdivisions are expressed in well log patterns
International Nuclear Information System (INIS)
Gabaj, A.M.; Shchegoleva, N.N.; Gaviko, V.S.; Ivanova, G.V.
2003-01-01
Magnetic properties of homogenized ingots and rapidly quenched ribbons of (Zr 1-x M x ) 16.4 Co 83.6 with M=Ti, Nb, Y, Gd and Zr 16.4 (Co 1-y M* y ) 83.6 with M*= Mn, Fe, Ni, Cu, Al, Ga, Si are studied. The phase composition of the alloys is determined with the help of thermomagnetic analysis and, in specific cases, with the use of X-ray diffraction analysis and electron microscopical data. It is ascertained that a part of zirconium in a phase Zr 2 Co 11 can be replaced by titanium and niobium. The solubility of rare earth elements is noted to be not revealed. Cobalt is partially replaced by Al, Cu, Ga, Si, Ni and Fe in a 2:11 phase, and Mn stabilizes the structure of a Laves phase with unexpectedly strong ferromagnetic properties. For magnetic hardness of the rapidly quenched alloys the introduction of Ti is appeared to be most beneficial. This element enhances noticeably the coercive force and hysteresis loop rectangularity and, as it takes place, it does not change practically magnetic properties of a 2:11 phase but suppresses the formation of dendrites on its crystallization. A small increase of the coercive force is also observed on addition of Cu and Al [ru
Altered auditory processing and effective connectivity in 22q11.2 deletion syndrome.
Larsen, Kit Melissa; Mørup, Morten; Birknow, Michelle Rosgaard; Fischer, Elvira; Hulme, Oliver; Vangkilde, Anders; Schmock, Henriette; Baaré, William Frans Christiaan; Didriksen, Michael; Olsen, Line; Werge, Thomas; Siebner, Hartwig R; Garrido, Marta I
2018-01-30
22q11.2 deletion syndrome (22q11.2DS) is one of the most common copy number variants and confers a markedly increased risk for schizophrenia. As such, 22q11.2DS is a homogeneous genetic liability model which enables studies to delineate functional abnormalities that may precede disease onset. Mismatch negativity (MMN), a brain marker of change detection, is reduced in people with schizophrenia compared to healthy controls. Using dynamic causal modelling (DCM), previous studies showed that top-down effective connectivity linking the frontal and temporal cortex is reduced in schizophrenia relative to healthy controls in MMN tasks. In the search for early risk-markers for schizophrenia we investigated the neural basis of change detection in a group with 22q11.2DS. We recorded high-density EEG from 19 young non-psychotic 22q11.2 deletion carriers, as well as from 27 healthy non-carriers with comparable age distribution and sex ratio, while they listened to a sequence of sounds arranged in a roving oddball paradigm. Despite finding no significant reduction in the MMN responses, whole-scalp spatiotemporal analysis of responses to the tones revealed a greater fronto-temporal N1 component in the 22q11.2 deletion carriers. DCM showed reduced intrinsic connection within right primary auditory cortex as well as in the top-down, connection from the right inferior frontal gyrus to right superior temporal gyrus for 22q11.2 deletion carriers although not surviving correction for multiple comparison. We discuss these findings in terms of reduced adaptation and a general increased sensitivity to tones in 22q11.2DS. Copyright © 2018. Published by Elsevier B.V.
Análisis funcional de la red trófica de Bahía Magdalena Baja California Sur, México
Cruz-Escalona,Víctor H; Morales-Zárate,María V; Navia,Andrés F; Rguez-Baron,Juan M; del Monte-Luna,Pablo
2013-01-01
El objetivo del presente estudio fue desarrollar un modelo trófico (ECOPATH con ECOSIM) para caracterizar la estructura y función de la trama alimentaria de Bahía Magdalena. El modelo consta de 24 grupos funcionales, siendo dominado por grupos de niveles tróficos secundarios y terciarios, que generan un tercio de los flujos de biomasa total. Los flujos totales del sistema y la eficiencia de transferencia promedio entre niveles tróficos, encajan bien en el rango reportado para otros ecosistema...
Selective Hydrogenation of m-Dinitrobenzene to m-Nitroaniline over Ru-SnOx/Al2O3 Catalyst
Directory of Open Access Journals (Sweden)
Haiyang Cheng
2014-07-01
Full Text Available Series catalysts of Ru-SnOx/Al2O3 with varying SnOx loading of 0–3 wt% were prepared, and their catalytic activity and selectivity have been discussed and compared for the selective hydrogenation of m-dinitrobenzene (m-DNB to m-nitroaniline (m-NAN. The Ru-SnOx/Al2O3 catalysts were characterized by X-ray powder diffraction (XRD, X-ray photoelectron spectroscopy (XPS, transmission electron microscopy (TEM and hydrogen temperature-programmed reduction (H2-TPR and desorption (H2-TPD. Under the modification of SnOx, the reaction activity increased obviously, and the best selectivity to m-NAN reached above 97% at the complete conversion of m-DNB. With the increasing of the SnOx loading, the amount of active hydrogen adsorption on the surface of the catalyst increased according to the H2-TPD analysis, and the electron transferred from Ru to SnOx species, as determined by XPS, inducing an electron-deficient Ru, which is a benefit for the absorption of the nitro group. Therefore, the reaction rate and product selectivity were greatly enhanced. Moreover, the Ru-SnOx/Al2O3 catalyst presented high stability: it could be recycled four times without any loss in activity and selectivity.
Core-free rolled actuators for Braille displays using P(VDF-TrFE-CFE)
Levard, Thomas; Diglio, Paul J.; Lu, Sheng-Guo; Rahn, Christopher D.; Zhang, Q. M.
2012-01-01
Refreshable Braille displays require many small diameter actuators to move the pins. The electrostrictive P(VDF-TrFE-CFE) terpolymer can provide the high strain and actuation force under modest electric fields that are required for this application. In this paper, we develop core-free tubular actuators and integrate them into a 3 × 2 Braille cell. The terpolymer films are solution cast, stretched to 6 μm thick, electroded, laminated into a bilayer, rolled into a 2 mm diameter tube, bonded, and provided with top and bottom contacts. Experimental testing of 17 actuators demonstrates significant strains (up to 4%) and blocking forces (1 N) at moderate electric fields (100 MV m-1). A novel Braille cell is designed and fabricated using six of these actuators.
Nested Inversion Polymorphisms Predispose Chromosome 22q11.2 to Meiotic Rearrangements
Demaerel, Wolfram; Hestand, Matthew S.; Vergaelen, Elfi; Swillen, Ann; López-Sánchez, Marcos; Pérez-Jurado, Luis A.; McDonald-Mcginn, Donna M.; Zackai, Elaine; Emanuel, Beverly S.; Morrow, Bernice E.; Breckpot, Jeroen; Devriendt, Koenraad; Vermeesch, Joris R.; Antshel, Kevin M.; Arango, Celso; Armando, Marco; Bassett, Anne S.; Bearden, Carrie E.; Boot, Erik; Bravo-Sanchez, Marta; Breetvelt, Elemi; Busa, Tiffany; Butcher, Nancy J.; Campbell, Linda E.; Carmel, Miri; Chow, Eva W C; Crowley, T. Blaine; Cubells, Joseph; Cutler, David; Demaerel, Wolfram; Digilio, Maria Cristina; Duijff, Sasja; Eliez, Stephan; Emanuel, Beverly S.; Epstein, Michael P.; Evers, Rens; Fernandez Garcia-Moya, Luis; Fiksinski, Ania; Fraguas, David; Fremont, Wanda; Fritsch, Rosemarie; Garcia-Minaur, Sixto; Golden, Aaron; Gothelf, Doron; Guo, Tingwei; Gur, Ruben C.; Gur, Raquel E.; Heine-Suner, Damian; Hestand, Matthew; Hooper, Stephen R.; Kates, Wendy R.; Kushan, Leila; Laorden-Nieto, Alejandra; Maeder, Johanna; Marino, Bruno; Marshall, Christian R.; McCabe, Kathryn; McDonald-Mcginn, Donna M.; Michaelovosky, Elena; Morrow, Bernice E.; Moss, Edward; Mulle, Jennifer; Murphy, Declan; Murphy, Kieran C.; Murphy, Clodagh M.; Niarchou, Maria; Ornstein, Claudia; Owen, Michael J; Philip, Nicole; Repetto, Gabriela M.; Schneider, Maude; Shashi, Vandana; Simon, Tony J.; Swillen, Ann; Tassone, Flora; Unolt, Marta; Van Amelsvoort, Therese; van den Bree, Marianne B M; Van Duin, Esther; Vergaelen, Elfi; Vermeesch, Joris R.; Vicari, Stefano; Vingerhoets, Claudia; Vorstman, Jacob; Warren, Steve; Weinberger, Ronnie; Weisman, Omri; Weizman, Abraham; Zackai, Elaine; Zhang, Zhengdong; Zwick, Michael
2017-01-01
Inversion polymorphisms between low-copy repeats (LCRs) might predispose chromosomes to meiotic non-allelic homologous recombination (NAHR) events and thus lead to genomic disorders. However, for the 22q11.2 deletion syndrome (22q11.2DS), the most common genomic disorder, no such inversions have
Measurement of urinary 11-dehydro-thromboxane B2 excretion in dogs with gastric dilatation-volvulus.
Baltzer, Wendy I; McMichael, Maureen A; Ruaux, Craig G; Noaker, Laura; Steiner, Jörg M; Williams, David A
2006-01-01
To measure 11-dehydro-thromboxane B2 (11-dTXB2) in urine of healthy control dogs, dogs undergoing ovariohysterectomy, and dogs with gastric dilatation-volvulus (GDV) and assess the relationship between urinary 11-dTXB2 concentrations in dogs with GDV and postoperative outcomes. Urine samples from 15 nonsurgical control dogs, 12 surgical control dogs, and 32 dogs with GVD. Urine samples were obtained from healthy pet dogs (ie, nonsurgical control dogs), dogs undergoing ovariohysterectomy at anesthetic induction and 1 hour following surgery (ie, surgical control dogs), and dogs with GDV at hospital admission and 1 hour following surgical derotation of the stomach (ie, GDV dogs). Urinary 11-dTXB2 concentrations were determined with an ELISA and normalized to urinary creatinine (Cr) concentrations by calculation of the 11-dTXB2 -to-Cr ratio. Differences in median 11-dTXB2 -to-Cr ratios among dogs and before and after surgery were analyzed. Urinary 11-dTXB2-to-Cr ratios did not differ between nonsurgical control dogs and surgical control dogs before or after surgery. Urinary 11-dTXB2-to-Cr ratios were significantly higher in GDV dogs at the time of hospital admission and 1 hour after surgery, compared with those of nonsurgical control dogs. Postoperative urine samples from GDV dogs had significantly higher 11-dTXB2-to-Cr ratios than postoperative urine samples from surgical control dogs. Median urinary 11-dTXB2-to-Cr ratios increased significantly in GDV dogs that developed postoperative complications. Urinary 11-dTXB2 concentration is increased in GDV dogs at the time of hospital admission and after surgical derotation of the stomach, compared with that of healthy dogs. An increased urinary 11-dTXB2-to-Cr ratio following surgery is associated with an increased incidence of postoperative complications in dogs with GDV.
Early onset intellectual disability in chromosome 22q11.2 deletion syndrome.
Cascella, Marco; Muzio, Maria Rosaria
2015-01-01
Chromosome 22q11.2 deletion syndrome, or DiGeorge syndrome, or velocardiofacial syndrome, is one of the most common multiple anomaly syndromes in humans. This syndrome is commonly caused by a microdelection from chromosome 22 at band q11.2. Although this genetic disorder may reflect several clinical abnormalities and different degrees of organ commitment, the clinical features that have driven the greatest amount of attention are behavioral and developmental features, because individuals with 22q11.2 deletion syndrome have a 30-fold risk of developing schizophrenia. There are differing opinions about the cognitive development, and commonly a cognitive decline rather than an early onset intellectual disability has been observed. We report a case of 22q11.2 deletion syndrome with both early assessment of mild intellectual disabilities and tetralogy of Fallot as the only physic manifestation. Copyright © 2015 Sociedad Chilena de Pediatría. Publicado por Elsevier España, S.L.U. All rights reserved.
DEFF Research Database (Denmark)
Jensen, Jens Kristian Jehrbo
Dette kompendium behandler træ- og stålkonstruktioners holdbarhed i marint miljø. Materialerne bliver udsat for kraftige påvirkninget· i form af bølgeslag, strø ninger, slid, nedbrydning og korrosion. Relevante mekanismer og beskyttelsessysleaer behandles . J~ftet tænkes anvendt ved undervisninge...... , spec ielt på anlægssektorens 6. semester, men andre interesserede er velkomne til at benytte det. Renskrivningen er foretaget af Tove Jensen, og Ingrid Christensen og Poul Skørbæk Sørensen har udført tegnearbejdet. Tak for veludført arbejde! Jens Kr . Jehcbo Jensen...
Shanmugaraju, Sankarasekaran; McAdams, Deirdre; Pancotti, Francesca; Hawes, Chris S; Veale, Emma B; Kitchen, Jonathan A; Gunnlaugsson, Thorfinnur
2017-09-13
We report here a novel one-pot synthetic strategy for the synthesis of a family of N-alkyl-1,8-naphthalimide based Tröger's bases via a nucleophilic substitution reaction of a common 'precursor' (or a 'synthon') N-aryl-1,8-naphthalimide Tröger's base heated at 80 °C in neat aliphatic primary amine, in overall yield of 65-96%. This methodology provides an efficient and one-step facile route to design 1,8-naphthalimide derived Tröger's base structures in analytically pure form without the use of column chromatography purification, that can be used in medicinal chemistry and as supramolecular scaffolds. We also report the formation of the corresponding anhydride, and the crystallographic analysis of two of the resulting products, that of the N-phenyl-4-amino-1,8-naphthalimide and the anhydride derived Tröger's bases.
