
Sample records for nam dinh nghe

  1. Adapting the Melon Production Model to Climate Change in Giao Thuy district, Nam Dinh Province, Vietnam

    Ngo, AT.


    Full Text Available Embedded in a package of climate change adaptation, researchers and farmers tested the melon hybrid variety, Kim Hoang Hau (KHH, for yield and disease resistance during the spring-summer season from March to June 2015 in Giao Thuy district, Nam Dinh province. The results were analysed and subsequently discussed with local farmers in focused groups. Analysis showed that the KHH was suitable to local soil conditions. The farmers preferred this new variety over the local melon, because not only did KHH give higher yield and pest resistance, it also showed less vulnerability to climatic stressors. Farmers decided to grow KHH based on the prevailing good market price at that time. However, farmers only shifted away from the old melon when they could anticipate the possibility of selling the new product. Those who did not continue with the KHH had difficulty in actively accessing the market for this new product. This study suggests that the market information does not solely drive the process of the adaptation itself, but it also provides relevant stimuli to farmers enabling them to successfully shift to new crop varieties. This study also implies that such process-based understanding is crucial in formulating strategies that increase the farmer's capacity to adapt to climate change.

  2. Investigation Of The Natural Radioactivity In The Phuoc Dinh Area Located In The Thuan Nam District, Ninh Thuan Province

    Ba Van Khoi; Vo Xuan An


    It is very important that the natural radioactivity in the Phuoc Dinh area located in the Thuan Nam district, Ninh Thuan province has to be investigated. Because Phuoc Dinh is an area anticipated for constructing The 1 st Ninh Thuan Nuclear Power Plant, the data of the natural radioactivity determined before installing and operating this Nuclear Power Plant are to evaluate the dangerous ecologic effects of this industry. The soil samples were collected in the radius of 0.5, 0.6 and 0.7 km from the fence of this Nuclear Power Plant. The results of the natural radioactivity were measured on the low background spectrometry using the high purity germanium (HPGe) detector at the Center for Nuclear Techniques Ho Chi Minh City. (author)

  3. A new nidovirus (NamDinh virus NDiV): Its ultrastructural characterization in the C6/36 mosquito cell line

    Thuy, Nguyen Thanh, E-mail: [National Institute of Hygiene and Epidemiology, 1 Yersin Street, Hai Ba Trung District, Hanoi (Viet Nam); Huy, Tran Quang, E-mail: [National Institute of Hygiene and Epidemiology, 1 Yersin Street, Hai Ba Trung District, Hanoi (Viet Nam); Nga, Phan Thi [National Institute of Hygiene and Epidemiology, 1 Yersin Street, Hai Ba Trung District, Hanoi (Viet Nam); Morita, Kouichi [Department of Virology, Institute of Tropical Medicine, Global COE Program, Nagasaki University, Nagasaki (Japan); Dunia, Irene; Benedetti, Lucio [Institut Jacques Monod, UMR7592 Université Paris Diderot/CNRS, Paris (France)


    We describe the ultrastructure of the NamDinh virus (NDiV), a new member of the order Nidovirales grown in the C6/36 mosquito cell line. Uninfected and NDiV-infected cells were investigated by electron microscopy 24–48 h after infection. The results show that the viral nucleocapsid-like particles form clusters concentrated in the vacuoles, the endoplasmic reticulum, and are scattered in the cytoplasm. Mature virions of NDiV were released as budding particles on the cell surface where viral components appear to lie beneath and along the plasma membrane. Free homogeneous virus particles were obtained by ultracentrifugation on sucrose gradients of culture fluids. The size of the round-shaped particles with a complete internal structure was 80 nm in diameter. This is the first study to provide information on the morphogenesis and ultrastructure of the first insect nidovirus NDiV, a missing evolutionary link in the emergence of the viruses with the largest RNA genomes. - Highlights: • NamDinh virus (NDiV), a new member of the order Nidovirales was tested in cultured cell line. • The morphogenesis and ultrastructure of NDiV were investigated by electron microscopy. • The viral nucleocapsid-like particles clustered and scattered in the cytoplasm. • NDiVs were released as budding particles on the cell surface. • The size of the viral particles with a complete internal structure was 80 nm in diameter.

  4. dinh quang khieu

    Home; Journals; Bulletin of Materials Science. DINH QUANG KHIEU. Articles written in Bulletin of Materials Science. Volume 41 Issue 1 February 2018 pp 6. Lead ions removal from aqueous solution using modified carbon nanotubes · NGUYEN DUC VU QUYEN TRAN NGOC TUYEN DINH QUANG KHIEU HO VAN MINH ...

  5. Distribution of freshwater snails in family-based VAC ponds and associated waterbodies with special reference to intermediate hosts of fish-borne zoonotic trematodes in Nam Dinh Province, Vietnam.

    Dung, Bui Thi; Madsen, Henry; The, Dang Tat


    Fish-borne zoonotic trematodes, such as Clonorchis sinensis, heterophyids and others, constitute a public health concern in parts of northern Vietnam and infections with these trematodes are often thought to be linked to fish culture. One common fish culture system is the integrated fish-livestock (VAC) ponds where individual households have 1 or more ponds. Fish fry, mainly of various carp species, produced in hatcheries, not necessarily local, are introduced into nursery ponds and after approximately 6 weeks, juvenile fishes are transferred to household ponds, referred to as grow-out ponds. Grow-out ponds are usually fertilized with organic debris, including animal excreta, to stimulate algal growth and subsequently fish growth. This paper describes the distribution of freshwater snails and occurrence of trematode infections in these in VAC ponds and associated habitats as part of a major study on risk factors of FZT infections in cultured fish in two communes, Nghia Lac and Nghia Phu, Nghia Hung District, Nam Dinh Province. The area is under intense rice cultivation with an extensive canal network supplying fields and also household VAC ponds. A total of 16 snail species was found and four were widely distributed i.e. Angulyagra polyzonata, Melanoides tuberculata, Bithynia fuchsiana and Pomacea insularum. Snail diversity and counts were higher in nursery ponds than in grow-out ponds. Species of the families Thiaridae and Viviparidae were more abundant than other species in VAC ponds while species of the Bithyniidae, Stenothyridae and Planorbidae dominated in rice fields and small canals. Trematode infections were found in eight snail species and among these M. tuberculata had the highest overall prevalence of infection (13.28%). No trematode infections were found in species of the Viviparidae and Ampullaridae except for metacercariae. Parapleurolophocercous and pleurolophocercous cercariae constituted the most common type of cercariae recovered, contributing 40

  6. Employed Mothers: Combining Work and Parenthood = Nguoi Me Giua Hai Trong Trach: Gia Dinh Va Nghe Nghiep.

    Cudaback, Dorothea; Sagert, Janis

    This bilingual booklet is intended to help female Vietnamese refugees learn to combine the tasks of work and motherhood. Included in the booklet are Vietnamese and English translations of a discussion of the effects of a working mother on her family, suggestions for employed mothers, and guidelines for learning about and selecting from available…

  7. Skin disease among farmers using wastewater in rice cultivation in Nam Dinh, Vietnam

    Do, Thuy Trang; van der Hoek, Wim; Nguyen, Dang Tuan


    for skin disease were involvement in agriculture in general (RR = 2.59, 95% CI 1.11-6.02), flower cultivation (RR = 1.36, 95% CI 1.01-1.83), vegetable farming (RR = 1.47, 95% CI 1.04-2.08), and a history of eczema (RR = 1.47, 95% CI 1.05-2.05). CONCLUSION: Exposure to wastewater is a major risk factor...

  8. A study on super-sulfated cement using Dinh Vu phosphogypsum

    Lam, Nguyen Ngoc


    Super-sulfated cement (SSC) is a newly developed unburnt cementitious material. It is a kind of environmental-friendly cementitious material due to its energy-saving, carbon emission reducing, and waste-utilization. It mainly composes of phosphogysum (PG) and ground granulated blast furnace slag (GFS), with a small amount of cement. In Vietnam, the Diammonium Phosphate DAP – Dinh Vu fertilizer plant in Dinh Vu industrial zone in the northern port city of Hai Phong – has discharged millions of tons of solid waste containing gypsum after 9 years of operation. The waste has changed the color of the water, eroded metal and destroyed fauna and floral systems in the surrounding area. Notably, according to the environmental impact assessment, the gypsum landfill area is supposed to be 13 hectares and the storage time reaches up to five years. This paper presents the experimental results on SSC using a high amount of Dinh Vu phosphogypsum and GFS in comparison with those of ordinary Portland cement (PC). The results show that the setting time of SSC is much longer than that of Portland cement but the compressive strength of SSC can be obtained 45-50 MPa at the age of 28 days, similar to that of the control sample using 100% PC40, and 69MPa at the age of 90 days. This value even exceeds the compressive strength of the PC40 cement.


    This, in the judgement of the international team, should be put into practice through ..... Viet Nam has placed a high value on equity as a fundamental socialist principle. ..... The recent industrialization successes of Indonesia, Malaysia, and Thailand ..... Tax constraints — The explicit S&T policies of Viet Nam are designed to ...

  10. River Basin Water Assessment and Balance in fast developing areas in Viet Nam

    Le, Van Chin; Ranzi, Roberto


    Uneven precipitation in space and time together with mismanagement and lack of knowledge about quantity and quality of water resources, have caused water shortages for water supply to large cities and irrigation areas in many regions of Viet Nam in the dry season. The rainy season (from June to October) counts for 80% of the total annual rainfall, while the water volume of dry season (from November to May of the following year) accounts for 20% only. Lack of sufficient water volumes occurs in some areas where the pressure of a fast increasing population (1.3% per year on average in the last decade in Viet Nam), intensive agricultural and industrial uses is one of the major problems facing sustainable development. For those areas an accurate water assessment and balance at the riverbasin scale is needed to manage the exploitation and appropriate use of water resources and plan future development. The paper describes the preliminary phase of the pilot development of the river basin water balance for the Day River Basin in the Red River delta in Viet Nam. The Day river basin includes a 7,897 km² area in the south-western part of the Red River in Viet Nam. The total population in the Day river basin exceeds 8 millions inhabitants, including the Hanoi capital, Nam Dinh and other large towns. Agricultural land covered 390,294 ha in 2000 and this area is going to be increased by 14,000 ha in 2010 due to land reclamation and expansion toward the sea. Agricultural uses exploit about 90% of surface water resources in the Day river basin but have to compete with industrial and civil needs in the recent years. At the background of the brief characterization of the Day River Basin, we concentrate on the application of a water balance model integrated by an assessment of water quality after consumptive uses for civil, agricultural and industrial needs to assist water management in the basin. In addition, future development scenarios are taken into account, considering less

  11. Socioeconomic Renovation in Viet Nam

    The rural development team was focusing on policy and practice change, the urban housing .... Market principles are now accepted as the basis for remunerating labour, ...... In 1992, the total population of Viet Nam was four times that of Malaysia, ...... construction, purchasing, sales, transfers, maintenance and taxation.

  12. Exposure assessment of chemical hazards in pork meat, liver, and kidney, and health impact implication in Hung Yen and Nghe An provinces, Vietnam.

    Tuyet-Hanh, Tran Thi; Sinh, Dang Xuan; Phuc, Pham Duc; Ngan, Tran Thi; Van Tuat, Chu; Grace, Delia; Unger, Fred; Nguyen-Viet, Hung


    This study assesses the risk of exposure to hazardous chemical residues in pork meat, liver, and kidney collected at wet markets in Nghe An and Hung Yen provinces and discusses health impact implication. 514 pig feed, kidney, liver, and pork samples were pooled and qualitatively and quantitatively analyzed for tetracyclines, fluoroquinolones, sulphonamide, chloramphenicol, β-agonists, and heavy metals. We compare the results with current regulations on chemical residues and discuss health implications. Legal antibiotics were found in feed. Tetracycline and fluoroquinolones were not present in pork, but 11% samples were positive with sulfamethazine above maximum residue limits (MRL); 11% of packaged feed and 4% of pork pooled samples were positive for chloramphenicol, a banned substance; two feed, two liver, and one pork samples were positive for β-agonists but did not exceed current MRL; 28% of pooled samples had lead, but all were below MRL; and all samples were negative for cadmium and arsenic. Thus, the health risks due to chemical hazards in pork in Hung Yen and Nghe An seemed not as serious as what were recently communicated to the public on the mass media. There is potential exposure to sulphonamide, chloramphenicol, and β-agonists from pork. Risk communication needs to focus on banned chemicals, while informing the public about the minimal risks associated with heavy metals.

  13. Researching the Viet Nam War inside Viet Nam: U.S. Student Teachers Explore War Myths

    Vadas, Robert E.


    The author asserts that it is time for social studies teachers to engage students in a review of the rift between historical reality and mythology about Viet Nam, especially in light of recent comparisons that many have made between the Viet Nam War and the current situation in Iraq. Few teachers dealt with Viet Nam at the time of the war, and…

  14. Nam June Paik / Nam June Paik ; interv. Tilman Baumgärtel

    Paik, Nam June


    Korea-ameerika kunstnikust Nam June Paikist (sünd. 1932), telefoniintervjuu kunstnikuga tema talvekodus Floridas 20.01.2001. Nam June Paiki töödest "Participation TV" (1963), "Video Synthesizer" (1969/70),sateliidiperformance'itest "Good Morning, Mr. Orwell!" (1980), "Bye Bye, Kipling" (1987) ja "Wrap around the World" (1988), näitusest "Electronic Superhighway" (1994) jm. Nam June Paik ka Internetist, Interneti-kunstist, töötamisest laseriga

  15. Hydro- and sediment dynamics in the estuary zone of the Mekong Delta: case study Dinh An estuary.

    Tran, Anh Tuan; Thoss, Heiko; Gratiot, Nicolas; Dussouillez, Philippe; Brunier, Guillaume; Apel, Heiko


    The Mekong River is the tenth largest river in the world, covers an area of 795,000 km2, 4400km in length, the main river flows over the six countries including: China, Myanmar, Thailand, Laos, Cambodia and Vietnam. Its water discharge is 470 km3year-1 and the sediment discharge is estimated about 160 million ton year-1. The sediment transported by the Mekong River is the key factor in the formation and development of the delta. It is a vital factor for the stability of the coastline and river banks. Furthermore it compensates land subsidence by floodplain deposition, and is the major natural nutrient source for agriculture and aquaculture. However, only a few studies were conducted to characterize and quantify sediment properties and process in the Delta. Also the morphodynamic processes were hardly studied systematically. Hence, this study targets to fill some important and open knowledge gaps with extensive field works that provide important information about the sediment properties and hydrodynamic processes in different seasons Firstly three field survey campaigns are carried out along a 30 km section of the Bassac River from the beginning of Cu Lao Dung Island to Dinh An estuary in 2015 and 2016. During the field campaign, the movement of the salt wedge and the turbidity were monitored by vertical profiles along the river, as well as discharge measurements by ADCP were carried out at three cross sections continuously for 72 hours. The extension of the salt wedge in the river was determined, along with mixing processes. The movement and dynamics observed under different flow conditions indicate that sediment was pumped during low flow upwards the river, while during high flow net transport towards the sea dominated. Also a distinct difference in the sediment properties in the different seasons was observed, with a general tendency towards a higher proportion of coarser particles in the high flow season. These quantitative results give insights into the

  16. British firms mark progress off Viet Nam



    British companies are making more inroads in exploring for oil and gas off Viet Nam. British Gas plc won a 25 year production sharing contract for a license off southern Viet Nam in the South China Sea. Meantime, London independent Lasmo plc started seismic surveys on the block adjoining the British Gas block. Separately, Thailand and Viet Nam have reached agreement to jointly explore for and develop oil and gas found in waters claimed by both countries. Plans call for the two countries to draw up joint development plans covering oil and gas resources in the southeastern fringe of the Gulf of Thailand. Bangkok officials say they would have preferred to delineate maritime boundaries with Hanoi, but opted for the joint development accord, noting that Thailand and Malaysia had taken 12 years to resolve a similar dispute

  17. Viet Nam national report: Greenhouse gas limitation

    Tuong, Le Nguyen; Hieu, Nguyen Khac.


    Viet Nam ratified the UNFCCC on 16 November 1994. The Hydro meteorological Service (HMS) has been assigned by the Government to take full responsibility for Climate Change issues and for implementing programs related to the objectives of the UNFCCC. The mount of GHG emission in Viet Nam is 111.7 Tg of CO 2 equivalent. It is expected that the amount will be increased dramatically in the coming decades because of fossil fuel consumption to meet energy demand in the country. Total CO 2 emissions would be increased from 101 Tg in 2000, to 139 Tg, 224 Tg and 433 Tg in 2010, 2020 and 2030 respectively. 13 GHG abatement options including 7 energy options and 6 non-energy options have been developed for this study. (EG)

  18. 31 CFR 500.560 - Bank accounts of official representatives of foreign governments in North Korea, North Viet-Nam...


    ... representatives of foreign governments in North Korea, North Viet-Nam, Cambodia, or South Viet-Nam. 500.560... governments in North Korea, North Viet-Nam, Cambodia, or South Viet-Nam. Specific licenses are issued... Viet-Nam, Cambodia, or South Viet-Nam for transactions which are not inconsistent with the purposes of...

  19. Health Costs Attributable to Smoking in Viet Nam | IDRC ...

    Health Costs Attributable to Smoking in Viet Nam ... and the government has a particular interest in the economic costs associated with high tobacco consumption. ... IWRA/IDRC webinar on climate change and adaptive water management.

  20. North American Mesoscale Forecast System (NAM) [12 km

    National Oceanic and Atmospheric Administration, Department of Commerce — The North American Mesoscale Forecast System (NAM) is one of the major regional weather forecast models run by the National Centers for Environmental Prediction...

  1. Viet Nam Economic Research Network (VERN) - Phase II | CRDI ...

    VERN I (101273) constituted the first network for young economic researchers in Viet Nam, where previously there had been no modality for cooperation or peer review. Guided by the philosophy of "understanding and managing globalization" that underpinned the earlier project, VERN II proposes to expand the network, ...

  2. Deforestation in Viet Nam | CRDI - Centre de recherches pour le ...

    Deforestation in Viet Nam reports on a innovative and timely study by a team of Vietnamese and Canadian researchers. It presents a labourious historical analysis of the smallest changes affecting soil use, forest cover, population, and political and socioeconomic characteristics. The book concludes with suggestions for ...

  3. Improving natural resource management in Viet Nam's Hong Ha ...


    Jul 15, 2011 ... Improving natural resource management in Viet Nam's Hong Ha commune ... In this work, the research team helped local farmers improve their land ... with a home garden economy, limit forest destruction, diversify crop production, ... low female participation rates in decision making; limited education; rapid ...

  4. Brain MR image segmentation using NAMS in pseudo-color.

    Li, Hua; Chen, Chuanbo; Fang, Shaohong; Zhao, Shengrong


    Image segmentation plays a crucial role in various biomedical applications. In general, the segmentation of brain Magnetic Resonance (MR) images is mainly used to represent the image with several homogeneous regions instead of pixels for surgical analyzing and planning. This paper proposes a new approach for segmenting MR brain images by using pseudo-color based segmentation with Non-symmetry and Anti-packing Model with Squares (NAMS). First of all, the NAMS model is presented. The model can represent the image with sub-patterns to keep the image content and largely reduce the data redundancy. Second, the key idea is proposed that convert the original gray-scale brain MR image into a pseudo-colored image and then segment the pseudo-colored image with NAMS model. The pseudo-colored image can enhance the color contrast in different tissues in brain MR images, which can improve the precision of segmentation as well as directly visual perceptional distinction. Experimental results indicate that compared with other brain MR image segmentation methods, the proposed NAMS based pseudo-color segmentation method performs more excellent in not only segmenting precisely but also saving storage.

  5. Tuberculosis case notification data in Viet Nam, 2007 to 2012.

    Nhung, Nguyen Viet; Hoa, Nguyen Binh; Khanh, Pham Huyen; Hennig, Cornelia


    Tuberculosis (TB) remains a major cause of morbidity and mortality, and Viet Nam ranks 12 among the 22 high-TB burden countries. This study analyses surveillance data of the National Tuberculosis Control Programme in Viet Nam for the six-year period 2007 to 2012. During the study period, 598,877 TB cases (all forms) were notified, and 313,225 (52.3%) were new smear-positive cases. The case notification rate of new smear-positive cases was decreased, from 65 per 100,000 population in 2007 to 57 per 100,000 population in 2012; this decrease was observed for males and females in all age groups except males aged 0-14 and females aged 15-24 years. The male-to-female ratio of new smear-positive TB cases increased from 2.85 in 2007 to 3.02 in 2012. The average annual cure rate of new smear-positive cases was 90.3%. The high male-to-female ratio for new smear-positive TB cases in this notification data was lower than that from the 2007 TB prevalence survey in Viet Nam, suggesting a lower case detection for males. The decrease in new smear-positive case notification rates may reflect a decline in TB incidence in Viet Nam as several programmatic improvements have been made, although further research is required to increase case detection among young males and children.

  6. Phylogeography of recently emerged DENV-2 in southern Viet Nam.

    Rabaa, Maia A; Ty Hang, Vu Thi; Wills, Bridget; Farrar, Jeremy; Simmons, Cameron P; Holmes, Edward C


    Revealing the dispersal of dengue viruses (DENV) in time and space is central to understanding their epidemiology. However, the processes that shape DENV transmission patterns at the scale of local populations are not well understood, particularly the impact of such factors as human population movement and urbanization. Herein, we investigated trends in the spatial dynamics of DENV-2 transmission in the highly endemic setting of southern Viet Nam. Through a phylogeographic analysis of 168 full-length DENV-2 genome sequences obtained from hospitalized dengue cases from 10 provinces in southern Viet Nam, we reveal substantial genetic diversity in both urban and rural areas, with multiple lineages identified in individual provinces within a single season, and indicative of frequent viral migration among communities. Focusing on the recently introduced Asian I genotype, we observed particularly high rates of viral exchange between adjacent geographic areas, and between Ho Chi Minh City, the primary urban center of this region, and populations across southern Viet Nam. Within Ho Chi Minh City, patterns of DENV movement appear consistent with a gravity model of virus dispersal, with viruses traveling across a gradient of population density. Overall, our analysis suggests that Ho Chi Minh City may act as a source population for the dispersal of DENV across southern Viet Nam, and provides further evidence that urban areas of Southeast Asia play a primary role in DENV transmission. However, these data also indicate that more rural areas are also capable of maintaining virus populations and hence fueling DENV evolution over multiple seasons.

  7. Some Aspects of the Teaching of English in Viet Nam.

    Le Van Diem

    In regard to the teaching of English, which is replacing French as a foreign language, Viet Nam presents some unique aspects and some individual problems. More secondary school students are selecting English as their foreign language choice; English departments in the universities are expanding rapidly; the teacher shortage is increasing. One…

  8. Inclusion in Viet Nam: More than a Decade of Implementation.

    Villa, Richard A.; Tac, Le Van; Muc, Pham Minh; Ryan, Susan; Thuy, Nguyen Thi Minh; Weill, Cindy; Thousand, Jacqueline S.


    This article traces the evolution of special education policies and services and the introduction of inclusive education as a service delivery model in Viet Nam. The impact of a series of inclusion projects and resultant goals of the Ministry of Education and Training to expand inclusive education are described. (Contains 8 references.) (Author/CR)

  9. Viet Nam steps up offshore E and D push



    This paper reports on Viet Nam's offshore exploration and development. Hanoi tentatively awarded three of five remaining blocks of prime offshore South China Sea acreage to companies from Europe and the Far East, with a fourth such award reported imminent. And state owned Petrovietnam signed a production sharing contract (PSC) covering acreage in the same area to a combine of British Petroleum Co. plc and Norway's Den norske stats oljeselskap AS. Retention of one block in the area covered by Viet Nam's second bidding round fueled speculation Hanoi is holding it in reserve for U.S. companies to enter bidding, pending easing of U.S. trade sanctions against Viet Nam, Agence France France (AFP) reported. Second round blocks have been carved from a concession held by Vietsovpetro, a joint venture of Petrovietnam and the former Soviet Union. All are in the southern Con Sun basin of the South China Sea off the port of Vung Tao and on trend with Viet Nam's only producing oil fields

  10. Globalization and the Governance of Education in Viet Nam

    London, Jonathan D.


    In a globalizing world, local and global governance arrangements are increasingly interdependent, which produces harmonization in some instances and new tensions and contradictions in others. Analysis shows that successive waves of globalization have affected the governance of education in Viet Nam differently. It shows that the globalization of…

  11. Habitat et environnement urbain au Viêt-nam

    Avant 1985, la construction et la gestion du logement au Viêt-nam étaient en ...... du contrôle administratif et n'ont pas été en mesure d'inciter le développement ...... et les syndicats, il est toutefois encore trop tôt pour juger de leur performance.

  12. Recent increase in sex ratio at birth in Viet Nam.

    Christophe Z Guilmoto

    Full Text Available INTRODUCTION: Since the 1980s, sex ratio at birth (male births per 100 female births has increased in many Asian countries as a result of selective abortions, but to date there has been no such evidence for Viet Nam. Our aim in this paper is to ascertain the situation with respect to sex ratio at birth in Viet Nam over the past five years. MATERIALS AND METHODS: Original data were obtained from sample population surveys in Viet Nam recording annual birth rates since 2000 of about 450,000 women, as well as from two successive birth surveys conducted for the first time in 2007 (1.1 million births. The annual population surveys include specific information on birth history and mothers' characteristics to be used for the analysis of trends and differentials in sex ratio at birth. RESULTS AND DISCUSSION: Birth history statistics indicate that the SRB in Viet Nam has recorded a steady growth since 2001. Starting from a level probably close to the biological standard of 105, the SRB reached 108 in 2005 and 112 in 2006, a value significantly above the normal level. An independent confirmation of these results comes from the surveys of births in health facilities which yielded a SRB of 110 in 2006-07. High SRB is linked to various factors such as access to modern health care, number of prenatal visits, level of higher education and employment status, young age, province of residence and prenatal sex determination. These results suggest that prenatal sex determination followed by selective abortion has recently become more common in Viet Nam. This recent trend is a consequence of various factors such as preference for sons, declining fertility, easy access to abortion, economic development as well as the increased availability of ultrasonography facilities.

  13. Recent increase in sex ratio at birth in Viet Nam.

    Guilmoto, Christophe Z; Hoàng, Xuyên; Van, Toan Ngo


    Since the 1980s, sex ratio at birth (male births per 100 female births) has increased in many Asian countries as a result of selective abortions, but to date there has been no such evidence for Viet Nam. Our aim in this paper is to ascertain the situation with respect to sex ratio at birth in Viet Nam over the past five years. Original data were obtained from sample population surveys in Viet Nam recording annual birth rates since 2000 of about 450,000 women, as well as from two successive birth surveys conducted for the first time in 2007 (1.1 million births). The annual population surveys include specific information on birth history and mothers' characteristics to be used for the analysis of trends and differentials in sex ratio at birth. Birth history statistics indicate that the SRB in Viet Nam has recorded a steady growth since 2001. Starting from a level probably close to the biological standard of 105, the SRB reached 108 in 2005 and 112 in 2006, a value significantly above the normal level. An independent confirmation of these results comes from the surveys of births in health facilities which yielded a SRB of 110 in 2006-07. High SRB is linked to various factors such as access to modern health care, number of prenatal visits, level of higher education and employment status, young age, province of residence and prenatal sex determination. These results suggest that prenatal sex determination followed by selective abortion has recently become more common in Viet Nam. This recent trend is a consequence of various factors such as preference for sons, declining fertility, easy access to abortion, economic development as well as the increased availability of ultrasonography facilities.

  14. Combiner L'Education Et Le Travail; Experiences en Asie et en Oceanie: Viet Nam (Combining Education and Work; Experiences in Asia and Oceania: Viet Nam).

    Vien, Hguyen Khac

    Educational policy in Viet Nam has closely followed the revolutionary movement. In the essentially democratic period from 1945 to 1960, Viet Nam created a nationwide 10-grade school system and fought illiteracy on a large scale. By 1960, as socialism began to predominate, especially in the North, traditional educational methods and values began to…

  15. Enterovirus D68 in Viet Nam (2009-2015).

    Ny, Nguyen Thi Han; Anh, Nguyen To; Hang, Vu Thi Ty; Nguyet, Lam Anh; Thanh, Tran Tan; Ha, Do Quang; Minh, Ngo Ngoc Quang; Ha, Do Lien Anh; McBride, Angela; Tuan, Ha Manh; Baker, Stephen; Tam, Pham Thi Thanh; Phuc, Tran My; Huong, Dang Thao; Loi, Tran Quoc; Vu, Nguyen Tran Anh; Hung, Nguyen Van; Minh, Tran Thi Thuy; Xang, Nguyen Van; Dong, Nguyen; Nghia, Ho Dang Trung; Chau, Nguyen Van Vinh; Thwaites, Guy; van Doorn, H Rogier; Anscombe, Catherine; Le Van, Tan


    Since 1962, enterovirus D68 (EV-D68) has been implicated in multiple outbreaks and sporadic cases of respiratory infection worldwide, but especially in the USA and Europe with an increasing frequency between 2010 and 2014. We describe the detection, associated clinical features and molecular characterization of EV-D68 in central and southern Viet Nam between 2009 and 2015. Enterovirus/rhinovirus PCR positive respiratory or CSF samples taken from children and adults with respiratory/central nervous system infections in Viet Nam were tested by an EV-D68 specific PCR. The included samples were derived from 3 different observational studies conducted at referral hospitals across central and southern Viet Nam between 2009 and 2015. Whole-genome sequencing was carried out using a MiSeq based approach. Phylogenetic reconstruction and estimation of evolutionary rate and recombination were carried out in BEAST and Recombination Detection Program, respectively. EV-D68 was detected in 21/625 (3.4%) enterovirus/rhinovirus PCR positive respiratory samples but in none of the 15 CSF. All the EV-D68 patients were young children (age range: 11.8 - 24.5 months) and had moderate respiratory infections. Phylogenetic analysis suggested that the Vietnamese sequences clustered with those from Asian countries, of which 9 fell in the B1 clade, and the remaining sequence was identified within the A2 clade. One intra sub-clade recombination event was detected, representing the second reported recombination within EV-D68. The evolutionary rate of EV-D68 was estimated to be 5.12E -3 substitutions/site/year. Phylogenetic analysis indicated that the virus was imported into Viet Nam in 2008. We have demonstrated for the first time EV-D68 has been circulating at low levels in Viet Nam since 2008, associated with moderate acute respiratory infection in children. EV-D68 in Viet Nam is most closely related to Asian viruses, and clusters separately from recent US and European viruses that were

  16. Two Integrator Loop Filters: Generation Using NAM Expansion and Review

    Ahmed M. Soliman


    Full Text Available Systematic synthesis method to generate a family of two integrator loop filters based on nodal admittance matrix (NAM expansion is given. Eight equivalent circuits are obtained; six of them are new. Each of the generated circuits uses two grounded capacitors and employs two current conveyors (CCII or two inverting current conveyors (ICCII or a combination of both. The NAM expansion is also used to generate eight equivalent grounded passive elements two integrator loop filters using differential voltage current conveyor (DVCC; six of them are new. Changing the input port of excitation, two new families of eight unity gain lowpass filter circuits each using two CCII or ICCII or combination of both or two DVCC are obtained.

  17. Social networks, geographic proximity, and firm performance in Viet Nam

    Howard, Emma


    This paper uses panel data to assess the relative importance of social networks and geographic proximity to micro, small, and medium enterprises in Viet Nam. The results suggest that a larger social network, and hiring employees mainly through social networks, are both correlated with higher value added per worker. The number of government officials and civil servants in a firm's network emerges as particularly important. When the quality of contacts is controlled for, firms with tighter soci...

  18. Phylogeography of recently emerged DENV-2 in southern Viet Nam.

    Maia A Rabaa


    Full Text Available Revealing the dispersal of dengue viruses (DENV in time and space is central to understanding their epidemiology. However, the processes that shape DENV transmission patterns at the scale of local populations are not well understood, particularly the impact of such factors as human population movement and urbanization. Herein, we investigated trends in the spatial dynamics of DENV-2 transmission in the highly endemic setting of southern Viet Nam. Through a phylogeographic analysis of 168 full-length DENV-2 genome sequences obtained from hospitalized dengue cases from 10 provinces in southern Viet Nam, we reveal substantial genetic diversity in both urban and rural areas, with multiple lineages identified in individual provinces within a single season, and indicative of frequent viral migration among communities. Focusing on the recently introduced Asian I genotype, we observed particularly high rates of viral exchange between adjacent geographic areas, and between Ho Chi Minh City, the primary urban center of this region, and populations across southern Viet Nam. Within Ho Chi Minh City, patterns of DENV movement appear consistent with a gravity model of virus dispersal, with viruses traveling across a gradient of population density. Overall, our analysis suggests that Ho Chi Minh City may act as a source population for the dispersal of DENV across southern Viet Nam, and provides further evidence that urban areas of Southeast Asia play a primary role in DENV transmission. However, these data also indicate that more rural areas are also capable of maintaining virus populations and hence fueling DENV evolution over multiple seasons.

  19. Assessing the impact of climate change on the water intake of the headworks on the Red River Basin in Viet Nam

    Pham Thi Huong Lan


    Full Text Available The irrigation systems for the Red River Delta usually get water by pumping and gravity.The results determine the possible minimum water level line in the dry-season months under climate change scenarios (B2, SC5 and SC6 and current scenario is B2, SC4 on the river system of the Red River – Thai Binh River in study areas of project as below: Water levels on the Red River in the dry season under climate change scenarios significantly reduced compared with 2010. At Ha Noi station on Red River, the water levels reduce in 2050 about 6.5cm (B2 and 7.5cm (A2 and 6cm (B1. At Nam Dinh station on Dao River, the water levels reduce in 2050 about 4cm (B2 and 5cm (A2 and 3cm (B1. At Cat Khe on Thai Binh River, the water levels reduce in 2050 about 2cm (B2 and 3cm (A2 and 1.5cm (B1. At An Bai on Kinh Thay River, the water levels reduce in 2050 about 5cm (B2 and 6cm (A2 and 4cm (B1. At Truc Phuong on Ninh Co River, the water levels reduce in 2050 about 6.5cm (B2 and 7.2cm (A2 and 5.8cm (B1. In the scenario in which 50% of the socio-economic development plans are achieved (SC6, the water demand is lower than the scenario of full development (SC5. The decrease in the average water level in the whole Red River system is about 1.3-1.8 cm less than in SC5, and in Thai Binh river this figure is about 1.4-2.1cm. The lowering of the water level under climate change in the river has caused problems for irrigation during the dry season, in order to reach the target level in Hanoi.

  20. Habitat et environnement urbain au Viet-Nam: Hanoi et Hô Chi Minh ...

    With an annual income of approximately $200 US per capita, the Socialist Republic of Viet Nam is one of the world's poorest countries. It has been repetitively devastated by armed conflicts and frequent large-scale natural disasters for over 50 years. Viet Nam's population is estimated to approximately 70 million, 80% of ...

  1. Home From the War: A Study of Psychiatric Problems in Viet Nam Returnees.

    Strange, Robert E.; Brown, Dudley E., Jr.