Indian Academy of Sciences (India)
Home; Journals; Pramana – Journal of Physics; Volume 67; Issue 5. Puzzles in physics. Hsiang-Nan Li ... Author Affiliations. Hsiang-Nan Li1 2. Institute of Physics, Academia Sinica, Taipei, Taiwan 115, Republic of China; Department of Physics, National Cheng-Kung University, Tainan, Taiwan 701, Republic of China ...
2011-04-06
... Zhong Guan Cun Nan Street, Haidian District, Beijing 100039, People's Republic of China and No 9A Dongtucheng Road, Heping Street, Chaoyang District, Beijing, People's Republic of China; Order Making Order.... 2 Zhong Guan Cun Nan Street, Haidian District, Beijing 100039, People's Republic of China, and No 9A...
International Nuclear Information System (INIS)
Fujita, Shoichi; Shin, Eisei; Nakamura, Tsutomu; Kurahashi, Hiroki; Mori, Takesada; Takai, Shin-ichiro; Nishisho, Isamu; Kaneda, Yasufumi; Tanaka, Kiyoji.
1993-01-01
Radiation-reduced hybrids for mapping of DNA markers in the pericentromeric region of chromosome 10 were developed. A Chinese hamster/human somatic cell hybrid (762-8A) carrying chromosomes 10 and Y as the only human material were exposed to 40,000 rads of irradiation and then rescued by fusion with non-irradiated recipient Chinese hamster cells (GM459). Southern hybridization analyses revealed that 10 of 128 HAT-resistant clones contained human chromosomal fragments corresponding to at least one marker locus between FNRB (10p11.2) and RBP3 (10q11.2). These hybrids were then used to map microdissection clones previously isolated and roughly mapped to this chromosomal region by fluorescence in situ hybridization (FISH). Two of the six microclones studies could be mapped to the proximity of the D10S102 locus. These radiation hybrids are useful for the construction of refined genetic maps of the pericentromeric region of chromosome 10. (author) 50 refs
Sicilia-Aguilar, Aurora; Kim, Jinyoung Serena; Sobolev, Andrej; Getman, Konstantin; Henning, Thomas; Fang, Min
2013-11-01
Aims: We present a study of accretion and protoplanetary disks around M-type stars in the 4 Myr-old cluster Tr 37. With a well-studied solar-type population, Tr 37 is a benchmark for disk evolution. Methods: We used low-resolution spectroscopy to identify and classify 141 members (78 new ones) and 64 probable members, mostly M-type stars. Hα emission provides information about accretion. Optical, 2MASS, Spitzer, and WISE data are used to trace the spectral energy distributions (SEDs) and search for disks. We construct radiative transfer models to explore the structures of full-disks, pre-transition, transition, and dust-depleted disks. Results: Including the new members and the known solar-type stars, we confirm that a substantial fraction (~2/5) of disks show signs of evolution, either as radial dust evolution (transition/pre-transition disks) or as a more global evolution (with low small-dust masses, dust settling, and weak/absent accretion signatures). Accretion is strongly dependent on the SED type. About half of the transition objects are consistent with no accretion, and dust-depleted disks have weak (or undetectable) accretion signatures, especially among M-type stars. Conclusions: The analysis of accretion and disk structure suggests a parallel evolution of dust and gas. We find several distinct classes of evolved disks, based on SED type and accretion status, pointing to different disk dispersal mechanisms and probably different evolutionary paths. Dust depletion and opening of inner holes appear to be independent processes: most transition disks are not dust-depleted, and most dust-depleted disks do not require inner holes. The differences in disk structure between M-type and solar-type stars in Tr 37 (4 Myr old) are not as remarkable as in the young, sparse, Coronet cluster (1-2 Myr old), suggesting that other factors, like the environment/interactions in each cluster, are likely to play an important role in the disk evolution and dispersal. Finally, we
Estructura trófica de los copépodos pelágicos en el Océano Pacifico Oriental Tropical
López Ibarra, Gladis Angélica
2008-01-01
Gran parte de la productividad secundaria marina es aportada por los copépodos, estos destacan dentro del zooplancton marino por su diversidad y abundancia, puede llegar a constituir un 80 % de la biomasa zooplanctonica. Probablemente el principal papel ecológico de esta comunidad es la transferencia de energía entre los niveles tróficos primarios y los sucesivos en las redes tróficas. En este estudio se analizó la estructura trófica de la comunidad de copépodos pelágicos en el Océano Pacifi...
Process Optimization of P(VDF-TrFE)-BaTiO3 Nanocomposites for Storage Capacitor Applications
Almadhoun, Mahmoud N.
2011-07-11
Increasing demands for efficient energy storage in microelectronics has pushed the scientific community towards finding suitable materials that can effectively deliver high pulse power in miniaturized systems. Polymer-ceramic composites are considered to be one possible solution towards the fabrication of high energy density capacitors, whether as embedded capacitors or gate insulators in organic field effect transistors (OFETs). Selecting high permittivity ceramics mixed with polymers with high breakdown field strengths would be the wisest approach towards enhancing energy storage. As such, novel ferroelectric polymers such as P(VDF-TrFE-CTFE) are being developed and researched, all displaying record dielectric values (K > 50) as promising candidates for high energy density composite capacitors (> 25 J/cm3). However, much work is still needed to understand the interaction mechanisms between the phases. We aim to seek an understanding of the processing challenges, especially in terms of fabricating thin film ferroelectric polymers and their application in nanocomposite capacitors while effectively maintaining optimized performance when embedded in flexible electronics. A process for synthesizing high performance P(VDF-TrFE) thin films is developed realizing the importance of controlling several process parameters to achieve high quality devices. Electrical and physicochemical characterization demonstrate how the performance of the polymer films improves with prolonged annealing periods by allowing sufficient time for solvent evaporation, crystallization and preferential-orientation of the crystallites. The polymer P(VDF-TrFE) is then used as a host material with barium titanate (BTO) nanoparticles below 100 nm (K = 150) as a ceramic filler in nanocomposite films. Facile surface modification by hydroxylation proved to be essential in the performance of the devices in terms of leakage current. A decrease of approximately 2 orders of magnitude in current leakage is
Doping-Induced Isotopic Mg11B2 Bulk Superconductor for Fusion Application
Directory of Open Access Journals (Sweden)
Qi Cai
2017-03-01
Full Text Available Superconducting wires are widely used for fabricating magnetic coils in fusion reactors. Superconducting magnet system represents a key determinant of the thermal efficiency and the construction/operating costs of such a reactor. In consideration of the stability of 11B against fast neutron irradiation and its lower induced radioactivation properties, MgB2 superconductor with 11B serving as the boron source is an alternative candidate for use in fusion reactors with a severe high neutron flux environment. In the present work, the glycine-doped Mg11B2 bulk superconductor was synthesized from isotopic 11B powder to enhance the high field properties. The critical current density was enhanced (103 A·cm−2 at 20 K and 5 T over the entire field in contrast with the sample prepared from natural boron.
Cultural distance between parents' and children's creativity: A within-country approach in Taiwan.
Chang, Jen-Ho; Su, Jenny C; Chen, Hsueh-Chih
2015-07-01
The present study adopted a within-country approach to investigate the relation of cultural distance to general creativity and math creativity in Taiwan. First, we conducted a pilot study of 201 young adolescents with parents from one of the 3 largest subethnic groups in Taiwan, namely Min-nan Taiwanese, Ha-kka Taiwanese, and Outside-Province Taiwanese. The results revealed that young Taiwanese adolescents perceived the cultural distance between Min-nan Taiwanese and Outside-Province Taiwanese as larger than the cultural distance between the other subethnic groups. The main study revealed that 610 young adolescents from large cultural distance families (i.e., those comprising 1 Min-nan Taiwanese parent and 1 Outside-Province Taiwanese parent) outperformed those from small cultural distance families (i.e., those comprising 2 Min-nan Taiwanese parents, and those comprising 1 Min-nan Taiwanese parent and 1 Ha-kka Taiwanese parent) on both general creativity and math creativity. This pattern remained even after controlling for family socioeconomic status, parents' education level, and adolescents' school mathematical performance. Implications and limitations are discussed. (c) 2015 APA, all rights reserved).
Recursos disponibles para la protección de mujeres migrantes en tránsito por Tamaulipas
Directory of Open Access Journals (Sweden)
Rocío CÁRDENAS-RODRÍGUEZ
2014-01-01
Full Text Available La labor del gobierno mexicano en materia de política migratoria es una estrategia para administrar el flujo de migrantes en tránsito rumbo a Estados Unidos, no para salvaguardar su integridad y derechos, menos aún está diseñada para proteger a las mujeres. En esa medida, el interés de este artículo es hacer evidentes los escasos recursos de protección disponibles para migrantes y la ausencia de perspectiva de género en los recursos de apoyo para mujeres en tránsito por México. A través de entrevistas a autoridades y organismos sociales en la frontera de Tamaulipas y con base en el enfoque del modelo ecológico, se evaluaron los recursos de la política pública mexicana como elementos amortiguadores para los migrantes, frente a riesgos y elementos de vulnerabilidad de la mujer en tránsito.
Measurement of brain pH using 11CO2 and positron emission tomography
International Nuclear Information System (INIS)
Buxton, R.B.; Wechsler, L.R.; Alpert, N.M.; Ackerman, R.H.; Elmaleh, D.R.; Correia, J.A.
1984-01-01
We have examined the feasibility of measuring local brain pH in vivo with 11 CO 2 and positron emission tomography. In particular, we have addressed two objections that have been raised against this method: the assumed need to estimate local tissue PCO 2 and the rapid fixation of 11 C in tissue. From a reexamination of the basic theory, we argue that after administration of 11 CO 2 the time-dependent distribution of 11 C between tissue and blood is independent of the distribution of CO 2 already in the body, making it unnecessary to estimate local tissue PCO 2 . Assuming that the blood--brain barrier is impermeable to bicarbonate ions, there will be equal partial pressures of 11 CO 2 in blood and tissue at equilibrium. To overcome the problem of fixation in the tissue we have developed a kinetic model of the time-dependent distribution of 11 C that accounts for regional variations in blood flow, CO 2 extraction, pH, and rate of fixation. The values of the model parameters can be estimated from sequential measurements of tissue activity concentration during administration of 11 CO 2 . Tissue pH can then be calculated from one of the parameter values, a measurement of arterial pH, and known constants. Numerical calculations based on the kinetic model with assumed values of the parameters were used to optimize the experimental design. The calculations show that problems with fixation are much less severe with continuous infusion of activity than with bolus administration. During infusion the tissue curve depends strongly on tissue pH but only weakly on the rate of fixation
Zandieh, Shahin; Bernt, Reinhard; Knoll, Peter; Wenzel, Thomas; Hittmair, Karl; Haller, Joerg; Hergan, Klaus; Mirzaei, Siroos
2016-01-01
Abstract Many people exposed to torture later suffer from torture-related post-traumatic stress disorder (TR-PTSD). The aim of this study was to analyze the morphologic and functional brain changes in patients with TR-PTSD using magnetic resonance imaging (MRI) and positron emission tomography (PET). This study evaluated 19 subjects. Thirteen subcortical brain structures were evaluated using FSL software. On the T1-weighted images, normalized brain volumes were measured using SIENAX software. The study compared the volume of the brain and 13 subcortical structures in 9 patients suffering from TR-PTSD after torture and 10 healthy volunteers (HV). Diffusion-weighted imaging (DWI) was performed in the transverse plane. In addition, the 18F-FDG PET data were evaluated to identify the activity of the elected regions. The mean left hippocampal volume for the TR-PTSD group was significantly lower than in the HV group (post hoc test (Bonferroni) P PTSD and the HV group (post hoc test (Bonferroni) P PTSD group showed low significant expansion of the ventricles in contrast to the HV group (post hoc test (Bonferroni) P PTSD and HV group (post hoc test (Bonferroni) P PTSD, in the temporal lobe in 1 of the 9 patients, and in the caudate nucleus in 5 of the 9 patients. In 2 cases, additional hypometabolism was observed in the posterior cingulate cortex and in the parietal and frontal lobes. The findings from this study show that TR-PTSD might have a deleterious influence on a set of specific brain structures. This study also demonstrated that PET combined with MRI is sensitive in detecting possible metabolic and structural brain changes in TR-PTSD. PMID:27082610
Electrochemical investigation of 2,2-dinitroethene-1,1-diamine (FOX-7) in aqueous media
Czech Academy of Sciences Publication Activity Database
Šimková, Ludmila; Klíma, Jiří; Sazama, Petr; Ludvík, Jiří
2011-01-01
Roč. 15, č. 10 (2011), s. 2133-2139 ISSN 1432-8488 R&D Projects: GA MŠk ME09002 Institutional research plan: CEZ:AV0Z40400503 Keywords : 2,2-dinitroethene-11-diamine * FOX -7 * reduction Subject RIV: CG - Electrochemistry Impact factor: 2.131, year: 2011
Oracle Data Guard 11gR2 administration beginner's guide
Baransel, Emre
2013-01-01
Using real-world examples and hands-on tasks, Oracle Data Guard 11gR2 Administration Beginner's Guide will give you a solid foundation in Oracle Data Guard. It has been designed to teach you everything you need to know to successfully create and operate Data Guard environments with maximum flexibility, compatibility, and effectiveness.If you are an Oracle database administrator who wants to configure and administer Data Guard configurations, then ""Oracle Data Guard 11gR2 Administration Beginner's Guide"" is for you. With a basic understanding of Oracle database administration, you'll be able
Attention Deficit Hyperactivity Disorder Symptoms and Psychosis in 22q11.2 Deletion Syndrome.
Niarchou, Maria; Calkins, Monica E; Moore, Tyler M; Tang, Sunny X; McDonald-McGinn, Donna M; Zackai, Elaine H; Emanuel, Beverly S; Gur, Ruben C; Gur, Raquel E
2017-10-10
22q11.2 Deletion Syndrome (22q11.2DS) is associated with increased risk for schizophrenia in adulthood while Attention Deficit Hyperactivity Disorder (ADHD) is the most prevalent diagnosis in childhood. Inattention symptoms are pronounced in 22q11.2DS and given that attentional impairment is a core feature of schizophrenia, inattention symptoms may reflect underlying ADHD, psychosis, or both. We investigate whether inattention is associated with psychosis in 22q11.2DS and in other groups at risk for psychosis but without the deletion (ND) (idiopathic clinical risk and first degree family members of individuals with schizophrenia). One hundred thirty-seven individuals with 22q11.2DS (mean age: 14.0), 84 ND individuals with subthreshold psychosis (mean age: 16.9) and 31 ND individuals with family history of psychosis (mean age: 17.0) were included in the study. Psychopathology was assessed using research diagnostic assessments. ADHD total symptoms were associated with overall levels of subthreshold psychosis symptoms in 22q11.2DS (β = .8, P = .04). Inattention symptoms were specifically associated with positive (β = .5, P = .004), negative (β = .5, P = .03), and disorganized (β = .5, P hyperactivity-impulsivity symptoms were associated with disorganized symptoms (β = .5, P = .01). The prevalence of ADHD inattention symptoms was higher in 22q11.2DS with subthreshold psychosis compared to ND individuals with subthreshold psychosis (P < .001), even when adjusting for cognitive impairment and overall psychopathology. The pattern was similar when comparing individuals with 22q11.2DS and ND individuals with family history of psychosis. This is the first study to examine the associations between ADHD symptoms and psychosis in 22q11.2DS. Our findings support a potentially important role of ADHD inattention symptoms in psychosis in 22q11.2DS. © The Author 2017. Published by Oxford University Press on behalf of the Maryland Psychiatric Research Center. All rights
Trisomy 2q11.2-->q21.1 resulting from an unbalanced insertion in two generations.
Glass, I A; Stormer, P; Oei, P T; Hacking, E; Cotter, P D
1998-01-01
In this communication, we describe two cases of proximal 2q trisomy (2q11.2--> q21.1) resulting from an interchromosomal insertion. The chromosomal origin of the insertion was confirmed by fluorescence in situ hybridisation. An unbalanced karyotype, 46,XX,der(8) ,ins(8;2) (p21.3; q21.1q11.2), was found in the proband and her mother, who both have mild mental retardation, short stature, dysmorphic features, insulin dependent diabetes mellitus, and a psychotic illness. This family is a rare example of direct transmission of a partial autosomal trisomy. Images PMID:9598728
Maung, K; Ohnmar, H; Than, W; Ramli, M; Najwa Hanim, M R; Ali Sabri, R; Ahmad Zafri, A B
The purposes of this study were to investigate the documentation of the DSM-IV-TR- Criteria A in diagnoses of schizophrenia and to identify the symptoms associated with over diagnosis of schizophrenia. This study involved a retrospective review and analysis of data from case notes. Data of 107 newly diagnosed patients with schizophrenia were keyed in and analyzed using SPSS v 19. The cases were then evaluated for the use of the DSM-IV-TR- Criteria A. Over diagnosis was noted in 37.39% of the patients. Disorganised behaviour (12.5%), affective flattening (12.5%), hallucination (16%) and non-bizarre delusion (18.3%) significantly contributed to the over-diagnosis of schizophrenia. Symptoms such as non-bizarre delusion and hallucination were the most commonly used in over-diagnosing schizophrenia and were statistically significant with p ≤0.05. There was a significant lack of DSM-IV-TR Criteria A among the data documented to diagnose schizophrenia and non-bizarre delusion and hallucination were the most commonly used in over-diagnosing schizophrenia. This key problem needs to be addressed. The reliability of a diagnosis is indispensable and achievable with the proper clinical application of DSM-IV-TR Criteria A. The DSM-IV-TR Criteria have been perceived to be useful and reliable and is most widely used throughout the world.
Children with Chromosome 22q11.2 Deletion Syndrome Exhibit Impaired Spatial Working Memory
Wong, Ling M.; Riggins, Tracy; Harvey, Danielle; Cabaral, Margarita; Simon, Tony J.
2014-01-01
Individuals with chromosome 22q11.2 deletion syndrome (22q11.2DS) have been shown to have impairments in processing spatiotemporal information. The authors examined whether children with 22q11.2DS exhibit impairments in spatial working memory performance due to these weaknesses, even when controlling for maintenance of attention. Children with…
Genetic interaction between the ero1-1 and leu2 mutations in Saccharomyces cerevisiae
DEFF Research Database (Denmark)
López-Mirabal, H Reynaldo; Winther, Jakob R; Kielland-Brandt, Morten C
2007-01-01
of the ero1-1 mutation were carried out in a leu2 mutant. The ero1-1 leu2 strain does not grow in standard synthetic complete medium at 30 degrees C, a defect that can be remedied by increasing the L-leucine concentration in the medium or by transforming the ero1-1 leu2 strain with the LEU2 wild-type allele...
37 CFR 11.2 - Director of the Office of Enrollment and Discipline.
2010-07-01
... 37 Patents, Trademarks, and Copyrights 1 2010-07-01 2010-07-01 false Director of the Office of Enrollment and Discipline. 11.2 Section 11.2 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE REPRESENTATION OF OTHERS BEFORE THE UNITED STATES PATENT AND TRADEMARK OFFICE General Provisions General...
X Congreso Panamericano de Ingeniería de Tránsito y Transporte
Luis Antonio Lindau; Orlando Strambi
2010-01-01
No texto o autor apresenta os temas que foram apresentados e discutidos no X PANAM, Congreso Panamericano de Ingeniería de Tránsito y Transporte, realizado em setembro de 1998 em Santander, na Espanha.
Space-charge-mediated anomalous ferroelectric switching in P(VDF-TrEE) polymer films
Hu, Weijin; Wang, Zhihong; Du, Yuanmin; Zhang, Xixiang; Wu, Tao
2014-01-01
We report on the switching dynamics of P(VDF-TrEE) copolymer devices and the realization of additional substable ferroelectric states via modulation of the coupling between polarizations and space charges. The space-charge-limited current
Radiosynthesis and ex vivo evaluation of (R)-(-)-2-chloro-N-[1-11C-propyl]n-propylnorapomorphine
International Nuclear Information System (INIS)
Palner, Mikael; McCormick, Patrick; Gillings, Nic; Begtrup, Mikael; Wilson, Alan A.; Knudsen, Gitte M.
2010-01-01
Introduction: Several dopamine D 2 agonist radioligands have been used with positron emission tomography (PET), including [ 11 C-]-(-)-MNPA, [ 11 C-]-(-)-NPA and [ 11 C]-(+)-PHNO. These radioligands are considered particularly powerful for detection of endogenous dopamine release, but they either provide PET brain images with limited contrast or have affinity for both D 2 and D 3 receptors. We here present the carbon-11 radiolabeling and ex vivo evaluation of 2-Cl-(-)-NPA, a novel PET-tracer candidate with high in vitro D 2 /D 3 selectivity. Methods: 2-Cl-[ 11 C]-(-)-NPA and [ 11 C]-(-)-NPA were synthesized by a two step N-acylation-reduction process using [ 11 C]-propionyl chloride. Awake rats were injected with either tracer, via the tail vein. The rats were decapitated at various times, the brains were removed and quickly dissected, and plasma metabolites were measured. Radioligand specificity, and P-glycoprotein involvement in brain uptake, was also assessed. Results: 2-Cl-[ 11 C]-(-)-NPA and [ 11 C]-(-)-NPA were produced in high specific activity and purity. 2-Cl-[ 11 C]-(-)-NPA accumulated slower in the striatum than [ 11 C]-(-)-NPA, reaching maximum concentrations after 30 min. The maximal striatal uptake of 2-Cl-[ 11 C]-(-)-NPA (standard uptake value 0.72±0.24) was approximately half that of [ 11 C]-(-)-NPA (standard uptake value 1.37±0.18). Nonspecific uptake was similar for the two compounds. 2-Cl-[ 11 C]-(-)-NPA was metabolized quickly, leaving only 17% of the parent compound in the plasma after 30 min. The specific binding of 2-Cl-[ 11 C]-(-)-NPA was completely blocked and inhibition of P-glycoprotein did not alter the brain uptake. Conclusion: Ex vivo experiments showed, despite a favorable D 2 /D 3 selectivity, that 2-Cl-[ 11 C]-(-)-NPA is inferior to [ 11 C]-(-)-NPA as a PET tracer in rat, because of slower brain uptake and lower specific to nonspecific binding ratio.
Energy Technology Data Exchange (ETDEWEB)
Huang Yiyun E-mail: hh285@columbia.edu; Narendran, Raj; Bae, Sung-A; Erritzoe, David; Guo Ningning; Zhu Zhihong; Hwang, D.-R.; Laruelle, Marc
2004-08-01
A new serotonin transporter (SERT) ligand, [{sup 11}C]2-[2-(dimethylaminomethylphenylthio)]-5-fluorophenylamine (10, [{sup 11}C]AFA), was synthesized and evaluated as a candidate PET radioligand in pharmacological and pharmacokinetic studies. As a PET radioligand, AFA (8) can be labeled with either C-11 or F-18. In vitro, AFA displayed high affinity for SERT (K{sub i} 1.46{+-}0.15 nM) and lower affinity for norepinephrine transporter (NET, K{sub i} 141.7{+-}47.4 nM) or dopamine transporter (DAT, K{sub i} >10,000 nM). [{sup 11}C]AFA (10) was prepared from its monomethylamino precursor 9 by reaction with high specific activity [{sup 11}C]methyl iodide. Radiochemical yield was 43{+-}20% based on [{sup 11}C]methyl iodide at end of bombardment (EOB, n = 10) and specific activity was 2,129 {+-} 1,369 Ci/mmol at end of synthesis (EOS, n = 10). Biodistribution studies in rats indicated that [{sup 11}C]AFA accumulated in brain regions known to contain high concentrations of SERT. Binding in SERT-rich brain regions was reduced significantly by pretreatment with either the cold compound 8 or with the selective serotonin reuptake inhibitor (SSRI) citalopram, but not by the selective norepinephrine reuptake inhibitor nisoxetine, thus underlining its in vivo binding selectivity and specificity for SERT. Imaging experiments in baboons demonstrated that the uptake pattern of [{sup 11}C]AFA in the baboon brain is consistent with the known distribution of SERT, with highest activity levels in the midbrain and thalamus, followed by striatum, hippocampus, and cortical regions. Activity levels in the baboon brain peaked at 15-40 min after radioligand injection, indicating a fast uptake kinetics for [{sup 11}C]AFA. Pretreatment of the baboon with citalopram (4 mg/kg) significantly reduced the specific binding of [{sup 11}C]AFA in all SERT-containing brain regions. Kinetic analysis revealed that the regional equilibrium specific to non-specific partition coefficients (V{sub 3}&apos
Mechanochemical synthesis of 1-stanna-2,3-dicarba-closo-dodecaborane SnB9C2H11
International Nuclear Information System (INIS)
Volkov, V.V.; Myakishev, K.G.; Solomatina, L.Ya.
1990-01-01
The possibility of synthesis of 1-stanna-2, 3-dicarba-dodecaborane (2), SnB 9 C 2 H 11 by the mechanical activation of solid mixtures of CsB 9 C 2 H 12 , NaH and SnCl 2 has been studied. These solid phase mechano-chemical reactions were performed in vacuum vibration mills without any liquid solvents at room temperature. Crystalline SnB 9 C 2 H 11 was produced by sublimation in vacuum at 140 deg C. Yioeld of the sublimate was 3-6%
Potencial discriminatório de três testadores em "topcrosses" de milho
Directory of Open Access Journals (Sweden)
Duarte Iran de Azevedo
2003-01-01
Full Text Available O objetivo deste trabalho foi determinar o potencial de três testadores endogâmicos elites a fim de avaliar e classificar 15 materiais genéticos para a síntese de híbridos. Quarenta e cinco híbridos mais quatro testemunhas foram avaliados em cinco ambientes, no ano agrícola 2000/2001, utilizando delineamento em blocos ao acaso, com três repetições. Foram avaliados os caracteres peso de grãos corrigido, altura de planta e altura de espiga. As estimativas de capacidade geral e específica de combinação foram obtidas pelo modelo de Griffing, adaptado por Vencovsky e Barriga, para análise em delineamento genético fatorial. O rendimento médio obtido entre os cinco ambientes variou de 8,97 t ha-1 a 12,21 t ha-1. Vinte e sete tratamentos superaram a média geral absoluta da melhor testemunha. A análise de variância conjunta revelou efeitos significativos de ambientes, capacidade geral de combinação dos parentais e testadores, capacidade específica de combinação e das interações ambiente x capacidade geral de combinação dos parentais e testadores. Os testadores promoveram uma classificação diferenciada para a base genética avaliada, com destaque para os cruzamentos entre parentais HS1, HS2, HS5 e HT4 com o testador LF e parentais L10 e HS5 com o testador L05.