    Fifty patients who developed psychiatric problems after return from tours of Viet Nam combat duty were compared with a group of patients who had not had such duty. The Viet Nam returnees reported more conflicts in intimate relationships and had a higher incidence of depression and somatization than did the noncombat group. A study was made of…

  2. Analysing Key Debates in Education and Sustainable Development in Relation to ESD Practice in Viet Nam

    Balls, Emily


    This article is based on qualitative field research carried out in Ha Noi, Viet Nam, in 2013 for an MA dissertation in Education and International Development at the UCL Institute of Education. It analyses interpretations of education for sustainable development (ESD) in Viet Nam, relating these to key debates around instrumental and democratic…

  3. Maternal health care utilization in Viet Nam: increasing ethnic inequity.

    Målqvist, Mats; Lincetto, Ornella; Du, Nguyen Huy; Burgess, Craig; Hoa, Dinh Thi Phuong


    To investigate changes that took place between 2006 and 2010 in the inequity gap for antenatal care attendance and delivery at health facilities among women in Viet Nam. Demographic, socioeconomic and obstetric data for women aged 15-49 years were extracted from Viet Nam's Multiple Indicator Cluster Survey for 2006 (MICS3) and 2010-2011 (MICS4). Multivariate logistic regression was performed to determine if antenatal care attendance and place of delivery were significantly associated with maternal education, maternal ethnicity (Kinh/Hoa versus other), household wealth and place of residence (urban versus rural). These independent variables correspond to the analytical framework of the Commission on Social Determinants of Health. Large discrepancies between urban and rural populations were found in both MICS3 and MICS4. Although antenatal care attendance and health facility delivery rates improved substantially between surveys (from 86.3 to 92.1% and from 76.2 to 89.7%, respectively), inequities increased, especially along ethnic lines. The risk of not giving birth in a health facility increased significantly among ethnic minority women living in rural areas. In 2006 this risk was nearly five times higher than among women of Kinh/Hoa (majority) ethnicity (odds ratio, OR: 4.67; 95% confidence interval, CI: 2.94-7.43); in 2010-2011 it had become nearly 20 times higher (OR: 18.8; 95% CI: 8.96-39.2). Inequity in maternal health care utilization has increased progressively in Viet Nam, primarily along ethnic lines, and vulnerable groups in the country are at risk of being left behind. Health-care decision-makers should target these groups through affirmative action and culturally sensitive interventions.

  4. Adequacy of anti-tuberculosis drug prescriptions in Viet Nam

    Hoa, N B; Lauritsen, J M; Rieder, H L


    SETTING: National Tuberculosis Program, Viet Nam, 2008. OBJECTIVES: To determine drug prescription adherence to national guidelines, to examine factors associated with an erroneous dosage of rifampin (RMP) and to evaluate the impact of an insufficient RMP dosage on treatment outcome. METHODS......: A representative sample of 30 treatment units was randomly selected. All patient treatment cards enrolled in these units were obtained, and data were double-entered and validated before calculating the adequacy of the individual drug prescriptions. RESULTS: Of 3412 tuberculosis treatment cards, 3225 (94.5%) had...

  5. Le Recul de la Forêt au Viet Nam

    Le fait d'ignorer la réalité pragmatique dans un souci d'opportunisme politique ne ... Si le texte de l'étude que voici a été rédigé en solo, les choses ont été fort différentes sur ..... Parmi les ressources requises par le système mondial — mis en place par les .... Les guerres dont le Viet Nam a été le théâtre au cours du dernier ...

  6. Cooperation of nuclear manpower development between Viet Nam and Korea in order to enhance establishment of infrastructure in exporting nuclear technology to Viet Nam

    Lee, E. J.; Han, K. W.; Park, J. K.; Kim, Y. T.; Nam, Y. M.; Jang, Y. H.; Yang, M. H.


    Through this project, KAERI provided OJT Programme to 3 nuclear experts of Viet Nam at the KAERI for 3 months as a cooperation of human resource development in the field of nuclear policy, nuclear safety analysis and thermo hydraulic. We could have publicity activities of S/W and H/W then achieve an advantage position of economical and technical in exporting nuclear technology to Viet Nam. Also we have provided a training course and seminar for a high-level delegation of nuclear policy decision makers, which is consisted of 5 deputy ministers and general directors of Viet Nam in Korea. Thus we could have Vietnamese who are favoring Korea. The KAERI will also prepare a data base of trained Vietnamese in Korea for the maximum utilization of them in cooperating with Viet Nam. We accomplished the cooperation of human resource development and providing program and curriculum of the nuclear education and training in Viet Nam. Furthermore, it is expected that the enhancement of nuclear technical cooperation between Viet Nam and Korea and the nuclear human resource development

  7. Cooperation of nuclear manpower development between Viet Nam and Korea in order to enhance establishment of infrastructure in exporting nuclear technology to Viet Nam

    Lee, E. J.; Han, K. W.; Park, J. K.; Kim, Y. T.; Nam, Y. M.; Jang, Y. H.; Yang, M. H


    Through this project, KAERI provided OJT Programme to 3 nuclear experts of Viet Nam at the KAERI for 3 months as a cooperation of human resource development in the field of nuclear policy, nuclear safety analysis and thermo hydraulic. We could have publicity activities of S/W and H/W then achieve an advantage position of economical and technical in exporting nuclear technology to Viet Nam. Also we have provided a training course and seminar for a high-level delegation of nuclear policy decision makers, which is consisted of 5 deputy ministers and general directors of Viet Nam in Korea. Thus we could have Vietnamese who are favoring Korea. The KAERI will also prepare a data base of trained Vietnamese in Korea for the maximum utilization of them in cooperating with Viet Nam. We accomplished the cooperation of human resource development and providing program and curriculum of the nuclear education and training in Viet Nam. Furthermore, it is expected that the enhancement of nuclear technical cooperation between Viet Nam and Korea and the nuclear human resource development.

  8. My Folkloristic History of the Việt Nam War: A Non-communist Experience

    Le, Long S


    Like many families who were on the “wrong” side of the Việt Nam war, my family history has effectively been “displaced” from official discourse in Việt Nam when the country was “reunified” in 1975, as well as in the discourse of public history in the U.S. which has overwhelmingly emphasized the “lessons” of the “American Experience” in Việt Nam. Using my family history as an index of historical processes, I hope to introduce windows on the continuities of what noncommunist Vietnamese do and ...

  9. Role of alcohol in hospitalized road trauma in Viet nam.

    Nguyen, Nam Phuong; Passmore, Jonathon; Tran, Lan Thi Ngoc; Luong, Anh Mai


    To assess the blood alcohol concentration (BAC; dependent variable) of patients with road traffic injuries (RTIs) presenting at 3 provincial and central hospitals in the Socialist Republic of Viet Nam by age, sex, and road user type (independent variables). This survey formed part of the Viet Nam Road Traffic Injury Prevention Project, funded by Bloomberg Philanthropies. RTIs are a leading cause of death and disability in Viet Nam, with 14,690 deaths and 143,940 injuries reported by the Ministry of Health (MOH) in 2010. Research estimates suggest that motorcycle riders and passengers account for 60 percent of fatalities. Alcohol has long been suspected of being a leading cause of road traffic collisions and injuries. However, until now data on this relationship have been limited. A descriptive cross-sectional study measuring BAC in all consenting patients with RTIs presenting at 3 provincial or central hospitals between July 2009 and September 2010. All results were anonymous and summary information on key variables was sent to MOH and the World Health Organization (WHO) on a monthly basis. Of the 36,418 patients with RTIs presenting to these 3 hospitals between July 2009 and September 2010, BAC analysis was completed on 14,990 patients (41.2%), representing all patients with RTIs 15 years of age and above who consented to anonymous testing. BAC results ranged from 0 to 0.589 g/dL blood, with a mean of 0.0441 g/dL being the average concentration among all tested patients. Of all patients tested, 56.8 percent had no detectable alcohol in their system. Motorcycle riders were most commonly represented in the tested sample (70.7%), with 27.8 percent having a BAC above the legal limit (0.05 g/dL). Car or other vehicle drivers represented 2.7 percent of the sample, with 63.4 percent tested having a BAC above 0 g/dL, the legal limit for these road users. The results of this preliminary study indicate that 29.1 percent of all car drivers and motorcycle riders presenting at

  10. Ecological Modernisation Theory and Industrialising Economies : The Case of Viet Nam

    Frijns, J.; Phuong Thuy Phung,; Mol, A.P.J.


    As Ecological Modernisation Theory has been developed against the background of European industrialised societies, the value and applicability of Ecological Modernisation Theory for developing or industrialising economies is often questioned. This article explores this controversy by taking Viet Nam

  11. Viet Nam, once isolated, poised for significant role in oil and gas



    This paper reports that Viet Nam is on its way up in the petroleum world. After years of international isolation, the country is poised for a flurry of exploration by international oil companies in the early 1990s. Viet Nam has joined the Soviet Union as the only members of the now dissolved, formerly Moscow dominated, 10 nation Council for Mutual Economic Assistance (CMEA) that are self-sufficient in oil production. Moreover, Viet Nam has far outstripped neighboring China, which was not a CMEA member, in offshore oil flow even though China has a much larger Outer Continental Shelf. Prospects are that Viet Nam will continue to lead China in offshore oil production until 1995 at least

  12. The Scientific and Technical Revolution in the Socialist Republic of Viet Nam.

    Vien, Nguyen Khac


    Discussed are the reasons for the Socialist Republic of Viet Nam's scientific backwardness. A development project which will enable this country to become a modern, economically self-sufficient country by the year 2000 is outlined. (BT)

  13. Tax Rates Effects on the Risk Level of Listed Viet Nam Wholesale ...


    The emerging stock market in Viet Nam has been developed since 2006 and was affected ... positive relationship with the increasing levels of tax rate. Finally, this ... Hypothesis 1: because tax may strongly affect business returns, changing tax.

  14. South China sea off Viet Nam to see more exploration



    British and Japanese operators are posed for exploration campaigns off southern Viet Nam. This paper reports that a 50-50 partnership of Lasmo International Ltd., London, and C. Itoh Exploration Co. of Japan signed a heads of agreement covering Block 04-2, and AEDC Vietnam Oil Development Co. and Teikoku Oil Co. acquired Block 05-3 under a production sharing contract. AEDC is a unit of AOC Energy Development Co., a subsidiary of Arabian Oil Co. (AOC) of Japan. Both tracts are in the Con Son basin in the South China Sea. Site is 15 km north of 500 million bbl Dai Hung (Big Bear) oil field for which state owned Petrovietnam is evaluating bids to place on production. A unit of the Royal Dutch/shell Group acquired a west offset, Block 10, early this year. The Lasmo-C. Itoh acreage is among five blocks offered in Vietnam's second round of offshore licensing. All are in the area that once was reserved entirely for Vietsovpetro, a partnership of Petrovietnam and the former Soviet Union

  15. Adequacy of anti-tuberculosis drug prescriptions in Viet Nam.

    Hoa, N B; Lauritsen, J M; Rieder, H L


    National Tuberculosis Program, Viet Nam, 2008. To determine drug prescription adherence to national guidelines, to examine factors associated with an erroneous dosage of rifampin (RMP) and to evaluate the impact of an insufficient RMP dosage on treatment outcome. A representative sample of 30 treatment units was randomly selected. All patient treatment cards enrolled in these units were obtained, and data were double-entered and validated before calculating the adequacy of the individual drug prescriptions. Of 3412 tuberculosis treatment cards, 3225 (94.5%) had information on treatment regimen and the patient's weight. Treatment was successful in 89.4%. Prescriptions of tablets/vials conforming to recommendations were found for respectively 91.2%, 89.9%, 92.3% and 94.6% of the patients for RMP/isoniazid, pyrazinamide, ethambutol and streptomycin. Patients in the 25-39 kg weight bracket received insufficient dosages. This was almost entirely attributable to patients at the end of the weight bracket. Nevertheless, no significant association was found between treatment failure and death, body weight and insufficient RMP dosage. Adherence to national recommendations was high. RMP was given in insufficient dosage for patients at the end of a weight range bracket, but the under-dosage was small and did not measurably affect treatment outcome.

  16. Pesticide regulations and farm worker safety: the need to improve pesticide regulations in Viet Nam.

    Phung, Dung Tri; Connell, Des; Miller, Greg; Rutherford, Shannon; Chu, Cordia


    Agricultural pesticide use in Viet Nam has more than tripled since 1990. However, pesticide legislation and regulations have not been developed in response to this large increase in usage, as a result of which pesticides pose a serious threat to human health and the environment. This paper identifies the need to improve pesticide regulations in Viet Nam through a comparative analysis of pesticide regulations in Viet Nam and the United States of America, where the rate of acute poisoning among agricultural workers is much lower than in Viet Nam and where information pertaining to pesticide regulations is made accessible to the public. The analysis identified several measures that would help to improve Viet Nam's pesticide regulations. These include enhancing pesticide legislation, clarifying the specific roles and active involvement of both the environmental and health sectors; performing a comprehensive risk-benefit evaluation of pesticide registration and management practices; improving regulations on pesticide suspension and cancellation, transport, storage and disposal; developing import and export policies and enhancing pesticide-related occupational safety programmes.

  17. Stimulating the development of national Streptococcus suis guidelines in Viet Nam through a strategic research partnership.

    Horby, Peter; Wertheim, Heiman; Ha, Nguyen Hong; Trung, Nguyen Vu; Trinh, Dao Tuyet; Taylor, Walter; Ha, Nguyen Minh; Lien, Trinh Thi Minh; Farrar, Jeremy; Van Kinh, Nguyen


    Streptococcus suis is a common cause of adult bacterial meningitis in Viet Nam, and possibly other parts of Asia, yet this disabling infection has been largely neglected. Prevention, diagnosis and treatment are relatively straightforward and affordable but, in early 2007, no national diagnostic, case management or prevention guidelines existed in Viet Nam. Enhanced detection of S. suis infections was established in 2007 as part of a collaborative research programme between the National Hospital for Tropical Diseases, a key national hospital with very close links to the Ministry of Health, and a research group affiliated with Oxford University based in Viet Nam. The results were reported directly to policy-makers at the Ministry of Health. Viet Nam is a low-income country with a health-care system that has seen considerable improvements and increased autonomy. However, parts of the system remain fairly centralized the Ministry of Health. Following the improved detection and reporting of S. suis cases, the Ministry of Health issued guidance to all hospitals in Viet Nam on the clinical and laboratory diagnosis, treatment and prevention of S. suis. A public health laboratory diagnostic service was established at the National Institute of Hygiene and Epidemiology and training courses were conducted for clinicians and microbiologists. Ministry of Health guidance on surveillance and control of communicable diseases was updated to include a section on S. suis. Research collaborations can efficiently inform and influence national responses if they are well positioned to reach policy-makers.

  18. Characterisation of Mycobacterium tuberculosis isolates lacking IS6110 in Viet Nam.

    Huyen, M N T; Tiemersma, E W; Kremer, K; de Haas, P; Lan, N T N; Buu, T N; Sola, C; Cobelens, F G J; van Soolingen, D


    The molecular diagnosis of tuberculosis (TB) in Viet Nam is often based on the detection of insertion sequence (IS) 6110 in Mycobacterium tuberculosis. However, 8-11% of M. tuberculosis strains in South-East Asia do not contain this target and this undermines the validity of these molecular tests. We quantified the frequency of M. tuberculosis strains lacking IS6110 in rural Viet Nam and studied their epidemiological and clinical characteristics. Consecutively diagnosed adult TB patients in rural Southern Viet Nam submitted two sputum samples for culture, IS6110 restriction fragment length polymorphism (RFLP) spoligotyping and 15-loci variable number tandem repeat typing. Polymerase chain reaction (PCR) was performed to confirm the absence of IS6110 elements in strains lacking IS6110 hybridisation in RFLP. Among 2664 TB patient isolates examined, 109 (4.1%) had no IS6110 element. Compared to other strains, these no-copy strains were less often resistant to anti-tuberculosis drugs, particularly to streptomycin (adjusted OR 0.2, 95%CI 0.1-0.5), and showed significant geographic variation. No associations with TB history or demographic factors were found. Strains without the IS6110 target pose a problem in Viet Nam as regards false-negative molecular TB diagnosis in PCR. Compared to other strains circulating in Viet Nam, no-copy strains are more susceptible to anti-tuberculosis drugs.

  19. Costs of providing tuberculosis diagnosis and treatment services in Viet Nam.

    Minh, H V; Mai, V Q; Nhung, N V; Hoi, L V; Giang, K B; Chung, L H; Kien, V D; Duyen, N T; Ngoc, N B; Anh, T T; Phuong, T B; Ngan, T T; Khanh, P H


    To estimate the cost of providing tuberculosis (TB) diagnosis and treatment packages at different levels of health facilities in Viet Nam. This was a retrospective costing study from the providers' perspective using a standard costing approach. We included typical services for TB diagnosis and treatment based on standard protocols. The least expensive TB service was the 6-month isoniazid preventive therapy regimen for latent tuberculous infection provided by district health centres (US$7.20-14.30, accounting for 0.3-0.7% of Viet Nam's per capita gross domestic product [GDP] of US$2052.30 in 2014). The cost of diagnosing and treating a patient with drug-susceptible TB (the most common type of TB) ranged between US$51.20 and US$180.70, and represented 2.5-8.8% of Viet Nam's per capita GDP in 2014. The most expensive TB service was the diagnosis and treatment of a multidrug-resistant TB case (US$1568.20-2391.20), accounting for 76.4-116.5% of Viet Nam's per capita GDP in 2014). The cost of TB diagnosis and treatment services in Viet Nam varied according to level of health facility, type of TB, different costing options, and different staff cost scenarios.

  20. Viet Nam [Status and technology of polymer-containing fibrous materials in the Eastern Hemisphere

    Le-Van-Thoi, [Viet Nam Atomic Energy Office, Saigon (Viet Nam)


    In South Viet Nam, forest covers about 30% of the land area or approximately 6 000 000 ha. Hardwoods comprise about 80% of the timber stock. The total growing stock is not known exactly. Forest inventory is difficult in Viet Nam since some areas are inaccessible in the virgin forest. Overcutting by the population for domestic uses should also be mentioned together with fire damage, destruction by the war, etc. Practically all species of fibrous wood which are common in South- East Asia grow in Viet Nam. Pine trees especially account for about 2% of the forest and bamboo for 1%, and rubber trees, kenaf and jute are abundant. Valuable fibrous materials other than wood are agricultural wastes such as rice straw and bagasse. Table I presents a list of the most common fibrous plants of Viet Nam; their importance, however, cannot be evaluated. In addition, restricted numbers of these plants are consumed by the population of the region where they grow wild. Exploitation is, in fact, purely artisanal and tends merely to meet local needs. Cotton plants (Gossipium herbaceum) grow mainly in Central Viet Nam; the cotton product is not of good quality since the fibres are not very long.

  1. My Folkloristic History of the Việt Nam War: A Non-communist Experience

    Long S. Le


    Full Text Available Like many families who were on the “wrong” side of the Việt Nam war, my family history has effectively been “displaced” from official discourse in Việt Nam when the country was “reunified” in 1975, as well as in the discourse of public history in the U.S. which has overwhelmingly emphasized the “lessons” of the “American Experience” in Việt Nam. Using my family history as an index of historical processes, I hope to introduce windows on the continuities of what noncommunist Vietnamese do and think. My family folklore is utilized as a way to create opportunities for other non-communist Vietnamese here and elsewhere to connect, articulate, or remind them of a pattern from the past that can provide a contemporary coherence with an ethic workable for the future.

  2. Disease spectrum and management of children admitted with acute respiratory infection in Viet Nam.

    Nguyen, T K P; Nguyen, D V; Truong, T N H; Tran, M D; Graham, S M; Marais, B J


    To assess the acute respiratory infection (ARI) disease spectrum, duration of hospitalisation and outcome in children hospitalised with an ARI in Viet Nam. We conducted a retrospective descriptive study of ARI admissions to primary (Hoa Vang District Hospital), secondary (Da Nang Hospital for Women and Children) and tertiary (National Hospital of Paediatrics in Ha Noi) level hospitals in Viet Nam over 12 months (01/09/2015 to 31/08/2016). Acute respiratory infections accounted for 27.9% (37 436/134 061) of all paediatric admissions; nearly half (47.6%) of all children admitted to Hoa Vang District Hospital. Most (64.6%) of children hospitalised with an ARI were Viet Nam, characterised by prolonged hospitalisation for relatively mild disease. There is huge potential to reduce unnecessary hospital admission and cost. © 2017 John Wiley & Sons Ltd.

  3. Implementation of GINA guidelines in Ho Chi Minh City: a model for Viet Nam.

    Tho, N V; Loan, H T H; Thao, N T P; Dung, N T T; Lan, L T T


    The Global Initiative for Asthma (GINA) guidelines have not been implemented effectively in primary care settings in Viet Nam. To estimate the proportion of patients with controlled asthma and the direct health care costs of managing asthma according to GINA guidelines at four out-patient clinics in Ho Chi Minh City (HCMC), Viet Nam. One hundred and six patients with asthma were treated and followed up according to GINA guidelines for 12 months. Clinical and pulmonary function responses and direct health care costs were evaluated every 3 months during the study. The proportion of patients with controlled asthma rose from 1.0% at the start of the study to 36.8% by the end of the study (P Viet Nam, improved asthma control with modest direct health care costs.

  4. A multicentre molecular analysis of hepatitis B and blood-borne virus coinfections in Viet Nam.

    Dunford, Linda; Carr, Michael J; Dean, Jonathan; Nguyen, Linh Thuy; Ta Thi, Thu Hong; Nguyen, Binh Thanh; Connell, Jeff; Coughlan, Suzie; Nguyen, Hien Tran; Hall, William W; Thi, Lan Anh Nguyen


    Hepatitis B (HBV) infection is endemic in Viet Nam, with up to 8.4 million individuals estimated to be chronically infected. We describe results of a large, multicentre seroepidemiological and molecular study of the prevalence of HBV infection and blood-borne viral coinfections in Viet Nam. Individuals with varying risk factors for infection (n = 8654) were recruited from five centres; Ha Noi, Hai Phong, Da Nang, Khanh Hoa and Can Tho. A mean prevalence rate of 10.7% was observed and levels of HBsAg were significantly higher in injecting drug users (IDUs) (17.4%, n = 174/1000) and dialysis patients (14.3%, n = 82/575) than in lower-risk groups (9.4%; pViet Nam and also highlights the significant levels of blood-borne virus coinfections, which have important implications for hepatitis-related morbidity and development of effective management strategies.

  5. The political sublime. reading Kok Nam, Mozambican photographer (1939-2012

    Rui Assubuji

    Full Text Available Kok Nam began his photographic career at Studio Focus in Lourenco Marques in the 1950s, graduated to the newspaper Noticias and joined Tempo magazine in the early 1970s. Most recently he worked at the journal Savana as a photojournalist and later director. This article opens with an account of the relationship that developed between Kok Nam and the late President Samora Machel, starting with the photographer's portrait of Machel in Nachingwea in November 1974 before Independence. It traces an arc through the Popular Republic (1976-1990 from political revelation at its inception to the difficult years of civil war and Machel's death in the plane crash at Mbuzini in 1986. The article then engages in a series of photo-commentaries across a selection of Kok Nam's photographs, several published in their time but others selected retrospectively by Kok Nam for later exhibition and circulation. The approach taken is that of 'association', exploring the connections between the photographs, their histories both then and in the intervening years and other artifacts and mediums of cultural expression that deal with similar issues or signifiers picked up in the images. Among the signifiers picked up in the article are soldiers, pigs, feet, empty villages, washing, doves and bridges. The central argument is that Kok Nam participated with many others in a kind of collective hallucination during the Popular Republic, caught up in the 'political sublime'. Later Kok Nam shows many signs of a photographic 'second thinking' that sought out a more delicate sublime in his own archive.

  6. The promises and perils of hospital autonomy: reform by decree in Viet Nam.

    London, Jonathan D


    This article investigates impacts of hospital autonomization in Viet Nam employing a "decision-space" framework that examines how hospitals have used their increased discretion and to what effect. Analysis suggests autonomization is associated with increased revenue, increasing staff pay, and greater investment in infrastructure and equipment. But autonomization is also associated with more costly and intensive treatment methods of uncertain contribution to the Vietnamese government's stated goal of quality healthcare for all. Impacts of autonomization in district hospitals are less striking. Despite certain limitations, the analysis generates key insights into early stages of hospital autonomization in Viet Nam. Copyright © 2013 The Author. Published by Elsevier Ltd.. All rights reserved.

  7. The effects of placing an operational research fellow within the Viet Nam National Tuberculosis Programme.

    Hoa, N B; Nhung, N V; Kumar, A M V; Harries, A D


    In April 2009, an operational research fellow was placed within the Viet Nam National Tuberculosis Control Programme (NTP). Over the 6 years from 2010 to 2015, the OR fellow co-authored 21 tuberculosis research papers (as principal author in 15 [71%]). This constituted 23% of the 91 tuberculosis papers published in Viet Nam during this period. Of the 21 published papers, 16 (76%) contributed to changes in policy ( n = 8) and practice ( n = 8), and these in turn improved programme performance. Many papers also contributed important evidence for better programme planning. Highly motivated OR fellows embedded within NTPs can facilitate high-quality research and research uptake.

  8. Reliability analysis of the Red River dikes system in Viet Nam

    Pham Quang, T.


    This dissertation presents the applications of probabilistic-based frameworks in geotechnical and hydraulic engineering, for the assessment of the Red River dikes in Viet Nam. Dike along rivers often spread over the deltaic environment and its earthen structures are parts of a long civilian history,

  9. A contextual ICA stakeholder model approach for the Namibian spatial data infrastructure (NamSDI)

    Sinvula, KM


    Full Text Available In 2011, the Namibian parliament presented and promulgated the Namibian Spatial Data Infrastructure (NamSDI) with the aim of promoting the sharing and improved access and use of geospatial data and services across Namibia. Notable SDI models...

  10. Identifying factors for job motivation of rural health workers in North Viet Nam

    Dieleman, Marjolein; Cuong, Pham Viet; Anh, Le Vu; Martineau, Tim


    BACKGROUND: In Viet Nam, most of the public health staff (84%) currently works in rural areas, where 80% of the people live. To provide good quality health care services, it is important to develop strategies influencing staff motivation for better performance. METHOD: An exploratory qualitative

  11. Viet Nam at the Crossroads: The Role of Science and Technology ...

    In response, IDRC and CIDA assembled a team of experts into a mission with the following objectives: Assess the impact of current Vietnamese science and technology policies on the economic and social development of Viet Nam;. Compare the Vietnamese experience with regard to science and technology policies with ...

  12. The formulation and implementation of a national helmet law: a case study from Viet Nam.

    Passmore, Jonathon W; Nguyen, Lan Huong; Nguyen, Nam Phuong; Olivé, Jean-Marc


    Road traffic injuries are a leading cause of death and disability in Viet Nam. In 2008, official data reported 11 243 deaths and 7771 serious injuries on the roads, of which an estimated 60% of fatalities occur in motorcycle riders and passengers. In recognition of this problem, Viet Nam has had partial motorcycle helmet legislation since 1995. However, for a variety of reasons, implementation and enforcement have been limited. On 15 December 2007, Viet Nam's first comprehensive mandatory helmet law came into effect, covering all riders and passengers on all roads nationwide. Penalties increased ten-fold and cohorts of police were mobilized for enforcement. The Viet Nam national helmet legislation was developed and implemented by the National Traffic Safety Committee. Despite past barriers to enforcement, increased policing in 2008 led to 680 000 infringements being issued for non-helmet wearing. While changes in helmet wearing were not nationally observed, significant increases were documented in selected provinces in the first six months of the law's introduction. In Da Nang, helmet wearing increased from 27 to 99%. In the first three months after the law took effect, surveillance data from 20 urban and rural hospitals, found the risk of road traffic head injuries and deaths decreased by 16% and 18% respectively. Political leadership, intensive advanced public education and stringent enforcement have contributed to the successful implementation of the new law. Through continual monitoring of the legislation, loopholes detrimental to the effectiveness of the law have been identified and addressed.

  13. Completeness and consistency in recording information in the tuberculosis case register, Cambodia, China and Viet Nam.

    Hoa, N B; Wei, C; Sokun, C; Lauritsen, J M; Rieder, H L


    Tuberculosis (TB) case registers in Cambodia, two provinces in China and in Viet Nam. To determine completeness and consistency of information for quarterly reports on case finding and treatment outcome. A representative sample of TB case registers was selected in Cambodia, in two provinces in China and in Viet Nam. Quarterly reports were reproduced from double-entered, validated data to determine completeness and consistency. The dataset comprised 37,635 patient records in 2 calendar years. Only 0.2%, 3.6% and 1.1% of cases, respectively, in Cambodia, the two China provinces, and Viet Nam did not allow classification for the quarterly report on case finding. If the treatment outcome was reported as cured, it was correct in 99.9%, 85.7%, and 98.5% of the respective three jurisdictions: errors were mostly due to misclassification of completion as cure. Under-reporting of failures was more frequent than over-reporting in Cambodia and Viet Nam, while in the two provinces in China 84% of reported failures did not actually meet the bacteriological criterion. This evaluation demonstrates that recording essential information is exemplary in all three countries. It will be essential to carefully supervise the ability of staff to correctly define TB treatment outcome results in all three countries.

  14. Innovative data tools: a suite for managing peer outreach to key affected populations in Viet Nam.

    Nga, Nguyen Thien; Jacka, David; Van Hai, Nguyen; Trinh, Nguyen Kieu; Boisen, Neil; Neukom, Josselyn


    The paper tools used to monitor outreach work in all major cities in Viet Nam had substantial writing requirements for each contact with difficulty maintaining confidentiality. This paper describes the development of a Unique Identifier Code (UIC), a field data collection notebook (databook) and a computer data entry system in Viet Nam. The databook can document 40 individual clients and has space for commodity distribution, group contacts and needles/syringe collection for each month. Field implementation trials of the UIC and databook have been undertaken by more than 160 peer outreach workers to document their work with people who inject drugs (PWID) and sex workers (SW). Following an expanded trial in Hai Phong province, there have been requests for national circulation of the databook to be used by peer educators documenting outreach to PWID, SW and men who have sex with men. The standardized UIC and databook, in a variety of locally adapted formats, have now been introduced in more than 40 of the 63 provinces in Viet Nam. This development in Viet Nam is, to our knowledge, the first example of the combination of a confidential UIC and an innovative, simple pocket-sized paper instrument with associated customized data-entry software for documenting outreach.

  15. Distance Education Policy and Public Awareness in Cambodia, Laos, and Viet Nam

    Vuth, Doung; Than, Chhuon Chan; Phanousith, Somphone; Phissamay, Phonpasit; Tai, Tran Thi


    The current project brings together academic and governmental specialists from Cambodia, Laos, and Viet Nam (CLV), in a collaborative study of the prospects for distance education (DE) in those countries. The study's overall objectives are to: (1) survey and take stock of existing educational scenarios and problems in CLV; (2) document the…

  16. Time to unsuccessful tuberculosis treatment outcome, Cambodia, China, and Viet Nam.

    Hoa, N B; Sokun, C; Wei, C; Lauritsen, J M; Rieder, H L


    To determine the frequency and characteristics of patients with unsuccessful tuberculosis (TB) treatment. Random selection of TB case registers among all treatment units in Cambodia, two provinces in China, and Viet Nam. The data of two calendar years were analyzed to assess unsuccessful outcomes and their time of occurrence. Among the 33 309 TB patients, treatment was unsuccessful in respectively 10.1%, 3.0% and 9.1% of patients in Cambodia, China and Viet Nam. The risk of death was highest in Cambodia, higher among males than females, increased with age, and was more common among retreatment cases than new cases, and among patients with a high than a low sputum smear microscopy grade. Half of all deaths occurred in the first 2 months in Cambodia and within 11 weeks in China and Viet Nam. Median time to default was 3 months in Cambodia and Viet Nam, and about 2 months in China. Treatment was highly successful in the three study countries, with a low proportion of death and default. As the majority of defaulting occurs at the beginning of treatment, all countries should critically review their current policy of treatment support in this period.

  17. Viet Nam - Nuclear power for GHG mitigation and sustainable energy development

    Le Doan Phac; Nguyen Tien Nguyen; Le Van Hong; Nguyen Huu Thanh; Nguyen Anh Tuan


    The Government of Viet Nam has recently formulated a national energy programme entitled Strategy and Policy of Sustainable Energy Development. Its aim is to define a development policy for the country for the period from 2000 to 2020. The main objectives of the national energy programme are: 1. Increasing energy efficiency and demand side management (DSM) 2. Expanding rural electrification 3. Defining an energy price policy (e.g. pricing such that revenues cover costs) 4. Minimizing environmental impacts 5. Encouraging private investment in the energy and electricity sectors 6. Energy supply security 7. Diversifying energy sources, and 8. Exploring the potential role of nuclear power in Viet Nam. In formulating this programme, one of the objectives has been to minimize environmental impacts, including those caused by the electricity sector. Nevertheless, the shortage of investment capital in Viet Nam and the difficulty of securing favourable financial arrangements are crucial obstacles to the introduction of new technology options to mitigate GHG emissions. Viet Nam views CDM as an opportunity to find ways to overcome such problems and expects that all GHG mitigating technologies will be considered equally under the CDM

  18. Cooperative learning vs confucian heritage culture's collectivism. The analysis in Viet Nam

    Nguyen, Phuong-Mai; Terlouw, C.; Pilot, A.


    Confucian Heritage Cultures (CHC) such as Viet Nam, China, Korea, Japan, Hong Kong and Singapore are proven to share characteristics of Collectivist society. Researchers agree that this collectivist mentality supports cooperation, that CHC’s learners/workers best perform in groups. Not satisfied

  19. Time to unsuccessful tuberculosis treatment outcome, Cambodia, China, and Viet Nam

    Hoa, N B; Sokun, C; Wei, C


    OBJECTIVE: To determine the frequency and characteristics of patients with unsuccessful tuberculosis (TB) treatment. METHODS: Random selection of TB case registers among all treatment units in Cambodia, two provinces in China, and Viet Nam. The data of two calendar years were analyzed to assess u...