Paulo Sergio Emerich; Patricia Almeida Prebianchi; Luciene Lage da Motta; Elton Almeida Lucas; Leonardo Mello Ferreira
2011-01-01
O Edema Agudo Hemorrágico da Infância é uma vasculite leucocitoclástica pouco frequente, que ocorre, quase exclusivamente, em crianças entre 4 meses e 2 anos de idade. Caracteriza-se, clinicamente, pela tríade febre, lesões purpúricas na face, pavilhões auriculares e extremidades e edema. Embora os achados cutâneos sejam dramáticos e de surgimento rápido, o prognóstico é favorável, com resolução espontânea dentro de 1 a 3 semanas. Descrevem-se três casos cujos achados clínicos e histopatológi...
García-López, C; Narbona, J
2014-02-01
Observational scales are useful to estimate the severity of symptoms in PDD as well as to monitor their evolution. a) To analyze the concordance between diagnoses based on the Autism Spectrum Inventory (Inventario del Espectro Autista, IDEA)) and the Childhood Autism Rating Scale (CARS), compared to DSM-IV-TR criteria, in subjects with a suspicion of pervasive developmental disorders (PDD), and b) to study the discrimination power of both scales to differentiate between a clinical diagnosis situated in the autism spectrum. Fifty-six children and adolescents, between 2 and 20 years-old, who attended our Neuropediatric Unit due to suspicion of PDD. Independently, two clinicians evaluated the presence of PDD symptoms; one of them according to DSM-IV-TR criteria and the other one based on the application of IDEA and CARS. The concordance of IDEA and CARS when compared to DSM-IV-TR classification was 73 and 82%, respectively, with a sensitivity of 1 and 0,83 and a specificity of 0,61 and 0,82, respectively. Both scales correctly discriminated between autistic disorder and other clinical diagnoses. Both IDEA and CARS are useful instruments to detect and monitor autism symptoms in the context of routine clinical practice. Copyright © 2012 Asociación Española de Pediatría. Published by Elsevier Espana. All rights reserved.
Directory of Open Access Journals (Sweden)
Érika Rossetto da Cunha
2011-12-01
Full Text Available A degermação cirúrgica das mãos e dos antebraços é um procedimento que integra as atividades de paramentação cirúrgica como uma medida de prevenção de infecção do sítio cirúrgico. Com o advento dos princípios antissépticos degermantes, a necessidade do uso de escovas para a degermação cirúrgica tem sido questionada e recomendado o abandono deste uso devido às lesões provocadas na pele. Com a finalidade de fundamentar a eficácia da técnica da degermação cirúrgica sem o uso de escovas ou esponjas, o objetivo deste estudo foi avaliar três métodos para degermação cirúrgica utilizando a formulação degermante de gluconato de clorexidina - GCH 2%: com escova, com esponja e sem artefato. Foram avaliados 29 profissionais da saúde, utilizando o método de caldo de luva para coleta de micro-organismos antes e depois de cada método testado. As análises estatísticas comprovaram não haver diferenças estatísticas significantes na redução microbiana entre os três métodos analisados (p=0,148, o que teoricamente descarta a necessidade da continuidade do uso de escovas e esponjas para a realização da degermação das mãos.
Directory of Open Access Journals (Sweden)
Érika Rossetto da Cunha
Full Text Available A degermação cirúrgica das mãos e dos antebraços é um procedimento que integra as atividades de paramentação cirúrgica como uma medida de prevenção de infecção do sítio cirúrgico. Com o advento dos princípios antissépticos degermantes, a necessidade do uso de escovas para a degermação cirúrgica tem sido questionada e recomendado o abandono deste uso devido às lesões provocadas na pele. Com a finalidade de fundamentar a eficácia da técnica da degermação cirúrgica sem o uso de escovas ou esponjas, o objetivo deste estudo foi avaliar três métodos para degermação cirúrgica utilizando a formulação degermante de gluconato de clorexidina - GCH 2%: com escova, com esponja e sem artefato. Foram avaliados 29 profissionais da saúde, utilizando o método de caldo de luva para coleta de micro-organismos antes e depois de cada método testado. As análises estatísticas comprovaram não haver diferenças estatísticas significantes na redução microbiana entre os três métodos analisados (p=0,148, o que teoricamente descarta a necessidade da continuidade do uso de escovas e esponjas para a realização da degermação das mãos.
Riesgo suicida según la tríada cognitiva negativa, ideación, desesperanza y depresión
Directory of Open Access Journals (Sweden)
Ronald Alberto Toro-Tobar
2016-01-01
Full Text Available Objetivo: establecer la relación entre ideación suicida, desesperanza, tríada cognitiva negativa y depresión, como evidencia del mo- delo cognitivo del riesgo suicida. Método: estudio empírico-analítico con diseño descriptivo, correlacional y comparativo. Las variables fueron medidas con los inventarios BDI-II, PANSI e ITC y la escala BHS. La muestra final estuvo constituida por 90 personas de ambos sexos, con una media de edad de 24,2 años (DT = 8,65 años pertenecientes a diversos niveles socioeconómicos, con estudios universi- tarios, principalmente. Resultados: se encontraron correlaciones estadísticamente significativas entre ideación suicida, desesperanza, depresión y la tríada cognitiva negativa. Las diferencias fueron significativas entre los grupos depresivos y no depresivos, con grandes efectos para las tres variables cognitivas. Interpretación y conclusiones: estos resultados constituyen nueva evidencia del modelo cognitivo planteado acerca de la relación entre las variables depresión, tríada cognitiva negativa, ideación suicida y desesperanza, tal como se ha propuesto en distintas revisiones sobre cognición negativa y suicidio. Se analizaron las limitaciones del estudio en cuanto el reducido tamaño muestral y las diferencias entre sexos para depresión ante estresores específicos, y las variaciones por grupos de edades en el riesgo suicida de los jóvenes.
International Nuclear Information System (INIS)
2015-01-01
From July 7-11, 2014, the NRC led a team of inspectors representing regulators from France, the United Kingdom, and the United States in performing the first Multinational Design Evaluation Program (MDEP) multinational inspection at Valinox Nuclear in Montbard, France. Valinox Nuclear's primary product line is steam generator tubes for the nuclear industry. The purpose of the inspection was to assess Valinox's compliance with the quality assurance/quality control (QA/QM) criteria described in the Multinational Design Evaluation Program (MDEP) Vendor Inspection Cooperation Working Group (VICWG) Technical Report, TR-VICWG-03, 'Common QA/QM Criteria for Multinational Vendor Inspection', Revision 1, dated January 20, 2014, and MDEP Protocol, VICWG-01, 'Witnessed, Joint, and Multinational Vendor Inspection Protocol', Revision 2, dated March 20, 2014, respectively. The inspection also offered the inspectors an opportunity to pilot the VICWG draft common position document to gain valuable insights into the effectiveness of application of the common QA/QM criteria to vendor inspections performed by a multinational inspection team. During this inspection, the inspection team evaluated implementation of Valinox's quality assurance (QA) program with respect to 15 specific criteria: 1. Quality management system; 2. Grading; 3. Documentation of the quality management system; 4. Control of documents and records; 5. Responsibility and Leadership; 6. Human resources; 7. Process Implementation; 8. Control of planning and implementation changes; 9. Purchasing (including aspects of CSFI); 10. Control of implementation including Control of special processes; 11. Monitoring and measurement of product and service; 12. Assessment; 13. Non-conformances; 14. Corrective and preventive actions; and 15. Safety culture. By letter dated 26 August 2014, the NRC issued a vendor inspection report to Valinox Nuclear, which documented four findings (Non
Synthesis of enantiomerically pure thiocrown ethers derived from 1,1'-binaphthalene-2,2'-diol
Stock, H. Thijs; Kellogg, Richard M.
1996-01-01
Synthetic methodology is given for the preparation of two different types of thiocrown ethers from optically pure 1,1'-binaphthalene-2,2'-diol (10). The conceptually simplest approach starts from optically pure 10 itself, which is alkylated (4 equiv of K2CO3 in DMF at 110 degrees C) with
Acute stress disorder in hospitalised victims of 26/11-terror attack on Mumbai, India.
Balasinorwala, Vanshree Patil; Shah, Nilesh
2010-11-01
The 26/11 terror attacks on Mumbai have been internationally denounced. Acute stress disorder is common in victims of terror. To find out the prevalence and to correlate acute stress disorder, 70 hospitalised victims of terror were assessed for presence of the same using DSM-IV TR criteria. Demographic data and clinical variables were also collected. Acute stress disorder was found in 30% patients. On demographic profile and severity of injury, there were some interesting observations and differences between the victims who developed acute stress disorder and those who did not; though none of the differences reached the level of statistical significance. This study documents the occurrence of acute stress disorder in the victims of 26/11 terror attack.
Lifescience Database Archive (English)
Full Text Available 70 5e-11 tr|A3C6S4|A3C6S4_ORYSJ Putative uncharacterized protein OS=Oryza... 70 5e-11 tr|B6U1W6|B6U1W6_MAIZE Angus...ent) OS=Arab... 65 2e-09 tr|Q84JM5|Q84JM5_IPONI Angustifolia OS=Ipomoea nil GN=IA
O planejamento urbano e os acidentes de trânsito: um estudo sobre o Município de Toledo - PR
Ruschel, Andressa Carolina
2017-01-01
O artigo propõe identificar como o planejamento urbano influencia nos acidentes de trânsito no Município de Toledo - PR no período de 2011 a 2015, dentro do Perímetro Urbano, partindo da problematização criada pelo alto índice de acidentes de trânsito no município. A metodologia utilizada foi através de aspectos conceituais da análise espacial e do planejamento urbano; coleta de dados primários nos Boletins de Ocorrência de Acidentes de Trânsito, em seguida tabelados e analisados conforme fun...
Fabrication of PVDF-TrFE based bilayered PbTiO{sub 3}/PVDF-TrFE films capacitor
Energy Technology Data Exchange (ETDEWEB)
Nurbaya, Z., E-mail: nurbayazainal@gmail.com [NANO-ElecTronic Centre (NET), Faculty of Electrical Engineering, Universiti Teknologi MARA, 40450 Shah Alam, Selangor (Malaysia); Razak School of Engineering and Advanced Technology, Universiti Teknologi Malaysia, 54100 Kuala Lumpur (Malaysia); Wahid, M. H.; Rozana, M. D. [Faculty of Applied Sciences, Department of Polymer, Universiti Teknologi MARA, 40450 Shah Alam, Selangor (Malaysia); Annuar, I. [UiTM Sarawak Kampus Kota Samarahan, Jalan Meranek, 94300 Sarawak (Malaysia); Alrokayan, S. A. H.; Khan, H. A. [Department of Biochemistry, College of Science, Bldg. 5, King Saud University (KSU) P.O: 2454 Riyadh 11451 (Saudi Arabia); Rusop, M., E-mail: nanouitm@gmail.com [NANO-ElecTronic Centre (NET), Faculty of Electrical Engineering, Universiti Teknologi MARA, 40450 Shah Alam, Selangor (Malaysia); NANO-Sci Tech Centre (NST), Institute of Science, Universiti Teknologi MARA, 40450 Shah Alam, Selangor (Malaysia)
2016-07-06
Development of high performance capacitor is reaching towards new generation where the ferroelectric materials take places as the active dielectric layer. The motivation of this study is to produce high capacitance device with long life cycle. This was configured by preparing bilayered films where lead titanate as an active dielectric layer and stacked with the top dielectric layer, poly(vinyledenefluoride-trifluoroethylene). Both of them are being referred that have one in common which is ferroelectric behavior. Therefore the combination of ceramic and polymer ferroelectric material could perform optimum dielectric characteristic for capacitor applications. The fabrication was done by simple sol-gel spin coating method that being varied at spinning speed property for polymer layers, whereas maintaining the ceramic layer. The characterization of PVDF-TrFE/PbTiO3 was performed according to metal-insulator-metal stacked capacitor measurement which includes structural, dielectric, and ferroelectric measurement.
Acidentes de trânsito: uma visão qualitativa no Município de Campinas, São Paulo, Brasil
Directory of Open Access Journals (Sweden)
Marcos S. Queiroz
2002-10-01
Full Text Available Este artigo focaliza, numa perspectiva interdisciplinar qualitativa, o problema de acidentes de trânsito no Município de Campinas. Ele começa analisando o processo de municipalização do transporte e trânsito no município, com base nas representações sociais de técnicos da Secretaria Municipal de Transporte. Alguns números são trazidos à tona para mostrar uma queda significativa de mortes no trânsito em Campinas nos últimos dez anos. Esses números demonstram que as políticas públicas implementadas nesse setor têm sido positivas em vários aspectos. Atenção especial é dada aos objetivos, estratégias e obstáculos encontrados pelo poder local no processo de municipalização do trânsito. O artigo conclui enfatizando que, além da municipalização, o Estado necessita implementar políticas públicas específicas consistentes, principalmente aquelas voltadas à revitalização do transporte coletivo e a programas de educação no trânsito, a fim de se poder avançar no controle do problema.
Examining the Overlap between Autism Spectrum Disorder and 22q11.2 Deletion Syndrome.
Ousley, Opal; Evans, A Nichole; Fernandez-Carriba, Samuel; Smearman, Erica L; Rockers, Kimberly; Morrier, Michael J; Evans, David W; Coleman, Karlene; Cubells, Joseph
2017-05-18
22q11.2 deletion syndrome (22q11.2DS) is a genomic disorder reported to associate with autism spectrum disorders (ASDs) in 15-50% of cases; however, others suggest that individuals with 22q11.2DS present psychiatric or behavioral features associated with ASDs, but do not meet full criteria for ASD diagnoses. Such wide variability in findings may arise in part due to methodological differences across studies. Our study sought to determine whether individuals with 22q11.2DS meet strict ASD diagnostic criteria using research-based guidelines from the Collaborative Programs of Excellence in Autism (CPEA), which required a gathering of information from three sources: the Autism Diagnostic Interview-Revised (ADI-R), the Autism Diagnostic Observational Schedule (ADOS), and a clinician's best-estimate diagnosis. Our study examined a cohort of children, adolescents, and young adults ( n = 56) with 22q11.2DS, who were ascertained irrespective of parents' behavioral or developmental concerns, and found that 17.9% ( n = 10) of the participants met CPEA criteria for an ASD diagnosis, and that a majority showed some level of social-communication impairment or the presence of repetitive behaviors. We conclude that strictly defined ASDs occur in a substantial proportion of individuals with 22q11.2DS, and recommend that all individuals with 22q11.2DS be screened for ASDs during early childhood.
Directory of Open Access Journals (Sweden)
Fabiano Inácio de Souza
2010-01-01
Full Text Available OBJETIVO: Avaliar os resultados da transposição do tríceps para a flexão do cotovelo em pacientes portadores de lesão crônica e completa do tronco superior do plexo braquial. MÉTODOS: Estudo retrospectivo, com inclusão apenas de pacientes que apresentassem bíceps grau 0 e tríceps grau 5, submetidos à transferência anterior do músculo tríceps, operados entre 1998 e 2005. Foram pesquisados o lado acometido, o sexo, o tipo de acidente, a força de flexão do cotovelo, as complicações e a satisfação do pacientes, em 11 casos. RESULTADOS: 10 pacientes eram do sexo masculino; a idade variou de 24 a 49 anos, com média de 33,7 anos. O tempo mínimo entre a lesão e o procedimento cirúrgico foi de 21 meses (variando de 21 a 74 meses. O lado esquerdo foi acometido em oito casos, enquanto o direito apenas em três. Obtiveram-se bons resultados em 10 pacientes, que adquiriram força de flexão do cotovelo grau 3 (dois casos e grau 4 (oito casos, enquanto um evoluiu desfavoravelmente, com força grau 2. Dois casos evoluíram com complicações (síndrome compartimental inicial e tensionamento insuficiente. Todos os pacientes definiram-se como satisfeitos com o procedimento. CONCLUSÃO: A transposição anterior do músculo tríceps proporcionou satisfação dos pacientes em todos os casos, exceto um, obtendo-se forças grau 4 em oito casos, grau 3 em dois casos e grau 2 em um caso.OBJETIVE: To evaluate the transposition of the triceps for elbow flexion in patients with chronic and complete injury to the upper trunk of the brachial plexus. METHODS: Retrospective study, including only patients who had biceps grade 0 and triceps grade 5, who underwent anterior transfer of the triceps muscle, operated between 1998 and 2005. The affected side, sex, type of accident, strength of elbow flexion, complications and satisfaction of patients, were studied in 11 cases. RESULTS: 10 patients were male, aged 24 to 49 years, with a mean of 33.7 years. The
Evaluation of 22q11.2 deletion in Cleft Palate patients
Prabodha, L. B. Lahiru; Dias, Dayanath Kumara; Nanayakkara, B. Ganananda; de Silva, Deepthi C.; Chandrasekharan, N. Vishvanath; Ileyperuma, Isurani
2012-01-01
Background: Cleft palate is the commonest multifactorial epigenetic disorder with a prevalence of 0.43-2.45 per 1000. The objectives of this study were to evaluate the clinical features and identify the 22q11.2 deletion in patients with cleft palate in Sri Lanka. Materials and Methods: Cleft patients attending a Teaching Hospital in Sri Lanka were recruited for this study. The relevant data were obtained from review of case notes, interviews, and examination of patients according to a standard evaluation sheet. Quantitative multiplex polymerase chain reaction (PCR) was performed to identify the 22q11.2 deletion. A gel documentation system (Bio-Doc) was used to quantify the PCR product following electrophoresis on 0.8% agarose gel. Results and Conclusion: There were 162 cleft palate patients of whom 59% were females. A total of 92 cleft palate subjects (56.2%) had other associated clinical features. Dysmorphic features (25.27%) and developmental delays (25.27%) were the commonest medical problems encountered. The cleft was limited to the soft palate in 125 patients, while in 25 patients it involved both the hard and the soft palate. There were seven subjects with bifid uvula and five subjects with submucous cleft palate. None of the patients had 22q11.2 deletion in this study population. A multicentered large population-based study is needed to confirm the results of this study and to develop guidelines on the appropriate use of 22q11.2 deletion testing, which are valid for cleft palate patients in Sri Lanka. PMID:23483617
Rare missense mutations in P2RY11 in narcolepsy with cataplexy
DEFF Research Database (Denmark)
Degn, Matilda; Dauvilliers, Yves; Dreisig, Karin
2017-01-01
these are single nucleotide polymorphisms in the P2RY11-EIF3G locus. It is unknown how these genetic variants affect narcolepsy pathogenesis and whether the effect is directly related to P2Y11 signalling or EIF3G function. Exome sequencing in 18 families with at least two affected narcolepsy with cataplexy...
Tráfego veicular e mortalidade por doenças do aparelho circulatório em homens adultos
Directory of Open Access Journals (Sweden)
Mateus Habermann
2012-02-01
Full Text Available OBJETIVO: Analisar a associação entre indicadores de exposição à poluição por tráfego veicular e mortalidade por doenças do aparelho circulatório em homens adultos. MÉTODOS: Foram analisadas informações sobre vias e volume de tráfego no ano de 2007 fornecidas pela companhia de engenharia de tráfego local. Mortalidade por doenças do aparelho circulatório no ano de 2005 entre homens > 40 anos foram obtidas do registro de mortalidade do Programa de Aprimoramento de Informações de Mortalidade do Município de São Paulo, SP. Dados socioeconômicos do Censo 2000 e informações sobre a localização dos serviços de saúde também foram coletados. A exposição foi avaliada pela densidade de vias e volume de tráfego para cada distrito administrativo. Foi calculada regressão (α = 5% entre esses indicadores de exposição e as taxas de mortalidade padronizadas, ajustando os modelos para variáveis socioeconômicas, número de serviços de saúde nos distritos e autocorrelação espacial. RESULTADOS: A correlação entre densidade de vias e volume de tráfego foi modesta (r² = 0,28. Os distritos do centro apresentaram os maiores valores de densidade de vias. O modelo de regressão espacial de densidade de vias indicou associação com mortalidade por doenças do aparelho circulatório (p = 0,017. Não se observou associação no modelo de volume de tráfego. Em ambos os modelos - vias e volume de tráfego (veículos leves/pesados - a variável socioeconômica foi estatisticamente significante. CONCLUSÕES: A associação entre mortalidade por doenças do aparelho circulatório e densidade de vias converge com a literatura e encoraja a realização de mais estudos epidemiológicos em nível individual e com métodos mais acurados de avaliação da exposição.
Core-free rolled actuators for Braille displays using P(VDF–TrFE–CFE)
International Nuclear Information System (INIS)
Levard, Thomas; Diglio, Paul J; Rahn, Christopher D; Lu, Sheng-Guo; Zhang, Q M
2012-01-01
Refreshable Braille displays require many small diameter actuators to move the pins. The electrostrictive P(VDF–TrFE–CFE) terpolymer can provide the high strain and actuation force under modest electric fields that are required for this application. In this paper, we develop core-free tubular actuators and integrate them into a 3 × 2 Braille cell. The terpolymer films are solution cast, stretched to 6 μm thick, electroded, laminated into a bilayer, rolled into a 2 mm diameter tube, bonded, and provided with top and bottom contacts. Experimental testing of 17 actuators demonstrates significant strains (up to 4%) and blocking forces (1 N) at moderate electric fields (100 MV m −1 ). A novel Braille cell is designed and fabricated using six of these actuators. (fast track communication)
A COL11A2 mutation in Labrador retrievers with mild disproportionate dwarfism.
Frischknecht, Mirjam; Niehof-Oellers, Helena; Jagannathan, Vidhya; Owczarek-Lipska, Marta; Drögemüller, Cord; Dietschi, Elisabeth; Dolf, Gaudenz; Tellhelm, Bernd; Lang, Johann; Tiira, Katriina; Lohi, Hannes; Leeb, Tosso
2013-01-01
We describe a mild form of disproportionate dwarfism in Labrador Retrievers, which is not associated with any obvious health problems such as secondary arthrosis. We designate this phenotype as skeletal dysplasia 2 (SD2). It is inherited as a monogenic autosomal recessive trait with incomplete penetrance primarily in working lines of the Labrador Retriever breed. Using 23 cases and 37 controls we mapped the causative mutation by genome-wide association and homozygosity mapping to a 4.44 Mb interval on chromosome 12. We re-sequenced the genome of one affected dog at 30x coverage and detected 92 non-synonymous variants in the critical interval. Only two of these variants, located in the lymphotoxin A (LTA) and collagen alpha-2(XI) chain gene (COL11A2), respectively, were perfectly associated with the trait. Previously described COL11A2 variants in humans or mice lead to skeletal dysplasias and/or deafness. The dog variant associated with disproportionate dwarfism, COL11A2:c.143G>C or p.R48P, probably has only a minor effect on collagen XI function, which might explain the comparatively mild phenotype seen in our study. The identification of this candidate causative mutation thus widens the known phenotypic spectrum of COL11A2 mutations. We speculate that non-pathogenic COL11A2 variants might even contribute to the heritable variation in height.
International Nuclear Information System (INIS)
Labar, D.; Vander Borght, T.
1990-01-01
In preliminary studies of cellular proliferation with [methyl- 11 C]thymidine, the labelled degradative products mask the progressive incorporation of the tracer into DNA. The authors have developed a procedure for the synthesis of [2- 11 C]thymidine to circumvent this difficulty, using a [ 11 C]urea precursor
Stevens, A; Fabra, M
2013-12-01
In May 2013 the American Psychiatric Association (APA) has released the latest and fifth edition of the diagnostic and statistical manual of mental disorders (DSM-5). Like its predecessor, the DSM-IV-TR, it will have considerable impact on the science of Psychiatry. The DSM-5 describes - actually available in English - the present medical knowledge about mental disorders. In the short run, German medical science and scientific medicolegal expertises will continue to rely on the German version of the DSM-IV-TR, however, they will be difficult to defend without bearing in mind the changes that DSM-5 brings about. This report discusses the transition from DSM-IV-TR to DSM-5 with regard to posttraumatic stress disorder (PTSD) and provides suggestions, how the criteria might be evaluated.
PWS/AS MS-MLPA Confirms Maternal Origin of 15q11.2 Microduplication
Directory of Open Access Journals (Sweden)
Angelika J. Dawson
2015-01-01
Full Text Available The proximal region of the long arm of chromosome 15q11.2-q13 is associated with various neurodevelopmental disorders, including Prader-Willi (PWS and Angelman (AS syndromes, autism, and other developmental abnormalities resulting from deletions and duplications. In addition, this region encompasses imprinted genes that cause PWS or AS, depending on the parent-of-origin. This imprinting allows for diagnosis of PWS or AS based on methylation status using methylation sensitive (MS multiplex ligation dependent probe amplification (MLPA. Maternally derived microduplications at 15q11.2-q13 have been associated with autism and other neuropsychiatric disorders. Multiple methods have been used to determine the parent-of-origin for 15q11.2-q13 microdeletions and microduplications. In the present study, a four-year-old nondysmorphic female patient with developmental delay was found to have a de novo ~5 Mb duplication within 15q11.2 by oligonucleotide genomic array. In order to determine the significance of this microduplication to the clinical phenotype, the parent-of-origin needed to be identified. The PWS/AS MS-MLPA assay is generally used to distinguish between deletion and uniparental disomy (UPD of 15q11.2-q13, resulting in either PWS or AS. However, our study shows that PWS/AS MS-MLPA can also efficiently distinguish the parental origin of duplications of 15q11.2-q13.
Poblaciones-Mercancía: Tráfico y trata de mujeres en España
García Cuesta, Sara; López Sala, Ana María; Hernández Corrochano, Elena; Mena Martínez, Luis
2011-01-01
Se trata de la primera publicación que hace la Delegación del Gobierno para la Violencia de Género a fin de ahondar en el fenómeno de la Trata de Seres Humanos con fines de explotación sexual. El estudio refleja la situación en España de las mujeres que han sido víctimas del tráfico y de la trata de seres humanos con fines de explotación sexual, trazando de manera firme la diferencia entre tráfico de personas y trata de mujeres con fines de explotación sexual.