  20. Characteristics of tuberculosis patients at intake in Cambodia, two provinces in China, and Viet Nam

    Lauritsen Jens M


    Full Text Available Abstract Background The tuberculosis register is a critical data source for the information system of national tuberculosis control programs. From the information in the tuberculosis case register, it is possible to extend the standard analysis of age and sex characteristics among sputum smear-positive cases to all tuberculosis case categories. National tuberculosis programs might utilize such information to identify problems related to referral and access to diagnosis and treatment. Objectives Based on the electronic database we created, our objectives were to provide a detailed description of age and sex characteristics of tuberculosis patients at registration and to provide a comparison of age-specific sex characteristics among incident and prevalent sputum smear-positive cases. Methods A representative sample of tuberculosis case registers from 1 January 2003 to 31 December 2005 was selected in Cambodia, two provinces in China and Viet Nam. Age and sex characteristics of cases in the three separate prevalence surveys in the three jurisdictions (Cambodia: year 2002; China: year 2000; and Viet Nam: year 2006-2007 were obtained for comparison. Results A total 37,635 patients had been registered during the period in the selected units in the three countries. Cases were more frequently male in all three countries with 53%, 71%, and 69% in Cambodia, China, and Viet Nam, respectively. The ratios of the female-to-male odds in the notification system to that in the prevalence survey in smear-positive cases in Cambodia, China and Viet Nam were 2.1, 0.9, and 1.8, respectively. Because of the small proportion of extrapulmonary tuberculosis registered in China, we limited the analysis on age and sex distribution for extrapulmonary cases to Cambodia and Viet Nam. The proportion with extrapulmonary tuberculosis among all cases was 18.5% in Cambodia and 15.7% in Viet Nam, decreasing in frequency with increasing age. Conclusions Characteristics of patients

  1. Characteristics of tuberculosis patients at intake in Cambodia, two provinces in China, and Viet Nam.

    Hoa, Nguyen B; Wei, Chen; Sokun, Chay; Lauritsen, Jens M; Rieder, Hans L


    The tuberculosis register is a critical data source for the information system of national tuberculosis control programs. From the information in the tuberculosis case register, it is possible to extend the standard analysis of age and sex characteristics among sputum smear-positive cases to all tuberculosis case categories. National tuberculosis programs might utilize such information to identify problems related to referral and access to diagnosis and treatment. Based on the electronic database we created, our objectives were to provide a detailed description of age and sex characteristics of tuberculosis patients at registration and to provide a comparison of age-specific sex characteristics among incident and prevalent sputum smear-positive cases. A representative sample of tuberculosis case registers from 1 January 2003 to 31 December 2005 was selected in Cambodia, two provinces in China and Viet Nam. Age and sex characteristics of cases in the three separate prevalence surveys in the three jurisdictions (Cambodia: year 2002; China: year 2000; and Viet Nam: year 2006-2007) were obtained for comparison. A total 37,635 patients had been registered during the period in the selected units in the three countries. Cases were more frequently male in all three countries with 53%, 71%, and 69% in Cambodia, China, and Viet Nam, respectively.The ratios of the female-to-male odds in the notification system to that in the prevalence survey in smear-positive cases in Cambodia, China and Viet Nam were 2.1, 0.9, and 1.8, respectively. Because of the small proportion of extrapulmonary tuberculosis registered in China, we limited the analysis on age and sex distribution for extrapulmonary cases to Cambodia and Viet Nam. The proportion with extrapulmonary tuberculosis among all cases was 18.5% in Cambodia and 15.7% in Viet Nam, decreasing in frequency with increasing age. Characteristics of patients greatly differed between countries and between patient categories. In Cambodia

  2. Surface ozone at Nam Co in the inland Tibetan Plateau: variation, synthesis comparison and regional representativeness

    Yin, Xiufeng; Kang, Shichang; de Foy, Benjamin; Cong, Zhiyuan; Luo, Jiali; Zhang, Lang; Ma, Yaoming; Zhang, Guoshuai; Rupakheti, Dipesh; Zhang, Qianggong


    Ozone is an important pollutant and greenhouse gas, and tropospheric ozone variations are generally associated with both natural and anthropogenic processes. As one of the most pristine and inaccessible regions in the world, the Tibetan Plateau has been considered as an ideal region for studying processes of the background atmosphere. Due to the vast area of the Tibetan Plateau, sites in the southern, northern and central regions exhibit different patterns of variation in surface ozone. Here, we present continuous measurements of surface ozone mixing ratios at Nam Co Station over a period of ˜ 5 years (January 2011 to October 2015), which is a background site in the inland Tibetan Plateau. An average surface ozone mixing ratio of 47.6 ± 11.6 ppb (mean ± standard deviation) was recorded, and a large annual cycle was observed with maximum ozone mixing ratios in the spring and minimum ratios during the winter. The diurnal cycle is characterized by a minimum in the early morning and a maximum in the late afternoon. Nam Co Station represents a background region where surface ozone receives negligible local anthropogenic emissions inputs, and the anthropogenic contribution from South Asia in spring and China in summer may affect Nam Co Station occasionally. Surface ozone at Nam Co Station is mainly dominated by natural processes involving photochemical reactions, vertical mixing and downward transport of stratospheric air mass. Model results indicate that the study site is affected differently by the surrounding areas in different seasons: air masses from the southern Tibetan Plateau contribute to the high ozone levels in the spring, and enhanced ozone levels in the summer are associated with air masses from the northern Tibetan Plateau. By comparing measurements at Nam Co Station with those from other sites on the Tibetan Plateau, we aim to expand the understanding of ozone cycles and transport processes over the Tibetan Plateau. This work may provide a

  3. IAEA Mission Concludes Peer Review of Viet Nam's Radiation and Nuclear Regulatory Framework


    Senior international nuclear safety and radiation protection experts today concluded a 10-day International Atomic Energy Agency (IAEA) mission to review how Viet Nam's regulatory framework for nuclear and radiation safety has incorporated recommendations and suggestions from an earlier review, conducted in 2009. The Integrated Regulatory Review Service (IRRS) follow-up mission, requested by the Viet Nam Agency for Radiation and Nuclear Safety (VARANS), also reviewed the development of the regulatory safety infrastructure to support Viet Nam's nuclear power programme. The eight-member team comprised senior regulatory experts from Canada, France, Pakistan, Slovenia, United Arab Emirates and the United States of America, as well as three IAEA staff members. The IRRS team said in its preliminary assessment that Viet Nam had made progress since 2009, but that some key recommendations still needed to be addressed. Particular strengths identified by the team included: The commitment of VARANS staff to develop legislation and regulations in the field of nuclear and radiation safety; VARANS' efforts to implement practices that are in line with IAEA Safety Standards and internationally recognized good practices; A willingness to receive feedback regarding the efforts to establish and implement a regulation programme; and Progress made in developing the regulatory framework to support the introduction of nuclear power. The team identified the following areas as high-priority steps to further strengthen radiation and nuclear safety in Viet Nam: The effective independence of the regulatory decision-making process needs to be urgently addressed; Additional resources are needed to regulate existing radiation facilities and activities, as well as the country's research reactor; Efforts to increase the capacity of VARANS to regulate the developing nuclear power programme should continue; The draft Master Plan for the Development of Nuclear Power Infrastructure should be finalized

  4. Delivery cost of human papillomavirus vaccination of young adolescent girls in Peru, Uganda and Viet Nam.

    Levin, Carol E; Van Minh, Hoang; Odaga, John; Rout, Swampa Sarit; Ngoc, Diep Nguyen Thi; Menezes, Lysander; Araujo, Maria Ana Mendoza; LaMontagne, D Scott


    To estimate the incremental delivery cost of human papillomavirus (HPV) vaccination of young adolescent girls in Peru, Uganda and Viet Nam. Data were collected from a sample of facilities that participated in five demonstration projects for hpv vaccine delivery: school-based delivery was used in Peru, Uganda and Viet Nam; health-centre-based delivery was also used in Viet Nam; and integrated delivery, which involved existing health services, was also used in Uganda. Microcosting methods were used to guide data collection on the use of resources (i.e. staff, supplies and equipment) and data were obtained from government, demonstration project and health centre administrative records. Delivery costs were expressed in 2009 United States dollars (US$). Exclusively project-related expenses and the cost of the vaccine were excluded. The economic delivery cost per vaccine dose ranged from US$ 1.44 for integrated outreach in Uganda to US$ 3.88 for school-based delivery in Peru. In Viet Nam, the lowest cost per dose was US$ 1.92 for health-centre-based delivery. Cost profiles revealed that, in general, the largest contributing factors were project start-up costs and recurrent personnel costs. The delivery cost of HPV vaccine was higher than published costs for traditional vaccines recommended by the Expanded Programme on Immunization (EPI). The cost of delivering HPV vaccine to young adolescent girls in Peru, Uganda and Viet Nam was higher than that for vaccines currently in the EPI schedule. The cost per vaccine dose was lower when delivery was integrated into existing health services.

  5. A situational review of infant and young child feeding practices and interventions in Viet Nam.

    Nguyen, Phuong Hong; Menon, Purnima; Ruel, Mariel; Hajeebhoy, Nemat


    Sub-optimal infant and young child feeding (IYCF) practices are likely a significant contributor to high undernutrition rates in Viet Nam. To date, however, there has been no comprehensive review of IYCF practices in Viet Nam. The objectives of this paper were to review: 1) patterns/trends in IYCF in Viet Nam; 2) the barriers and facilitators to IYCF practices; and 3) interventions and policies and their effectiveness. Methods used include reviewing and analyzing existing data, summarizing and organizing the evidence into broad themes based on a pre-defined conceptual framework. Findings show that the proportion of children ever breastfed is almost universal and the median duration of breastfeeding is 13-18 months. However, exclusive breastfeeding for the first six months is low (8-17%) and appears to be declining over time. Information on complementary feeding is limited, but two key challenges are: early introduction, and low nutrient quality of complementary foods. Facilitators of optimal IYCF were support from 1) government progressive policies, 2) non-profit organizations and 3) family members. Barriers to optimal IYCF included 1) the lack of enforcement of, and compliance with the code of marketing breast milk substitutes, 2) inadequate knowledge among health care providers; and 3) maternal poor knowledge. These findings indicate that the evidence base on complementary feeding is weak in Viet Nam and needs to be strengthened. The review also reinforces that program and policy actions to improve IYCF in Viet Nam must target multiple stakeholders at different levels: the family, the health system and the private sector.

  6. Supply- and Demand-Side Factors Influencing Utilization of Infant and Young Child Feeding Counselling Services in Viet Nam.

    Nguyen, Phuong H; Kim, Sunny S; Nguyen, Tuan T; Tran, Lan M; Hajeebhoy, Nemat; Frongillo, Edward A; Ruel, Marie T; Rawat, Rahul; Menon, Purnima


    Adequate utilization of services is critical to maximize the impact of counselling on infant and young child feeding (IYCF), but little is known about factors affecting utilization. Our study examined supply- and demand-side factors associated with the utilization of IYCF counselling services in Viet Nam. We used survey data from mothers with children Viet Nam, and may be relevant for increasing and sustaining use of nutrition services in similar contexts.

  7. Climate change and development responses on agriculture in Quang Nam Province Vietnam

    Schroll, Henning; Andersen, Jan; Lund, Søren


    to document the influence of climate change on the agriculture of Quang Nam. Administratively, agriculture in Quang Nam includes the three sectors: farming, forestry and aquaculture. From interviews we found that many Vietnamese authorities and farmers were convinced that today climate changes impact farming......, forestry and aquaculture and consequently different kinds of adaptations have been introduced. We wanted to study the development in agriculture in order to scrutinize if climate events had major impacts on productivity of the three sectors. An overview of agricultural changes was provided through...... statistics and interviews and important climate impacts and adaptations were identified and assessed. An energy flow method was used to describe the agricultural situation. During the last decade the study showed that farmers in the agricultural field had increased the productivity and they performed strong...

  8. Validation of clinical case definition of acute intussusception in infants in Viet Nam and Australia.

    Bines, JE; Liem, NT; Justice, F; Son, TN; Carlin, JB; de Campo, M; Jamsen, K; Mulholland, K; Barnett, P; Barnes, GL


    OBJECTIVE: To test the sensitivity and specificity of a clinical case definition of acute intussusception in infants to assist health-care workers in settings where diagnostic facilities are not available. METHODS: Prospective studies were conducted at a major paediatric hospital in Viet Nam (the National Hospital of Pediatrics, Hanoi) from November 2002 to December 2003 and in Australia (the Royal Children's Hospital, Melbourne) from March 2002 to March 2004 using a clinical case definition ...

  9. Oseltamivir resistance among influenza viruses: surveillance in northern Viet Nam, 2009-2012.

    Hoang Vu, Mai-Phuong; Nguyen, Co Thach; Nguyen, Le Khanh Hang; Nguyen, Thi Kim Phuong; Le, Quynh Mai


    Antiviral resistance has been reported in seasonal influenza A viruses and avian influenza A(H5N1) viruses in Viet Nam, raising concerns about the efficacy of treatment. We analysed specimens from two sources during the period 2009-2012: influenza-positive samples from influenza-like illness patients at sentinel clinics in northern Viet Nam and isolates from patients with confirmed A(H5N1) infections. Pyrosequencing was used to detect mutations: H275Y [for A(H1N1) and A(H5N1)], E119V [for A(H3N2)] and I117V [for A(H5N1)]. A neuraminidase inhibition assay was used to determine the Inhibitory Concentration 50 (IC₅₀) values for all influenza A and B isolates. There were 341 influenza A positive samples identified; influenza A(H1N1)pdm09 was identified most frequently (n = 215). In 2009, oseltamivir resistance was observed in 100% (19 of 19) of seasonal A(H1N1) isolates and 1.4% (3/215) of A(H1N1)pdm09 isolates. This H275Y mutation was not found in influenza subtypes A(H5N1) or A(H3N2) isolates. In Viet Nam, seasonal and A(H5N1) influenza vaccines are not currently available; thus, effective treatment is required. The presence of oseltamivir-resistant viruses is therefore a concern. Active surveillance for oseltamivir resistance among influenza viruses circulating in Viet Nam should be continued.

  10. Player or referee? Aid effectiveness and the governance of health policy development: Lessons from Viet Nam.

    Dodd, Rebecca; Olivé, Jean-Marc


    Viet Nam is one of the brightest stars in the constellation of developing countries. Its remarkable achievements in reducing poverty and improving health and education outcomes are well known, and as a result it has enjoyed generous aid programmes. Viet Nam also has a reputation for taking a strong lead in disciplining its donors and pushing for more efficient and effective forms of aid delivery, both at home and internationally. This article discusses how efforts to improve the effectiveness of aid intersect with policy-making processes in the health sector. It presents a quantitative review of health aid flows in Viet Nam and a qualitative analysis of the aid environment using event analysis, participant observation and key informant interviews. The analysis reveals a complex and dynamic web of incentives influencing the implementation of the aid effectiveness agenda in the health sector. There are contradictory forces within the Ministry of Health, within government as a whole, within the donor community and between donors and government. Analytical frameworks drawn from the study of policy networks and governance can help explain these tensions. They suggest that governance of health aid in Viet Nam is characterised by multiple, overlapping 'policy networks' which cut across the traditional donor-government divide. The principles of aid effectiveness make sense for some of these communities, but for others they are irrational and may lead to a loss of influence and resources. However, sustained engagement combined with the building of strategic coalitions can overcome individual and institutional incentives. This article suggests that aid reform efforts should be understood not as a technocratic agenda but as a political process with all the associated tensions, perverse incentives and challenges. Partners thus need to recognise - and find new ways of making sense of - the complexity of forces affecting aid delivery.

  11. Criteria for prioritization of HIV programs in Viet Nam: a discrete choice experiment.

    Safarnejad, Ali; Pavlova, Milena; Son, Vo Hai; Phuong, Huynh Lan; Groot, Wim


    With the decline in funding for Viet Nam's response to the HIV epidemic, there is a need for evidence on the criteria to guide the prioritization of HIV programs. There is a gap in the research on the relative importance of multiple criteria for prioritizing a package of interventions. This study elicits preferences and the trade-offs made between different HIV programs by relevant stakeholders and decision-makers in Viet Nam. It also pays attention to how differences in social and professional characteristics of stakeholders and their agency affiliations shape preferences for HIV program criteria in Viet Nam. This study uses self-explicated ranking and discrete choice experiments to determine the relative importance of five criteria - effectiveness, feasibility, cost-effectiveness, rate of investment and prevention/treatment investment ratio - to stakeholders when they evaluate and select hypothetical HIV programs. The study includes 69 participants from government, civil society, and international development partners. Results of the discrete choice experiment show that overall the feasibility criterion is ranked highest in importance to the participants when choosing a hypothetical HIV program, followed by sustainability, treatment to prevention spending ratio, and effectiveness. The participant's work in management, programming, or decision-making has a significant effect on the importance of some criteria to the participant. In the self-explicated ranking effectiveness is the most important criterion and the cost-effectiveness criterion ranks low in importance across all groups. This study has shown that the preferred HIV program in Viet Nam is feasible, front-loaded for sustainability, has a higher proportion of investment on prevention, saves more lives and prevents more infections. Similarities in government and civil society rankings of criteria can create common grounds for future policy dialogues between stakeholders. Innovative models of planning should

  12. Symptoms and risk factors for stroke in a community-based observational sample in Viet Nam.

    Fitzpatrick, Annette L; Ngo, Quang Van; Ly, Kiet A; Ton, Thanh G N; Longstreth, W T; Vo, Tung T; Heitzinger, Kristen; Pham, Chien H; Tirschwell, David L


    Viet Nam is experiencing a health transition from infectious to chronic disease. Data on cardiovascular diseases, including strokes, are limited. Data were randomly collected from six communities in Da Nang, Viet Nam, on participant demographics, medical history, blood pressure, anthropometrics and health behavior using World Health Organization (WHO) guidelines. Stroke symptoms were collected by self-report with the standardized Questionnaire for Verifying Stroke Free Status. Multivariate logistic regression was used to identify factors associated with the presence of stroke symptoms. One thousand six hundred and twenty one adults were examined with a mean age of 52.0 years (± 12.5 years), of which 56.1% were women. 27.3% of the participants were found to have hypertension, 26.2% used tobacco, and 16.1% were overweight. More than two-thirds of the participants with hypertension were unaware of their condition. Almost one fourth of the participants were identified by the questionnaire as previously experiencing at least one stroke symptom. Age, rural residence, and education were associated with the presence of stroke symptoms. Models adjusted for demographics found hypertension, high cholesterol, reported severe chest pain, former smoking, and being overweight to be associated with a higher prevalence of stroke symptoms. The high frequency of stroke symptoms in Da Nang calls for further evaluation and interventions to reduce hypertension and other risk factors for chronic disease in Viet Nam and other health transition countries.

  13. Circulation of influenza B lineages in northern Viet Nam, 2007-2014.

    Le, Thi Thanh; Pham, Thu Hang; Pham, Thi Hien; Nguyen, Le Khanh Hang; Nguyen, Co Thach; Hoang, Vu Mai Phuong; Tran, Thu Huong; Nguyen, Vu Son; Ngo, Huong Giang; Le, Quynh Mai


    Influenza B viruses circulate throughout Viet Nam, and their activities vary by region. There have been two antigenically distinct lineages of influenza B viruses co-circulating in the past 20 years; however, only one lineage is selected as a component of contemporary trivalent seasonal influenza vaccines. To improve the understanding of circulating influenza B lineages and influenza vaccine mismatches, we report the virus lineages circulating in northern Viet Nam over an eight-year period (2007-2014). Lineages of 331 influenza B viruses were characterized by haemagglutination inhibition assay against standard reference ferret (Yamagata) and sheep (Victoria) antisera. Sequence analysis of the haemagglutinin gene was performed in 64 selected influenza B isolates. The proportion of influenza B lineages changed by year. The Yamagata lineage predominated in 2007, 2008 and 2012; the Victoria lineage predominated in 2009-2014 except 2012. The two lineages showed continuous evolution over time. The Northern Hemisphere's influenza vaccine components were mismatched with the predominant circulating viruses in 2007, 2009 and 2014. The seasonality of influenza B activity is more variable in tropical and subtropical regions than in temperate zones. Our data showed a common co-circulation of both influenza B lineages in northern Viet Nam, and it was difficult to predict which one was the predominant lineage. Quadrivalent influenza vaccines containing both lineages may improve the effectiveness of influenza vaccine programmes in the future.

  14. The fourth national anti-tuberculosis drug resistance survey in Viet Nam.

    Nhung, N V; Hoa, N B; Sy, D N; Hennig, C M; Dean, A S


    Viet Nam's Fourth National Anti-Tuberculosis Drug Resistance Survey was conducted in 2011. To determine the prevalence of resistance to the four main first-line anti-tuberculosis drugs in Viet Nam. Eighty clusters were selected using a probability proportion to size approach. Drug susceptibility testing (DST) against the four main first-line anti-tuberculosis drugs was performed. A total of 1629 smear-positive tuberculosis (TB) patients were eligible for culture. Of these, DST results were available for 1312 patients, including 1105 new TB cases, 195 previously treated TB cases and 12 cases with an unknown treatment history. The proportion of cases with resistance to any drug was 32.7% (95%CI 29.1-36.5) among new cases and 54.2% (95%CI 44.3-63.7) among previously treated cases. The proportion of multidrug-resistant TB (MDR-TB) cases was 4.0% (95%CI 2.5-5.4) in new cases and 23.3 (95%CI 16.7-29.9) in previously treated cases. The fourth drug resistance survey in Viet Nam found that the proportion of MDR-TB among new and previously treated cases was not significantly different from that in the 2005 survey. The National TB Programme should prioritise the detection and treatment of MDR-TB to reduce transmission of MDR-TB in the community.

  15. Circulation of influenza B lineages in northern Viet Nam, 2007–2014

    Le, Thi Thanh; Pham, Thu Hang; Pham, Thi Hien; Nguyen, Le Khanh Hang; Hoang, Vu Mai Phuong; Tran, Thu Huong; Nguyen, Vu Son; Ngo, Huong Giang


    Introduction Influenza B viruses circulate throughout Viet Nam, and their activities vary by region. There have been two antigenically distinct lineages of influenza B viruses co-circulating in the past 20 years; however, only one lineage is selected as a component of contemporary trivalent seasonal influenza vaccines. To improve the understanding of circulating influenza B lineages and influenza vaccine mismatches, we report the virus lineages circulating in northern Viet Nam over an eight-year period (2007–2014). Methods Lineages of 331 influenza B viruses were characterized by haemagglutination inhibition assay against standard reference ferret (Yamagata) and sheep (Victoria) antisera. Sequence analysis of the haemagglutinin gene was performed in 64 selected influenza B isolates. Results The proportion of influenza B lineages changed by year. The Yamagata lineage predominated in 2007, 2008 and 2012; the Victoria lineage predominated in 2009–2014 except 2012. The two lineages showed continuous evolution over time. The Northern Hemisphere’s influenza vaccine components were mismatched with the predominant circulating viruses in 2007, 2009 and 2014. Discussion The seasonality of influenza B activity is more variable in tropical and subtropical regions than in temperate zones. Our data showed a common co-circulation of both influenza B lineages in northern Viet Nam, and it was difficult to predict which one was the predominant lineage. Quadrivalent influenza vaccines containing both lineages may improve the effectiveness of influenza vaccine programmes in the future. PMID:26798557

  16. Clinical and Molecular Epidemiology of Human Parainfluenza Viruses 1-4 in Children from Viet Nam.

    Linster, Martin; Do, Lien Anh Ha; Minh, Ngo Ngoc Quang; Chen, Yihui; Zhe, Zhu; Tuan, Tran Anh; Tuan, Ha Manh; Su, Yvonne C F; van Doorn, H Rogier; Moorthy, Mahesh; Smith, Gavin J D


    HPIVs are serologically and genetically grouped into four species that account for up to 10% of all hospitalizations due to acute respiratory infection in children under the age of five. Genetic and epidemiological data for the four HPIVs derived from two pediatric cohorts in Viet Nam are presented. Respiratory samples were screened for HPIV1-4 by real-time PCR. Demographic and clinical data of patients infected with different HPIV were compared. We used a hemi-nested PCR approach to generate viral genome sequences from HPIV-positive samples and conducted a comprehensive phylogenetic analysis. In total, 170 samples tested positive for HPIV. HPIV3 was most commonly detected in our cohort and 80 co-detections of HPIV with other respiratory viruses were found. Phylogenetic analyses suggest local endemic circulation as well as punctuated introductions of new HPIV lineages. Viral gene flow analysis revealed that Viet Nam is a net importer of viral genetic diversity. Epidemiological analyses imply similar disease severity for all HPIV species. HPIV sequences from Viet Nam formed local clusters and were interspersed with sequences from diverse geographic regions. Combined, this new knowledge will help to investigate global HPIV circulation patterns in more detail and ultimately define more suitable vaccine strains.

  17. A rapid assessment and response approach for socially marketed nutrition commodities in Viet Nam.

    Turk, Tahir; Quang, Nguyen Dinh; Nga, Tran Thuy; Phuong, Huynh; Tung, Le Van Anh; Trang, Vu Hoang


    The leading cause of death in children in developing countries is protein-energy malnutrition. In Viet Nam, 25.9% of children under 5 experience stunted growth and 6.6% are moderately wasted. Iron deficiency anaemia and vitamin A deficiency contribute to these and other malnutrition conditions. Given these factors, more evidence based approaches are required to improve understanding of current attitudes, opinions and behaviours of mothers with young children, in order to operationalise social marketing of nutrition commodities in Viet Nam. A literature review supported a rapid assessment and response method involving semi-structured interviews with 77 stakeholders and focus group discussions with 80 program beneficiaries from four geographic locations in the north and south of Viet Nam. Discussion agendas were developed to address key program issues with grounded theory utilized for data analysis. Data analysis highlighted challenges and opportunities within the six Ps of social marketing: Supply and demand side issues included: cost and the quality of products, the limited scale of interventions and promotional activities. Policy issues identified related to current policies that inhibited the broader promotion and distribution of micronutrient products, and opportunities for improved dialogue with policy partners. Partnerships further emphasized the need for public private partnerships to support the social change process. Implications for theory, policy, and practice indicates that rapid assessment and response is a cost-effective, pragmatic method of public health research, in resource constrained settings, to explore policies and behaviours amenable to change and build stakeholder engagement in the program.

  18. Prevalence of latent tuberculous infection among adults in the general population of Ca Mau, Viet Nam.

    Marks, G B; Nhung, N V; Nguyen, T A; Hoa, N B; Khoa, T H; Son, N V; Phuong, N T B; Tin, D M; Ho, J; Fox, G J


    The study was conducted in a randomly selected sample of persons aged 15 years living in Ca Mau Province, southern Viet Nam. To estimate the prevalence of latent tuberculous infection (LTBI) in the general adult population of this province of Viet Nam. The secondary objective was to examine age and sex differences in prevalence. A cross-sectional survey was conducted in a cluster-random sample of the population. Clusters were subcommunes. The presence of LTBI was assessed using the QuantiFERON®-TB Gold In-Tube test system. QuantiFERON tests were performed among 1319 persons aged 15 years (77.7% of those selected). The overall prevalence of positive tests was 36.8% (95%CI 33.4-40.3). The prevalence of a positive test was lower in females than in males (31.0% vs. 44.7%, OR 0.57, 95%CI 0.45-0.72, P Viet Nam have evidence of LTBI. Although LTBI prevalence is higher in males, the sex difference is not as great as that for TB notification rates.

  19. Surface ozone at Nam Co in the inland Tibetan Plateau: variation, synthesis comparison and regional representativeness

    X. Yin


    Full Text Available Ozone is an important pollutant and greenhouse gas, and tropospheric ozone variations are generally associated with both natural and anthropogenic processes. As one of the most pristine and inaccessible regions in the world, the Tibetan Plateau has been considered as an ideal region for studying processes of the background atmosphere. Due to the vast area of the Tibetan Plateau, sites in the southern, northern and central regions exhibit different patterns of variation in surface ozone. Here, we present continuous measurements of surface ozone mixing ratios at Nam Co Station over a period of  ∼ 5 years (January 2011 to October 2015, which is a background site in the inland Tibetan Plateau. An average surface ozone mixing ratio of 47.6 ± 11.6 ppb (mean ± standard deviation was recorded, and a large annual cycle was observed with maximum ozone mixing ratios in the spring and minimum ratios during the winter. The diurnal cycle is characterized by a minimum in the early morning and a maximum in the late afternoon. Nam Co Station represents a background region where surface ozone receives negligible local anthropogenic emissions inputs, and the anthropogenic contribution from South Asia in spring and China in summer may affect Nam Co Station occasionally. Surface ozone at Nam Co Station is mainly dominated by natural processes involving photochemical reactions, vertical mixing and downward transport of stratospheric air mass. Model results indicate that the study site is affected differently by the surrounding areas in different seasons: air masses from the southern Tibetan Plateau contribute to the high ozone levels in the spring, and enhanced ozone levels in the summer are associated with air masses from the northern Tibetan Plateau. By comparing measurements at Nam Co Station with those from other sites on the Tibetan Plateau, we aim to expand the understanding of ozone cycles and transport processes over the Tibetan Plateau

  20. Phylodynamics of Enterovirus A71-Associated Hand, Foot, and Mouth Disease in Viet Nam.

    Geoghegan, Jemma L; Tan, Le Van; Kühnert, Denise; Halpin, Rebecca A; Lin, Xudong; Simenauer, Ari; Akopov, Asmik; Das, Suman R; Stockwell, Timothy B; Shrivastava, Susmita; Ngoc, Nghiem My; Uyen, Le Thi Tam; Tuyen, Nguyen Thi Kim; Thanh, Tran Tan; Hang, Vu Thi Ty; Qui, Phan Tu; Hung, Nguyen Thanh; Khanh, Truong Huu; Thinh, Le Quoc; Nhan, Le Nguyen Thanh; Van, Hoang Minh Tu; Viet, Do Chau; Tuan, Ha Manh; Viet, Ho Lu; Hien, Tran Tinh; Chau, Nguyen Van Vinh; Thwaites, Guy; Grenfell, Bryan T; Stadler, Tanja; Wentworth, David E; Holmes, Edward C; Van Doorn, H Rogier


    Enterovirus A71 (EV-A71) is a major cause of hand, foot, and mouth disease (HFMD) and is particularly prevalent in parts of Southeast Asia, affecting thousands of children and infants each year. Revealing the evolutionary and epidemiological dynamics of EV-A71 through time and space is central to understanding its outbreak potential. We generated the full genome sequences of 200 EV-A71 strains sampled from various locations in Viet Nam between 2011 and 2013 and used these sequence data to determine the evolutionary history and phylodynamics of EV-A71 in Viet Nam, providing estimates of the effective reproduction number (Re) of the infection through time. In addition, we described the phylogeography of EV-A71 throughout Southeast Asia, documenting patterns of viral gene flow. Accordingly, our analysis reveals that a rapid genogroup switch from C4 to B5 likely took place during 2012 in Viet Nam. We show that the Re of subgenogroup C4 decreased during the time frame of sampling, whereas that of B5 increased and remained >1 at the end of 2013, corresponding to a rise in B5 prevalence. Our study reveals that the subgenogroup B5 virus that emerged into Viet Nam is closely related to variants that were responsible for large epidemics in Malaysia and Taiwan and therefore extends our knowledge regarding its associated area of endemicity. Subgenogroup B5 evidently has the potential to cause more widespread outbreaks across Southeast Asia. EV-A71 is one of many viruses that cause HFMD, a common syndrome that largely affects infants and children. HFMD usually causes only mild illness with no long-term consequences. Occasionally, however, severe infection may arise, especially in very young children, causing neurological complications and even death. EV-A71 is highly contagious and is associated with the most severe HFMD cases, with large and frequent epidemics of the virus recorded worldwide. Although major advances have been made in the development of a potential EV-A71

  1. Antibiotic use and resistance in emerging economies: a situation analysis for Viet Nam.

    Nguyen, Kinh Van; Thi Do, Nga Thuy; Chandna, Arjun; Nguyen, Trung Vu; Pham, Ca Van; Doan, Phuong Mai; Nguyen, An Quoc; Thi Nguyen, Chuc Kim; Larsson, Mattias; Escalante, Socorro; Olowokure, Babatunde; Laxminarayan, Ramanan; Gelband, Hellen; Horby, Peter; Thi Ngo, Ha Bich; Hoang, Mai Thanh; Farrar, Jeremy; Hien, Tran Tinh; Wertheim, Heiman F L


    Antimicrobial resistance is a major contemporary public health threat. Strategies to contain antimicrobial resistance have been comprehensively set forth, however in developing countries where the need for effective antimicrobials is greatest implementation has proved problematic. A better understanding of patterns and determinants of antibiotic use and resistance in emerging economies may permit more appropriately targeted interventions.Viet Nam, with a large population, high burden of infectious disease and relatively unrestricted access to medication, is an excellent case study of the difficulties faced by emerging economies in controlling antimicrobial resistance. Our working group conducted a situation analysis of the current patterns and determinants of antibiotic use and resistance in Viet Nam. International publications and local reports published between 1-1-1990 and 31-8-2012 were reviewed. All stakeholders analyzed the findings at a policy workshop and feasible recommendations were suggested to improve antibiotic use in Viet Nam.Here we report the results of our situation analysis focusing on: the healthcare system, drug regulation and supply; antibiotic resistance and infection control; and agricultural antibiotic use. Market reforms have improved healthcare access in Viet Nam and contributed to better health outcomes. However, increased accessibility has been accompanied by injudicious antibiotic use in hospitals and the community, with predictable escalation in bacterial resistance. Prescribing practices are poor and self-medication is common - often being the most affordable way to access healthcare. Many policies exist to regulate antibiotic use but enforcement is insufficient or lacking.Pneumococcal penicillin-resistance rates are the highest in Asia and carbapenem-resistant bacteria (notably NDM-1) have recently emerged. Hospital acquired infections, predominantly with multi-drug resistant Gram-negative organisms, place additional strain on

  2. Towards a lifelong learning society through reading promotion: Opportunities and challenges for libraries and community learning centres in Viet Nam

    Hossain, Zakir


    The government of Viet Nam has made a commitment to build a Lifelong Learning Society by 2020. A range of related initiatives have been launched, including the Southeast Asian Ministers of Education Organization Centre for Lifelong Learning (SEAMEO CELLL) and "Book Day" - a day aimed at encouraging reading and raising awareness of its importance for the development of knowledge and skills. Viet Nam also aims to implement lifelong learning (LLL) activities in libraries, museums, cultural centres and clubs. The government of Viet Nam currently operates more than 11,900 Community Learning Centres (CLCs) and is in the process of both renovating and innovating public libraries and museums throughout the country. In addition to the work undertaken by the Viet Nam government, a number of enterprises have been initiated by non-governmental organisations and non-profit organisations to promote literacy and lifelong learning. This paper investigates some government initiatives focused on libraries and CLCs and their impact on reading promotion. Proposing a way forward, the paper confirms that Viet Nam's libraries and CLCs play an essential role in promoting reading and building a LLL Society.

  3. The text of the Agreement of 1 July 1983 concerning the Agency's assistance to Viet Nam for the transfer of enriched uranium for a research reactor


    The full text of the Supply and Project Agreement of 1 July 1983 between the Agency and the Government of the Socialist Republic of Viet Nam concerning the Agency's assistance for the transfer of moderately enriched uranium from the USSR for a research reactor in Viet Nam is presented

  4. Water Isotope framework for lake water balance monitoring and modelling in the Nam Co Basin, Tibetan Plateau

    Shichang Kang


    New hydrological insights: A water isotope framework for the Nam Co basin, including the Local Meteoric Water Line, limiting isotopic composition of evaporation and two hypothetical evaporation trajectories, is established. We further applied the isotope mass balance model to estimate the overall isotopic composition of input water to the Nam Co, the evaporation over inputs ratios (E/I for three consecutive years, and the water yields (Wy, depth equivalent runoff at a basin scale. Our results clearly suggest a positive water budget (i.e., E/I < 1, providing another line of evidence that the subsurface leakage from Nam Co is likely. The discrepancy between isotope-based water yields estimations and field-based runoff observations suggest that, compared to the well-studied Nyainqentanglha Mountains and southwestern mountains, the ridge-and-valley landscape in the western highlands and northwestern hogbacks are possibly low yields area, which should draw more research attentions in future hydrological investigations.

  5. Foot-and-mouth disease virus typing from foot-and-mouth outbreaks in the central provinces of Viet Nam

    Nguyen Luong Hien


    A total of 167 tissue samples were collected from Foot-and-mouth disease (FMD) infected animals from 57 FMD outbreaks to detect the sero-type of the FMD virus by the ELISA technique. The ELISA kit has been prepared and standardised by the World Reference Laboratory (WRL), UK and supplied under a Research Contract as part of an FAO/IAEA Co-ordinated Research Project. Eight tissue samples from cattle and one tissue sample from pig were sent to WRL for further study on the sero-type and to characterize the FMD viruses present in Viet Nam. The study was carried out from March 1996 to May 1998 in the central region of Viet Nam and the FMD type O virus was detected in these outbreaks only. The FMD type O virus from cattle and the FMD type O virus from pig are two distinct FMD type O viruses in Viet Nam. (author)

  6. Criteria for prioritization of HIV programs in Viet Nam: a discrete choice experiment

    Ali Safarnejad


    Full Text Available Abstract Background With the decline in funding for Viet Nam’s response to the HIV epidemic, there is a need for evidence on the criteria to guide the prioritization of HIV programs. There is a gap in the research on the relative importance of multiple criteria for prioritizing a package of interventions. This study elicits preferences and the trade-offs made between different HIV programs by relevant stakeholders and decision-makers in Viet Nam. It also pays attention to how differences in social and professional characteristics of stakeholders and their agency affiliations shape preferences for HIV program criteria in Viet Nam. Methods This study uses self-explicated ranking and discrete choice experiments to determine the relative importance of five criteria - effectiveness, feasibility, cost-effectiveness, rate of investment and prevention/treatment investment ratio - to stakeholders when they evaluate and select hypothetical HIV programs. The study includes 69 participants from government, civil society, and international development partners. Results Results of the discrete choice experiment show that overall the feasibility criterion is ranked highest in importance to the participants when choosing a hypothetical HIV program, followed by sustainability, treatment to prevention spending ratio, and effectiveness. The participant’s work in management, programming, or decision-making has a significant effect on the importance of some criteria to the participant. In the self-explicated ranking effectiveness is the most important criterion and the cost-effectiveness criterion ranks low in importance across all groups. Conclusions This study has shown that the preferred HIV program in Viet Nam is feasible, front-loaded for sustainability, has a higher proportion of investment on prevention, saves more lives and prevents more infections. Similarities in government and civil society rankings of criteria can create common grounds for future

  7. The association of estimated salt intake with blood pressure in a Viet Nam national survey.

    Paul N Jensen

    Full Text Available To evaluate the association of salt consumption with blood pressure in Viet Nam, a developing country with a high level of salt consumption.Analysis of a nationally representative sample of Vietnamese adults 25-65 years of age who were surveyed using the World Health Organization STEPwise approach to Surveillance protocol. Participants who reported acute illness, pregnancy, or current use of antihypertensive medications were excluded. Daily salt consumption was estimated from fasting mid-morning spot urine samples. Associations of salt consumption with systolic blood pressure and prevalent hypertension were assessed using adjusted linear and generalized linear models. Interaction terms were tested to assess differences by age, smoking, alcohol consumption, and rural/urban status.The analysis included 2,333 participants (mean age: 37 years, 46% male, 33% urban. The average estimated salt consumption was 10g/day. No associations of salt consumption with blood pressure or prevalent hypertension were observed at a national scale in men or women. The associations did not differ in subgroups defined by age, smoking, or alcohol consumption; however, associations differed between urban and rural participants (p-value for interaction of urban/rural status with salt consumption, p = 0.02, suggesting that higher salt consumption may be associated with higher systolic blood pressure in urban residents but lower systolic blood pressure in rural residents.Although there was no evidence of an association at a national level, associations of salt consumption with blood pressure differed between urban and rural residents in Viet Nam. The reasons for this differential association are not clear, and given the large rate of rural to urban migration experienced in Viet Nam, this topic warrants further investigation.

  8. The Use of Microorganism for Biological Control of Anthracnose in Nam Dok Mai Mango for Export

    Piadiang, Nattaya


    Antagonist were tested inhibition of mycelial growth of Collectorichum gloeosporioides, a causal agent of anthracnose on potato dextrose agar (PDA) revealed that 46 isolated that 46 isolate inhibited the growth of mycelia by 40.01-60.00 5. The selected four isolates inhibit the growth of fungal nycelia by 47.01-50.00 % including YFm1, YFm2, Y18 and AC2-1 were test for the potential reduce anthracnose lesion development on detected Nam Dok Mai mango by application of antagonistic microorganism before inoculation of C. gloeosporioides. This result slow that four isolate antagonistic reduced sized of lesion on Nam Dok Mai mango by 89.23, 75.38, 58.46 and 33.85 %, respectively as compare the control. Five isolate of antagonist including YFm1, YFm2, Y18, CLY35 and CLY23 could inhibited the growth of mycelia on PDA by 44.01-50.00 % were test the potential reduce anthracnose lesion development on detected Nam Dok Mai mango by application of antagonistic microorganism after inoculation of C. gloeosporioides. It was found that this application could not inhibit anthracnose on fruit mango as compare to the control. YFm1 were test for the potential inhibition anthracnose disease under field condition. It was found that YFm1 could control of C. gloeosporioides within 7 and 14 day after spraying antagonistic suspension. The efficiency test of YFm1 for anthracnose controlling on mango was followed by export treatment Azoxystrobin, ET-fon and showed 55.55%, 77.77 % and 88.88 % anthracnose infection and/or spoilage respectively

  9. High-risk and multiple human papillomavirus infections among married women in Can Tho, Viet Nam.

    Vu, Lan Thi Hoang


    The two currently licensed human papillomavirus (HPV) vaccines are highly efficacious in preventing cervical pre-cancers related to HPV 6, 11, 16 and 18. Before implementing a large-scale HPV vaccine campaign in Viet Nam, information about the prevalence of infection with the HPV vaccine types is required. This study was done in Can Tho, the province with the highest prevalence of cervical cancer in the south of Viet Nam, to explore the distribution of other high-risk types of HPV among married women in this province. The study employed a cross-sectional design with multistage sampling. A total of 1000 participants were randomly selected, interviewed and given gynaecological examinations. HPV infection status and HPV genotyping test were completed for all participants. A broad spectrum of HPV types was reported in this study. The prevalence of cases infected with HPV 16 and/or 18 was 7%; the prevalence of cases infected with other high-risk HPV types was 6%. The highest prevalence for single and multiple infections, as well as for high-risk infections, was reported for the youngest age group (less than 30 years). While it is relevant to implement an HPV vaccine campaign in Viet Nam due to the high prevalence of infection with HPV 16 and/or 18, it is important to note that one can be infected with multiple types of HPV. Vaccination does not protect against all types of high-risk HPV. Future vaccine campaigns should openly disclose this information to women receiving vaccines.

  10. Childhood tuberculosis in northern Viet Nam: a review of 103 cases.

    Blount, Robert J; Tran, Bao; Jarlsberg, Leah G; Phan, Ha; Thanh Hoang, Van; Nguyen, Nhung Viet; Lewinsohn, Deborah A; Nahid, Payam


    Childhood tuberculosis causes significant morbidity and mortality in Southeast Asia, yet little is known about the epidemiology and clinical characteristics of this disease in Viet Nam. To determine the demographics, clinical presentations, radiographic and microbiologic findings, treatment regimens, and outcomes of children admitted with tuberculosis (TB) to a national referral hospital in Viet Nam. We conducted a retrospective case series study of children ≤ 15 years old with bacteriologically confirmed or clinically diagnosed TB admitted to a national referral hospital in Ha Noi, Viet Nam from January through December 2007. One hundred three children were identified: median age 5 years (IQR 2-10), 44% female, 99% Kinh ethnicity, 27% residing in Ha Noi, 88% with BCG vaccination, 27% with known TB contact, and 38% malnourished. Intrathoracic TB was present in 62%, extrathoracic in 52%, both intra and extrathoracic in 19%, and undetermined site in 5%. The most common extrathoracic manifestation was peripheral lymphadenitis, and children under 5 were more likely to have miliary TB or both intra and extrathoracic TB. Fever and failure to thrive were common presenting symptoms among all participants (65% and 56%, respectively), 66% of those with intrathoracic TB presented with cough, and 92% of those with TB meningitis presented with severe neurologic impairment. Acid-fast bacilli smears and mycobacterial cultures were positive in 18% and 21% of children tested, and histopathology was positive in 88% of those biopsied. There were no adverse drug reactions necessitating change in therapy, and no inpatient mortality. Extrathoracic TB was common, treatment well tolerated and clinical outcomes excellent. Culture confirmation rates were low and emphasize the need for improved diagnostics.

  11. The association of estimated salt intake with blood pressure in a Viet Nam national survey.

    Jensen, Paul N; Bao, Tran Quoc; Huong, Tran Thi Thanh; Heckbert, Susan R; Fitzpatrick, Annette L; LoGerfo, James P; Ngoc, Truong Le Van; Mokdad, Ali H


    To evaluate the association of salt consumption with blood pressure in Viet Nam, a developing country with a high level of salt consumption. Analysis of a nationally representative sample of Vietnamese adults 25-65 years of age who were surveyed using the World Health Organization STEPwise approach to Surveillance protocol. Participants who reported acute illness, pregnancy, or current use of antihypertensive medications were excluded. Daily salt consumption was estimated from fasting mid-morning spot urine samples. Associations of salt consumption with systolic blood pressure and prevalent hypertension were assessed using adjusted linear and generalized linear models. Interaction terms were tested to assess differences by age, smoking, alcohol consumption, and rural/urban status. The analysis included 2,333 participants (mean age: 37 years, 46% male, 33% urban). The average estimated salt consumption was 10g/day. No associations of salt consumption with blood pressure or prevalent hypertension were observed at a national scale in men or women. The associations did not differ in subgroups defined by age, smoking, or alcohol consumption; however, associations differed between urban and rural participants (p-value for interaction of urban/rural status with salt consumption, p = 0.02), suggesting that higher salt consumption may be associated with higher systolic blood pressure in urban residents but lower systolic blood pressure in rural residents. Although there was no evidence of an association at a national level, associations of salt consumption with blood pressure differed between urban and rural residents in Viet Nam. The reasons for this differential association are not clear, and given the large rate of rural to urban migration experienced in Viet Nam, this topic warrants further investigation.

  12. Factors associated with breastfeeding intent among mothers of newborn babies in Da Nang, Viet Nam.

    Nguyen, Phuong Thi Kim; Tran, Hoang Thi; Thai, Thuy Thi Thanh; Foster, Kirsty; Roberts, Christine L; Marais, Ben J


    Breastfeeding is recognized as the single most cost-effective intervention to reduce child morbidity and mortality. However, few studies have explored perceived barriers to breastfeeding and factors associated with breastfeeding intent among mothers of newborn babies in Viet Nam. We conducted a study to assess breastfeeding initiation rates, intent to breastfeed exclusively for 6 months or more and perceived barriers to breastfeed among mothers of newborn babies in Da Nang, Viet Nam. We conducted a cross-sectional questionnaire survey of mothers in the postnatal wards of Da Nang Hospital for Women and Children in central Viet Nam from 10 February 2017 to 24 February 2017, following implementation of the World Health Organization (WHO) Essential Newborn Care (ENC) package. Of 286 mothers surveyed, 259 (90.6%) initiated breastfeeding; 203/258 (78.7%) within 1 hour (h) of birth. Most (207, 72.4%) mothers indicated intent to breastfeed exclusively for 6 months or more, but this was lower among mothers of preterm babies (82.2% versus 20.0%, p  < 0.001) and those without post-secondary school education (74.8% versus 55.6%, p  = 0.02). Amongst mothers struggling to establish breastfeeding, 18/27 (66.7%) had a Cesarean section. Planned non-exclusive breastfeeding was mostly (39, 60.9%) motivated by mothers' concern that their milk supply would be insufficient for their baby's growth requirements. Most mothers had good knowledge about the benefits of breastfeeding and indicated strong decision autonomy. We documented high rates of early breastfeeding establishment and intent to breastfeed exclusively for 6 months or more. This probably reflects high levels of maternal education and successful implementation of the WHO ENC package. Mothers of premature babies may benefit from additional support.

  13. Consequences of gestational diabetes in an urban hospital in Viet Nam: a prospective cohort study.

    Hirst, Jane E; Tran, Thach S; Do, My An T; Morris, Jonathan M; Jeffery, Heather E


    Gestational diabetes mellitus (GDM) is increasing and is a risk for type 2 diabetes. Evidence supporting screening comes mostly from high-income countries. We aimed to determine prevalence and outcomes in urban Viet Nam. We compared the proposed International Association of the Diabetes and Pregnancy Study Groups (IADPSG) criterion, requiring one positive value on the 75-g glucose tolerance test, to the 2010 American Diabetes Association (ADA) criterion, requiring two positive values. We conducted a prospective cohort study in Ho Chi Minh City, Viet Nam. Study participants were 2,772 women undergoing routine prenatal care who underwent a 75-g glucose tolerance test and interview around 28 (range 24-32) wk. GDM diagnosed by the ADA criterion was treated by local protocol. Women with GDM by the IADPSG criterion but not the ADA criterion were termed "borderline" and received standard care. 2,702 women (97.5% of cohort) were followed until discharge after delivery. GDM was diagnosed in 164 participants (6.1%) by the ADA criterion, 550 (20.3%) by the IADPSG criterion. Mean body mass index was 20.45 kg/m(2) in women with out GDM, 21.10 in women with borderline GDM, and 21.81 in women with GDM, pViet Nam. Women with GDM by the IADPSG criterion were at risk of preterm delivery and neonatal hypoglycaemia, although this criterion resulted in 20% of pregnant women being positive for GDM. The ability to cope with such a large number of cases and prevent associated adverse outcomes needs to be demonstrated before recommending widespread screening. Please see later in the article for the Editors' Summary.

  14. The Agency's technical co-operation programme with Viet Nam 1983-1993 country programme summaries


    This report contains a review of the Agency's technical co-operation activities in Viet Nam carried out during 1983-1993. In terms of coverage and analytical depth, country programmes summaries stand somewhere midway between in-depth country programme evaluations and individual project evaluations. They attempt to provide a comprehensive, descriptive picture of the Agency's co-operation with a Member State in a manner that will be particularly useful for programming decisions. The attempt is very much to describe - largely through statistical data - not to provide independent analysis and evaluation

  15. Private standards and labour productivity in the food sector in Viet Nam

    Trifkovic, Neda

    standards affect labour productivity of small and medium firms from the food sector in Viet Nam. The results based on a 3-year panel show that the application of private standards improves labour productivity. These gains primarily occur to firms operating above a threshold labour-intensity level. Firms......A rising number of firms from developing countries have adopted voluntary private standards in the last decade. This has become an area of active research, especially in terms of the impact of private standards on trade, organizational performance, and employee outcomes. This paper analyses how...

  16. Manual on sample-based data collection for fisheries assessment : Examples from Viet Nam

    Sparre, Per Johan

    with through both detailed discussion and by using simple examples. These examples are mostly based on situations in tropical fisheries and, in particular, experience has been drawn from developing a data collection programme in Viet Nam. The main questions addressed in the manual are which fisheries data...... to collect, where and when to collect them. Only data collected from commercial marine capture fisheries are considered (data from freshwater fisheries, cultured fish and experimental fisheries are excluded). The methodologies used are mainly appropriate for a tropical developing country with many small...

  17. First record of a cave species of Euscorpiops Vachon from Viet Nam (Scorpiones, Euscorpiidae, Scorpiopinae).

    Lourenço, Wilson R; Pham, Dinh-Sac


    Euscorpiops cavernicola sp. n., belonging to the family Euscorpiidae Laurie, is described on the basis of two male and two female specimens collected in the Hua Ma cave located in the Quang Khe commune, Ba Be district of Bac Kan province in Viet Nam. The new species presents most features exhibited by scorpions within the genus Euscorpiops, however it may represent the first discovered Scorpiopinae species exhibiting certain adaptations to cave life. Copyright © 2013 Académie des sciences. Published by Elsevier SAS. All rights reserved.

  18. Evaporation variability of Nam Co Lake in the Tibetan Plateau and its role in recent rapid lake expansion

    Ma, Ning; Szilagyi, Jozsef; Niu, Guo-Yue; Zhang, Yinsheng; Zhang, Teng; Wang, Binbin; Wu, Yanhong


    Previous studies have shown that the majority of the lakes in the Tibetan Plateau (TP) started to expand rapidly since the late 1990s. However, the causes are still not well known. For Nam Co, being a closed lake with no outflow, evaporation (EL) over the lake surface is the only way water may leave the lake. Therefore, quantifying EL is key for investigating the mechanism of lake expansion in the TP. EL can be quantified by Penman- and/or bulk-transfer-type models, requiring only net radiation, temperature, humidity and wind speed for inputs. However, interpolation of wind speed data may be laden with great uncertainty due to extremely sparse ground meteorological observations, the highly heterogeneous landscape and lake-land breeze effects. Here, evaporation of Nam Co Lake was investigated within the 1979-2012 period at a monthly time-scale using the complementary relationship lake evaporation (CRLE) model which does not require wind speed data. Validations by in-situ observations of E601B pan evaporation rates at the shore of Nam Co Lake as well as measured EL over an adjacent small lake using eddy covariance technique suggest that CRLE is capable of simulating EL well since it implicitly considers wind effects on evaporation via its vapor transfer coefficient. The multi-year average of annual evaporation of Nam Co Lake is 635 mm. From 1979 to 2012, annual evaporation of Nam Co Lake expressed a very slight decreasing trend. However, a more significant decrease in EL occurred during 1998-2008 at a rate of -12 mm yr-1. Based on water-level readings, this significant decrease in lake evaporation was found to be responsible for approximately 4% of the reported rapid water level increase and areal expansion of Nam Co Lake during the same period.

  19. Seismic Interpretation of the Nam Con Son Basin and its Implication for the Tectonic Evolution

    Nguyen Quang Tuan


    Full Text Available DOI:10.17014/ijog.3.2.127-137The Nam Con Son Basin covering an area of circa 110,000 km2 is characterized by complex tectonic settings of the basin which has not fully been understood. Multiple faults allowed favourable migration passageways for hydrocarbons to go in and out of traps. Despite a large amount of newly acquired seismic and well data there is no significant update on the tectonic evolution and history of the basin development. In this study, the vast amount of seismic and well data were integrated and reinterpreted to define the key structural events in the Nam Con Son Basin. The results show that the basin has undergone two extentional phases. The first N - S extensional phase terminated at around 30 M.a. forming E - W trending grabens which are complicated by multiple half grabens filled by Lower Oligocene sediments. These grabens were reactivated during the second NW - SE extension (Middle Miocene, that resulted from the progressive propagation of NE-SW listric fault from the middle part of the grabens to the margins, and the large scale building up of roll-over structure. Further to the SW, the faults of the second extentional phase turn to NNE-SSW and ultimately N - S in the SW edge of the basin. Most of the fault systems were inactive by Upper Miocene except for the N - S fault system which is still active until recent time.

  20. Floristic inventory of vascular plant in Nam Ha National Biodiversity Conservation Area, Lao People's Democratic Republic

    Jeong Ho Park


    Full Text Available The floristic inventory of vascular plants in Nam Ha National Biodiversity Conservation Area was conducted to understand the plant diversity in the northern area of Lao People's Democratic Republic. From the joint field surveys between Korean and Laos experts conducted during 2015–2017, it was found that there are 64 families, 145 genera, and 189 species distributed in the Nam Ba National Biodiversity Conservation Area, and a total of 56 families, 117 genera, and 148 species which comprise more than 78% of the total species were identified as endemic plants to the Lao People's Democratic Republic. Considering the usage of the plants, there are 91 species of medicinal plants, 33 species of ornamental plants, eight species of edible plants, and 16 species of economic plants. In addition, it was found out that Dalbergia balansae and Cinnamomum macrocarpum are categorized as vulnerable in the International Union for Conservation of Nature (IUCN Red list, and 13 more species are categorized as the least concern.

  1. Management and treatment outcomes of patients enrolled in MDR-TB treatment in Viet Nam.

    Phuong, N T M; Nhung, N V; Hoa, N B; Thuy, H T; Takarinda, K C; Tayler-Smith, K; Harries, A D


    The programmatic management of drug-resistant tuberculosis (TB) in Viet Nam has been rapidly scaled up since 2009. To document the annual numbers of patients enrolled for multidrug-resistant tuberculosis (MDR-TB) treatment during 2010-2014 and to determine characteristics and treatment outcomes of patients initiating treatment during 2010-2012. A retrospective cohort study using national reports and data from the national electronic data system for drug-resistant TB. The number of patients enrolled annually for MDR-TB treatment increased from 97 in 2010 to 1522 in 2014. The majority of patients were middle-aged men who had pulmonary disease and had failed a retreatment regimen; 77% had received ⩾2 courses of TB treatment. Favourable outcomes (cured and treatment completed) were attained in 73% of patients. Unfavourable outcomes included loss to follow-up (12.5%), death (8%) and failure (6.3%). Having had ⩾2 previous treatment courses and being human immunodeficiency virus-positive were associated with unfavourable outcomes. Increasing numbers of patients are being treated for MDR-TB each year with good treatment outcomes under national programme management in Viet Nam. However, there is a need to increase case detection-currently at 30% of the estimated 5100 MDR-TB cases per year, reduce adverse outcomes and improve monitoring and evaluation.

  2. Collaborative activities and treatment outcomes in patients with HIV-associated tuberculosis in Viet Nam.

    Huyen, T T T; Nhung, N V; Shewade, H D; Hoa, N B; Harries, A D


    The National Tuberculosis (TB) Programme in Viet Nam and Ho Chi Minh City (HCMC). To determine 1) at national level between 2011 and 2013, the relationship between human immunodeficiency virus (HIV) testing, uptake of TB-HIV interventions and adverse treatment outcomes among TB-HIV patients; and 2) in HCMC in 2013, patient characteristics associated with adverse outcomes. An ecological study reviewing aggregate nationwide data and a retrospective cohort review in HCMC. Nationwide, from 2011 to 2013, HIV testing increased in TB patients from 58% to 68% and antiretroviral therapy (ART) increased in TB-HIV patients from 54% to 63%. Adverse treatment outcomes in TB-HIV patients increased from 24% to 27%, largely due to transfer out (5-9% increase) and death. The Northern and Highland regions showed poor uptake of TB-HIV interventions. In HCMC, 303 (27%) of 1110 TB-HIV patients had adverse outcomes, with higher risks observed in those with previously treated TB, those diagnosed as HIV-positive before TB onset and those never placed on cotrimoxazole or ART. Despite improving HIV testing rates and TB-HIV interventions, adverse outcomes in TB-HIV patients remain at about 26%. Characteristics predicting higher risk of adverse outcomes must be addressed if Viet Nam wishes to end the TB epidemic by 2030.

  3. Validation and norming of the Intelligibility in Context Scale in Northern Viet Nam.

    Phạm, Ben; McLeod, Sharynne; Harrison, Linda J


    Vietnamese is one of the 20 most commonly spoken languages in the world; however, there are no standardised tools to assess Vietnamese children's speech. This study aimed to validate and norm the Vietnamese version of the Intelligibility in Context Scale (ICS-VN). Data were collected from parents of 181 children (aged 2;0-5;11) living in Ha Noi, Northern Viet Nam. The mean ICS-VN score was 4.43 (out of a maximum of 5), indicating that children were 'usually' to 'always' intelligible; however, item-level scores demonstrated significant differences between communication partners. Children with parental concerns about speech and language had significantly lower mean scores than children without parental concerns. Scores also differed by children's age, parents' occupation and mothers' education level but not by sex of child or fathers' education level. The ICS-VN had good psychometric properties indicating it to be a valid tool for use with Vietnamese-speaking children in Northern Viet Nam.

  4. Sensitivity, completeness and agreement of the tuberculosis electronic system in Ho Chi Minh City, Viet Nam.

    Thai, L H; Nhat, L M; Shah, N; Lyss, S; Ackers, M


    Setting: Since 2011, tuberculosis (TB) clinics in Ho Chi Minh City (HCMC), Viet Nam, have been entering data from a paper-based TB treatment register into an electronic database known as VITIMES (Viet Nam TB Information Management Electronic System), which is currently used in parallel with the paper system. Objective: To evaluate the sensitivity, completeness and agreement of data in VITIMES with that of paper-based registers among TB patients co-infected with the human immunodeficiency virus (HIV) being treated for TB in HCMC. Design: This was a retrospective data review of all TB-HIV patients receiving anti-tuberculosis treatment in each of the 24 district TB clinics in HCMC in 2013. Data were abstracted from the paper-based TB treatment registers at district level and extracted electronically at the provincial level. Records were matched based on name, age and address. The sensitivity, completeness and agreement of the electronic data were compared with data from the paper system. Results: The findings showed that the electronic system had high sensitivity (99.2%), high completeness (87-99%) and high agreement (κ 0.78-0.97) for all variables. Conclusion: The results of this study suggest that data are being correctly entered into VITIMES and that patient data can be directly entered into VITIMES instead of having a parallel, paper-based system.

  5. Impact of Adverse Events Following Immunization in Viet Nam in 2013 on chronic hepatitis B infection.

    Li, Xi; Wiesen, Eric; Diorditsa, Sergey; Toda, Kohei; Duong, Thi Hong; Nguyen, Lien Huong; Nguyen, Van Cuong; Nguyen, Tran Hien


    Adverse Events Following Immunization in Viet Nam in 2013 led to substantial reductions in hepatitis B vaccination coverage (both the birth dose and the three-dose series). In order to estimate the impact of the reduction in vaccination coverage on hepatitis B transmission and future mortality, a widely-used mathematical model was applied to the data from Viet Nam. Using the model, we estimated the number of chronic infections and deaths that are expected to occur in the birth cohort in 2013 and the number of excessive infections and deaths attributable to the drop in immunization coverage in 2013. An excess of 90,137 chronic infections and 17,456 future deaths were estimated to occur in the 2013 birth cohort due to the drop in vaccination coverage. This analysis highlights the importance of maintaining high vaccination coverage and swiftly responding to reported Adverse Events Following Immunization in order to regain consumer confidence in the hepatitis B vaccine. Copyright © 2015 World Health Organization; licensee Elsevier. Published by Elsevier Ltd.. All rights reserved.

  6. Early marriage and intimate partner violence among adolescents and young adults in Viet Nam.

    Hong Le, Minh Thi; Tran, Thach Duc; Nguyen, Huong Thanh; Fisher, Jane


    Research about the association between early marriage and intimate partner violence (IPV) in low-income countries has yielded conflicting evidence. The aim of this study was to describe the prevalence of and associations between early marriage, and IPV among adolescents and young adults in Viet Nam. Secondary analysis of data from the national Survey Assessment of Viet Namese Youth-Round II (SAVY-II) conducted in 2009-2010, which assessed a representative cohort of people aged 14 to 25 years recruited via a systematic household survey was undertaken. Prevalence was established using descriptive statistics. The association between early marriage and IPV was examined using multiple logistic regressions, adjusting for potential risk factors. Of 10,044 participants, 1,701 had ever married and were included in analyses. Early marriage (before age 18), and experiences of verbal, physical, or sexual IPV were more common among females than males. More young married men than women reported experiences of controlling behaviors by their partners. Early marriage, being illiterate, and exposure to sexual abuse were associated with experience of IPV among young females, but not among young males. Poverty and exposure to family violence was associated with IPV in both sexes. Addressing early marriage, low educational opportunities for girls, childhood sexual abuse, family violence, and poverty should be considered in strategies to reduce IPV in Viet Nam.

  7. Prevalence of and risk factors for violent disciplinary practices at home in Viet Nam.

    Cappa, Claudia; Dam, Hang


    Data on parenting practices and the use of violence in child rearing remain scarce worldwide, hindering prevention efforts. This study examines disciplinary methods used on children at home in Viet Nam. It is based on data collected from 2010 to 2011 through the fourth round of the Multiple Indicator Cluster Survey (MICS4)-a household survey program supported by the United Nations Children's Fund (UNICEF) that focuses on women and children in low- and middle-income countries. Respondents in the survey were asked 11 questions relating to disciplinary measures used in the preceding month on one randomly selected child (2-14 years old) in each household. A final question about attitudes probed adults' views on the need for physical punishment in child rearing. Univariate and multivariate analyses were conducted to estimate the prevalence of violent and nonviolent forms of discipline, and to identify risk factors associated with violent punishment. Results showed that three in four children in Viet Nam are disciplined through violent means. The exposure of Vietnamese children to violent forms of discipline was significantly associated with varied characteristics of both children and their caregivers. Moreover, the use of violent disciplinary practices on children was strongly associated with positive attitudes toward corporal punishment. Risk factors for violent child discipline identified in this study can inform future interventions to promote positive practices and to protect Vietnamese children against violence in the home.

  8. No evidence for ideological asymmetry in dissonance avoidance : Unsuccessful close and conceptual replications of Nam, Jost, and van Bavel

    Collins, Timothy P.; Crawford, Jarret T.; Brandt, M.J.


    Nam, Jost, and van Bavel (2013) found that conservatives were more likely than liberals to avoid dissonance-arousing situations (viz., writing counter-attitudinal essays in a high-choice situation). A close replication of this original research was unsuccessful, as both liberals and conservatives

  9. A Self-Sustained Education System for a Developing Country: The Case of the Socialist Republic of Viet Nam.

    Tran, Dien Ngoc

    Viet Nam's average annual population growth rate is 2.6%, which accounts for a large youth population: 37.7% of the total population is under age 15, compared with an average of 20% in developed or newly industrialized countries. A free basic education for all children is almost impossible to provide. With consideration of the Vietnamese people's…

  10. Examining the Seven-Flag "Chieu Hoi" Pass: A Primary Document from the American War in Viet Nam

    Engelmann, Ted


    During the Viet Nam war, U.S. military helicopters dropped "Chieu Hoi" (safe conduct) passes over suspected enemy locations to encourage enemy soldiers to surrender. This article presents a classroom activity that encourages students to examine a "Chieu Hoi" pass as a primary historical document, identify its various elements,…

  11. Towards a Lifelong Learning Society through Reading Promotion: Opportunities and Challenges for Libraries and Community Learning Centres in Viet Nam

    Hossain, Zakir


    The government of Viet Nam has made a commitment to build a Lifelong Learning Society by 2020. A range of related initiatives have been launched, including the Southeast Asian Ministers of Education Organization Centre for Lifelong Learning (SEAMEO CELLL) and "Book Day"--a day aimed at encouraging reading and raising awareness of its…

  12. The Elimination of Illiteracy and the Use of Complementary Education in the Socialist Republic of Viet Nam.

    United Nations Educational, Scientific, and Cultural Organization, Bangkok (Thailand). Regional Office for Education in Asia and Oceania.

    To counteract the legacy of 80 years of colonial rule in North Viet Nam, President Ho Chi Minh outlined government objectives in the Declaration of Independence in 1945. Major objectives included combatting ignorance and illiteracy. To work toward these objectives, the government established a Department of Popular Education and encouraged…

  13. Accreditation of Viet Nam's Higher Education: Achievements and Challenges after a Dozen Years of Development

    Nguyen, Huu Cuong; Evers, Colin; Marshall, Stephen


    Purpose: The purpose of this paper is to investigate the development of Viet Nam's approach to higher education quality assurance during the past dozen years since its establishment, focusing on the achievements and challenges. Design/methodology/approach: This is a desktop analysis study. The paper analyses the policies and practices related to…

  14. Effects of Social Class and School Conditions on Educational Enrollment and Achievement of Boys and Girls in Rural Viet Nam

    Nguyen, Phuong L.


    This study examines the effects of parental SES, school quality, and community factors on children's enrollment and achievement in rural areas in Viet Nam, using logistic regression and ordered logistic regression. Multivariate analysis reveals significant differences in educational enrollment and outcomes by level of household expenditures and…

  15. Psychological and social factors associated with late pregnancy iron deficiency anaemia in rural Viet Nam: a population-based prospective study.

    Tran, Thach Duc; Biggs, Beverley-Ann; Tran, Tuan; Casey, Gerard J; Hanieh, Sarah; Simpson, Julie Anne; Dwyer, Terence; Fisher, Jane


    The aim of this study was to examine the relationships between psychological and social factors and late pregnancy IDA among pregnant women in rural Viet Nam. Pregnant women from 50 randomly-selected communes within Ha Nam province were recruited and assessed at 12 - 20 weeks gestation (Wave 1, W1). They were followed up in the last trimester (Wave 2, W2). IDA was defined as Haemoglobin Viet Nam. The link between them suggests that while direct recommendations to use iron supplements are important, the social factors associated with common mental disorders should be addressed in antenatal care in order to improve the health of pregnant women and their infants.

  16. A multicentre molecular analysis of hepatitis B and blood-borne virus coinfections in Viet Nam.

    Linda Dunford

    Full Text Available Hepatitis B (HBV infection is endemic in Viet Nam, with up to 8.4 million individuals estimated to be chronically infected. We describe results of a large, multicentre seroepidemiological and molecular study of the prevalence of HBV infection and blood-borne viral coinfections in Viet Nam. Individuals with varying risk factors for infection (n = 8654 were recruited from five centres; Ha Noi, Hai Phong, Da Nang, Khanh Hoa and Can Tho. A mean prevalence rate of 10.7% was observed and levels of HBsAg were significantly higher in injecting drug users (IDUs (17.4%, n = 174/1000 and dialysis patients (14.3%, n = 82/575 than in lower-risk groups (9.4%; p<0.001. Coinfection with HIV was seen in 28% of HBV-infected IDUs (n = 49/174 and 15.2% of commercial sex workers (CSWs; n = 15/99. HCV infection was present in 89.8% of the HBV-HIV coinfected IDUs (n = 44/49 and 40% of HBV-HIV coinfected CSWs (n = 16/40. Anti-HDV was detected in 10.7% (n = 34/318 of HBsAg positive individuals. Phylogenetic analysis of HBV S gene (n = 187 showed a predominance of genotype B4 (82.6%; genotypes C1 (14.6%, B2 (2.7% and C5 (0.5% were also identified. The precore mutation G1896A was identified in 35% of all specimens, and was more frequently observed in genotype B (41% than genotype C (3%; p<0.0001. In the immunodominant 'a' region of the surface gene, point mutations were identified in 31% (n = 58/187 of sequences, and 2.2% (n = 4/187 and 5.3% (n = 10/187 specimens contained the major vaccine escape mutations G145A/R and P120L/Q/S/T, respectively. 368 HBsAg positive individuals were genotyped for the IL28B SNP rs12979860 and no significant association between the IL28B SNP and clearance of HBsAg, HBV viral load or HBeAg was observed. This study confirms the high prevalence of HBV infection in Viet Nam and also highlights the significant levels of blood-borne virus coinfections, which have important implications for hepatitis-related morbidity and development of effective

  17. Drinking & driving in Viet Nam: prevalence, knowledge, attitudes, and practices in two provinces.

    Bachani, Abdulgafoor M; Jessani, Nasreen S; Pham, V Cuong; Quang, La Ngoc; Nguyen, Phuong N; Passmore, Jonathon; Hyder, Adnan A


    Viet Nam is experiencing a shift in its burden of disease profile with injuries becoming more prominent. A history of high alcohol involvement in road traffic crashes despite stringent laws led to increased enforcement by police, enhanced public education messaging and targeted social marketing campaigns in Ha Nam and Ninh Binh provinces in Viet Nam. This study aims to illustrate the changes in prevalence (November 2010 to December 2011) and knowledge, attitudes and practices (KAP) around alcohol use and drink-driving for the year 2011. Breath Alcohol Concentration (BrAC) was collected through police enforcement checkpoints in the two provinces. The proportion of drivers with BrAC above the legal limit was plotted over time for both provinces. The trend in prevalence of drink-driving over time was further assessed using Poisson regression models. Prevailing KAPs were determined through surveying randomly selected road users over the age of 17 years at gas stations at quarterly intervals. Cross tabulations of key variables as well Chi-Square statistic were used to assess associations. A total of 8,404 drivers were tested for BrAC levels of which less than 0.25% were female. Of 1,639 drivers displaying BrAC levels in excess of the legal limit, 87.3% were car drivers, 7.9% motorcyclists and 86% were between the ages of 25 and 44 years. KAP surveys captured 1,661 drivers over the study period. The prevalence of self-reported drink-driving increased 6 percentage points among respondents aged 27-36. Between 44% (January 2011) and 49% (December 2011) of respondents indicated awareness of a drinking and driving Blood Alcohol Concentration (BAC) or BrAC limit and only 25% of all study participants recalled being penalized for a traffic violation - none of which were for drink-driving. While there has been some reduction in drink-driving prevalence, inadequate or incorrect knowledge on drink-driving legislation appears to be an impediment to greater gains. Increased

  18. A Flood Risk Assessment of Quang Nam, Vietnam Using Spatial Multicriteria Decision Analysis

    Chinh Luu


    Full Text Available Vietnam is highly vulnerable to flood and storm impacts. Holistic flood risk assessment maps that adequately consider flood risk factors of hazard, exposure, and vulnerability are not available. These are vital for flood risk preparedness and disaster mitigation measures at the local scale. Unfortunately, there is a lack of knowledge about spatial multicriteria decision analysis and flood risk analysis more broadly in Vietnam. In response to this need, we identify and quantify flood risk components in Quang Nam province through spatial multicriteria decision analysis. The study presents a new approach to local flood risk assessment mapping, which combines historical flood marks with exposure and vulnerability data. The flood risk map output could assist and empower decision-makers in undertaking flood risk management activities in the province. Our study demonstrates a methodology to build flood risk assessment maps using flood mark, exposure and vulnerability data, which could be applied in other provinces in Vietnam.