Zandieh, Shahin; Bernt, Reinhard; Knoll, Peter; Wenzel, Thomas; Hittmair, Karl; Haller, Joerg; Hergan, Klaus; Mirzaei, Siroos
2016-04-01
Many people exposed to torture later suffer from torture-related post-traumatic stress disorder (TR-PTSD). The aim of this study was to analyze the morphologic and functional brain changes in patients with TR-PTSD using magnetic resonance imaging (MRI) and positron emission tomography (PET). This study evaluated 19 subjects. Thirteen subcortical brain structures were evaluated using FSL software. On the T1-weighted images, normalized brain volumes were measured using SIENAX software. The study compared the volume of the brain and 13 subcortical structures in 9 patients suffering from TR-PTSD after torture and 10 healthy volunteers (HV). Diffusion-weighted imaging (DWI) was performed in the transverse plane. In addition, the 18F-FDG PET data were evaluated to identify the activity of the elected regions. The mean left hippocampal volume for the TR-PTSD group was significantly lower than in the HV group (post hoc test (Bonferroni) P PTSD and the HV group (post hoc test (Bonferroni) P PTSD group showed low significant expansion of the ventricles in contrast to the HV group (post hoc test (Bonferroni) P PTSD and HV group (post hoc test (Bonferroni) P PTSD, in the temporal lobe in 1 of the 9 patients, and in the caudate nucleus in 5 of the 9 patients. In 2 cases, additional hypometabolism was observed in the posterior cingulate cortex and in the parietal and frontal lobes. The findings from this study show that TR-PTSD might have a deleterious influence on a set of specific brain structures. This study also demonstrated that PET combined with MRI is sensitive in detecting possible metabolic and structural brain changes in TR-PTSD.
Directory of Open Access Journals (Sweden)
Lucila Coca Leventhal
2010-06-01
Full Text Available O estudo teve como objetivo comparar três modalidades de crioterapia em mulheres saudáveis e não grávidas. Trata-se de um ensaio clínico randomizado, não controlado, com 32 alunas do curso de graduação de uma faculdade de enfermagem particular da cidade de São Paulo, divididas em três grupos (gelo água, gelo mole, gelo gel. Foram verificadas as temperaturas (axilar, coxa e das três bolsas de gelo entre zero e vinte minutos. As temperaturas das bolsas foram: gelo mole de 9°C negativos a 2°C, gelo água de 0°C a 8°C e gelo gel de 11°C negativos a 2°C. Houve diferença significativa entre as médias das temperaturas da coxa com 10 minutos (p=0,007, 15 minutos (p=0,003 e 20 minutos (p=0,005. O gel foi mais eficiente no resfriamento comparado aos outros dois métodos. As três modalidades de crioterapia atingem a temperatura recomendada para analgesia e podem ser aplicadas em puérperas com dor perineal após o parto normal.El estudio tuvo como objetivo comparar tres modalidades de crioterapia en mujeres saludables y no grávidas. Se trató de un ensayo clínico randomizado no controlado con 32 alumnas del curso de graduación de una facultad de enfermería particular de la ciudad de São Paulo (Brasil. Las alumnas fueron divididas en tres grupos (agua helada, hielo blando, gel helado. Fueron verificadas las temperaturas (axilar, del muslo y de las tres bolsas de hielo entre cero y veinte minutos. Las temperaturas de las bolsas fueron: hielo blando, de -9°C a 2°C; agua helada, de 0°C a 8°C; gel helado, de -11°C a 2°C. Hubo diferencia significativa entre las medias de las temperaturas del muslo tomadas a los 10 minutos (p=0,007, 15 minutos (p=0,003 y 20 minutos (p=0,005. El gel fue más eficiente en el enfriamiento comparado con los otros dos métodos. Las tres modalidades de crioterapia alcanzan la temperatura recomendada para la analgesia y pueden ser aplicadas en mujeres con dolor perineal posparto.The objective of the
Directory of Open Access Journals (Sweden)
Deborah Carvalho Malta
2016-02-01
Full Text Available Resumo O artigo tem por objetivo descrever as lesões no trânsito segundo características demográficas, utilização de equipamentos de proteção, uso de serviços de saúde, limitação de atividades e incapacidades. Estimou-se o percentual de envolvimento em acidentes de trânsito com lesões, o de uso de equipamentos de proteção, o uso de serviços saúde, limitação de atividades habituais, incapacidades e sequelas, segundo escolaridade, raça-cor, sexo, idade e região de residência. O uso de cinto de segurança na população adulta foi de 79,4% e 50,2%, nos bancos da frente e de trás, respectivamente; o de uso do capacete entre os condutores e passageiros de motocicleta foi respectivamente de 83,4 e 80,1. Equipamentos de segurança são menos usados nas regiões Norte e Nordeste e na zona rural. Relataram acidente de trânsito no último mês 3,1%, sendo maior no sexo masculino 4,5%, nas pessoas de escolaridade de nível fundamental completo e médio completo, adulto jovem e de raça-cor parda. Entre os acidentados receberam algum tipo de assistência de saúde devido a este acidente 52,4% foram internados, 7,7% relataram ter tido limitação de atividades habituais, incapacidades e sequelas decorrente de acidente de trânsito 14,1%. Os acidentes de trânsito são elevados no país.
Sadilkova, Lenka; Paluch, Zoltan; Mottlova, Jirina; Bednar, Frantisek; Alusik, Stefan
2012-01-01
Thromboxane B2 (TxB2) and particularly 11-dehydrothromboxane B2 (11-dTxB2) are widely used as prognostic risk markers of platelet activation in cardiovascular diseases. The main errors in TxB2 and 11-dTxB2 determination include either low concentrations of circulating TxB2 (1 - 2 pg/mL) and 11-dTxB2 (0.9 - 4.3 pg/mL) or rather high transiency (mean TxB2 half-life is approximately 5 minutes) as well as an incorrect pre-analytical phase set up. The aim of this study was to investigate the impact of a widely used purification step on the results of enzyme immunosorbent assay (EIA)--based measurement of the two selected thromboxanes. For the purpose of this study, 20 plasma samples (10 healthy donors, 10 patients under treatment with acetylsalicylic acid) were screened for TxB2 and 11-dTxB2 concentrations using commercial competitive EIA kits (Cayman Chemicals, Tallinn, Estonia; Neogen, Lexington, KY, USA) with or without the introduction of the purification procedure. The purification step does not significantly affect the results of EIA measurements of the two of TxA2 metabolites (TxB2, 11-dTxB2) in human plasma. The levels of TxB2 and 11-dTxB2 determined in the plasma samples were not significantly changed (p < 0.05) when the purification step was omitted compared to the purified samples. This study establishes a protocol allowing for reliable and reproducible plasma TxB2 and 11-dTxB2 EIA measurement for routine basic screening of platelet function.
Replication the association of 2q32.2-q32.3 and 14q32.11 with hepatocellular carcinoma.
Chen, Wei; Wang, Mingquan; Zhang, Zhen; Tang, Huayang; Zuo, Xianbo; Meng, Xiangling; Xiong, Maoming; Zhou, Fusheng; Liang, Bo; Dai, Fen; Fang, Jun; Gao, Jinping; Zhu, Jun; Zhu, Yong; Wan, Hong; Wang, Miaofeng; Chan, Shixin; Sun, Liangdan
2015-04-25
Hepatocellular carcinoma (HCC) is a malignant tumor. The morbidity and mortality of HCC tend to ascend and become a serious threat to the population health. Genetic studies of HCC have identified several susceptibility loci of HCC. In this study, we aim to replicate the association of these loci in our samples from Chinese population and further investigate the genetic interaction. We selected 16 SNPs within 1p36.22, 2q32.2-q32.3, 3p21.33, 8p12, 14q32.11 and 21q21.3 and genotyped in 507 HCC patients and 3014 controls by using Sequenom MassARRAY system. Association analyses were performed by using PLINK 1.07. We observed that the STAT4 (2q32.2-q32.3) at rs7574865 (P=1.17×10(-3), OR=0.79) and EFCAB11 (14q32.11) at rs8013403 (P=1.54×10(-3), OR=0.80) were significantly associated with HCC in this study. In 3p21.33, genetic variant rs6795737 within GLB1 was also observed with suggestive evidence (P=9.98×10(-3), OR=0.84). In the interaction analysis, the pair of associated SNPs (rs7574865 within STAT4, rs8013403 within EFCAB11) generated evidence for interaction (P=4.10×10(-3)). In summary, our work first reported the association of 14q32.11 (EFCAB11) with HCC in Chinese Han population and revealed the genetic interaction between STAT4 (2q32.2-q32.3) and EFCAB11 (14q32.11) in HCC. Copyright © 2015 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Ernest A. Mancini; William C. Parcell; Bruce S. Hart
2005-09-19
The principal research effort for Year 2 of the project is on stratigraphic model assessment and development. The research focus for the first six (6) months of Year 2 is on T-R cycle model development. The emphasis for the remainder of the year is on assessing the depositional model and developing and testing a sequence stratigraphy model. The development and testing of the sequence stratigraphy model has been accomplished through integrated outcrop, well log and seismic studies of Mesozoic strata in the Gulf of Mexico, North Atlantic and Rocky Mountain areas.
Synthesis and Evaluation of a 2,11-Cembranoid-Inspired Library.
Welford, Amanda J; Caldwell, John J; Liu, Manjuan; Richards, Meirion; Brown, Nathan; Lomas, Cara; Tizzard, Graham J; Pitak, Mateusz B; Coles, Simon J; Eccles, Suzanne A; Raynaud, Florence I; Collins, Ian
2016-04-11
The 2,11-cembranoid family of natural products has been used as inspiration for the synthesis of a structurally simplified, functionally diverse library of octahydroisobenzofuran-based compounds designed to augment a typical medicinal chemistry library screen. Ring-closing metathesis, lactonisation and SmI2 -mediated methods were exemplified and applied to the installation of a third ring to mimic the nine-membered ring of the 2,11-cembranoids. The library was assessed for aqueous solubility and permeability, with a chemical-space analysis performed for comparison to the family of cembranoid natural products and a sample set of a screening library. Preliminary investigations in cancer cells showed that the simpler scaffolds could recapitulate the reported anti-migratory activity of the natural products. © 2016 The Authors. Published by Wiley-VCH Verlag GmbH & Co. KGaA.
Prevalence of 22q11.2 deletions in 311 Dutch patients with schizophrenia
Hoogendoorn, Mechteld L C; Vorstman, Jacob A S; Jalali, Gholam R; Selten, Jean-Paul; Sinke, Richard J; Emanuel, Beverly S; Kahn, René S
UNLABELLED: The objectives of this study were 1) to examine whether the prevalence of 22q11.2 deletion syndrome (22q11DS) in schizophrenia patients with the Deficit syndrome is higher than the reported approximately 2% for the population of schizophrenia patients as a whole, and 2) to estimate the
African Crop Science Journal - Vol 11, No 2 (2003)
African Journals Online (AJOL)
Variation of β-1,3-Glucanase, Chitinase and Polyphenoloxidase Activities in Cacao Pods upon Phytophthora megakarya Inoculation. N.D. Omokolo,, D.J. Nankeu, N. Niemenak, T. Boudjeko. http://dx.doi.org/10.4314/acsj.v11i2.27522 ...
Speech Optimization at 9600 Bits/Second. Volume 2. Real-Time Software and Hardware.
1980-09-30
resumed as follows: q s A r c ACCA -- S rUP > When resumed, the task closes the MAP and exits. If a complete, two MAP system is desired, the process...A r - C 2 #1 L. II V. It 1, x It -- C C cr t9-tr it 2 - 9C--99 .I. 11 1 16 f6 .~ 4 2t V V t6 M W C It It 22~ ~~ .20 2 r2-~. z-. C22 z C Z ~ 2 O s~ 9
Examining the Overlap between Autism Spectrum Disorder and 22q11.2 Deletion Syndrome
Directory of Open Access Journals (Sweden)
Opal Ousley
2017-05-01
Full Text Available 22q11.2 deletion syndrome (22q11.2DS is a genomic disorder reported to associate with autism spectrum disorders (ASDs in 15–50% of cases; however, others suggest that individuals with 22q11.2DS present psychiatric or behavioral features associated with ASDs, but do not meet full criteria for ASD diagnoses. Such wide variability in findings may arise in part due to methodological differences across studies. Our study sought to determine whether individuals with 22q11.2DS meet strict ASD diagnostic criteria using research-based guidelines from the Collaborative Programs of Excellence in Autism (CPEA, which required a gathering of information from three sources: the Autism Diagnostic Interview-Revised (ADI-R, the Autism Diagnostic Observational Schedule (ADOS, and a clinician’s best-estimate diagnosis. Our study examined a cohort of children, adolescents, and young adults (n = 56 with 22q11.2DS, who were ascertained irrespective of parents’ behavioral or developmental concerns, and found that 17.9% (n = 10 of the participants met CPEA criteria for an ASD diagnosis, and that a majority showed some level of social-communication impairment or the presence of repetitive behaviors. We conclude that strictly defined ASDs occur in a substantial proportion of individuals with 22q11.2DS, and recommend that all individuals with 22q11.2DS be screened for ASDs during early childhood.
Administrateur de la trésorerie (h/f) | CRDI - Centre de recherches ...
International Development Research Centre (IDRC) Digital Library (Canada)
examen annuel des procédures de gestion de la trésorerie et des processus de paiement;; Procéder au dépôt électronique de tous les documents constitutifs conformément aux normes applicables;; Préparer une analyse comptable périodique et ...
Atmospheric Electricity and Tethered Aerostats, Volume 2
1976-05-11
EASTERN TEST RANGE PATRICK AIR FORCE BASE, FLORIDA 11 MAY 1976 028 099 AFETR -TR-76-07 ATMOSPHERIC ELECTRICITY AND ~TETHERED AEROSTATS, VOLUME 11 Range...number) Atmospheric Electricity Lightning- Effects , Protection, Warning Balloons Systems Conducting & Nonconducting Tethers Potential Gradient Anomalies...if necessary and Identify by block number) Part A, "Atmospheric Electrical Effects of and on Tethered Balloon Systems," by Latham includes airborne
Trafficking in persons: a health concern? Tráfico de pessoas: uma preocupação da Saúde?