  19. EIA models and capacity building in Viet Nam: an analysis of development aid programs

    Doberstein, Brent


    There has been a decided lack of empirical research examining development aid agencies as 'agents of change' in environmental impact assessment (EIA) systems in developing countries, particularly research examining the model of environmental planning practice promoted by aid agencies as part of capacity building. This paper briefly traces a conceptual framework of EIA, then introduces the concept of 'EIA capacity building'. Using Viet Nam as a case study, the paper then outlines the empirical results of the research, focusing on the extent to which aid agency capacity-building programs promoted a Technical vs. Planning Model of EIA and on the coherence of capacity-building efforts across all aid programs. A discussion follows, where research results are interpreted within the Vietnamese context, and implications of research results are identified for three main groups of actors. The paper concludes by calling for development aid agencies to reconceptualise EIA capacity building as an opportunity to transform developing countries' development planning processes

  20. On stable ground: Tackling soil erosion with nuclear techniques in Viet Nam

    Gaspar, Miklos


    Dao Thanh Canh never studied physics or chemistry in school, but he understands a thing or two about nuclear isotopes. Until a couple of years ago, much of his five acre farm on the hills of central Viet Nam was gradually sliding away. Thanks to nuclear techniques used in determining the exact cause and source of soil erosion, his land is now stable, and his coffee plantation profitable. “We were very worried as uncertainty loomed,” he said. “A few centimetres of the soil disappeared every year when we had big hail storms.” Thanh Canh is not alone. Soil degradation affects 1.9 billion hectares of land worldwide, close to two thirds of global soil resources.

  1. Prevalence and risk factors for tuberculosis infection among hospital workers in Hanoi, Viet Nam.

    Lien, Luu Thi; Hang, Nguyen Thi Le; Kobayashi, Nobuyuki; Yanai, Hideki; Toyota, Emiko; Sakurada, Shinsaku; Thuong, Pham Huu; Cuong, Vu Cao; Nanri, Akiko; Mizoue, Tetsuya; Matsushita, Ikumi; Harada, Nobuyuki; Higuchi, Kazue; Tuan, Le Anh; Keicho, Naoto


    Transmission of tuberculosis (TB) to health care workers (HCWs) is a global issue. Although effective infection control measures are expected to reduce nosocomial TB, HCWs' infection has not been assessed enough in TB high burden countries. We conducted a cross-sectional study to determine the prevalence of TB infection and its risk factors among HCWs in Hanoi, Viet Nam. A total of 300 HCWs including all staff members in a municipal TB referral hospital received an interferon-gamma release assay (IGRA), QuantiFERON-TB Gold In-Tube(TM), followed by one- and two-step tuberculin skin test (TST) and a questionnaire-based interview. Agreement between the tests was evaluated by kappa statistics. Risk factors for TB infection were analyzed using a logistic regression model. Among the participants aged from 20 to 58 years (median = 40), prevalence of TB infection estimated by IGRA, one- and two-step TST was 47.3%, 61.1% and 66.3% respectively. Although the levels of overall agreement between IGRA and TST were moderate, the degree of agreement was low in the group with BCG history (kappa = 0.29). Working in TB hospital was associated with twofold increase in odds of TB infection estimated by IGRA. Increased age, low educational level and the high body mass index also demonstrated high odds ratios of IGRA positivity. Prevalence of TB infection estimated by either IGRA or TST is high among HCWs in the hospital environment for TB care in Viet Nam and an infection control program should be reinforced. In communities with heterogeneous history of BCG vaccination, IGRA seems to estimate TB infection more accurately than any other criteria using TST.

  2. Harm reduction and “Clean” community: can Viet Nam have both?

    Khuat Thu


    Full Text Available Abstract The findings of our research show that while police play multiple roles in the fight against drug-related crime, they often perceived their tasks – especially preventing and controlling drug use on the one hand, and supporting harm reduction on the other – as contradictory, and this creates tensions in their work and relations with their communities. Although they are leaders and implementers of harm reduction, not all police know about it, and some remain skeptical or perceive it as contradictory to their main task of fighting drugs. Methadone treatment is seen by some as in competition with their main task of coordinating conventional drug treatment in the rehabilitation center. The history of drug use and the evolution of discourses on drug use in Viet Nam have created these conflicting pressures on police, and thus created contradictory expectations and led to different views and attitudes of police regarding various harm reduction measures. This might aid understanding why, despite the comprehensive and progressive policies on HIV/AIDS and harm reduction in Viet Nam, it is not easy for police to actively and effectively support and be involved in harm reduction at the ground level. To promote the wider acceptance of harm reduction the concept of community safety must be expanded to include community health; harm reduction must be integrated into the “new society” movement; and laws and policies need further revision to reduce contradiction between current drug laws and HIV laws. Harm reduction guidelines for police and other actors need to be disseminated and supported, embodying better ways of working between sectors, and all sectors in the partnership require support for building capacity to contribute to the overall goal.

  3. The online measured black carbon aerosol and source orientations in the Nam Co region, Tibet.

    Zhang, Xin; Ming, Jing; Li, Zhongqin; Wang, Feiteng; Zhang, Guoshuai


    Equivalent black carbon (eBC) mass concentrations were measured by an aethalometer (AE-31) in the Nam Co, central Tibet from 2010 to 2014. Different from previous filter-sampling studies (Ming et al., J Environ Sci 22(11):1748-1756, 2010; Zhao et al., Environ Sci Pollut Res 20:5827-5838, 2013), the first high-resolution online eBC measurement conducted in central Tibet is reported here, allowing to discuss the diurnal variations as well as seasonal variabilities of eBC. Average daily eBC concentration was 74 ± 50 ng/m 3 , reflecting a global background level. Meteorological conditions influenced eBC concentrations largely at seasonal scale, which are higher in February-May but lower in June-January. The highest eBC concentrations (greater than 210 ng/m 3 ) were more associated with the W and WSW winds smaller than 6 m/s. The diurnal variations of eBC showed plateaus from 10:00 to 15:00 with seasonal variations, associated with local anthropogenic activities, such as indigenous Tibetan burning animal waste and tourism traffic. The PBLHs showed a co-variance with eBC concentrations, implicating close sources. The aerosol optical depths derived from the MODIS data over the Nam Co Observatory Station (NCOS)-included sub-area (30° N-40° N, 90° E-100° E) showed significant relationship with eBC concentrations. This suggests that nearby or short-distance sources other than long-distance transported pollutants could be important contributors to eBC concentrations at the NCOS, different from the conclusions suggested by previous studies.

  4. Prevalence and risk factors for tuberculosis infection among hospital workers in Hanoi, Viet Nam.

    Luu Thi Lien

    Full Text Available BACKGROUND: Transmission of tuberculosis (TB to health care workers (HCWs is a global issue. Although effective infection control measures are expected to reduce nosocomial TB, HCWs' infection has not been assessed enough in TB high burden countries. We conducted a cross-sectional study to determine the prevalence of TB infection and its risk factors among HCWs in Hanoi, Viet Nam. METHODOLOGY/PRINCIPAL FINDINGS: A total of 300 HCWs including all staff members in a municipal TB referral hospital received an interferon-gamma release assay (IGRA, QuantiFERON-TB Gold In-Tube(TM, followed by one- and two-step tuberculin skin test (TST and a questionnaire-based interview. Agreement between the tests was evaluated by kappa statistics. Risk factors for TB infection were analyzed using a logistic regression model. Among the participants aged from 20 to 58 years (median = 40, prevalence of TB infection estimated by IGRA, one- and two-step TST was 47.3%, 61.1% and 66.3% respectively. Although the levels of overall agreement between IGRA and TST were moderate, the degree of agreement was low in the group with BCG history (kappa = 0.29. Working in TB hospital was associated with twofold increase in odds of TB infection estimated by IGRA. Increased age, low educational level and the high body mass index also demonstrated high odds ratios of IGRA positivity. CONCLUSIONS/SIGNIFICANCE: Prevalence of TB infection estimated by either IGRA or TST is high among HCWs in the hospital environment for TB care in Viet Nam and an infection control program should be reinforced. In communities with heterogeneous history of BCG vaccination, IGRA seems to estimate TB infection more accurately than any other criteria using TST.

  5. Risk Factors for Chronic Disease in Viet Nam: A Review of the Literature

    Rao, Chalapati; Nhung, Nguyen Thi Trang; Marks, Geoffrey; Hoa, Nguyen Phuong


    Introduction Chronic diseases account for most of the disease burden in low- and middle-income countries, particularly those in Asia. We reviewed literature on chronic disease risk factors in Viet Nam to identify patterns and data gaps. Methods All population-based studies published from 2000 to 2012 that reported chronic disease risk factors were considered. We used standard chronic disease terminology to search PubMed and assessed titles, abstracts, and articles for eligibility for inclusion. We summarized relevant study information in tables listing available studies, risk factors measured, and the prevalence of these risk factors. Results We identified 23 studies conducted before 2010. The most common age range studied was 25 to 64 years. Sample sizes varied, and sample frames were national in 5 studies. A combination of behavioral, physical, and biological risk factors was studied. Being overweight or obese was the most common risk factor studied (n = 14), followed by high blood pressure (n = 11) and tobacco use (n = 10). Tobacco and alcohol use were high among men, and tobacco use may be increasing among Vietnamese women. High blood pressure is common; however, people’s knowledge that they have high blood pressure may be low. A high proportion of diets do not meet international criteria for fruit and vegetable consumption. Prevalence of overweight and obesity is increasing. None of the studies evaluated measured dietary patterns or total caloric intake, and only 1 study measured dietary salt intake. Conclusion Risk factors for chronic diseases are common in Viet Nam; however, more recent and context-specific information is required for planning and monitoring interventions to reduce risk factors and chronic disease in this country. PMID:23306076

  6. Touchstone for Japan's Export of nuclear power plant system. Vinh Hai unit 1 and 2 project in the Ninh Thuan province in Viet Nam

    Mitsumata, Hiroki; Takekuro, Ichiro; Kaneko, Kumao; Suzuki, Hideaki; Saito, Shinzo


    'Japan-Viet Nam Joint Statement on the Strategic Partnership for Peace and Prosperity in Asia' issued after the meeting between Japan-Viet Nam Prime Ministers on October 31, affirmed that the Vietnamese Government had decided to choose Japan as the cooperation partner for building Vinh Hai Unit 1 and 2 Project in the Ninh Thuan Province, southern Viet Nam, which showed substantially an order of Japan was arranged informally. 'International Nuclear Energy Development of Japan Co., Ltd. (JINED)' set up by industry and government, would negotiate to decide fundamental parameters such as type and power of nuclear power plants with the start of operation scheduled in 2021. This special issue consisted of six articles on significance of the project of Japan's first export, feasibility studies and future perspective and regional effects with introduction of nuclear power station in Viet Nam. (T. Tanaka)

  7. La sexualidad en adolescentes de la secundaria básica "Viet Nam" Sexuality of adolescent students in "Viet Nam" junior high school

    Elisa Puentes Rizo


    Full Text Available Introducción: en la actualidad existe en los adolescentes una temprana iniciación de las relaciones sexuales y cambios en la actitud social hacia la sexualidad. Objetivo: identificar las particularidades y conocimientos sobre sexualidad en adolescentes. Métodos: se realizó una investigación descriptiva y transversal en adolescentes entre los 12 y 15 años, de la secundaria básica "Viet Nam" del municipio Arroyo Naranjo, durante los años 2009-2010. El universo estuvo constituido por 296 estudiantes y la muestra por 150, seleccionados mediante sorteo hasta completar 50 estudiantes de cada año. La información se obtuvo de una encuesta validada por el Ministerio de Educación. Todos los seleccionados expresaron su consentimiento para participar en la investigación. Resultados: predominó el sexo masculino y los adolescentes de 15 años. El inicio de las relaciones sexuales fue a los 14 años en los muchachos y a los 15 en las muchachas; 72 (56,69 % adolescentes utilizaron el condón en su "primera vez". Las principales vías de obtención de información fueron los padres, profesores y la información televisiva. Hubo mayor conocimiento sobre VIH-sida, gonorrea y sífilis y menor sobre, herpes simple y clamidia. El condón resultó ser el método anticonceptivo más conocido. Conclusiones: hay un inicio precoz en las relaciones sexuales y poco conocimiento acerca de los métodos anticonceptivos biológicos o naturales, lo que pudiera estar indicando la importancia que tiene la familia, sobre todo los padres, los profesores y médicos de familia, en incrementar y mantener la labor educativa con los jóvenes en relación con la sexualidad.Introduction: there exists an early onset of sexual relations in adolescents at present, together with changes in the social attitude towards sexuality. Objective: to identify the particularities of and the knowledge on sexuality in adolescents. Methods: a cross-sectional and descriptive research study was

  8. Enterovirus D68 in Viet Nam (2009-2015 [version 1; referees: 2 approved, 1 approved with reservations

    Nguyen Thi Han Ny


    Full Text Available Background: Since 1962, enterovirus D68 (EV-D68 has been implicated in multiple outbreaks and sporadic cases of respiratory infection worldwide, but especially in the USA and Europe with an increasing frequency between 2010 and 2014. We describe the detection, associated clinical features and molecular characterization of EV-D68 in central and southern Viet Nam between 2009 and 2015. Methods: Enterovirus/rhinovirus PCR positive respiratory or CSF samples taken from children and adults with respiratory/central nervous system infections in Viet Nam were tested by an EV-D68 specific PCR. The included samples were derived from 3 different observational studies conducted at referral hospitals across central and southern Viet Nam between 2009 and 2015. Whole-genome sequencing was carried out using a MiSeq based approach. Phylogenetic reconstruction and estimation of evolutionary rate and recombination were carried out in BEAST and Recombination Detection Program, respectively. Results: EV-D68 was detected in 21/625 (3.4% enterovirus/rhinovirus PCR positive respiratory samples but in none of the 15 CSF. All the EV-D68 patients were young children (age range: 11.8 – 24.5 months and had moderate respiratory infections. Phylogenetic analysis suggested that the Vietnamese sequences clustered with those from Asian countries, of which 9 fell in the B1 clade, and the remaining sequence was identified within the A2 clade. One intra sub-clade recombination event was detected, representing the second reported recombination within EV-D68. The evolutionary rate of EV-D68 was estimated to be 5.12E-3 substitutions/site/year. Phylogenetic analysis indicated that the virus was imported into Viet Nam in 2008. Conclusions: We have demonstrated for the first time EV-D68 has been circulating at low levels in Viet Nam since 2008, associated with moderate acute respiratory infection in children. EV-D68 in Viet Nam is most closely related to Asian viruses, and clusters

  9. Brief behavioural surveys in routine HIV sentinel surveillance: a new tool for monitoring the HIV epidemic in Viet Nam

    Duong Cong Thanh


    Full Text Available In this report we describe a new approach in HIV sentinel surveillance that was piloted in Viet Nam in 2009 and is currently being rolled out in all provinces. It comprises a brief behavioural questionnaire added to the HIV sentinel surveillance surveys conducted routinely among people who inject drugs, female sex workers and men who have sex with men. Timely reporting of data from this system has resulted in improvements to HIV prevention efforts for most at-risk populations.

  10. Brief behavioural surveys in routine HIV sentinel surveillance: a new tool for monitoring the HIV epidemic in Viet Nam.

    Thanh, Duong Cong; Hien, Nguyen Tran; Tuan, Nguyen Anh; Ha, Hoang Thi Thanh; Thang, Pham Hong; Ha, Nguyen Thi Thanh; Tuan, Le Anh; Quang, Tran Dai; Tram, Tran Hong; Le Hai, Nguyen; Huong, Phan Thi Thu; Son, Vo Hai; Duc, Bui Hoang; Nga, Nguyen Thien; Jacka, David; Sabin, Keith


    In this report we describe a new approach in HIV sentinel surveillance that was piloted in Viet Nam in 2009 and is currently being rolled out in all provinces. It comprises a brief behavioural questionnaire added to the HIV sentinel surveillance surveys conducted routinely among people who inject drugs, female sex workers and men who have sex with men. Timely reporting of data from this system has resulted in improvements to HIV prevention efforts for most at-risk populations.

  11. Positive and negative metacognitions about alcohol use among university students: Psychometric properties of the PAMS and NAMS French versions.

    Gierski, Fabien; Spada, Marcantonio M; Fois, Eveline; Picard, Aurélie; Naassila, Mickaël; Van der Linden, Martial


    Metacognitions about the positive and negative effects of alcohol use have been associated with various patterns of drinking. The aim of the present study was to validate French versions of the Positive Alcohol Metacognitions Scale (PAMS) and the Negative Alcohol Metacognitions Scale (NAMS) developed by Spada and Wells (2008, Addict. Behav. 33, 515) and to investigate the relationship between metacognitions and patterns of alcohol use among university students. Responses of 1600 university students who participated in an internet survey-based study on alcohol use were submitted to confirmatory (N=800, mean age 20.40 years, 45.50% male) and exploratory (N=800, mean age 20.34 years, 45.38% male) factor analyses in two separate samples. Alcohol use, binge drinking and mood were also assessed. In line with the original versions of the scales, results provided support for a two-factor structure of the French PAMS and NAMS. Both scales revealed adequate internal reliability. Good temporal stability was found for the two factors of the NAMS, whereas one factor of the PAMS showed weakness across time. Predictive validity revealed that negative alcohol metacognitions about the uncontrollability of alcohol use were found to be consistently associated with alcohol use and binge drinking, whereas positive metacognitions about alcohol use were found to be differentially associated with alcohol use and binge drinking. The French versions of the PAMS and NAMS exhibited suitable psychometric properties. This study also emphasized the role of metacognitions about alcohol use in drinking behaviour among university students. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  12. Improving the diagnosis of pulmonary tuberculosis in HIV-infected individuals in Ho Chi Minh City, Viet Nam.

    Nguyen, D T M; Hung, N Q; Giang, L T; Dung, N H; Lan, N T N; Lan, N N; Yen, N T B; Bang, N D; Ngoc, D V; Trinh, L T T; Beasley, R P; Ford, C E; Hwang, L-Y; Graviss, E A


    District 6, An Hoa Clinic in Ho Chi Minh City (HCMC), Viet Nam. To evaluate the performance of various algorithms in tuberculosis (TB) screening and diagnosis in a human immunodeficiency virus (HIV) infected population in HCMC, Viet Nam. A cross-sectional study of 397 consecutive HIV-infected patients seeking care at the An Hoa Clinic from August 2009 to June 2010. Data on participant demographics, clinical status, chest radiography (CXR) and laboratory results were collected. A multiple logistic regression model was developed to assess the association of covariates and pulmonary TB (PTB). The prevalence of sputum culture-confirmed PTB, acid-fast bacilli (AFB) positive TB, and multidrugresistant TB among the 397 HIV-infected patients was respectively 7%, 2%, and 0.3%. Adjusted odds ratios for low CD4+ cell count, positive sputum smear, and CXR to positive sputum culture were respectively 3.17, 32.04 and 4.28. Clinical findings alone had poor sensitivity, but combining CD4+ cell count, AFB sputum smear and CXR had a more accurate diagnostic performance. Results suggest that symptom screening had poor clinical performance, and support the routine use of sputum culture to improve the detection of TB disease in HIV-infected individuals in Viet Nam. However, when routine sputum culture is not available, an algorithm combining CD4+ cell count, AFB sputum smear and CXR is recommended for diagnosing PTB.

  13. Decreasing In-home Smoking of Adults-Results from a School-based Intervention Program in Viet Nam.

    Huong, Le Thi Thanh; Long, Tran Khanh; Anh, Le Vu; Cook, Margaret; Capra, Mike


    It is indicated that children are involuntarily exposed to secondhand smoke from adults, mainly at their home environment. This study aimed at describing the effectiveness of the school-based intervention to decrease the in-home smoking situation of adults so as to decrease children's exposure to secondhand smoke at home during the year 2011-2012 in a rural district in Hanoi, Viet Nam. This school-based intervention program (intervention and control group) involved 804 children aged 8 to 11 years from August 2011 to May 2012 in a rural district of Hanoi, Viet Nam. Children were taught in class about the harmful effects of secondhand smoke and about how to negotiate with fathers not to smoke in-home. Then children applied what they learnt, including staying away from secondhand smoke and persuading fathers not to smoke in-home in order to decrease children's exposure to secondhand smoke. Chi square test, t-test and multinominal logistic regression were applied in data analysis. The results showed that children's reported their father's in-home smoking decreased from 83.0% pre-intervention to 59.8% post-intervention ( p Viet Nam to increase children's awareness on the adverse health effects of secondhand smoke and to help them to be able to avoid their exposure to secondhand smoke at their home environment.

  14. Seasonal variability of faecal indicator bacteria numbers and die-off rates in the Red River basin, North Viet Nam

    Nguyen, Huong Thi Mai; Le, Quynh Thi Phuong; Garnier, J.; Janeau, J.-L.; Rochelle-Newall, E.


    The Red River is the second largest river in Viet Nam and constitutes the main water source for a large percentage of the population of North Viet Nam. Here we present the results of an annual survey of Escherichia coli (EC) and Total Coliforms (TC) in the Red River basin, North Viet Nam. The objective of this work was to obtain information on faecal indicator bacteria (FIB) numbers over an annual cycle and, secondly, to determine the die-off rates of these bacterial indicators. Monthly observations at 10 stations from July 2013-June 2014 showed that TC and EC reached as high as 39100 cfu (colony forming units) 100 ml-1 and 15300 colonies 100 ml-1, respectively. We observed a significant seasonal difference for TC (p < 0.05) with numbers being higher during the wet season. In contrast, no significant seasonal difference was found for EC. The FIB die-off rates ranged from 0.01 d-1 to a maximum of 1.13 d-1 for EC and from 0.17 d-1 to 1.33 d-1 for TC. Die-off rates were significantly higher for free bacteria than for total (free + particle attached) bacteria, suggesting that particle attachment provided a certain level of protection to FIB in this system.

  15. Land use changes assessment using spatial data: Case study in Cong river basin - Thai Nguyen City - Viet Nam

    Nguyen, Hieu

    Land use changes are being interested in most countries, especially in developing countries. Because land use changes always impacts on sustainable development not only in a region or a country but also in whole the world. Viet Nam is a developing country, in the last 10 years, land uses have rapidly changed in most provinces. Many of agriculture areas, forest areas have changed for various purposes as urban sprawl, establishing new industrial parks, public areas, mining and other land uses relate to human activities or economic function associated with a specific piece of land. Beside efficiencies of economic and society, then environment issues have been threatening serious pollution, are from land use changes. Remote sensing images application on studying land use changes, has been done in many countries around the world, and has brought high efficiencies. However, this application is still very new and limited in Viet Nam due to lacking of materials, tools, experts of remote sensing. This study used spatial data as Landsat TM images, SPOT5 images and land use planning maps to rapidly assess on happenings of land uses in the period 2000 -2010 in Cong river basin (Thai Nguyen City, Viet Nam), and to forecast the changes of land uses in the period 2010 - 2020. The results had a good accuracy and to be important references for authorities, policy makers in local land use.

  16. Completeness and reliability of mortality data in Viet Nam: Implications for the national routine health management information system.

    Hong, Tran Thi; Phuong Hoa, Nguyen; Walker, Sue M; Hill, Peter S; Rao, Chalapati


    Mortality statistics form a crucial component of national Health Management Information Systems (HMIS). However, there are limitations in the availability and quality of mortality data at national level in Viet Nam. This study assessed the completeness of recorded deaths and the reliability of recorded causes of death (COD) in the A6 death registers in the national routine HMIS in Viet Nam. 1477 identified deaths in 2014 were reviewed in two provinces. A capture-recapture method was applied to assess the completeness of the A6 death registers. 1365 household verbal autopsy (VA) interviews were successfully conducted, and these were reviewed by physicians who assigned multiple and underlying cause of death (UCOD). These UCODs from VA were then compared with the CODs recorded in the A6 death registers, using kappa scores to assess the reliability of the A6 death register diagnoses. The overall completeness of the A6 death registers in the two provinces was 89.3% (95%CI: 87.8-90.8). No COD recorded in the A6 death registers demonstrated good reliability. There is very low reliability in recording of cardiovascular deaths (kappa for stroke = 0.47 and kappa for ischaemic heart diseases = 0.42) and diabetes (kappa = 0.33). The reporting of deaths due to road traffic accidents, HIV and some cancers are at a moderate level of reliability with kappa scores ranging between 0.57-0.69 (pViet Nam.

  17. Using lot quality-assurance sampling and area sampling to identify priority areas for trachoma control: Viet Nam.

    Myatt, Mark; Mai, Nguyen Phuong; Quynh, Nguyen Quang; Nga, Nguyen Huy; Tai, Ha Huy; Long, Nguyen Hung; Minh, Tran Hung; Limburg, Hans


    To report on the use of lot quality-assurance sampling (LQAS) surveys undertaken within an area-sampling framework to identify priority areas for intervention with trachoma control activities in Viet Nam. The LQAS survey method for the rapid assessment of the prevalence of active trachoma was adapted for use in Viet Nam with the aim of classifying individual communes by the prevalence of active trachoma among children in primary school. School-based sampling was used; school sites to be sampled were selected using an area-sampling approach. A total of 719 communes in 41 districts in 18 provinces were surveyed. Survey staff found the LQAS survey method both simple and rapid to use after initial problems with area-sampling methods were identified and remedied. The method yielded a finer spatial resolution of prevalence than had been previously achieved in Viet Nam using semiquantitative rapid assessment surveys and multistage cluster-sampled surveys. When used with area-sampling techniques, the LQAS survey method has the potential to form the basis of survey instruments that can be used to efficiently target resources for interventions against active trachoma. With additional work, such methods could provide a generally applicable tool for effective programme planning and for the certification of the elimination of trachoma as a blinding disease.

  18. Atmospheric nitrogen deposition budget in a subtropical hydroelectric reservoir (Nam Theun II case study, Lao PDR)

    Adon, Marcellin; Galy-Lacaux, Corinne; Serça, Dominique; Guerin, Frederic; Guedant, Pierre; Vonghamsao, Axay; Rode, Wanidaporn


    With 490 km² at full level of operation, Nam Theun 2 (NT2) is one of the largest hydro-reservoir in South East Asia. NT2 is a trans-basin hydropower project that diverts water from the Nam Theun river (a Mekong tributary) to the Xe Ban Fai river (another Mekong tributary). Atmospheric deposition is an important source of nitrogen (N), and it has been shown that excessive fluxes of N from the atmosphere has resulted in eutrophication of many coastal waters. A large fraction of atmospheric N input is in the form of inorganic N. This study presents an estimation of the atmospheric inorganic nitrogen budget into the NT2 hydroelectric reservoir based on a two-year monitoring (July 2010 to July 2012) including gas concentrations and precipitation. Dry deposition fluxes are calculated from monthly mean surface measurements of NH3, HNO3 and NO2 concentrations (passive samplers) together with simulated deposition velocities, and wet deposition fluxes from NH4+ and NO3- concentrations in single event rain samples (automated rain sampler). Annual rainfall amount was 2500 and 3160 mm for the two years. The average nitrogen deposition flux is estimated at 1.13 kgN.ha-1.yr-1 from dry processes and 5.52 kgN.ha-1.yr-1 from wet ones, i.e., an average annual total nitrogen flux of 6.6 kgN.ha-1.yr-1 deposited into the NT2 reservoir. The wet deposition contributes to 83% of the total N deposition. The nitrogen deposition budget has been also calculated over the rain tropical forest surrounding the reservoir. Due to higher dry deposition velocities above forested ecosystems, gaseous dry deposition flux is estimated at 4.0 kgN.ha-1.yr-1 leading to a total nitrogen deposition about 9.5 kgN.ha-1.yr-1. This result will be compared to nitrogen deposition in the African equatorial forested ecosystems in the framework of the IDAF program (IGAC-DEBITS-AFrica).

  19. Genotypic differences in phosphorus use efficiency and yield of wetland rice of southern Viet Nam

    Bui Thi Hong Thanh; Le Dac Lieu; Luong Thu Tra; Mai Thanh Son; Nguyen Dang Nghia; Do Trung Binh


    This study was conducted during 1992 to 1994 with the objective of assessing genotypic differences in phosphorus use efficiency of wetland rice (Oriza sativa L.) and to select genotypes which grow well on soils low in available P or requiring only small amounts of added phosphorus fertilizer. In the first experiment, 24 genotypes of rice were screened under field conditions at low P (0 P added) and high P (90 kg P 2 O 5 /ha) on a gray soil of South Viet Nam. Significant genotypic differences were found in straw and grain yield, total P uptake, plant height and phosphorus use efficiency. Grain yield was highly correlated with phosphorus use efficiency. The effect of P supply was generally small. On average P supply decreased straw yield and increased grain yield. In the second experiment, four genotypes selected from the first experiment were grown under greenhouse conditions for four weeks supplied with 0, 30 and 90 ppm. Dry weight of shoots did not respond to P fertilization, but dry weight of roots increased with increasing P supply. The two efficient genotypes, G6 and G22, showed a higher root/shoot ratio than the two inefficient genotypes, G11 and G19. This indicates a higher potential for P acquisition of G6 and G22. In the third experiment, the same contrasting genotypes, and G18 with intermediate efficiency, were grown under field conditions at 0, 30, 60, 90 and 120 kg P 2 O 5 /ha. Of the two inefficient genotypes, G11 gave the highest grain yield at 60 and G19 at 90 kg P 2 O 5 /ha; G18 gave a clear response up to 60 kg P 2 O 5 /ha. Based on the information obtained in this study we conclude that G6 and G22 are efficiently and well adapted rice genotypes to gray soils of South Viet Nam, low in available P. At low P supply G6 may be slightly better than G22. Further, the 15 N tracer study showed that for G6, a small P supply (30 kg P 2 O 5 /ha) can increase the % N recover from urea applied at 120 kg N/ha. (author). 12 refs, 6 figs, 3 tabs

  20. Genotypic differences in phosphorus use efficiency and yield of wetland rice of southern Viet Nam

    Hong Thanh, Bui Thi; Lieu, Le Dac; Tra, Luong Thu; Son, Mai Thanh [Center of Nuclear Techniques, Ho Chi Minh City (Viet Nam); Nghia, Nguyen Dang; Binh, Do Trung [Agricultural Science Inst., Ho Chi Minh City (Viet Nam)


    This study was conducted during 1992 to 1994 with the objective of assessing genotypic differences in phosphorus use efficiency of wetland rice (Oriza sativa L.) and to select genotypes which grow well on soils low in available P or requiring only small amounts of added phosphorus fertilizer. In the first experiment, 24 genotypes of rice were screened under field conditions at low P (0 P added) and high P (90 kg P{sub 2}O{sub 5}/ha) on a gray soil of South Viet Nam. Significant genotypic differences were found in straw and grain yield, total P uptake, plant height and phosphorus use efficiency. Grain yield was highly correlated with phosphorus use efficiency. The effect of P supply was generally small. On average P supply decreased straw yield and increased grain yield. In the second experiment, four genotypes selected from the first experiment were grown under greenhouse conditions for four weeks supplied with 0, 30 and 90 ppm. Dry weight of shoots did not respond to P fertilization, but dry weight of roots increased with increasing P supply. The two efficient genotypes, G6 and G22, showed a higher root/shoot ratio than the two inefficient genotypes, G11 and G19. This indicates a higher potential for P acquisition of G6 and G22. In the third experiment, the same contrasting genotypes, and G18 with intermediate efficiency, were grown under field conditions at 0, 30, 60, 90 and 120 kg P{sub 2}O{sub 5}/ha. Of the two inefficient genotypes, G11 gave the highest grain yield at 60 and G19 at 90 kg P{sub 2}O{sub 5}/ha; G18 gave a clear response up to 60 kg P{sub 2}O{sub 5}/ha. Based on the information obtained in this study we conclude that G6 and G22 are efficiently and well adapted rice genotypes to gray soils of South Viet Nam, low in available P. At low P supply G6 may be slightly better than G22. Further, the {sup 15}N tracer study showed that for G6, a small P supply (30 kg P{sub 2}O{sub 5}/ha) can increase the % N recover from urea applied at 120 kg N/ha.

  1. Common perinatal mental disorders in northern Viet Nam: community prevalence and health care use

    Tran, Thach; La, Buoi thi; Kriitmaa, Kelsi; Rosenthal, Doreen; Tran, Tuan


    Abstract Objective To establish the prevalence of common perinatal mental disorders their determinants, and their association with preventive health care use among women in one rural and one urban province in northern Viet Nam. Methods We conducted a cross-sectional survey of cohorts of pregnant women and mothers of infants recruited systematically in 10 randomly-selected communes. The women participated in psychiatrist-administered structured clinical interviews and separate structured interviews to assess sociodemographic factors, reproductive health, the intimate partner relationship, family violence and the use of preventive and psychiatric health care. Associations between these variables and perinatal mental disorders were explored through univariate analyses and multivariable logistic regression. Findings Among women eligible for the study (392), 364 (93%) were recruited. Of these, 29.9% (95% confidence interval, CI: 25.20–34.70) were diagnosed with a common perinatal mental disorder (CPMD). The frequency of such disorders during pregnancy and in the postpartum period was the same. Their prevalence was higher among women in rural provinces (odds ratio, OR: 2.17; 95% CI: 1.19–3.93); exposed to intimate partner violence (OR: 2.11; 95% CI: 1.12–3.96); fearful of other family members (OR: 3.36; 95% CI: 1.05–10.71) or exposed to coincidental life adversity (OR: 4.40; 95% CI: 2.44–7.93). Fewer women with a CPMD used iron supplements than women without a CPMD, but the results were not statistically significant (P = 0.05). None of the women studied had ever received mental health care. Conclusion Perinatal depression and anxiety are prevalent in women in northern Viet Nam. These conditions are predominantly determined by social factors, including rural residence, poverty and exposure to family violence. At present the needs of women with common perinatal mental disorders are unrecognized and not attended to and their participation in essential

  2. Co-existence of Paragonimus harinasutai and Paragonimus bangkokensis metacercariae in fresh water crab hosts in central Viet Nam with special emphasis on their close phylogenetic relationship.

    Doanh, Pham Ngoc; Hien, Hoang Van; Nonaka, Nariaki; Horii, Yoichiro; Nawa, Yukifumi


    During our epidemiological surveys for Paragonimus species in central Viet Nam, we found four morphologically different Paragonimus metacercariae in mountainous crabs. They were identified as metacercariae of Paragonimus westermani, P. bangkokensis, P. proliferus, and P. harinasutai in the order of their prevalence in crab hosts. This is the first discovery of P. harinasutai in Viet Nam, co-inhabiting with P. bangkokensis and other species. Metacercariae of P. harinasutai were given orally to a cat to obtain adult worms. Then, ITS2 and CO1 sequences of metacercariae and adults of P. harinasutai, and metacercariae of P. bangkokensis collected from the same place were determined for analyses of phylogenetic relationships to other P. harinasutai and P. bangkokensis populations as well as related species. The results of molecular analyses showed that P. harinasutai from Quang Binh province of central Viet Nam was almost completely identical with those from Vientiane, Lao PDR; P. bangkokensis from Quang Binh, Viet Nam was also almost completely identical with those from Lao PDR and from Quang Ninh province, Viet Nam. Except for one P. harinasutai isolate from China, all populations of P. harinasutai and P. bangkokensis from Thailand, Lao and Viet Nam make a single clade in both ITS2 and CO1 trees. In ITS2 sequences, AT deletion and ATC insertion were observed in some isolates of both species, indicating recent gene flow between P. harinasutai and P. bangkokensis. Moreover, because of their extremely high genetic similarities and their co-inhabitation in the same crab hosts found in Thailand, Lao PDR and Viet Nam, they should be considered as the sister species at the early stage of divergence. In addition, P. microrchis previously described from Yunnan, China should be placed as the synonym of P. harinasutai, because of their morphological and molecular similarities. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

  3. Effect of heat treatment and shelf life on chilling injury of mango cv. Nam Dok Mai

    Apiradee Muangdech


    Full Text Available This study was aimed to investigate the effect of heat treatment and shelf life on chilling injury of mango cv.Nam Dok Mai.The heat treatment of mango pulp during storage were determined by hot air oven set at 34 and 38°C for three intervals, as 24, 48, and 72 hours, then they were subsequently stored at 5°C for 10, 20, and 30 days to determine the appropriate shelf life. The findings showed that the symptom of mango fruit after chilling injury appeared within the 30th day of storage at 5°C. Several symptoms of mango fruit after chilling injury treatment were observed, i.e., pitting, browning on the skin, water soaking, and rapid rotting of the fruits that resulted in shorter shelf life. It was found that chilling injury mangoes had lower level of total soluble solid, higher disease incidence, and lower quality of fruit when compared with normal ripe-mango fruits at 25°C. Mango fruits treated at 34°C for either 24 or 48 hours, and at 38°C for 24 hours prior to cold storage at 5°C for 10 and 20 days showed a significant reduction in the chilling injury (CI index when compared to that of non-heated fruits. On the other hand, the heat treatment did not affect fruit weight loss, firmness, color changes, and water soaking at 5°C.

  4. Feasibility study of VLH hydro turbine installation at Nam Pung hydropower plant, Thailand

    Weerapon Nuantong


    Full Text Available The aim of this research was to study the feasibility of installing a Very Low Head (VLH hydro turbine at downstream of the Nam Pung hydropower plant by increasing the potential of renewable energy sources for the Electricity Generating Authority of Thailand (EGAT. Due to the constraints of the local site, the water head level was limited to less than 2 meters and the flow rate to below 5 m3/ s. The hydro turbine selected was an axial flow turbine with performance of 86.4%. The outcome of the power output was 84.61 kW. Investment analysis was subsequently applied to estimate feasibility of the project using engineering economics. The analyses of results have shown that the project is worthwhile in terms of an investment decision. The payback period of actual price was 0.83 and 0.88 years and general price case of 3.68 and 4.04 years, along with an interest rate of 6.75% and 12.625% respectively. Projected project lifespan is 25 years.

  5. Worlds Apart: Nam Le’s The Boat and Ali Alizadeh’s Transactions

    Lachlan Brown


    Full Text Available This paper reads Ali Alizadeh’s transnational book of short stories (Transactions, 2013 as a curious and pointed response to the kind of literary internationalism seen in Nam Le’s The Boat (2008. Le’s work was first published in the same year as Alizadeh’s The New Angel (which was set during the Iranian revolution. There is a sense in which the spectacular success of Le’s book ‘overshadowed’ the publicity for Alizadeh’s novel in the year of its arrival. But Le’s also work contains a story about an American woman visiting Tehran, and his mimicry perhaps signifies a more problematic representational point of comparison. With this in mind, this paper examines Alizadeh’s Transactions exploring the ways in which Alizadeh’s brutally connected global vision is coded through certain aesthetic choices (including structural, tonal and descriptive that offer something very different to the artisanal and paratactic sensibility of The Boat.

  6. Validation of clinical case definition of acute intussusception in infants in Viet Nam and Australia.

    Bines, Julie E; Liem, Nguyen Thanh; Justice, Frances; Son, Tran Ngoc; Carlin, John B; de Campo, Margaret; Jamsen, Kris; Mulholland, Kim; Barnett, Peter; Barnes, Graeme L


    To test the sensitivity and specificity of a clinical case definition of acute intussusception in infants to assist health-care workers in settings where diagnostic facilities are not available. Prospective studies were conducted at a major paediatric hospital in Viet Nam (the National Hospital of Pediatrics, Hanoi) from November 2002 to December 2003 and in Australia (the Royal Children's Hospital, Melbourne) from March 2002 to March 2004 using a clinical case definition of intussusception. Diagnosis of intussusception was confirmed by air enema or surgery and validated in a subset of participants by an independent clinician who was blinded to the participant's status. Sensitivity of the definition was evaluated in 584 infants agedclinical features consistent with intussusception but for whom another diagnosis was established (234 infants in Hanoi; 404 in Melbourne). In both locations the definition used was sensitive (96% sensitivity in Hanoi; 98% in Melbourne) and specific (95% specificity in Hanoi; 87% in Melbourne) for intussusception among infants with sufficient data to allow classification (449/533 in Hanoi; 50/51 in Melbourne). Reanalysis of patients with missing data suggests that modifying minor criteria would increase the applicability of the definition while maintaining good sensitivity (96-97%) and specificity (83-89%). The clinical case definition was sensitive and specific for the diagnosis of acute intussusception in infants in both a developing country and a developed country but minor modifications would enable it to be used more widely.

  7. Supervisors and accomplices: extra-marital sex among migrant construction workers in Ha Noi, Viet Nam.

    Thuy, Bui Thi Thanh; Kretchmar, Joshua


    This study examines the influence of social networks on the sexual relations of migrant construction workers in Ha Noi, Viet Nam. Research included observation and interviews with members of two different groups of workers. The first group, together with their employer (cai), came from the same village; the second group came from different villages. Of interest in the present study was how social relationships among workers and their employers influence extra-marital sexual activity. In the group where workers and their cai came from the same village of origin, fear of acquiring a bad reputation made these workers reluctant to seek sex services, since accounts of their behaviour were transmitted quickly home. In contrast, workers from the group who came from different villages often went out together to purchase sex. The absence of direct links to their villages of origin made it easier for these latter workers to conceal their activity. The implication of these findings for sexual safety and risk are discussed.

  8. A model immunization programme to control Japanese encephalitis in Viet Nam.

    Yen, Nguyen Thu; Liu, Wei; Hanh, Hoang Duc; Chang, Na Yoon; Duong, Tran Nhu; Gibbons, Robert V; Marks, Florian; Thu, Nghiem Anh; Hong, Nguyen Minh; Park, Jin Kyung; Tuan, Pham Anh; Nisalak, Ananda; Clemens, John D; Xu, Zhi-Yi


    In Viet Nam, an inactivated, mouse brain-derived vaccine for Japanese encephalitis (JE) has been given exclusively to ≤ 5 years old children in 3 paediatric doses since 1997. However, JE incidence remained high, especially among children aged 5-9 years. We conducted a model JE immunization programme to assess the feasibility and impact of JE vaccine administered to 1-9 year(s) children in 3 standard-dose regimen: paediatric doses for children aged <3 years and adult doses for those aged ≥ 3 years. Of the targeted children, 96.2% were immunized with ≥ 2 doses of the vaccine. Compared to the national immunization programme, JE incidence rate declined sharply in districts with the model programme (11.32 to 0.87 per 100,000 in pre-versus post-vaccination period). The rate of reduction was most significant in the 5-9 years age-group. We recommend a policy change to include 5-9 years old children in the catch-up immunization campaign and administer a 4th dose to those aged 5-9 years, who had received 3 doses of the vaccine during the first 2-3 years of life.

  9. Study On The Choice Of Leaching System For Thanh My, Quang Nam Province Uranium Ores Treatment

    Than Van Lien; Nguyen Dinh Van; Tran The Dinh


    In order to implement the plan of peaceful uses of atomic energy, the Radioactive and Rare Earth Geology Division have been carried out the uranium ores exploitation project in Thanh My area of Quang Nam province since 2010. The treatment uranium ores samples is one of works of this project. In order to preparing for uranium ores samples treatment, the Institute for Technology of Radioactive and Rare Elements have been studied and have chosen the heap leaching method for Thanh My uranium ore treatment. The ore, which contained less than 0.07% U, was crushed to -1 cm before being placed in the heap. The acid consumption for this heap leach operation was approximately ranged 40 kg - 45 kg of H 2 SO 4 per tonne of ore, and oxidant 4 kg of MnO 2 per tonne of ore. The entire treatment cycle required 20-25 days, the recovery exceeded 80%, the leached tails contained less than 0.01% U. The experimental results were comparable with those obtained in the field scale heap leaching in the world. (author)

  10. Forty women parliamentarians gather to reaffirm commitment to the ICPD, Ho Chi Minh City, Viet Nam.


    Over 40 delegates attended the Indo-China Female Parliamentarians Conference on the Status of Women and Reproductive Health held in Viet Nam in June 1995. The conference was organized by the Vietnamese Association of Parliamentarians on Population and Development. Participants noted that, in Indochina, the participation of women in local politics has been blocked by the absence of laws and policies on gender equality. Recommended, to remedy this situation, were the following measures: 1) implementation of programs on women's status outlined at the 1994 International Conference on Population and Development; 2) allocation of sufficient resources for programs in the areas of maternal-child health, family planning, and acquired immunodeficiency syndrome (AIDS) prevention; 3) enactment of laws banning child prostitution and violence against women; 4) promotion of changes in men's sexual behaviors that spread AIDS; 5) encouragement of women to increase their knowledge of and participation in political action; and 6) appeals to international agencies and nongovernmental organizations to develop programs for Indochinese women.

  11. Financial burden of household out-of pocket health expenditure in Viet Nam: findings from the National Living Standard Survey 2002-2010.

    Van Minh, Hoang; Kim Phuong, Nguyen Thi; Saksena, Priyanka; James, Chris D; Xu, Ke


    In Viet Nam, household direct out-of-pocket (OOP) health expenditure as a share of the total health expenditure has been always high, ranging from 50% to 70%. The high share of OOP expenditure has been linked to different inequity problems such as catastrophic health expenditure (households must reduce their expenditure on other necessities) and impoverishment. This paper aims to examine catastrophic and poverty impacts of household out-of-pocket health expenditure in Viet Nam over time and identify socio-economic indicators associated with them. Data used in this research were obtained from a nationally representative household survey, Viet Nam Living Standard Survey 2002, 2004, 2006, 2008 and 2010. The findings revealed that there were problems in health care financing in Viet Nam - many households encountered catastrophic health expenditure and/or were pushed into poverty due to health care payments. The issues were pervasive over time. Catastrophic expenditure and impoverishment problems were more common among the households who had more elderly people and those located in rural areas. Importantly, the financial protection aspect of the national health insurance schemes was still modest. Given these findings, more attention is needed on developing methods of financial protection in Viet Nam. Copyright © 2012 Elsevier Ltd. All rights reserved.

  12. Le pluralisme médicamenteux face à l’épidémie de VIH/sida au Viêt Nam Drug Pluralism Confronted by HIV/AIDS Epidemic in Viêt Nam

    Marie-Ève Blanc


    Full Text Available Cet article traite de la place du pluralisme médicamenteux au Viêt Nam dans le contexte de l’épidémie de VIH/sida et de la mise en place d’une nouvelle politique du médicament qui mène à la régulation du médicament traditionnel. Un des principaux problèmes dans la prise en charge du VIH/sida au Viêt Nam fut l’absence de médicaments appropriés, efficaces et accessibles. Contrairement à la Chine, la médecine traditionnelle au Viêt Nam ne s’est pas adaptée, ni n’a réussi à développer durablement de produits spécifiques. Pourtant, l’OMS favorise et incite les thérapeutes traditionnels à participer et à proposer des solutions et pas seulement dans le cadre de soins complémentaires ou palliatifs. On a pu parfois même observer des attitudes plutôt répressives de la part des autorités vietnamiennes à l’égard d’un médicament traditionnel qui n’était pas passé par l’evidence based medicine. En revanche, contrairement à la Chine, le Viêt Nam s’est orienté vers une production locale de médicaments génériques pour répondre aux besoins locaux et baisser le coût de la prise en charge du VIH. À l’aide d’une analyse de contenu de la presse vietnamienne sur le sujet nous tenterons de comprendre les enjeux politiques, économiques et culturels qui se cachent derrière le faible développement de médicaments traditionnels dans le cadre de la prise en charge du VIH/sida. Nous montrerons que l’occidentalisation pendant la période coloniale, l’ouverture du pays depuis le début des années 1990, la globalisation (vue ici comme la multiplication des échanges avec les pays occidentaux et l’intégration du Viêt Nam au reste du monde et à l’ASEAN et la chaîne de production du médicament pharmaceutique ont modifié les pratiques de pluralisme médicamenteux ainsi que la politique nationale en matière de santé, avec des implications à plus ou moins long terme sur les pratiques

  13. John Cage y su influencia en la obra del video artista Nam June Paik

    Sarriugarte Gómez, Íñigo


    Full Text Available In 1958, the Korean artist Nam June Paik (*1932; †2006 meets in Germany John Cage (*1912; †1992, avant-garde musician, who was deeply interested in the Zen Buddhism. The meeting with Cage was vital, because the North American composer will convince him to orient his career towards the artistic avant-garde, giving up his facet like classic pianist. The philosophy of Cage is refl ected in compositions like “4’ 33’’, from 1952, where the spectator doesn’t listen the sound of the piano, because this isn’t played, but he listens a silence that is interrupted by the environmental sound. There are several versions of this piece, marking the silences by means of processes at random with the “I Ching”. In this sense, the silence used by John Cage is related to the vacuity of the Zen Buddhism. Also, Paik makes use of silence in numerous works, like “1963 TV Clock”, where 24 colour television sets are manipulated, feeling at the same time the silence, interrupted again by the own momentary circumstances of the spectator. This same infl uence of the Zen Buddhism in the music of Cage is observed when argues that the music composed of melodies has the same value than the sound understood by us like noises. This aspect, among others, infl uenced to Paik, whose video images are defi ned like attributes of traditional works that don’t impress to the audience, but they suggest variable conditions. Some of his works related to Cage’s philosophy have been “Hommage à John Cage” from 1959; “Study for pianoforte” from 1960; and “Global Grove” from 1973, where Paik uses as a collage the images of his avant-garde collaborators John Cage, Allen Ginsberg and Merce Cunningham.

    En 1958, el artista coreano Nam June Paik (*1932; †2006 conoce en Alemania a John Cage (*1912; †1992, músico vanguardista, quien estaba profundamente interesado en el budismo zen. Su encuentro con Cage fue vital, ya que el compositor

  14. Immunological and viral determinants of dengue severity in hospitalized adults in Ha Noi, Viet Nam.

    Annette Fox


    Full Text Available The relationships between the infecting dengue serotype, primary and secondary infection, viremia and dengue severity remain unclear. This cross-sectional study examined these interactions in adult patients hospitalized with dengue in Ha Noi.158 patients were enrolled between September 16 and November 11, 2008. Quantitative RT-PCR, serology and NS1 detection were used to confirm dengue infection, determine the serotype and plasma viral RNA concentration, and categorize infections as primary or secondary. 130 (82% were laboratory confirmed. Serology was consistent with primary and secondary infection in 34% and 61%, respectively. The infecting serotype was DENV-1 in 42 (32%, DENV-2 in 39 (30% and unknown in 49 (38%. Secondary infection was more common in DENV-2 infections (79% compared to DENV-1 (36%, p<0.001. The proportion that developed dengue haemorrhagic fever (DHF was 32% for secondary infection compared to 18% for primary infection (p = 0.14, and 26% for DENV-1 compared to 28% for DENV-2. The time until NS1 and plasma viral RNA were undetectable was shorter for DENV-2 compared to DENV-1 (p≤0.001 and plasma viral RNA concentration on day 5 was higher for DENV-1 (p = 0.03. Plasma viral RNA concentration was higher in secondary infection on day 5 of illness (p = 0.046. We didn't find an association between plasma viral RNA concentration and clinical severity.Dengue is emerging as a major public health problem in Ha Noi. DENV-1 and DENV-2 were the prevalent serotypes with similar numbers and clinical presentation. Secondary infection may be more common amongst DENV-2 than DENV-1 infections because DENV-2 infections resulted in lower plasma viral RNA concentrations and viral RNA concentrations were higher in secondary infection. The drivers of dengue emergence in northern Viet Nam need to be elucidated and public health measures instituted.

  15. Respiratory virus laboratory pandemic planning an surveillance in central Viet Nam, 2008-2010

    Trinh Xuan Mai


    Full Text Available Introduction: Laboratory capacity is needed in central Viet Nam to provide early warning to public health authorities of respiratory outbreaks of importance to human health, for example the outbreak of influenza A(H1N1 pandemic in 2009. Polymerase chain reaction (PCR procedures established as part of a capacity-building process were used to conduct prospective respiratory surveillance in a region where few previous studies have been undertaken.Methods: Between October 2008 and September 2010, nose and throat swabs from adults and children (approximately 20 per week presenting with an acute respiratory illness to the Ninh Hoa General Hospital were collected. Same-day PCR testing and result reporting for 13 respiratory viruses were carried out by locally trained scientists.Results: Of 2144 surveillance samples tested, 1235 (57.6% were positive for at least one virus. The most common were influenza A strains (17.9%, with pandemic influenza A(H1N1 2009 and seasonal H3N2 strain accounting for 52% and 43% of these, respectively. Other virus detections included: rhinovirus (12.4%, enterovirus (8.9%, influenza B (8.3%, adenovirus (5.3%, parainfluenza (4.7%, respiratory syncytial virus (RSV (3.9%, human coronavirus (3.0% and human metapneumovirus (0.3%. The detection rate was greatest in the 0–5 year age group. Viral co-infections were identified in 148 (6.9% cases.Discussion: The outbreak in 2009 of the influenza A(H1N1 pandemic strain provided a practical test of the laboratory’s pandemic plan. This study shows that the availability of appropriate equipment and molecular-based testing can contribute to important individual and public health outcomes in geographical locations susceptible to emerging infections.

  16. Respiratory virus laboratory pandemic planning and surveillance in central Viet Nam, 2008-2010.

    Tran, Thomas; Chien, Bui Trong; Papadakis, Georgina; Druce, Julian; Birch, Chris; Chibo, Doris; An, Truong Phuoc; Trang, Le Thi Kim; Trieu, Nguyen Bao; Thuy, Doan Thi Thanh; Catton, Mike; Mai, Trinh Xuan


    Laboratory capacity is needed in central Viet Nam to provide early warning to public health authorities of respiratory outbreaks of importance to human health, for example the outbreak of influenza A(H1N1) pandemic in 2009. Polymerase chain reaction (PCR) procedures established as part of a capacity-building process were used to conduct prospective respiratory surveillance in a region where few previous studies have been undertaken. Between October 2008 and September 2010, nose and throat swabs from adults and children (approximately 20 per week) presenting with an acute respiratory illness to the Ninh Hoa General Hospital were collected. Same-day PCR testing and result reporting for 13 respiratory viruses were carried out by locally trained scientists. Of 2144 surveillance samples tested, 1235 (57.6%) were positive for at least one virus. The most common were influenza A strains (17.9%), with pandemic influenza A(H1N1) 2009 and seasonal H3N2 strain accounting for 52% and 43% of these, respectively. Other virus detections included: rhinovirus (12.4%), enterovirus (8.9%), influenza B (8.3%), adenovirus (5.3%), parainfluenza (4.7%), respiratory syncytial virus (RSV) (3.9%), human coronavirus (3.0%) and human metapneumovirus (0.3%). The detection rate was greatest in the 0-5 year age group. Viral co-infections were identified in 148 (6.9%) cases. The outbreak in 2009 of the influenza A(H1N1) pandemic strain provided a practical test of the laboratory's pandemic plan. This study shows that the availability of appropriate equipment and molecular-based testing can contribute to important individual and public health outcomes in geographical locations susceptible to emerging infections.

  17. Breeding for high N2 fixation in groundnut and soybean in Viet Nam

    Nguyen Xuan Hong


    Groundnut (Arachis hypogaea L.) and soybean (Glycine max (L.) Mer.) are grown mainly on two types of soil in Viet Nam: coastal-sandy and upland-degraded soils. These soils are deficient in N, and considering that fertilizer N is not only costly to farmers but also a threat to the environment, it is important to maximize productivity by exploiting the ability of these legumes to fix N 2 symbiotically in their root nodules. We initiated programmes of breeding and selection to combine high N 2 fixation and high grain-yielding capacity. In the spring of 1992, breeding lines of groundnut and soybean were tested under greenhouse conditions for varietal differences in the capacity to fix N 2 using the acetylene reduction assay and the 15 N-dilution technique, with upland rice as reference plants. Varietal differences were found in nitrogenase activity, and percent N derived from fixation (%Ndfa) ranged from 11 to 63% for groundnut and from 9 to 79% for soybean. Field experiments in the autumn-winter season of 1992 again revealed significant varietal differences; %Ndfa ranged from 36 to 56% for groundnut and from 28 to 58% for soybean. Gamma-irradiated seeds of soybean were propagated in bulk from M 1 to M 4 . Five high-yielding mutant lines of both species were selected from the M 5 populations, and N 2 fixation was estimated using the 15 N-dilution technique. The average values for %Ndfa of the mutants were 55 and 57%, significant improvements over the parent-cultivar values of 25 and 29% for soybean and groundnut, respectively

  18. Effect of land use change on water discharge in Srepok watershed, Central Highland, Viet Nam

    Nguyen Thi Ngoc Quyen


    Full Text Available Srepok watershed plays an important role in Central Highland in Viet Nam. It impacts to developing social-economic conditions. Therefore, it is necessary to research elements which impact to natural resources in this watershed. The Soil and Water Assessment Tool (SWAT model and Geography Information System (GIS were used to simulate water discharge in the Srepok watershed. The objectives of the research were to apply GIS and SWAT model for simulation water discharge and then, we assessed land use change which impacted on water discharge in the watershed. The observed stream flow data from Ban Don Stream gauge station was used to calibrate for the period from 1981 to 2000 and then validate for the period from 2001 to 2009. After using SWAT-CUP software to calibration, NSI reached 0.63 and R square value achieved 0.64 from 2004 to 2008 in calibration and NSI gained good level at 0.74 and R square got 0.75 from 2009 to 2012 in validation step at Ban Don Station. After that, land cover in 2010 was processed like land cover in 2000 and set up SWAT model again. The simulated water discharge in scenario 1 (land use 2000 was compared with scenario 2 (land use 2010, the simulation result was not significant difference between two scenarios because the change of area of land use was not much enough to affect the fluctuation of water discharge. However, the effect of land cover on water resource could be seen clearly via total water yield. The percentage of surface flow in 2000 was twice times more than in 2010; retard and base flow in 2000 was slightly more than in 2010. Therefore, decreased surface flow, increased infiltration capacity of water and enriched base flow resulted in the growth of land cover.

  19. Collaborative GIS for flood susceptibility mapping: An example from Mekong river basin of Viet Nam

    Thanh, B.


    Flooding is one of the most dangerous natural disasters in Vietnam. Floods have caused serious damages to people and made adverse impact on social economic development across the country, especially in lower river basin where there is high risk of flooding as consequences of the climate change and social activities. This paper presents a collaborative platform of a combination of an interactive web-GIS framework and a multi-criteria evaluation (MCE) tool. MCE is carried out in server side through web interface, in which parameters used for evaluation are groups into three major categories, including (1) climatic factor: precipitation, typhoon frequency, temperature, humidity (2) physiographic data: DEM, topographic wetness index, NDVI, stream power index, soil texture, distance to river (3) social factor: NDBI, land use pattern. Web-based GIS is based on open-source technology that includes an information page, a page for MCE tool that users can interactively alter parameters in flood susceptible mapping, and a discussion page. The system is designed for local participation in prediction of the flood risk magnitude under impacts of natural processes and human intervention. The proposed flood susceptibility assessment prototype was implemented in the Mekong river basin, Viet Nam. Index images were calculated using Landsat data, and other were collected from authorized agencies. This study shows the potential to combine web-GIS and spatial analysis tool to flood hazard risk assessment. The combination can be a supportive solution that potentially assists the interaction between stakeholders in information exchange and in disaster management, thus provides for better analysis, control and decision-making.

  20. Respiratory virus laboratory pandemic planning and surveillance in central Viet Nam, 2008–2010

    Chien, Bui Trong; Papadakis, Georgina; Druce, Julian; Birch, Chris; Chibo, Doris; An, Truong Phuoc; Trang, Le Thi Kim; Trieu, Nguyen Bao; Thuy, Doan Thi Thanh; Catton, Mike; Mai, Trinh Xuan


    Introduction Laboratory capacity is needed in central Viet Nam to provide early warning to public health authorities of respiratory outbreaks of importance to human health, for example the outbreak of influenza A(H1N1) pandemic in 2009. Polymerase chain reaction (PCR) procedures established as part of a capacity-building process were used to conduct prospective respiratory surveillance in a region where few previous studies have been undertaken. Methods Between October 2008 and September 2010, nose and throat swabs from adults and children (approximately 20 per week) presenting with an acute respiratory illness to the Ninh Hoa General Hospital were collected. Same-day PCR testing and result reporting for 13 respiratory viruses were carried out by locally trained scientists. Results Of 2144 surveillance samples tested, 1235 (57.6%) were positive for at least one virus. The most common were influenza A strains (17.9%), with pandemic influenza A(H1N1) 2009 and seasonal H3N2 strain accounting for 52% and 43% of these, respectively. Other virus detections included: rhinovirus (12.4%), enterovirus (8.9%), influenza B (8.3%), adenovirus (5.3%), parainfluenza (4.7%), respiratory syncytial virus (RSV) (3.9%), human coronavirus (3.0%) and human metapneumovirus (0.3%). The detection rate was greatest in the 0–5 year age group. Viral co-infections were identified in 148 (6.9%) cases. Discussion The outbreak in 2009 of the influenza A(H1N1) pandemic strain provided a practical test of the laboratory’s pandemic plan. This study shows that the availability of appropriate equipment and molecular-based testing can contribute to important individual and public health outcomes in geographical locations susceptible to emerging infections. PMID:23908924

  1. Effects of the family schizophrenia psychoeducation program for individuals with recent onset schizophrenia in Viet Nam.

    Ngoc, T N; Weiss, B; Trung, L T


    Although psychoeducation has been found effective for improving the life functioning of patients with schizophrenia in high income countries, there have been relatively few studies of schizophrenia psychoeducation adapted for low and middle-income countries (LMIC), particularly in Southeast Asia. The present study assessed effects of the Family Schizophrenia Psychoeducation Program (FSPP) among Vietnamese patients and their families on the patients' (1) quality of life and (2) medication non-compliance, and the family and patients' (3) stigma towards schizophrenia, and (4) consumer satisfaction. This intervention study involved 59 patients, and their families, from the Da Nang Psychiatric Hospital, randomly assigned to treatment (n=30) or control (n=29) conditions. Control subjects received services as usual (antipsychotic medication); treatment group subjects received the FSPP as well. Blind-rater assessments were conducted at T1 immediately after project enrollment (prior to participating in the FSPP) and at T2 six months later. There were significant treatment effects on: (1) quality of life, (2) stigma, (3) medication compliance, and (4) consumer satisfaction, with all effects favoring the treatment group. Effect sizes were moderate to large. This psychoeducation program appears to reduce stigma, improve quality of life and medication compliance, and increase consumer satisfaction of Vietnamese patients with schizophrenia and their families, beyond the effects of antipsychotic medication. It involves relatively little cost, and it may be useful for it or equivalent programs to be implemented in other hospitals in Viet Nam, and potentially other low-income Asian countries to improve the lives of patients with schizophrenia. Copyright © 2016 Elsevier B.V. All rights reserved.

  2. Father's involvement and its effect on early breastfeeding practices in Viet Nam.

    Bich, Tran Huu; Hoa, Dinh Thi Phuong; Ha, Nguyen Thanh; Vui, Le Thi; Nghia, Dang Thi; Målqvist, Mats


    Fathers have an important but often neglected role in the promotion of healthy breastfeeding practices in developing countries. A community-based education intervention was designed to mobilize fathers' support for early breastfeeding. This study aimed to evaluate an education intervention targeting fathers to increase the proportion of early breastfeeding initiation and to reduce prelacteal feeding. Quasi-experimental study design was used to compare intervention and control areas located in two non-adjacent rural districts that shared similar demographic and health service characteristics in northern Viet Nam. Fathers and expectant fathers with pregnant wives from 7 to 30 weeks gestational age were recruited. Fathers in the intervention area received breastfeeding education materials, counselling services at a commune health centre and household visits. They were also invited to participate in a breastfeeding promotion social event. After intervention, early breastfeeding initiation rate was 81.2% in the intervention area and 39.6% in the control area (P < 0.001). Babies in the intervention area were more likely to be breastfed within the first hour after birth [odds ratio (OR) 7.64, 95% confidence interval (CI) 4.81-12.12] and not to receive any prelacteal feeding (OR 4.43, 95% CI 2.88-6.82) compared with those in the control area. Fathers may positively influence the breastfeeding practices of mothers, and as a resource for early childcare, they can be mobilized in programmes aimed at improving the early initiation of breastfeeding. © 2015 John Wiley & Sons Ltd.

  3. Evaluation of mobile digital light-emitting diode fluorescence microscopy in Hanoi, Viet Nam.

    Chaisson, L H; Reber, C; Phan, H; Switz, N; Nilsson, L M; Myers, F; Nhung, N V; Luu, L; Pham, T; Vu, C; Nguyen, H; Nguyen, A; Dinh, T; Nahid, P; Fletcher, D A; Cattamanchi, A


    Hanoi Lung Hospital, Hanoi, Viet Nam. To compare the accuracy of CellScopeTB, a manually operated mobile digital fluorescence microscope, with conventional microscopy techniques. Patients referred for sputum smear microscopy to the Hanoi Lung Hospital from May to September 2013 were included. Ziehl-Neelsen (ZN) smear microscopy, conventional light-emitting diode (LED) fluorescence microscopy (FM), CellScopeTB-based LED FM and Xpert(®) MTB/RIF were performed on sputum samples. The sensitivity and specificity of microscopy techniques were determined in reference to Xpert results, and differences were compared using McNemar's paired test of proportions. Of 326 patients enrolled, 93 (28.5%) were Xpert-positive for TB. The sensitivity of ZN microscopy, conventional LED FM, and CellScopeTB-based LED FM was respectively 37.6% (95%CI 27.8-48.3), 41.9% (95%CI 31.8-52.6), and 35.5% (95%CI 25.8-46.1). The sensitivity of CellScopeTB was similar to that of conventional LED FM (difference -6.5%, 95%CI -18.2 to 5.3, P = 0.33) and ZN microscopy (difference -2.2%, 95%CI -9.2 to 4.9, P = 0.73). The specificity was >99% for all three techniques. CellScopeTB performed similarly to conventional microscopy techniques in the hands of experienced TB microscopists. However, the sensitivity of all sputum microscopy techniques was low. Options enabled by digital microscopy, such as automated imaging with real-time computerized analysis, should be explored to increase sensitivity.

  4. Persisting stigma reduces the utilisation of HIV-related care and support services in Viet Nam

    Thanh Duong Cong


    Full Text Available Abstract Background Seeking and utilisation of HIV prevention, treatment, care, and support services for people living with HIV is often hampered by HIV-related stigma. The study aimed to explore the perceptions and experiences regarding treatment, care, and support amongst people living with HIV in Viet Nam, where the HIV epidemic is concentrated among injecting drug users, sex workers, and men who have sex with men. Methods In-depth interviews and focus group discussions were conducted during September 2007 in 6 districts in Hai Phong with a very high HIV prevalence among injecting drug users. The information obtained was analysed and merged within topic areas. Illustrative quotes were selected. Results Stigma and discrimination against people living with HIV in the community and healthcare settings was commonly reported, and substantially hampered the seeking and the utilisation of HIV-related services. The informants related the high level of stigma to the way the national HIV preventive campaigns played on fear, by employing a “scare tactic” mainly focusing on drug users and sex workers, who were defined as “social evils” in the anti-drug and anti-prostitution policy. There was a strong exclusion effect caused by the stigma, with serious implications, such as loss of job opportunities and isolation. The support and care provided by family members was experienced as vital for the spirit and hope for the future among people living with HIV. Conclusions A comprehensive care and support programme is needed. The very high levels of stigma experienced seem largely to have been created by an HIV preventive scare tactic closely linked to the “social evil“ approach in the national policy on drug and prostitution. In order to reduce the stigma and create more effective interventions, this tactic will have to be replaced with approaches that create better legal and policy environments for drug users and sex workers.

  5. Violation of Bans on Tobacco Advertising and Promotion at Points of Sale in Viet Nam: Trend from 2009 - 2015.

    Huong, Le Thi Thanh; Long, Tran Khanh; Son, Phung Xuan; Huyen, Do Phuc; Linh, Phan Thuy; Bich, Nguyen Ngoc; Lam, Nguyen Xuan; Anh, Le Vu; Tuyet-Hanh, Tran Thi


    Comprehensive bans on tobacco advertising and promotion were introduced through tobacco control legislation in Viet Nam, but it has been established that violations of the bans are very common. This study was conducted to explore the trend in violations of bans on tobacco advertising and promotion at points of sale in Viet Nam in the past six years and to explore any differences in the violation situations before and after the Law on Tobacco Control came into effect on 1st May 2013. Quantitative data were collected through observation of violations of the bans on tobacco advertising and promotion at points of sale in 10 provinces throughout Viet Nam in four survey rounds (2009, 2010, 2011, and 2015). Variation in violation prevalence over time was examined by chi-square test using a Bonferini method. Binary logistic regression was employed to identify the factors that may have influences on different types of violation. A level of significance of padvertising increased while violations on promotion ban and on displaying tobacco decreased through time. Some factors associated with the tobacco advertising and promotion bans included surveyed years, types of points of sale, regions and areas where the points of sale were located. The enforcement of the bans did not improve even after the issuance and the enactment of the Law on Tobacco Control. This suggests that the monitoring and enforcement of bans on tobacco advertising and promotion at points of sale should be strengthened. Penalties should be strictly applied for violators as indicated in the current tobacco control legislation.