Directory of Open Access Journals (Sweden)
Cathy Zimmerman
2009-08-01
Full Text Available Human trafficking is a phenomenon that has now been documented in most regions in the world. Although trafficking of women and girls for sexual exploitation is the most commonly recognised form of trafficking, it is widely acknowledged that human trafficking also involves men, women and children who are trafficked for various forms of labour exploitation and into other abusive circumstances. Despite the violence and harm inherent in most trafficking situations, there remains extremely little evidence on the individual and public health implications of any form of human trafficking. The Brazilian government has recently launched a national plan to combat human trafficking. However, because the health risks associated with human trafficking have not been well-recognised or documented, there is extremely limited reliable data on the health needs of trafficked persons to inform policy and practices.. Brazilian policy-makers and service providers should be encouraged to learn about the likely range of health impacts of trafficking, and incorporate this into anti-trafficking protection and response strategies. As well as prevention activities, the government, international and local organisations should work together with the public health research community to study the health needs of trafficked persons and explore opportunities to provide safe and appropriate services to victims in need of care.O tráfico de pessoas é um fenômeno que foi registrado na maioria das regiões do mundo. Embora o tráfico de mulheres e meninas para exploração sexual seja a forma mais comumente reconhecida de tráfico, sabe-se que o comércio ilegal de pessoas envolve também homens, mulheres e crianças, em várias formas de exploração de trabalho e circunstâncias abusivas. Apesar da violência e danos inerentes à maioria das situações de tráfico, há ainda muito pouca evidência sobre as implicações do tráfico de pessoas para a saúde individual e p
Caracterización y simulación del tráfico de redes LAN mediante el modelo MMPP
Directory of Open Access Journals (Sweden)
Jaime Alberto Moreno Mogollón
2007-01-01
Full Text Available En este artículo se presenta un método para caracterizar y simular el tráfico de acceso a Internet de cualquier red LAN con comportamiento autosimilar. Para ello se emplea el modelo de cola D-MMPP/D/1 para generar una traza discreta y analizar su comportamiento al pasar por la cola con diferentes capacidades de buffer. Este método ha sido probado por otros autores en condiciones controladas de laboratorio y solo para tráfico entrante. Nuestro estudio demuestra que esta metodología puede ser utilizada en redes LAN bajo condiciones reales y actuales tanto para tráfico autosimilar entrante como saliente. Para tal fin se utiliza el tráfico capturado en los enlaces de entrada/salida de Internet de la Red LAN de la Universidad Pontificia Bolivariana, seccional Bucaramanga. Además, esta metodología soluciona el problema de modelar tráfico autosimilar ya que genera una traza simulada aproximada a la traza medida. La exactitud del modelo se ve reflejada en la gráfica de los quantiles (Q-Q plot entre la traza medida y la traza generada mediante D-MMPP. Para realizar nuestro estudio, el modelo y los algoritmos fueron validados inicialmente utilizando trazas obtenidas en los laboratorios Bellcore. Posteriormente, se realizaron algunos ajustes para tener una traza simulada en términos de bits por segundo y no en términos de paquetes por segundo como se hace en otros trabajos, con el fin de obtener una simulación de la capacidad del canal en bits por segundo.
The 1:1 adduct of caffeine and 2-(1,3-dioxoisoindolin-2-ylacetic acid
Directory of Open Access Journals (Sweden)
Moazzam H. Bhatti
2011-09-01
Full Text Available In the crystal structure of the title adduct [systematic name: 2-(1,3-dioxoisoindolin-2-ylacetic acid–1,3,7-trimethyl-1,2,3,6-tetrahydro-7H-purine-2,6-dione (1/1], C8H10N4O2·C10H7NO4, the components are linked by an O—H...N hydrogen-bond and no proton transfer occurs.
A COL11A2 mutation in Labrador retrievers with mild disproportionate dwarfism.
Directory of Open Access Journals (Sweden)
Mirjam Frischknecht
Full Text Available We describe a mild form of disproportionate dwarfism in Labrador Retrievers, which is not associated with any obvious health problems such as secondary arthrosis. We designate this phenotype as skeletal dysplasia 2 (SD2. It is inherited as a monogenic autosomal recessive trait with incomplete penetrance primarily in working lines of the Labrador Retriever breed. Using 23 cases and 37 controls we mapped the causative mutation by genome-wide association and homozygosity mapping to a 4.44 Mb interval on chromosome 12. We re-sequenced the genome of one affected dog at 30x coverage and detected 92 non-synonymous variants in the critical interval. Only two of these variants, located in the lymphotoxin A (LTA and collagen alpha-2(XI chain gene (COL11A2, respectively, were perfectly associated with the trait. Previously described COL11A2 variants in humans or mice lead to skeletal dysplasias and/or deafness. The dog variant associated with disproportionate dwarfism, COL11A2:c.143G>C or p.R48P, probably has only a minor effect on collagen XI function, which might explain the comparatively mild phenotype seen in our study. The identification of this candidate causative mutation thus widens the known phenotypic spectrum of COL11A2 mutations. We speculate that non-pathogenic COL11A2 variants might even contribute to the heritable variation in height.
Mapping a2 Adrenoceptors of the Human Brain with 11C-Yohimbine
DEFF Research Database (Denmark)
Nahimi, Adjmal; Jakobsen, Steen; Munk, Ole
2015-01-01
A previous study from this laboratory suggested that 11C-yohimbine, a selective α2-adrenoceptor antagonist, is an appropriate ligand for PET of α2 adrenoceptors that passes readily from blood to brain tissue in pigs but not in rodents. To test usefulness in humans, we determined blood–brain...... values of VT ranged from 0.82 mL cm−3 in the right frontal cortex to 0.46 mL cm−3 in the corpus callosum, with intermediate VT values in subcortical structures. Binding potentials averaged 0.6–0.8 in the cortex and 0.2–0.5 in subcortical regions. Conclusion: The maps of 11C-yohimbine binding to α2...... adrenoceptors in human brain had the highest values in cortical areas and hippocampus, with moderate values in subcortical structures, as found also in vitro. The results confirm the usefulness of the tracer 11C-yohimbine for mapping α2 adrenoceptors in human brain in vivo....
A critical look at the function of the P2Y11 receptor
DEFF Research Database (Denmark)
Dreisig, Karin; Kornum, Birgitte Rahbek
2016-01-01
The P2Y11 receptor is a member of the purinergic receptor family. It has been overlooked, somewhat due to the lack of a P2ry11 gene orthologue in the murine genome, which prevents the generation of knockout mice, which have been so helpful for defining the roles of other P2Y receptors. Furthermor...
Directory of Open Access Journals (Sweden)
Nitin Kumar Tripathi
2013-07-01
Full Text Available This paper evaluates the possible impacts of climate change and land use change and its combined effects on soil loss and net soil loss (erosion and deposition in the Mae Nam Nan sub-catchment, Thailand. Future climate from two general circulation models (GCMs and a regional circulation model (RCM consisting of HadCM3, NCAR CSSM3 and PRECIS RCM ware downscaled using a delta change approach. Cellular Automata/Markov (CA_Markov model was used to characterize future land use. Soil loss modeling using Revised Universal Soil Loss Equation (RUSLE and sedimentation modeling in Idrisi software were employed to estimate soil loss and net soil loss under direct impact (climate change, indirect impact (land use change and full range of impact (climate and land use change to generate results at a 10 year interval between 2020 and 2040. Results indicate that soil erosion and deposition increase or decrease, depending on which climate and land use scenarios are considered. The potential for climate change to increase soil loss rate, soil erosion and deposition in future periods was established, whereas considerable decreases in erosion are projected when land use is increased from baseline periods. The combined climate and land use change analysis revealed that land use planning could be adopted to mitigate soil erosion and deposition in the future, in conjunction with the projected direct impact of climate change.
Doyen, Jérôme; Carpentier, Xavier; Haudebourg, Juliette; Hoch, Benjamin; Karmous-Benailly, Houda; Ambrosetti, Damien; Fabas, Thibault; Amiel, Jean; Lambert, Jean-Claude; Pedeutour, Florence
2012-11-01
We observed a t(11;22)(q23-24;q11.2-12) and monosomy 3 in renal tumor cells from a 72-year-old man. The hypothesis of a primitive peripheral neuroectodermal tumor (PPNET) located in the kidney was promptly excluded: Histologically, the tumor was a clear cell renal cell carcinoma (RCC) and we did not observe an EWSR1 gene rearrangement. The constitutional origin of this alteration was established. We report on the second case of RCC in a patient with a constitutional t(11;22). The t(11;22)(q23;q11.2) is the main recurrent germline translocation in humans. Unbalanced translocation can be transmitted to the progeny and can cause Emanuel syndrome. Our observation alerts cancer cytogeneticists to the fortuitous discovery of the constitutional t(11;22) in tumor cells. This translocation appears grossly similar to the t(11;22)(q24;q12) of PPNET and should be evoked if present in all cells of a tumor other than PPNET. This is important when providing appropriate genetic counseling. Moreover, the potential oncogenic role of the t(11;22) and its predisposing risk of cancer are under debate. The family history of the patient revealed a disabled brother who died at an early age from colon cancer and a sister with breast cancer. This observation reopens the issue of a link between the constitutional t(11;22) and cancer, and the utility of cancer prevention workups for t(11;22) carriers. Copyright © 2012 Elsevier Inc. All rights reserved.
The Coupling Structure Features Between (2,1) NTM and (1,1) Internal Mode in EAST Tokamak
International Nuclear Information System (INIS)
Shi Tonghui; Wan Baonian; Sun Youwen; Shen Biao; Qian Jinping; Hu Liqun; Chen Kaiyun; Liu Yong
2015-01-01
In the discharge of EAST tokamak, it is observed that (2,1) neoclassical tearing mode (NTM) is triggered by mode coupling with a (1,1) internal mode. Using singular value decomposition (SVD) method for soft X-ray emission and for electron cyclotron emission (ECE), the coupling spatial structures and coupling process between these two modes are analyzed in detail. The results of SVD for ECE reveal that the phase difference between these two modes equals to zero. This is consistent with the perfect coupling condition. Finally, performing statistical analysis of r 1/1 , ξ 1/1 and w 2/1 , we find that r 1/1 more accurately represents the coupling strength than ξ 1/1 , and r 1/1 is also strongly related to the (2,1) NTM triggering, where r 1/1 is the width of (1,1) internal mode, ξ 1/1 is the perturbed amplitude of (1,1) internal mode, and w 2/1 denot es the magnetic island width of (2,1) NTM. (paper)
Directory of Open Access Journals (Sweden)
Chao Huang
2017-09-01
Full Text Available The title compounds, tetrabutylammonium chloride–1,1′-(1,2-phenylenebis(3-m-tolylurea (1/1, C16H36N+·Cl−·C22H22N4O2 or [(n-Bu4N+·Cl−(C22H22N4O2] (I and tetrabutylammonium bromide–1,1′-(1,2-phenylenebis(3-m-tolylurea (1/1, C16H36N+·Br−·C22H22N4O2 or [(n-Bu4N+·Br−(C22H22N4O2] (II, both comprise a tetrabutylammonium cation, a halide anion and an ortho-phenylene bis-urea molecule. Each halide ion shows four N—H...X (X = Cl or Br interactions with two urea receptor sites of different bis-urea moieties. A crystallographic inversion centre leads to the formation of a 2:2 arrangement of two halide anions and two bis-urea molecules. In the crystals, the dihedral angle between the two urea groups of the bis-urea molecule in (I [defined by the four N atoms, 165.4 (2°] is slightly smaller than that in (II [167.4 (2°], which is probably due to the smaller ionic radius of chloride compared to bromide.
InGaP DHBT for High Efficiency L-band T/R Module, Phase I
National Aeronautics and Space Administration — A fully monolithically integrated L-band T/R module using InGaP/GaAs-based HBTs (heterojunction bipolar transistors) for both the transmit and receive functions is...
Stoyanov, Evgenii S
2017-04-20
Chloronium cations in their salts (C n H 2n+1 ) 2 Cl + {CHB 11 Cl 11 - }, with n = 1 to 3 and exceptionally stable carborane anions, are stable at ambient and elevated temperatures. The temperature at which they decompose to carbocations with HCl elimination (below 150 °C) decreases with the increasing n from 1 to 3 because of increasing ionicity of C-Cl bonds in the C-Cl + -C bridge. At room temperature, the salts of cations with n ≥ 4 [starting from t-Bu 2 Cl + or (cyclo-C 5 H 11 ) 2 Cl + ] are unstable and decompose. With decreasing chloronium ion stability, their ability to interact with chloroalkanes to form oligomeric cations increases. It was shown indirectly that unstable salt of fluoronium ions (CH 3 ) 2 F + (CHB 11 F 11 - ) must exist at low temperatures. The proposed (CH 3 ) 2 F + cation is much more reactive than the corresponding chloronium, showing at room temperature chemical properties expected of (CH 3 ) 2 Cl + at elevated temperatures.