  6. Iodine status in late pregnancy and psychosocial determinants of iodized salt use in rural northern Viet Nam

    Tran, Thach; Biggs, Beverley; Tran, Tuan; Dwyer, Terry; Casey, Gerard; Tho, Dang Hai; Hetzel, Basil


    Abstract Objective To establish iodine status among pregnant women in rural northern Viet Nam and explore psychosocial predictors of the use of iodized salt in their households. Methods This prospective study included pregnant women registered in health stations in randomly-selected communes in Ha Nam province. At recruitment ( 28 weeks of gestation) a urine specimen was collected to measure urinary iodine concentration (UIC) and iodized salt use was assessed. Predictors were explored through univariable analyses and multivariable linear and logistic regression. Findings The 413 pregnant women who provided data for this study had a median UIC of 70 µg/l; nearly 83% had a UIC lower than the 150 µg/l recommended by the World Health Organization; only 73.6% reported using iodized salt in any form in their households. Iodized salt use was lower among nulliparous women (odds ratio, OR: 0.56; 95% confidence interval, CI: 0.32–0.96); less educated women (OR: 0.34; 95% CI: 0.16–0.71); factory workers or small-scale traders (OR: 0.52; 95% CI: 0.31–0.86), government workers (OR: 0.35; 95% CI: 0.13–0.89) and women with common mental disorders at recruitment (OR: 0.61; 95% CI: 0.38–0.98). Conclusion The decline in the use of iodized salt in Viet Nam since the National Iodine Deficiency Disorders Control Programme was suspended in 2005 has placed pregnant women and their infants in rural areas at risk of iodine deficiency disorders. PMID:22084527

  7. A world-class target for ICDP drilling at Lake Nam Co, Tibetan Plateau, China: progresses and perspectives

    Zhu, L.; Wang, J.; Daut, G.; Spiess, V.; Haberzettl, T.; Schulze, N.; Ju, J.; Lü, X.; Bergmann, F.; Haberkern, J.; Schwalb, A.; Mäusbacher, R.


    Lake Nam Co (ca. 2000 km2, 4718 m a.s.l., maximum depth: 100 m) is located at the interaction zone of the Westerlies and the Indian monsoon on the central Tibetan Plateau. It was part of a mega-lake during Marine Isotope Stage (MIS) 3 before the Last Glacial Maximum. A long term sedimentary record from Nam Co could therefore provide an excellent paleo-environmental sequence for regional and global comparative studies. This will to deepen our understanding of large scale atmospheric circulation shifts and the environmental links between the Tibetan Plateau at low latitudes and the North Atlantic region at high latitudes. A Nam Co deep drilling will fill the gap in two large scale ICDP/IODP drilling transects (N-S: Lake Baikal, Lake Qinghai, Bay of Bengal; W-E: Lake Van, Lake Issyk-Kul, South China Sea, Lake Towuti), which will show the great significance of monsoon dynamics on a long-term scale. Multidisciplinary researches have been conducted since 2005 by a Sino-German cooperative team. The progresses during the last decade are: 1) Detailed bathymetric surveying, including a shallow sediment profiler investigation (Innomar SES 2000 light, ca. 30 m sediment penetration); 2) Paleo-environmental reconstructions covering the past 24 ka; 3) Modern sediment distribution covering the entire lake; 4) Monitoring including water temperature profiles, sediment traps, seasonal airborne pollen collection; 5) Deep seismic survey penetrating up to 800 meters of lake sediments. Based on sediment rates from reference core NC08/01, seismic results show that an age of 500 ka may be reached at 500 m, and >1 Ma at the observed base. Faulting can be clearly detected in the seismic profiles, especially from MIS 5 to early Holocene, and shows the characteristics of normal faults or strike-slip faults. Both rotation of the layers and the close spacing, along with negative and positive offsets of the faults make a transtensional origin of the basin likely. An ICDP workshop proposal was

  8. Detection of NAM-A1 Natural Variants in Bread Wheat Reveals Differences in Haplotype Distribution between a Worldwide Core Collection and European Elite Germplasm

    Fabien Cormier


    Full Text Available In wheat, remobilization of nitrogen absorbed before anthesis and regulation of monocarpic senescence is a major issue in breeding for nutrient use efficiency. We identified natural variants of NAM-A1, a gene having the same role as its well-characterized homoeolog NAM-B1, a NAC transcription factor associated with senescence kinetics and nutrient remobilization to the grain. Differences in haplotype frequencies between a worldwide core collection and a panel of European elite varieties were assessed and discussed. Moreover, hypotheses for the loss of function of the most common haplotype in elite European germplasm are discussed.

  9. Osmanlı Devletinin Son Yıllarında Ağnam Vergisine Yapılan Zamlar Rise In Ağnam (Sheep Tax In The Recent Years Of Ottoman State

    Ünal TAŞKIN


    Full Text Available People generally known as rayah in Ottoman State had some responsibilities to state. Among these responsibilities there were tax figures to be paid about agricultural and husbandry facilities. Each rayah doing husbandry facilities made payments in certain rates according to animal breed fed. Known as the tax of sheep and goat in the classical time of state, sheep tax gained a more general meaning and was subject to new regulations. It was initiated to be collected with a method called mukataa and expressing a certain amount determined in advance since the XVII. century of Ottoman State. Called as sheep tax mukataa, this income became one the most important figure of central treasury. Since the XIX. by abandoning the collection in kind method additional taxes with various names were also abolished.The price determined as the amount of tax was too much for some regions of the state because of regional differences in sheep prices. Because of this it was initiated to determine how much income was gained from the milk and wool of sheep and goat according to each region with the new regulation since the second part of the XIX. century. Determined by local administrations seperately, the tax figure of these amounts were determined in central office.As the rise in the taxes caused a negative effect on public, they were read justed towards the end of XIX. century. Reasons such as the current social situation of state, the worry of fund raising and political events caused changes in the encashment of taxes called as ağnam group. In ourwork the eight fold rise in ağnam tax which is accepted as one of the most important sources for recovering budget deficit of Ottoman State is goingto be studied. Osmanlı Devleti’nde reaya genel adıyla bilinen halkın, devletekarşı birtakım mükellefiyetleri vardı. Bu mükellefiyetler içerisinde,tarım ve hayvancılık faaliyetlerinden kaynaklı, ödenmesi gereken vergikalemleri mevcuttu. Hayvanc

  10. Allergen sensitisation among chronic respiratory diseases in urban and rural areas of the south of Viet Nam.

    Chu, H T; Godin, I; Phuong, N T; Nguyen, L H; Hiep, T T M; Michel, O


    To evaluate the prevalence of and risk factors for allergen sensitisation among patients with chronic respiratory disease (CRD) in southern Viet Nam. An environmental questionnaire and skin prick tests for airborne and food allergens were administered to patients with CRD, defined as individuals with respiratory symptoms and lung function defects. Of 610 CRD patients, 56% had chronic obstructive pulmonary disease and 31% were asthma patients; 80% were males. The most frequent sensitisers were dust mites (Dermatophagoides farinae 22%, Blomia tropicalis 19%, D. pteronyssinus 18%) and cockroach droppings (13%). Among study participants, 37% were from rural settings and 36% from urban areas, whereas 27% had migrated from rural to urban areas. Compared with people from rural areas, being born in an urban area was a risk factor for sensitisation to mites (OR 1.56, 95%CI 1.11-2.20, P Viet Nam. Compared with the urban population, being native to a rural area was protective against mite sensitisation, but this effect ceased to be significant after migration from rural to urban areas.

  11. The World Report on Disability in relation to the development of speech-language pathology in Viet Nam.

    Atherton, Marie; Dung, Nguyễn Thị Ngọc; Nhân, Võ Hoàng


    Wylie, McAllister, Davidson, and Marshall (2013) argue that recommendations made within the World Report on Disability provide an opportunity for speech-language pathologists to consider new ways of developing services for people with communication and swallowing disorders. They propose that current approaches to the delivery of speech-language pathology services are largely embedded within the medical model of impairment, thereby limiting the ability of services to meet the needs of people in a holistic manner. In this paper, the criticality of selecting an appropriate service delivery model is discussed within the context of a recently established post-graduate speech therapy education programme in Viet Nam. Driving forces for the implementation of the program will be explored, as will the factors that determined the choice of service delivery. Opportunities and challenges to the long-term viability of the program and the program's potential to meet the needs of persons with communication and swallowing disorders in Viet Nam will be considered.

  12. Impact of mandatory motorcycle helmet wearing legislation on head injuries in Viet Nam: results of a preliminary analysis.

    Passmore, Jonathon; Tu, Nguyen Thi Hong; Luong, Mai Anh; Chinh, Nguyen Duc; Nam, Nguyen Phuong


    To compare estimated prevalence of head injuries among road traffic injury patients admitted to hospitals, before and after the introduction of a mandatory helmet law in the Socialist Republic of Viet Nam. Before and after study of all road traffic injury patients with head injuries admitted to 20 provincial and central hospitals 3 months before and after the new law came into effect on 15 December 2007. Relative risk was computed and comparison made for the periods of 3 months before and after the new law. The study found a 16 percent reduction in the risk of road traffic head injuries (4683 to 3522; relative risk [RR] 0.84; 95% confidence interval [CI] 0.81-0.87) and an 18 percent reduction in the risk of road traffic death (deaths in hospital plus injured patients discharged to die at home; 566 to 417; RR 0.82; 95% CI 0.73-0.93). Over the first 3 months of the comprehensive mandatory helmet legislation there has been a significant reduction in the risk of road traffic head injuries among patients admitted to 20 hospitals. The Viet Nam Government's decision to require all motorcycle riders and passengers to wear helmets is suspected of leading to positive road safety benefits and should be seen as a policy example for other low- and middle-income countries with a high utilization of motorcycles for transport.

  13. Aetiologies of central nervous system infection in Viet Nam: a prospective provincial hospital-based descriptive surveillance study.

    Nghia Ho Dang Trung

    Full Text Available Infectious diseases of the central nervous system (CNS remain common and life-threatening, especially in developing countries. Knowledge of the aetiological agents responsible for these infections is essential to guide empiric therapy and develop a rational public health policy. To date most data has come from patients admitted to tertiary referral hospitals in Asia and there is limited aetiological data at the provincial hospital level where most patients are seen.We conducted a prospective Provincial Hospital-based descriptive surveillance study in adults and children at thirteen hospitals in central and southern Viet Nam between August 2007-April 2010. The pathogens of CNS infection were confirmed in CSF and blood samples by using classical microbiology, molecular diagnostics and serology.We recruited 1241 patients with clinically suspected infection of the CNS. An aetiological agent was identified in 640/1241 (52% of the patients. The most common pathogens were Streptococcus suis serotype 2 in patients older than 14 years of age (147/617, 24% and Japanese encephalitis virus in patients less than 14 years old (142/624, 23%. Mycobacterium tuberculosis was confirmed in 34/617 (6% adult patients and 11/624 (2% paediatric patients. The acute case fatality rate (CFR during hospital admission was 73/617 (12% in adults and to 42/624 (7% in children.Zoonotic bacterial and viral pathogens are the most common causes of CNS infection in adults and children in Viet Nam.

  14. Epidemiology, Seasonality, and Predictors of Outcome of AIDS-Associated Penicillium marneffei Infection in Ho Chi Minh City, Viet Nam

    Wolbers, Marcel; Quang, Vo Minh; Chinh, Nguyen Tran; Huong Lan, Nguyen Phu; Lam, Pham Si; Kozal, Michael J.; Shikuma, Cecilia M.; Day, Jeremy N.; Farrar, Jeremy


    Background. Penicillium marneffei is an important human immunodeficiency virus (HIV)–associated opportunistic pathogen in Southeast Asia. The epidemiology and the predictors of penicilliosis outcome are poorly understood. Methods. We performed a retrospective study of culture-confirmed incident penicilliosis admissions during 1996–2009 at the Hospital for Tropical Diseases in Ho Chi Minh City, Viet Nam. Seasonality of penicilliosis was assessed using cosinor models. Logistic regression was used to assess predictors of death or worsening disease based on 10 predefined covariates, and Cox regression was performed to model time-to-antifungal initiation. Results. A total of 795 patients were identified; hospital charts were obtainable for 513 patients (65%). Cases increased exponentially and peaked in 2007 (156 cases), mirroring the trends in AIDS admissions during the study period. A highly significant seasonality for penicilliosis (P Viet nam. The number of cases increases during rainy months. Injection drug use, shorter history, absence of fever or skin lesions, respiratory difficulty, higher lymphocyte count, and lower platelet count predict poor in-hospital outcome. PMID:21427403

  15. Patterns of the utilization of prenatal diagnosis services among pregnant women, their satisfaction and its associated factors in Viet Nam.

    Doan, Duong Thi Thuy; Nguyen, Huong Thi Thu; Bui, Ha Thi Thu


    This study aimed at understanding the patterns of the utilization of prenatal diagnostic (PND) services among pregnant women, their satisfaction and its associated factors at three regional prenatal diagnostic centres in Viet Nam. A cross-sectional design was used, with a consecutive sampling method to recruit pregnant women who used PND services at the three biggest regional PND services centres in Viet Nam between January and June, 2014. A total of 298 participants, about 100 participants per centre were interviewed and included in data analysis. Descriptive analyses and logistic regression methods were applied to identify association between satisfaction of women and their socio-economic characteristics. 80% of pregnant women received counselling on PND services, whilst 90% received ultrasonography services; 65.4% were satisfied with the PND services they used. Pregnant women, who were in a lower income group and received counselling but did not receive ultrasonography, were more likely to have higher satisfaction levels of PND services. A process to ensure that every pregnant woman receives sufficient PND counselling before and after receiving PND testing must be given careful and thorough consideration.

  16. Determination of boron and lithium in diverse biological matrices using neutron activation-mass spectrometry (NA-MS)

    Iyengar, G.V.; Downing, R.G.; Clarke, W.B.


    Essential features of the neutron activation-mass Spectrometry (NA-MS) technique are described. Applicability of this technique for the simultaneous determination of boron and lithium is demonstrated for a diverse group of biomaterials. NA-MS is a nondestructive analytical technique, and dynamic in nature since its coverage extends to a broad range of concentration levels. Contamination after the irradiation step, extraneous by natural lithium or boron is inconsequential, since only the activation products are the analyted assayed. Coupling the nuclear activation phenomenon which generates 4 He and 3 He (from 10 B and 6 Li, respectively), with the high precision potential of mass spectrometry forms the bases of this technique. Under ideal conditions the detection limit is extendable to pg g -1 concentration ranges and therefore, it is extremely well suited to investigate the natural concentration levels of boron and lithium in biomaterials. The potential of this method for the determination of lithium in biomedical trace element research is of special significance since determination of sub-ppb levels of lithium by other analytical techniques faces serious analytical difficulties mainly due to contamination control and in some cases to insufficiently low detection limits. (orig.)

  17. Primary drug-resistant tuberculosis in Hanoi, Viet Nam: present status and risk factors.

    Nguyen Thi Le Hang

    Full Text Available INTRODUCTION: Resistance of Mycobacterium tuberculosis (MTB to anti-tuberculosis (TB drugs presents a serious challenge to TB control worldwide. We investigated the status of drug resistance, including multidrug-resistant (MDR TB, and possible risk factors among newly diagnosed TB patients in Hanoi, the capital of Viet Nam. METHODS: Clinical and epidemiological information was collected from 506 newly diagnosed patients with sputum smear- and culture-positive TB, and 489 (96.6% MTB isolates were subjected to conventional drug susceptibility testing, spoligotyping, and 15-locus variable numbers of tandem repeats typing. Adjusted odds ratios (aORs were calculated to analyze the risk factors for primary drug resistance. RESULTS: Of 489 isolates, 298 (60.9% were sensitive to all drugs tested. Resistance to isoniazid, rifampicin, streptomycin, ethambutol, and MDR accounted for 28.2%, 4.9%, 28.2%, 2.9%, and 4.5%, respectively. Of 24 isolates with rifampicin resistance, 22 (91.7% were MDR and also resistant to streptomycin, except one case. Factors associated with isoniazid resistance included living in old urban areas, presence of the Beijing genotype, and clustered strains [aOR = 2.23, 95% confidence interval (CI 1.15-4.35; 1.91, 1.18-3.10; and 1.69, 1.06-2.69, respectively. The Beijing genotype was also associated with streptomycin resistance (aOR = 2.10, 95% CI 1.29-3.40. Human immunodeficiency virus (HIV coinfection was associated with rifampicin resistance and MDR (aOR = 5.42, 95% CI 2.07-14.14; 6.23, 2.34-16.58, respectively. CONCLUSION: Isoniazid and streptomycin resistance was observed in more than a quarter of TB patients without treatment history in Hanoi. Transmission of isoniazid-resistant TB among younger people should be carefully monitored in urban areas, where Beijing strains and HIV coinfection are prevalent. Choosing an optimal treatment regimen on the basis of the results of drug susceptibility tests and monitoring of treatment

  18. Art as a Political Act: Expression of Cultural Identity, Self-Identity, and Gender by Suk Nam Yun and Yong Soon Min

    Caruso, Hwa Young Choi


    This cross-cultural study explored the lives of two contemporary Korean/Korean American women artists--Suk Nam Yun and Yong Soon Min--who live in Seoul, South Korea, and Los Angeles, California. The author's research focused on the artists' identity formation, artistic expression, professional achievements, and the role of art as a political act.…

  19. Risk factors for the presence of Aedes aegypti and Aedes albopictus in domestic water-holding containers in areas impacted by the Nam Theun 2 hydroelectric project, Laos

    Hiscox, A.F.; Kaye, A.; Vongphayloth, K.; Banks, I.; Piffer, M.; Khammanithong, P.; Sananikhom, P.; Kaul, S.; Hill, N.; Lindsay, S.W.; Brey, P.T.


    We assessed risk factors for vectors of dengue and chikungunya viruses near a new hydroelectric project, Nam Theun 2, in Laos. Immature stages of Aedes aegypti were found only in sites within 40 km of the urban provincial capital, but Aedes albopictus was found throughout. Aedes aegypti pupae were

  20. 'Never testing for HIV' among men who have sex with men in Viet Nam: results from an Internet-based cross-sectional survey.

    García, Macarena Cecilia; Duong, Quyen Le; Mercer, Licelot Eralte; Meyer, Samantha Beth; Ward, Paul Russell


    Men who have sex with men in Viet Nam have been under-studied as a high-risk group for HIV infection, and this population's percentage and determinants of HIV testing have not been comprehensively investigated. A national Internet-based survey of self-reported sexual and health seeking behaviours was conducted between August and October 2011 with 2077 Vietnamese men who had sex with men in the last twelve months to identify the frequency of 'never testing for HIV' among Internet-using MSM living in Viet Nam, as well as the factors associated with this HIV-related high-rish behavior. Logistic regression analyses were conducted to assess the demographic characteristics and behaviours predicting never testing for HIV. A total of 76.5% of men who have sex with men who were surveyed reported never having been voluntarily tested for HIV. Predictors of never being tested included having a monthly income less than VND 5 Million, being a student, using the Internet less than 15 hour per week, and not participating in a behavioural HIV intervention. Never testing for HIV is common among Internet-using men who have sex with men in Viet Nam. Given the dangerously high prevalence of this high-risk behaviour, our findings underscore the urgent need for segmented and targeted HIV prevention, care and treatment strategies, focusing on drastically reducing the number of men who have sex with men never testing for HIV in Viet Nam.

  1. Gauging the Acceptability of HIV Vaccines: An Exploratory Study Examining Knowledge, Attitudes, and Beliefs among Injecting Drug Users in Viet Nam

    Nguyen, France


    In contrast to other countries in Southeast Asia, the HIV/ AIDS epidemic is in the initial stages in Viet Nam, although the rates have increased notably since 1997. This study examined attitudes towards the use of an HIV vaccine (when one becomes available) as a means for preventing the disease. Since injecting drug users are the great majority of…

  2. Identification of QTL conferring resistance to stripe rust (Puccinia striiformis f. sp. hordei) and leaf rust (Puccinia hordei) in barley using nested association mapping (NAM).

    Vatter, Thomas; Maurer, Andreas; Perovic, Dragan; Kopahnke, Doris; Pillen, Klaus; Ordon, Frank


    The biotrophic rust fungi Puccinia hordei and Puccinia striiformis are important barley pathogens with the potential to cause high yield losses through an epidemic spread. The identification of QTL conferring resistance to these pathogens is the basis for targeted breeding approaches aiming to improve stripe rust and leaf rust resistance of modern cultivars. Exploiting the allelic richness of wild barley accessions proved to be a valuable tool to broaden the genetic base of resistance of barley cultivars. In this study, SNP-based nested association mapping (NAM) was performed to map stripe rust and leaf rust resistance QTL in the barley NAM population HEB-25, comprising 1,420 lines derived from BC1S3 generation. By scoring the percentage of infected leaf area, followed by calculation of the area under the disease progress curve and the average ordinate during a two-year field trial, a large variability of resistance across and within HEB-25 families was observed. NAM based on 5,715 informative SNPs resulted in the identification of twelve and eleven robust QTL for resistance against stripe rust and leaf rust, respectively. Out of these, eight QTL for stripe rust and two QTL for leaf rust are considered novel showing no overlap with previously reported resistance QTL. Overall, resistance to both pathogens in HEB-25 is most likely due to the accumulation of numerous small effect loci. In addition, the NAM results indicate that the 25 wild donor QTL alleles present in HEB-25 strongly differ in regard to their individual effect on rust resistance. In future, the NAM concept will allow to select and combine individual wild barley alleles from different HEB parents to increase rust resistance in barley. The HEB-25 results will support to unravel the genetic basis of rust resistance in barley, and to improve resistance against stripe rust and leaf rust of modern barley cultivars.

  3. Swedish Spring Wheat Varieties with the Rare High Grain Protein Allele of NAM-B1 Differ in Leaf Senescence and Grain Mineral Content

    Asplund, Linnéa; Bergkvist, Göran; Leino, Matti W.; Westerbergh, Anna; Weih, Martin


    Some Swedish spring wheat varieties have recently been shown to carry a rare wildtype (wt) allele of the gene NAM-B1, known to affect leaf senescence and nutrient retranslocation to the grain. The wt allele is believed to increase grain protein concentration and has attracted interest from breeders since it could contribute to higher grain quality and more nitrogen-efficient varieties. This study investigated whether Swedish varieties with the wt allele differ from varieties with one of the more common, non-functional alleles in order to examine the effect of the gene in a wide genetic background, and possibly explain why the allele has been retained in Swedish varieties. Forty varieties of spring wheat differing in NAM-B1 allele type were cultivated under controlled conditions. Senescence was monitored and grains were harvested and analyzed for mineral nutrient concentration. Varieties with the wt allele reached anthesis earlier and completed senescence faster than varieties with the non-functional allele. The wt varieties also had more ears, lighter grains and higher yields of P and K. Contrary to previous information on effects of the wt allele, our wt varieties did not have increased grain N concentration or grain N yield. In addition, temporal studies showed that straw length has decreased but grain N yield has remained unaffected over a century of Swedish spring wheat breeding. The faster development of wt varieties supports the hypothesis of NAM-B1 being preserved in Fennoscandia, with its short growing season, because of accelerated development conferred by the NAM-B1 wt allele. Although the possible effects of other gene actions were impossible to distinguish, the genetic resource of Fennoscandian spring wheats with the wt NAM-B1 allele is interesting to investigate further for breeding purposes. PMID:23555754

  4. Identification of QTL conferring resistance to stripe rust (Puccinia striiformis f. sp. hordei) and leaf rust (Puccinia hordei) in barley using nested association mapping (NAM)

    Vatter, Thomas; Maurer, Andreas; Perovic, Dragan; Kopahnke, Doris; Pillen, Klaus


    The biotrophic rust fungi Puccinia hordei and Puccinia striiformis are important barley pathogens with the potential to cause high yield losses through an epidemic spread. The identification of QTL conferring resistance to these pathogens is the basis for targeted breeding approaches aiming to improve stripe rust and leaf rust resistance of modern cultivars. Exploiting the allelic richness of wild barley accessions proved to be a valuable tool to broaden the genetic base of resistance of barley cultivars. In this study, SNP-based nested association mapping (NAM) was performed to map stripe rust and leaf rust resistance QTL in the barley NAM population HEB-25, comprising 1,420 lines derived from BC1S3 generation. By scoring the percentage of infected leaf area, followed by calculation of the area under the disease progress curve and the average ordinate during a two-year field trial, a large variability of resistance across and within HEB-25 families was observed. NAM based on 5,715 informative SNPs resulted in the identification of twelve and eleven robust QTL for resistance against stripe rust and leaf rust, respectively. Out of these, eight QTL for stripe rust and two QTL for leaf rust are considered novel showing no overlap with previously reported resistance QTL. Overall, resistance to both pathogens in HEB-25 is most likely due to the accumulation of numerous small effect loci. In addition, the NAM results indicate that the 25 wild donor QTL alleles present in HEB-25 strongly differ in regard to their individual effect on rust resistance. In future, the NAM concept will allow to select and combine individual wild barley alleles from different HEB parents to increase rust resistance in barley. The HEB-25 results will support to unravel the genetic basis of rust resistance in barley, and to improve resistance against stripe rust and leaf rust of modern barley cultivars. PMID:29370232

  5. Identification of QTL conferring resistance to stripe rust (Puccinia striiformis f. sp. hordei and leaf rust (Puccinia hordei in barley using nested association mapping (NAM.

    Thomas Vatter

    Full Text Available The biotrophic rust fungi Puccinia hordei and Puccinia striiformis are important barley pathogens with the potential to cause high yield losses through an epidemic spread. The identification of QTL conferring resistance to these pathogens is the basis for targeted breeding approaches aiming to improve stripe rust and leaf rust resistance of modern cultivars. Exploiting the allelic richness of wild barley accessions proved to be a valuable tool to broaden the genetic base of resistance of barley cultivars. In this study, SNP-based nested association mapping (NAM was performed to map stripe rust and leaf rust resistance QTL in the barley NAM population HEB-25, comprising 1,420 lines derived from BC1S3 generation. By scoring the percentage of infected leaf area, followed by calculation of the area under the disease progress curve and the average ordinate during a two-year field trial, a large variability of resistance across and within HEB-25 families was observed. NAM based on 5,715 informative SNPs resulted in the identification of twelve and eleven robust QTL for resistance against stripe rust and leaf rust, respectively. Out of these, eight QTL for stripe rust and two QTL for leaf rust are considered novel showing no overlap with previously reported resistance QTL. Overall, resistance to both pathogens in HEB-25 is most likely due to the accumulation of numerous small effect loci. In addition, the NAM results indicate that the 25 wild donor QTL alleles present in HEB-25 strongly differ in regard to their individual effect on rust resistance. In future, the NAM concept will allow to select and combine individual wild barley alleles from different HEB parents to increase rust resistance in barley. The HEB-25 results will support to unravel the genetic basis of rust resistance in barley, and to improve resistance against stripe rust and leaf rust of modern barley cultivars.

  6. Decreasing In-home Smoking of Adults—Results from a School-based Intervention Program in Viet Nam

    Le Thi Thanh Huong


    Full Text Available It is indicated that children are involuntarily exposed to secondhand smoke from adults, mainly at their home environment. This study aimed at describing the effectiveness of the school-based intervention to decrease the in-home smoking situation of adults so as to decrease children’s exposure to secondhand smoke at home during the year 2011–2012 in a rural district in Hanoi, Viet Nam. This school-based intervention program (intervention and control group involved 804 children aged 8 to 11 years from August 2011 to May 2012 in a rural district of Hanoi, Viet Nam. Children were taught in class about the harmful effects of secondhand smoke and about how to negotiate with fathers not to smoke in-home. Then children applied what they learnt, including staying away from secondhand smoke and persuading fathers not to smoke in-home in order to decrease children’s exposure to secondhand smoke. Chi square test, t-test and multinominal logistic regression were applied in data analysis. The results showed that children’s reported their father’s in-home smoking decreased from 83.0% pre-intervention to 59.8% post-intervention (p < 0.001 in the intervention school while no change happened in the control school. The study found that the better changed smoking location of adult smokers as reported by children associated with the school who received intervention activities (adjusted OR = 2.04; 95% CI: 1.28–3.24. Poorer changed attitudes towards secondhand smoke of children associated with a lower percentage of better change in smoking location of their fathers/other adult smokers (aOR = 0.51, 95% CI: 0.28–0.96. Children’s poorer changed knowledge towards secondhand smoke also associated with poorer changed smoking location of adult smokers (aOR = 2.88, 95% CI: 1.07–7.76. It is recommended by this study that similar school based intervention approaches should be applied in primary schools in Viet Nam to increase children’s awareness on the

  7. Isolation and Selection of Microalgal Strains from Natural Water Sources in Viet Nam with Potential for Edible Oil Production.

    Thao, Tran Yen; Linh, Dinh Thi Nhat; Si, Vo Chi; Carter, Taylor W; Hill, Russell T


    Industrial vegetable oil production in Viet Nam depends on oil seeds and crude plant oils that are currently more than 90% imported. As the first step in investigating the feasibility of using microalgae to provide Viet Nam with a domestic source of oil for food and edible oil industries, fifty lipid-producing microalgae were isolated and characterized. The microalgae were isolated from water sources ranging from freshwater to brackish and marine waters from a wide geographic distribution in Viet Nam. Initial analyses showed that 20 of the 50 strains had good growth rates, produced high biomass and had high lipid content, ranging up to 50% of dry weight biomass. 18S rRNA gene sequence analyses of the 50 strains showed a great diversity in this assemblage of microalgae, comprising at least 38 species and representatives of 25 genera : Chlamydomonas , Poterioochromonas , Scenedesmus , Desmodesmus , Chlorella , Bracteacoccus , Monoraphidium , Selenastrum , Acutodesmus , Mychonastes , Ankistrodesmus , Kirchneriella , Raphidocelis , Dictyosphaerium , Coelastrella , Schizochlamydella , Oocystidium , Nannochloris , Auxenochlorella , Chlorosarcinopsis , Stichococcus , Picochlorum , Prasinoderma , Chlorococcum , and Marvania. Some of the species are closely related to well-known lipid producers such as Chlorella sorokiniana , but some other strains are not closely related to the strains found in public sequence databases and likely represent new species. Analysis of oil quality showed that fatty acid profiles of the microalgal strains were very diverse and strain-dependent. Fatty acids in the microalgal oils comprised saturated fatty acids (SFAs), poly-unsaturated fatty acids (PUFAs), and mono-unsaturated fatty acids (MUFAs). The main SFA was palmitic acid. MUFAs and PUFAs were dominated by oleic acid, and linoleic and linolenic acids, respectively. Some strains were especially rich in the essential fatty acid α-linolenic acid (ALA), which comprised more than 20% of the

  8. The Effect of Intermittent Antenatal Iron Supplementation on Maternal and Infant Outcomes in Rural Viet Nam: A Cluster Randomised Trial

    Hanieh, Sarah; Ha, Tran T.; Simpson, Julie A.; Casey, Gerard J.; Khuong, Nguyen C.; Thoang, Dang D.; Thuy, Tran T.; Pasricha, Sant-Rayn; Tran, Thach D.; Tuan, Tran; Dwyer, Terence; Fisher, Jane; Biggs, Beverley-Ann


    Background Anemia affects over 500 million women, and in pregnancy is associated with impaired maternal and infant outcomes. Intermittent antenatal iron supplementation is an attractive alternative to daily dosing; however, the impact of this strategy on infant outcomes remains unclear. We compared the effect of intermittent antenatal iron supplementation with daily iron supplementation on maternal and infant outcomes in rural Viet Nam. Methods and Findings This cluster randomised trial was conducted in Ha Nam province, Viet Nam. 1,258 pregnant women (<16 wk gestation) in 104 communes were assigned to daily iron–folic acid (IFA), twice weekly IFA, or twice weekly multiple micronutrient (MMN) supplementation. Primary outcome was birth weight. Mean birth weight was 3,148 g (standard deviation 416). There was no difference in the birth weights of infants of women receiving twice weekly IFA compared to daily IFA (mean difference [MD] 28 g; 95% CI −22 to 78), or twice weekly MMN compared to daily IFA (MD −36.8 g; 95% CI −82 to 8.2). At 32 wk gestation, maternal ferritin was lower in women receiving twice weekly IFA compared to daily IFA (geometric mean ratio 0.73; 95% CI 0.67 to 0.80), and in women receiving twice weekly MMN compared to daily IFA (geometric mean ratio 0.62; 95% CI 0.57 to 0.68), but there was no difference in hemoglobin levels. Infants of mothers who received twice weekly IFA had higher cognitive scores at 6 mo of age compared to those who received daily IFA (MD 1.89; 95% CI 0.23 to 3.56). Conclusions Twice weekly antenatal IFA or MMN did not produce a clinically important difference in birth weight, when compared to daily IFA supplementation. The significant improvement in infant cognitive outcomes at 6 mo of age following twice weekly antenatal IFA requires further exploration, and provides additional support for the use of intermittent, rather than daily, antenatal IFA in populations with low rates of iron deficiency. Trial registration

  9. Interaction between surface water areas and groundwater in Hanoi city, Viet Nam

    Hayashi, T.; Kuroda, K.; Do Thuan, A.; Tran Thi Viet, N.; Takizawa, S.