2013-01-01
Background A strong relationship between insomnia and painful disorders has been found, but it is still unclear whether chronic pain leads to insomnia. There is a need of large-scale prospective studies to evaluate if there is a causal relationship between painful disorders and insomnia. Methods All inhabitants aged ≥ 20 years in Nord-Trøndelag County of Norway were invited to participate in two surveys (n = 92,566 and 93,860, respectively). 27,185 subjects participated in both surveys, and 19,271 of these were insomnia-free at baseline (population at risk). Using logistic regression, we evaluated the influence of headache, CMSCs and coexisting headache and CMSCs on the subsequent risk of insomnia. Results Compared to subjects without headache and CMSCs, there was an increased risk of insomnia among those with headache, most pronounced among those with headache ≥ 7 days / month (OR = 2.2, 95% CI = 1.9 – 2.6). Similarly, an increased risk among those with CMSCs was found, most evident for those with widespread CMSCs (OR = 2.0, 95% CI = 1.8 – 2.2). Having coexistent CMSCs and headache (OR = 2.0, 95% CI = 1.8 – 2.2) predisposed more strongly to insomnia than having headache (OR = 1.5, 95% CI = 1.3 – 1.6) and CMSCs (OR = 1.6, 95% CI = 1.4 – 1.7) alone. Conclusion In this prospective study headache and CMSCs were risk factors for insomnia 11 years later. PMID:23566158
A Spitzer five-band analysis of the Jupiter-sized planet TrES-1
Energy Technology Data Exchange (ETDEWEB)
Cubillos, Patricio; Harrington, Joseph; Foster, Andrew S. D.; Lust, Nate B.; Hardy, Ryan A.; Bowman, M. Oliver [Planetary Sciences Group, Department of Physics, University of Central Florida, Orlando, FL 32816-2385 (United States); Madhusudhan, Nikku, E-mail: pcubillos@fulbrightmail.org [Department of Physics and Department of Astronomy, Yale University, New Haven, CT 06511 (United States)
2014-12-10
With an equilibrium temperature of 1200 K, TrES-1 is one of the coolest hot Jupiters observed by Spitzer. It was also the first planet discovered by any transit survey and one of the first exoplanets from which thermal emission was directly observed. We analyzed all Spitzer eclipse and transit data for TrES-1 and obtained its eclipse depths and brightness temperatures in the 3.6 μm (0.083% ± 0.024%, 1270 ± 110 K), 4.5 μm (0.094% ± 0.024%, 1126 ± 90 K), 5.8 μm (0.162% ± 0.042%, 1205 ± 130 K), 8.0 μm (0.213% ± 0.042%, 1190 ± 130 K), and 16 μm (0.33% ± 0.12%, 1270 ± 310 K) bands. The eclipse depths can be explained, within 1σ errors, by a standard atmospheric model with solar abundance composition in chemical equilibrium, with or without a thermal inversion. The combined analysis of the transit, eclipse, and radial-velocity ephemerides gives an eccentricity of e=0.033{sub −0.031}{sup +0.015}, consistent with a circular orbit. Since TrES-1's eclipses have low signal-to-noise ratios, we implemented optimal photometry and differential-evolution Markov Chain Monte Carlo (MCMC) algorithms in our Photometry for Orbits, Eclipses, and Transits pipeline. Benefits include higher photometric precision and ∼10 times faster MCMC convergence, with better exploration of the phase space and no manual parameter tuning.
The cognitive development of children with the 22q11.2 deletion syndrome
Duijff, S.N.
2012-01-01
Background: The 22q11.2 deletion syndrome (22q11DS) is a genetic disorder associated with palatal abnormalities, cardiac defects and characteristic facial features. On a behavioural/ psychiatric level, children with 22q11DS are at an increased risk for various psychiatric problems, including Autism
Directory of Open Access Journals (Sweden)
Fabio Sandoli de Brito Junior
2012-08-01
Full Text Available FUNDAMENTO: O implante por cateter de bioprótese valvar aórtica é uma nova modalidade de tratamento para portadores de estenose aórtica inoperáveis ou de alto risco cirúrgico. Objetivo: Relatar a experiência de três anos do implante por cateter da bioprótese CoreValve. MÉTODOS: Entre janeiro de 2008 e janeiro de 2011, 35 pacientes com estenose aórtica (33 casos ou disfunção de bioprótese valvar aórtica (dois casos de alto risco cirúrgico foram submetidos ao implante da bioprótese CoreValve. RESULTADOS: A média de idade dos pacientes foi 81,5 ± 9 anos, e 80% apresentavam-se em classe funcional III ou IV de insuficiência cardíaca. O EuroScore foi 18,4 ± 14,3% e o STS 14,5 ± 11,6%. Obteve-se sucesso do implante em 34 (97,1% pacientes. Após a intervenção houve redução do gradiente transvalvar de 84,9 ± 22 para 22,5 ± 9,5 mmHg e 87,1% dos pacientes evoluíram em classe funcional I ou II. A mortalidade aos 30 dias e no seguimento médio de 400 ± 298 dias foi, respectivamente, de 11,4% e 31,4%. A ocorrência de complicações hemorrágicas com risco de morte foi o único preditor independente de mortalidade cardiovascular. Acidente vascular cerebral ocorreu em 5,7% dos pacientes. Marca-passo permanente foi necessário em 32,1% dos casos no primeiro mês após o procedimento. CONCLUSÃO: O implante por cateter de bioprótese valvar aórtica é um procedimento seguro e eficaz para ser empregado em portadores de estenose aórtica de alto risco cirúrgico. O dispositivo CoreValve é eficaz no médio-prazo, em seguimento de até três anos.
A VDF/TrFE copolymer on silicon pyroelectric sensor: design considerations and experiments
Setiadi, D.; Setiadi, D.; Regtien, Paulus P.L.
1995-01-01
For an optimal design of a VDF/TrFE (vinylidene fluoride trifluoroethylene) copolymer-on-silicon pyroelectric sensor, the one-dimensional diffusion equation is solved for the pyroelectric multilayer structure. Output current and voltage of the sensor are calculated. Improvement of the sensor can be
On the Probabilistic Deployment of Smart Grid Networks in TV White Space.
Cacciapuoti, Angela Sara; Caleffi, Marcello; Paura, Luigi
2016-05-10
To accommodate the rapidly increasing demand for wireless broadband communications in Smart Grid (SG) networks, research efforts are currently ongoing to enable the SG networks to utilize the TV spectrum according to the Cognitive Radio paradigm. To this aim, in this letter, we develop an analytical framework for the optimal deployment of multiple closely-located SG Neighborhood Area Networks (NANs) concurrently using the same TV spectrum. The objective is to derive the optimal values for both the number of NANs and their coverage. More specifically, regarding the number of NANs, we derive the optimal closed-form expression, i.e., the closed-form expression that assures the deployment of the maximum number of NANs in the considered region satisfying a given collision constraint on the transmissions of the NANs. Regarding the NAN coverage, we derive the optimal closed-form expression, i.e., the closed-form expression of the NAN transmission range that assures the maximum coverage of each NAN in the considered region satisfying the given collision constraint. All the theoretical results are derived by adopting a stochastic approach. Finally, numerical results validate the theoretical analysis.
Crystal structure of RbCe(SeO4)2 · 5H2O
International Nuclear Information System (INIS)
Ovanesyan, S.M.; Iskhakova, L.D.; Trunov, V.K.
1987-01-01
RbTR(SeO 4 ) 2 x5H 2 O TR=La-Pr are synthesized. Crystal structure of RbCe(SeO 4 ) 2 x5H 2 O is studied. Monoclinic unit parameters are: a=7,200(2), b=8,723(1), c=19,258(6) A, Β=90,88(2), ρ (calc) =3,304 sp.gr. P2 1 /c. Within the structure the Ce nine vertex cages are united by Se(1)- and Se(2)-tetrahedrons in (Ce(SeO 4 ) 2 (H 2 O) 5 ) 2 ∞ n- layers. Some crystal structure regularities of the laminated MTR(EO 4 ) 2 xnH 2 O (M=NH 4 ,K,Rb,Cs; TR=La-Ln, E=S,Se) are considered
Control y simulación de tráfico urbano en Colombia: Estado del arte
Directory of Open Access Journals (Sweden)
Daniel Robles
2009-05-01
Full Text Available Las condiciones actuales de la movilidad en Colombia generan interrogantes acerca de qué tan apropiadas son las estrategias de control de tráfico aplicadas en las redes urbanas del país. Con esto en mente, se plantea una revisión de las estrategias de control y plataformas de simulación de sistemas de tráfico más utilizadas en Colombia y en otras partes del mundo; con el propósito de caracterizar el nivel de desarrollo del país en el estudio e implementación de estrategias de control de tráfico urbano y, posteriormente, formular propuestas orientadas hacia la mejora de la movilidad urbana en el país./ The current mobility conditions in Colombia give place to questions about the suitability of the traffic control strategies applied on the Colombian urban networks. Therefore, a review of the control strategies and simulation platforms used in Colombia and around the world is shown. This is done to characterize the level of development of the country, in terms of research and implementation of such control strategies and, furthermore, to formulate proposals oriented towards the improvement of the Colombian urban mobility.
TR-PIV Performance Test for a Flow Field Measurement in a Single Rod Test Section
International Nuclear Information System (INIS)
Park, Ju Yong; Shin, Chang Hwan; Lee, Chi Young; Oh, Dong Seok; In, Wang Kee
2011-01-01
For large enhancement of performance of Pressurized Water Reactor(PWR), dual-cooled fuel is being developed in Korea Atomic Energy Research Institute(KAERI). This nuclear fuel is a ring shape fuel which is different from conventional cylindrical nuclear fuel and cooling water flows both inner and outer channel. For this fuel, it widens the surface area. But it is bigger outer diameter of fuel rods. So, interval between fuel rods narrows. This because of outer channel flow is unstable. So, measurement of turbulence flow and perturbation that influence in heat transfer elevation is important.. To understand heat transfer characteristics by turbulence, measurement of flow perturbation element is necessary. To measure these turbulence characteristics, hot wire anemometer is widely used. However, it has many disadvantages such as low durability of prove, and big probe size. For these reasons, TR-PIV(Time-Resolved Particle Image Velocimetry) system is employed for better flow measurement in our research institute. TR-PIV system is consisted of laser system and high-speed camera that have high frequency. So, was judged that can measurement complicated turbulence flow and perturbation. In this paper, introduce TR-PIV system, and with results acquiring in single rod flow through this system, and wish to introduce about after this practical use plan
Energy Technology Data Exchange (ETDEWEB)
Palner, Mikael [Neurobiology Research Unit, Rigshospitalet, University of Copenhagen, DK-2300, Copenhagen (Denmark); Center for Integrated Molecular Brain Imaging, Copenhagen (Denmark)], E-mail: mikael.palner@nru.dk; McCormick, Patrick [PET Centre, Centre for Addiction and Mental Health, M5T 1RB, Toronto, ON (Canada); Gillings, Nic [Center for Integrated Molecular Brain Imaging, Copenhagen (Denmark); PET and Cyclotron Unit, Rigshospitalet, DK-2300, Copenhagen (Denmark); Begtrup, Mikael [Center for Integrated Molecular Brain Imaging, Copenhagen (Denmark); Institute for Medicinal Chemistry, Pharmaceutical Faculty, University of Copenhagen, DK-2300, Copenhagen (Denmark); Wilson, Alan A. [PET Centre, Centre for Addiction and Mental Health, M5T 1RB, Toronto, ON (Canada); Knudsen, Gitte M. [Neurobiology Research Unit, Rigshospitalet, University of Copenhagen, DK-2300, Copenhagen (Denmark); Center for Integrated Molecular Brain Imaging, Copenhagen (Denmark)
2010-01-15
Introduction: Several dopamine D{sub 2} agonist radioligands have been used with positron emission tomography (PET), including [{sup 11}C-]-(-)-MNPA, [{sup 11}C-]-(-)-NPA and [{sup 11}C]-(+)-PHNO. These radioligands are considered particularly powerful for detection of endogenous dopamine release, but they either provide PET brain images with limited contrast or have affinity for both D{sub 2} and D{sub 3} receptors. We here present the carbon-11 radiolabeling and ex vivo evaluation of 2-Cl-(-)-NPA, a novel PET-tracer candidate with high in vitro D{sub 2}/D{sub 3} selectivity. Methods: 2-Cl-[{sup 11}C]-(-)-NPA and [{sup 11}C]-(-)-NPA were synthesized by a two step N-acylation-reduction process using [{sup 11}C]-propionyl chloride. Awake rats were injected with either tracer, via the tail vein. The rats were decapitated at various times, the brains were removed and quickly dissected, and plasma metabolites were measured. Radioligand specificity, and P-glycoprotein involvement in brain uptake, was also assessed. Results: 2-Cl-[{sup 11}C]-(-)-NPA and [{sup 11}C]-(-)-NPA were produced in high specific activity and purity. 2-Cl-[{sup 11}C]-(-)-NPA accumulated slower in the striatum than [{sup 11}C]-(-)-NPA, reaching maximum concentrations after 30 min. The maximal striatal uptake of 2-Cl-[{sup 11}C]-(-)-NPA (standard uptake value 0.72{+-}0.24) was approximately half that of [{sup 11}C]-(-)-NPA (standard uptake value 1.37{+-}0.18). Nonspecific uptake was similar for the two compounds. 2-Cl-[{sup 11}C]-(-)-NPA was metabolized quickly, leaving only 17% of the parent compound in the plasma after 30 min. The specific binding of 2-Cl-[{sup 11}C]-(-)-NPA was completely blocked and inhibition of P-glycoprotein did not alter the brain uptake. Conclusion: Ex vivo experiments showed, despite a favorable D{sub 2}/D{sub 3} selectivity, that 2-Cl-[{sup 11}C]-(-)-NPA is inferior to [{sup 11}C]-(-)-NPA as a PET tracer in rat, because of slower brain uptake and lower specific to