    Hanoi is the capital of Viet Nam and the second largest city in this country (population: 6.45 million in 2009). Hanoi city has developed along the Red River and has many lakes, ponds and canals. However, recent rapid urbanization of this city has reduced number of natural water areas such as ponds and lakes by reclamation not only in the central area but the suburban area. Canals also have been reclaimed or cut into pieces. Contrary, number of artificial water areas such as fish cultivation pond has rapidly increased. On the other hand, various kind of waste water flows into these natural and artificial water areas and induces pollution and eutrophication. These waste waters also have possibility of pollution of groundwater that is one of major water resources in this city. In addition, groundwater in this area has high concentrations of Arsenic, Fe and NH4. Thus, groundwater use may causes re-circulation of Arsenic. However, studies on the interaction between surface water areas and groundwater and on the role of surface water areas for solute transport with water cycle are a few. Therefore, we focused on these points and took water samples of river, pond and groundwater from four communities in suburban areas: two communities are located near the Red River and other two are far from the River. Also, columnar sediment samples of these ponds were taken and pore water was abstracted. Major dissolved ions, metals and stable isotopes of oxygen and hydrogen of water samples were analyzed. As for water cycle, from the correlation between δ18O and δD, the Red River water (after GNIR) were distributed along the LMWL (δD=8.2δ18O+14.1, calculated from precipitation (after GNIP)). On the other hand, although the pond waters in rainy season were distributed along the LMWL, that in dry season were distributed along the local evaporation line (LEL, slope=5.6). The LEL crossed with the LMWL at around the point of weighted mean values of precipitation in rainy season and of

  10. Roles of surface water areas for water and solute cycle in Hanoi city, Viet Nam

    Hayashi, Takeshi; Kuroda, Keisuke; Do Thuan, An; Tran Thi Viet, Nga; Takizawa, Satoshi


    Hanoi city, the capital of Viet Nam, has developed beside the Red river. Recent rapid urbanization of this city has reduced a large number of natural water areas such as lakes, ponds and canals not only in the central area but the suburban area. Contrary, the urbanization has increased artificial water areas such as pond for fish cultivation and landscaping. On the other hand, the urbanization has induced the inflow of waste water from households and various kinds of factories to these water areas because of delay of sewerage system development. Inflow of the waste water has induced eutrophication and pollution of these water areas. Also, there is a possibility of groundwater pollution by infiltration of polluted surface water. However, the role of these water areas for water cycle and solute transport is not clarified. Therefore, this study focuses on the interaction between surface water areas and groundwater in Hanoi city to evaluate appropriate land development and groundwater resource management. We are carrying out three approaches: a) understanding of geochemical characteristics of surface water and groundwater, b) monitoring of water levels of pond and groundwater, c) sampling of soil and pond sediment. Correlation between d18O and dD of precipitation (after GNIP), the Red River (after GNIR) and the water samples of this study showed that the groundwater is composed of precipitation, the Red River and surface water that has evaporation process. Contribution of the surface water with evaporation process was widely found in the study area. As for groundwater monitoring, the Holocene aquifers at two sites were in unconfined condition in dry season and the groundwater levels in the aquifer continued to increase through rainy season. The results of isotopic analysis and groundwater level monitoring showed that the surface water areas are one of the major groundwater sources. On the other hand, concentrations of dissolved Arsenic (filtered by 0.45um) in the pore

  11. The Seroprevalence and Seroincidence of Enterovirus71 Infection in Infants and Children in Ho Chi Minh City, Viet Nam

    Tran, Chau Bich Nguyen; Nguyen, Hieu Trong; Phan, Ha Thanh Thi; Tran, Ngoc Van; Wills, Bridget; Farrar, Jeremy; Santangelo, Joseph D.; Simmons, Cameron P.


    Enterovirus 71 (EV71)-associated hand, foot and mouth disease has emerged as a serious public health problem in South East Asia over the last decade. To better understand the prevalence of EV71 infection, we determined EV71 seroprevalence and seroincidence amongst healthy infants and children in Ho Chi Minh City, Viet Nam. In a cohort of 200 newborns, 55% of cord blood samples contained EV71 neutralizing antibodies and these decayed to undetectable levels by 6 months of age in 98% of infants. The EV71 neutralizing antibody seroconversion rate was 5.6% in the first year and 14% in the second year of life. In children 5–15 yrs of age, seroprevalence of EV71 neutralizing antibodies was 84% and in cord blood it was 55%. Taken together, these data suggest EV71 force of infection is high and highlights the need for more research into its epidemiology and pathogenesis in high disease burden countries. PMID:21765891

  12. The mangrove's contribution to people: Interdisciplinary pilot study of the Can Gio Mangrove Biosphere Reserve in Viet Nam

    Cormier-Salem, Marie-Christine; Van Trai, Nguyen; Burgos, Ariadna; Durand, Jean-Dominique; Bettarel, Yvan; Klein, Judith; Duc Huy, Hoang; Panfili, Jacques


    The main objective of this pilot study, conducted in June 2015 in the Can Gio Mangrove Biosphere Reserve (Can Gio MBR, Viet Nam), was to develop an interdisciplinary approach to assess some key services provided by reforested mangroves subject to external pressures and varying management policies. We focused on the abundance of viruses, bacteria, endo- and epi- and macrofauna and the diversity of crabs in the mangrove and the exploitation of its resources. The main social finding was that the local inhabitants are aware of the levels of protection of the different zones within the Can Gio MBR and respect them. The core and the buffer zones seem to present a similar ecological status. Genotyping showed a low level of crab diversity although there were many different morphotypes. In the future, we need to understand the stakeholders' general perception of the biodiversity and environment changes by developing an integrated, multi-scale approach.

  13. GIS and local knowledge in disaster management: a case study of flood risk mapping in Viet Nam.

    Tran, Phong; Shaw, Rajib; Chantry, Guillaume; Norton, John


    Linking community knowledge with modern techniques to record and analyse risk related data is one way of engaging and mobilising community capacity. This paper discusses the use of the Geographic Information System (GIS) at the local level and the need for integrating modern technology and indigenous knowledge into disaster management. It suggests a way to mobilise available human and technical resources in order to strengthen a good partnership between local communities and local and national institutions. The paper also analyses the current vulnerability of two communes by correlating hazard risk and loss/damage caused by disasters and the contribution that domestic risk maps in the community can make to reduce this risk. The disadvantages, advantages and lessons learned from the GIS flood risk mapping project are presented through the case study of the Quang Tho Commune in Thua Thien Hue province, central Viet Nam.

  14. Enterovirus serotypes in patients with central nervous system and respiratory infections in Viet Nam 1997-2010.

    B'Krong, Nguyen Thi Thuy Chinh; Minh, Ngo Ngoc Quang; Qui, Phan Tu; Chau, Tran Thi Hong; Nghia, Ho Dang Trung; Do, Lien Anh Ha; Nhung, Nguyen Ngoc; Van Vinh Chau, Nguyen; Thwaites, Guy; Van Tan, Le; van Doorn, H Rogier; Thanh, Tran Tan


    Enteroviruses are the most common causative agents of human illness. Enteroviruses have been associated with regional and global epidemics, recently, including with severe disease (Enterovirus A71 and D68), and are of interest as emerging viruses. Here, we typed Enterovirus A-D (EV) from central nervous system (CNS) and respiratory infections in Viet Nam. Data and specimens from prospective observational clinical studies conducted between 1997 and 2010 were used. Species and serotypes were determined using type-specific RT-PCR and viral protein 1 or 4 (VP1, VP4) sequencing. Samples from patients with CNS infection (51 children - 10 CSF and 41 respiratory/rectal swabs) and 28 adults (28 CSF) and respiratory infection (124 children - 124 respiratory swabs) were analysed. Twenty-six different serotypes of the four Enterovirus species (A-D) were identified, including EV-A71 and EV-D68. Enterovirus B was associated with viral meningitis in children and adults. Hand, foot and mouth disease associated Enteroviruses A (EV-A71 and Coxsackievirus [CV] A10) were detected in children with encephalitis. Diverse serotypes of all four Enterovirus species were found in respiratory samples, including 2 polio-vaccine viruses, but also 8 CV-A24 and 8 EV-D68. With the exception of EV-D68, the relevance of these viruses in respiratory infection remains unknown. We describe the diverse spectrum of enteroviruses from patients with CNS and respiratory infections in Viet Nam between 1997 and 2010. These data confirm the global circulation of Enterovirus genera and their associations and are important for clinical diagnostics, patient management, and outbreak response.

  15. La Misión Salesiana "La Candelaria" y los cambios en la dieta de los selk'nam

    Casali, Romina


    Full Text Available Esta comunicación tiene como objetivo dar a conocer los primeros resultados acerca del análisis de la dieta de los aborígenes Selk’nam que habitaron en la Misión Salesiana ‘La Candelaria’, Río Grande (Tierra del Fuego durante su funcionamiento (1893-1931. Nuestros anteriores estudios señalaron a la tuberculosis como causa de muerte excluyente dentro de la Misión. Por tanto, asumimos la relevancia de evaluar y generar información comparativa, acerca de aspectos de la vida cotidiana, en este caso los cambios dietarios, y su incidencia en la salud de los Selk’nam. Se trata de un abordaje interdisciplinario, en función de la conexión de distintos tipos de evidencia y de una visión totalizadora del proceso de desaparición étnica (intervención de múltiples factores con grado variable de sustento en el contacto interétnico, lo mismo que con un comportamiento sinérgico. Se revistan fuentes etnográficas, etnohistóricas y primarias (registros internos de la Misión. Se entrelazan los datos obtenidos, atendiendo a variables cuanti y cualitativas, lo mismo que a las referencias al ámbito de la Misión, como al exterior. Se formaliza una lectura historiográ- fica, antropológica y biológica. Se vislumbra un claro contraste en el tipo de dieta pre y pos contacto interétnico, lo mismo que una discordancia entre los ámbitos “naturales” y la Misión.

  16. Study design and the estimation of the size of key populations at risk of HIV: lessons from Viet Nam.

    Safarnejad, Ali; Groot, Wim; Pavlova, Milena


    Estimation of the size of populations at risk of HIV is a key activity in the surveillance of the HIV epidemic. The existing framework for considering future research needs may provide decision-makers with a basis for a fair process of deciding on the methods of the estimation of the size of key populations at risk of HIV. This study explores the extent to which stakeholders involved with population size estimation agree with this framework, and thus, the study updates the framework. We conducted 16 in-depth interviews with key informants from city and provincial governments, NGOs, research institutes, and the community of people at risk of HIV. Transcripts were analyzed and reviewed for significant statements pertaining to criteria. Variations and agreement around criteria were analyzed, and emerging criteria were validated against the existing framework. Eleven themes emerged which are relevant to the estimation of the size of populations at risk of HIV in Viet Nam. Findings on missing criteria, inclusive participation, community perspectives and conflicting weight and direction of criteria provide insights for an improved framework for the prioritization of population size estimation methods. The findings suggest that the exclusion of community members from decision-making on population size estimation methods in Viet Nam may affect the validity, use, and efficiency of the evidence generated. However, a wider group of decision-makers, including community members among others, may introduce diverse definitions, weight and direction of criteria. Although findings here may not apply to every country with a transitioning economy or to every emerging epidemic, the principles of fair decision-making, value of community participation in decision-making and the expected challenges faced, merit consideration in every situation.

  17. Abundance and prevalence of Aedes aegypti immatures and relationships with household water storage in rural areas in southern Viet Nam.

    Nguyen, Le Anh P; Clements, Archie C A; Jeffery, Jason A L; Yen, Nguyen Thi; Nam, Vu Sinh; Vaughan, Gregory; Shinkfield, Ramon; Kutcher, Simon C; Gatton, Michelle L; Kay, Brian H; Ryan, Peter A


    Since 2000, the Government of Viet Nam has committed to provide rural communities with increased access to safe water through a variety of household water supply schemes (wells, ferrocement tanks and jars) and piped water schemes. One possible, unintended consequence of these schemes is the concomitant increase in water containers that may serve as habitats for dengue mosquito immatures, principally Aedes aegypti. To assess these possible impacts we undertook detailed household surveys of Ae. aegypti immatures, water storage containers and various socioeconomic factors in three rural communes in southern Viet Nam. Positive relationships between the numbers of household water storage containers and the prevalence and abundance of Ae. aegypti immatures were found. Overall, water storage containers accounted for 92-97% and 93-96% of the standing crops of III/IV instars and pupae, respectively. Interestingly, households with higher socioeconomic levels had significantly higher numbers of water storage containers and therefore greater risk of Ae. aegypti infestation. Even after provision of piped water to houses, householders continued to store water in containers and there was no observed decrease in water storage container abundance in these houses, compared to those that relied entirely on stored water. These findings highlight the householders' concerns about the limited availability of water and their strong behavoural patterns associated with storage of water. We conclude that household water storage container availability is a major risk factor for infestation with Ae. aegypti immatures, and that recent investment in rural water supply infrastructure are unlikely to mitigate this risk, at least in the short term.

  18. Episiotomy rate in Vietnamese-born women in Australia: support for a change in obstetric practice in Viet Nam.

    Trinh, Anh T; Khambalia, Amina; Ampt, Amanda; Morris, Jonathan M; Roberts, Christine L


    To describe the use of episiotomy among Vietnamese-born women in Australia, including risk factors for, and pregnancy outcomes associated with, episiotomy. This population-based, retrospective cohort study included data on 598 305 singleton, term (i.e. ≥ 37 weeks' gestation) and vertex-presenting vaginal births between 2001 and 2010. Data were obtained from linked, validated, population-level birth and hospitalization data sets. Contingency tables and multivariate analysis were used to compare risk factors and pregnancy outcomes in women who did or did not have an episiotomy. The episiotomy rate in 12 208 Vietnamese-born women was 29.9%, compared with 15.1% in Australian-born women. Among Vietnamese-born women, those who had an episiotomy were significantly more likely than those who did not to be primiparous, give birth in a private hospital, have induced labour or undergo instrumental delivery. In these women, having an episiotomy was associated with postpartum haemorrhage (adjusted odds ratio, aOR: 1.26; 95% confidence interval, CI: 1.08-1.46) and postnatal hospitalization for more than 4 days (aOR: 1.14; 95% CI: 1.00-1.29). Among multiparous women only, episiotomy was positively associated with a third- or fourth-degree perineal tear (aOR: 2.00; 95% CI: 1.31-3.06); in contrast, among primiparous women the association was negative (aOR: 0.47; 95% CI: 0.37-0.60). Episiotomy was performed in far fewer Vietnamese-born women giving birth in Australia than in Viet Nam, where more than 85% undergo the procedure, and was not associated with adverse outcomes. A lower episiotomy rate should be achievable in Viet Nam.

  19. Liver disease in Viet Nam: screening, surveillance, management and education: a 5-year plan and call to action.

    Gish, Robert G; Bui, Tam D; Nguyen, Chuc T K; Nguyen, Duc T; Tran, Huy V; Tran, Diem M T; Trinh, Huy N


    Despite a high prevalence of liver disease in Viet Nam, there has been no nationwide approach to the disease and no systematic screening of at-risk individuals. Risk factors include chronic hepatitis B (estimated prevalence of 12%), chronic hepatitis C (at least 2% prevalence), and heavy consumption of alcohol among men. This combination of factors has resulted in liver cancer being the most common cause of cancer death in Viet Nam. There is a general lack of understanding by both the general public and health-care providers about the major risk to health that liver disease represents. We report here the initial steps taken as part of a comprehensive approach to liver disease that will ultimately include nationwide education for health-care providers, health educators, and the public; expansion of nationwide screening for hepatitis B and C followed by hepatitis B virus vaccination or treatment of chronic hepatitis B and/or hepatitis C; education about alcoholic liver disease; long-term surveillance for liver cancer; reduction of infection transmission related to medical, commercial, and personal re-use of contaminated needles, syringes, sharp instruments, razors, and inadequately sterilized medical equipment; and ongoing collection and analysis of data about the prevalence of all forms of liver disease and the results of the expanded screening, vaccination, and treatment programs. We report the beginning results of our pilot hepatitis B screening program. We believe that this comprehensive nationwide approach could substantially reduce the morbidity and mortality from liver disease and greatly lessen the burden in terms of both lives lost and health-care costs. © 2011 Journal of Gastroenterology and Hepatology Foundation and Blackwell Publishing Asia Pty Ltd.

  20. The text of the Agreement of 12 June 1981 between Viet Nam and the Agency relating to the application of safeguards in connection with the supply of nuclear fuel for the Da Lat research reactor


    The full text of the agreement between Viet Nam and the International Atomic Energy Agency relating to the application of safeguards in connection with the supply of nuclear fuel for the DA LAT Research Reactor is presented

  1. Les impacts de la guerre du Việt Nam sur les forêts d’A Lưới

    Robert-Charmeteau, Amélie


    Au cours de la guerre du Việt Nam, l’actuel district d’A Lưới (province de Thừa Thiên Huế, Việt Nam central), traversé par la piste Hồ Chí Minh, subit de nombreux épandages d’herbicides et pilonnages. Les forêts sont une cible privilégiée. Mais les conséquences de ces pratiques militaires sur les sylvosystèmes sont sujettes à controverses. Pour identifier objectivement le poids de la guerre sur les dynamiques paysagères, l’étude se fonde sur une analyse diachronique régressive des paysages et...

  2. Developing management packages for acid sulphate soils based on farmer and expert knowledge : field study in the Mekong Delta, Viet Nam

    Quang Tri, Le


    Effective interaction of farmers' expertise and expert knowledge has been a special point of attention for this study. The objectives of the study were to describe the process of interaction between farmers and experts in improving the use of acid sulphate soils and to point out difficulties encountered. Actual conditions for four major areas were described including variabilities. Four representative areas: Tan Thanh, Tri Ton, Phung Hiep, and Hong Dan in the Mekong Delta, Viet Nam...

  3. Improving hospital death certification in Viet Nam: results of a pilot study implementing an adapted WHO hospital death report form in two national hospitals.

    Walton, Merrilyn; Harrison, Reema; Chevalier, Anna; Esguerra, Esmond; Van Duong, Dang; Chinh, Nguyen Duc; Giang, Huong


    Viet Nam does not have a system for the national collection of death data that meets international requirements for mortality reporting. It is identified as a 'no-report' country by the WHO. Verbal autopsy reports are used in the community but exclude deaths in hospitals. This project was undertaken in Bach Mai National General Hospital and Viet Duc Surgical and Trauma Hospital in Viet Nam from 1 March 2013 to 31 March 2015. In phase 1, a modified hospital death report form, consistent with the International Statistical Classification of Diseases and Related Health Problems, 10th Revision, was developed. Small group training in use of the report form was delivered to 427 doctors. In phase two, death data were collected, collated and analysed. In phase three, a random sample (7%) of all report forms was checked for accuracy and completeness against medical records. During the 23 months of the study, 3956 deaths were recorded. Across both hospitals, 222 distinct causes of deaths were recorded. Traumatic cerebral oedema was the immediate cause of death (15% of cases, 575/3956 patients), followed by septic shock (13%, 528/3956), brain compression (11%, 416/3956), intracerebral haemorrhage (8%, 336/3956) and pneumonia (5%, 186/3956); 67% (2639/3956) of patients were discharged home to die and 33% (1314/3956) of deaths were due to a road traffic accident, or injury at home or at work. This study confirms the viability of implementing a death report form system compliant with international standards in hospitals in Viet Nam and provides the foundation for introducing a national death report form scheme. These data are critical to comprehensive knowledge of causes of death in Viet Nam. Death data about patients discharged home to die is presented for the first time, with implications for countries where this is a cultural preference.

  4. ‘Never testing for HIV’ among Men who have Sex with Men in Viet Nam: results from an internet-based cross-sectional survey


    Background Men who have sex with men in Viet Nam have been under-studied as a high-risk group for HIV infection, and this population’s percentage and determinants of HIV testing have not been comprehensively investigated. Methods A national Internet-based survey of self-reported sexual and health seeking behaviours was conducted between August and October 2011 with 2077 Vietnamese men who had sex with men in the last twelve months to identify the frequency of ‘never testing for HIV’ among Internet-using MSM living in Viet Nam, as well as the factors associated with this HIV-related high-rish behavior. Logistic regression analyses were conducted to assess the demographic characteristics and behaviours predicting never testing for HIV. Results A total of 76.5% of men who have sex with men who were surveyed reported never having been voluntarily tested for HIV. Predictors of never being tested included having a monthly income less than VND 5 Million, being a student, using the Internet less than 15 hour per week, and not participating in a behavioural HIV intervention. Conclusions Never testing for HIV is common among Internet-using men who have sex with men in Viet Nam. Given the dangerously high prevalence of this high-risk behaviour, our findings underscore the urgent need for segmented and targeted HIV prevention, care and treatment strategies, focusing on drastically reducing the number of men who have sex with men never testing for HIV in Viet Nam. PMID:24373483

  5. Detection of potentially novel paramyxovirus and coronavirus viral RNA in bats and rats in the Mekong Delta region of southern Viet Nam.

    Berto, A; Anh, P H; Carrique-Mas, J J; Simmonds, P; Van Cuong, N; Tue, N T; Van Dung, N; Woolhouse, M E; Smith, I; Marsh, G A; Bryant, J E; Thwaites, G E; Baker, S; Rabaa, M A


    Bats and rodents are being increasingly recognized as reservoirs of emerging zoonotic viruses. Various studies have investigated bat viruses in tropical regions, but to date there are no data regarding viruses with zoonotic potential that circulate in bat and rat populations in Viet Nam. To address this paucity of data, we sampled three bat farms and three wet markets trading in rat meat in the Mekong Delta region of southern Viet Nam. Faecal and urine samples were screened for the presence of RNA from paramyxoviruses, coronaviruses and filoviruses. Paramyxovirus RNA was detected in 4 of 248 (1%) and 11 of 222 (4.9%) bat faecal and urine samples, respectively. Coronavirus RNA was detected in 55 of 248 (22%) of bat faecal samples; filovirus RNA was not detected in any of the bat samples. Further, coronavirus RNA was detected in 12 of 270 (4.4%) of rat faecal samples; all samples tested negative for paramyxovirus. Phylogenetic analysis revealed that the bat paramyxoviruses and bat and rat coronaviruses were related to viruses circulating in bat and rodent populations globally, but showed no cross-species mixing of viruses between bat and rat populations within Viet Nam. Our study shows that potentially novel variants of paramyxoviruses and coronaviruses commonly circulate in bat and rat populations in Viet Nam. Further characterization of the viruses and additional human and animal surveillance is required to evaluate the likelihood of viral spillover and to assess whether these viruses pose a risk to human health. © 2017 The Authors. Zoonoses and Public Health Published by Blackwell Verlag GmbH.

  6. Unpredictable Agency: An Analysis of Youth and Educational Practices in Times of Political and Economic Precarity in Contemporary Đà Nẵng City, Việt Nam

    Duong, Phuoc M


    This dissertation investigates how educational agency performed by young adults in Việt Nam is utilized to build and sustain the socialist nation-building project. Drawing on a framework of governmentality, I analyze the rationale of governance and agency through Việt Nam’s experiment with differing political economies to contribute to anthropological debates on how the shift from collective action for the greater common good to liberal individualism by young adults, sustain or compromise the...

  7. Seroprevalence survey of avian influenza A(H5N1) among live poultry market workers in northern Viet Nam, 2011.

    Dung, Tham Chi; Dinh, Pham Ngoc; Nam, Vu Sinh; Tan, Luong Minh; Hang, Nguyen Le Khanh; Thanh, Le Thi; Mai, Le Quynh


    Highly pathogenic avian influenza A(H5N1) is endemic in poultry in Viet Nam. The country has experienced the third highest number of human infections with influenza A(H5N1) in the world. A study in Hanoi in 2001, before the epizootic that was identified in 2003, found influenza A(H5N1) specific antibodies in 4% of poultry market workers (PMWs). We conducted a seroprevalence survey to determine the seroprevalence of antibodies to influenza A(H5N1) among PMWs in Hanoi, Thaibinh and Thanhhoa provinces. We selected PMWs from five markets, interviewed them and collected blood samples. These were then tested using a horse haemagglutination inhibition assay and a microneutralization assay with all three clades of influenza A(H5N1) viruses that have circulated in Viet Nam since 2004. The overall seroprevalence was 6.1% (95% confidence interval: 4.6-8.3). The highest proportion (7.2%) was found in PMWs in Hanoi, and the majority of seropositive subjects (70.3%) were slaughterers or sellers of poultry. The continued circulation and evolution of influenza A(H5N1) requires comprehensive surveillance of both human and animal sites throughout the country with follow-up studies on PMWs to estimate the risk of avian-human transmission of influenza A(H5N1) in Viet Nam.

  8. Can health systems be enhanced for optimal health services through disease-specific programs? Results of field studies in Viet Nam and Cambodia.

    Egami, Y; Fujita, N; Akashi, H; Matsumoto, Y; Ohara, H; Takeuchi, M


    Developing better health systems is the key to delivering optimal health services, although more evidence of effective strategies to do so is needed. Field surveys were conducted in Viet Nam and Cambodia to identify best practices in addressing health system bottlenecks to scale up disease control programs. The two countries were compared over time using a framework for analysis developed by the authors. In Viet Nam, a health system was in place for decades at the central to municipal levels, although it was fragile until the 1990s, when the government started taking measures. In Cambodia, the previous health system had been destroyed during previous internal conflict. In the post-conflict period, the health system was rebuilt with support for programs followed by centralization of health services. In different settings, different measures were taken to deal with similar bottlenecks. In Cambodia, vertical programs were dominant, so the government sought to centralize drug management to deal with shortages of essential drugs, while Viet Nam sought to mobilize resources to ensure drug distribution at all levels. This study shows there is no single successful approach to health systems, and a systemic approach needs to be taken because elimination of one bottleneck may reveal another. Efforts to enhance disease-specific programs may not always contribute to overall enhancement of the health system, and the best possible approach may not be the same in different countries. Further study is needed to explore common issues and principles for effective strategies to enhance health systems in different contexts.

  9. Seroprevalence survey of avian influenza A(H5N1 among live poultry market workers in northern Viet Nam, 2011

    Tham Chi Dung


    Full Text Available Objective: Highly pathogenic avian influenza A(H5N1 is endemic in poultry in Viet Nam. The country has experienced the third highest number of human infections with influenza A(H5N1 in the world. A study in Hanoi in 2001, before the epizootic that was identified in 2003, found influenza A(H5N1 specific antibodies in 4% of poultry market workers (PMWs. We conducted a seroprevalence survey to determine the seroprevalence of antibodies to influenza A(H5N1 among PMWs in Hanoi, Thaibinh and Thanhhoa provinces. Methods: We selected PMWs from five markets, interviewed them and collected blood samples. These were then tested using a horse haemagglutination inhibition assay and a microneutralization assay with all three clades of influenza A(H5N1 viruses that have circulated in Viet Nam since 2004. Results: The overall seroprevalence was 6.1% (95% confidence interval: 4.6–8.3. The highest proportion (7.2% was found in PMWs in Hanoi, and the majority of seropositive subjects (70.3% were slaughterers or sellers of poultry. Discussion: The continued circulation and evolution of influenza A(H5N1 requires comprehensive surveillance of both human and animal sites throughout the country with follow-up studies on PMWs to estimate the risk of avian–human transmission of influenza A(H5N1 in Viet Nam.

  10. Study of the natural radiation background affected on the human body in some areas of Viet Nam

    Ngo Van Thanh


    The author had studied the natural radiation background in 68 districts belong 40 provinces and cities of Vietnam from 2002 to 2005. The estimated results clearly show that the average external irradiation dose levels and the average annual external radiation equivalent dose affected on the human body are 0.181± 0.0189 μSv/h and 1599 ± 171.8 μSv/year respectively, both are in normal limit; the highest levels are in Lai Chau district (Lai Chau province); the lowest levels are in Buon Ma Thuot city (DakLak province), Phuoc Son district (Quang Nam province), Tan An district (Long An province). The radon concentration in the human being and the average annual internal inhalation irradiation equivalent dose affected on the human beings are 26.9 ± 15.89 Bq/m 3 and 392.88 ± 231.99 μSv/year respectively; the maximums are in Nha Trang city (Khanh Hoa province), Bac Binh district (Binh Phuoc province); the minimums are in Vung Tau city (Ba Ria- Vung Tau province), Tan An district (Long An province), Rach Gia district (Kien Giang province). The terrestrial radionuclide concentrations in the cereals, foodstuffs (rice, meat, vegetables), water, earth and the average annual internal irradiation equivalent dose are 829.2 ± 38.06 Bq/kg and 229.3 ± 67.70 μSv/year respectively; the highest levels are in Phong Tho district (Lai Chau province), Dien Bien city; the lowest levels are in Dong Xoai district (Binh Phuoc province), Tan An district (Long An province). The average total annual natural radiation background effective equivalent dose level affected on the human body is 2206.9 ± 529.30 μSv/year; the highest levels are in Lai Chau district (Lai Chau province); the lowest levels are in Tan An district (Long An province). The 14 maps of Natural Radiation Background in several localized regions belong 40 provinces and cities of Viet Nam had been set up. These results can reserve for serviceman and public health in the both wartime and peacetime. (author)

  11. Multiple and concurrent sexual partnerships among men who have sex with men in Viet Nam: results from a National Internet-based Cross-sectional Survey.

    García, M C; Duong, Q L; Meyer, S B; Ward, P R


    Men who have sex with men (MSM) are one of the largest HIV risk groups in Viet Nam and have been understudied. Sexual concurrency and multiple sex partnerships may contribute to high HIV incidence among MSM in Viet Nam. Limited information is available on concurrency and multiple sexual partnerships among MSM in Viet Nam or on the extent to which this population engages in concurrent and multiple unprotected anal intercourse. Data are from a self-administered Internet-based survey of Vietnamese MSM aged 18 years or older, having sex with male partner(s) in the last 12 months and recruited from social networking MSM-specific websites in Viet Nam. Multiple partnerships and concurrency were measured using the UNAIDS-recommended sexual partner matrix, a key component in the questionnaire. Concurrent and multiple sexual partnerships were analyzed at the individual level. Logistic regression analyses were conducted to assess the demographic characteristics and behaviors associated with multiple sexual partnerships. A total of 1695 MSM reported on multiple sexual partnerships; 69.5% indicated multiple sexual partnerships in the last 6 months. A total of 257 MSM reported on concurrent sexual partnerships, with 51.0% reporting penetrative sex with concurrent partners in the last 6 months. Respondents were more likely to engage in multiple sexual partnerships if they were no longer a student, consumed alcohol before and/or during sex, used the Internet to meet casual sex partners and had never participated in a behavioral HIV intervention. Multiple sexual partnerships in the previous 6 months were common among MSM surveyed, as was sexual concurrency. High levels of multiple and concurrent sexual partnerships may be catalyzing the transmission of HIV among MSM in Viet Nam. Given the high prevalence of this high-risk sexual behavior, our findings underscore the urgent need for targeted prevention efforts, focusing on the reduction of multiple and concurrent sexual partners

  12. Three new species of earthworms in the Amynthas (Clitellata: Megascolecidae from Nam Xam National Protected Area, Laos

    Yong Hong


    Full Text Available Earthworm specimens collected from the Nam Xam National Protected Area, Laos, belong to three new species of megascolecid earthworms: Amynthas xamtaiensis sp. nov., Amynthas vanhyai sp. nov., and Amynthas multipapillatus sp. nov. The authors provide a new record for Amynthas gracilis (Kinberg, 1867. All three new species key to the gracilis (hawayanus group in Sims and Easton (1972, defined by having three pairs of spermathecal pores in 5/6–7/8. A. xamtaiensis sp. nov. has male pores superficial in thickened areas, containing two genital papillae medial to the male pores. A. vanhyai sp. nov. has male pores equatorial oval pads at sixth setal lines, and shallowly pinnate intestinal ceca having 6–10 lobes on each edge. A. multipapillatus sp. nov. has male pores on small longitudinal shallow invaginations at lateral margins of the ventrum, and more than 100 small genital papillae covering the ventral surface from 16/17 to 17/18.

  13. The Impact of Para Rubber Expansion on Streamflow and Other Water Balance Components of the Nam Loei River Basin, Thailand

    Winai Wangpimool


    Full Text Available At present, Para rubber is an economical crop which provides a high priced product and is in demand by global markets. Consequently, the government of Thailand is promoting the expansion of Para rubber plantations throughout the country. Traditionally, Para rubber was planted and grown only in the southern areas of the country. However, due to the Government’s support and promotion as well as economic reasons, the expansion of Para rubber plantations in the northeast has increased rapidly. This support has occurred without accounting for suitable cultivation of Para rubber conditions, particularly in areas with steep slopes and other factors which have significant impacts on hydrology and water quality. This study presents the impacts of Para rubber expansion by applying the Soil and Water Assessment Tool (SWAT hydrological model on the hydrology and water balance of the Nam Loei River Basin, Loei Province. The results showed that the displacement of original local field crops and disturbed forest land by Para rubber production resulted in an overall increase of evapotranspiration (ET of roughly 3%. The major factors are the rubber canopy and precipitation. Moreover, the water balance results showed an annual reduction of about 3% in the basin average water yield, especially during the dry season.

  14. Discovery of the fossiliferous Cu Brei Formation (Lower Devonian) in the Kon Tum Block (South Viet Nam)

    Thanh, Tong-Dzuy; Duyen, Than Duc; Hung, Nguyen Huu; My, Bui Phu


    Lower Devonian corals and stromatoporoids have recently been discovered in limestones among low grade metamorphic rocks on the western margin of the Kon Tum Block (South Viet Nam). This unit has been identified as the Cu Brei Formation. Coral and stromatoporoid species have been described including Squameofavosites aff. spongiosus, Parallelostroma cf. multicolumnum, Amphipora cf. rasilis, A. cf. raritalis, Simplexodictyon cf. artyschtense, Stromatopora cf. boriarchinovi and Stromatopora sp. indet. The Cu Brei Formation is exposed in a small area 6 km in length and 3 km wide at the foot of Cu Brei Mountain (Sa Thay District, Kon Tum Province). As this formation is in marine shelf facies it is probable that further exposures of Lower Devonian sediments may be discovered in the Kon Tum Block. This discovery raises the question of the tectonic history of the metamorphic Kon Tum Block. It is possible that the block was not an area of positive uplift from the beginning of Paleozoic as has been supposed, but was submerged in a marine environment, at least on its outer margins, in the Devonian, and possibly even earlier, in Early Paleozoic.

  15. Assessing error sources for Landsat time series analysis for tropical test sites in Viet Nam and Ethiopia

    Schultz, Michael; Verbesselt, Jan; Herold, Martin; Avitabile, Valerio


    Researchers who use remotely sensed data can spend half of their total effort analysing prior data. If this data preprocessing does not match the application, this time spent on data analysis can increase considerably and can lead to inaccuracies. Despite the existence of a number of methods for pre-processing Landsat time series, each method has shortcomings, particularly for mapping forest changes under varying illumination, data availability and atmospheric conditions. Based on the requirements of mapping forest changes as defined by the United Nations (UN) Reducing Emissions from Forest Degradation and Deforestation (REDD) program, the accurate reporting of the spatio-temporal properties of these changes is necessary. We compared the impact of three fundamentally different radiometric preprocessing techniques Moderate Resolution Atmospheric TRANsmission (MODTRAN), Second Simulation of a Satellite Signal in the Solar Spectrum (6S) and simple Dark Object Subtraction (DOS) on mapping forest changes using Landsat time series data. A modification of Breaks For Additive Season and Trend (BFAST) monitor was used to jointly map the spatial and temporal agreement of forest changes at test sites in Ethiopia and Viet Nam. The suitability of the pre-processing methods for the occurring forest change drivers was assessed using recently captured Ground Truth and high resolution data (1000 points). A method for creating robust generic forest maps used for the sampling design is presented. An assessment of error sources has been performed identifying haze as a major source for time series analysis commission error.

  16. Correlation analysis between forest carbon stock and spectral vegetation indices in Xuan Lien Nature Reserve, Thanh Hoa, Viet Nam

    Dung Nguyen, The; Kappas, Martin


    In the last several years, the interest in forest biomass and carbon stock estimation has increased due to its importance for forest management, modelling carbon cycle, and other ecosystem services. However, no estimates of biomass and carbon stocks of deferent forest cover types exist throughout in the Xuan Lien Nature Reserve, Thanh Hoa, Viet Nam. This study investigates the relationship between above ground carbon stock and different vegetation indices and to identify the most likely vegetation index that best correlate with forest carbon stock. The terrestrial inventory data come from 380 sample plots that were randomly sampled. Individual tree parameters such as DBH and tree height were collected to calculate the above ground volume, biomass and carbon for different forest types. The SPOT6 2013 satellite data was used in the study to obtain five vegetation indices NDVI, RDVI, MSR, RVI, and EVI. The relationships between the forest carbon stock and vegetation indices were investigated using a multiple linear regression analysis. R-square, RMSE values and cross-validation were used to measure the strength and validate the performance of the models. The methodology presented here demonstrates the possibility of estimating forest volume, biomass and carbon stock. It can also be further improved by addressing more spectral bands data and/or elevation.

  17. Development of Phaeocystis globosa blooms in the upwelling waters of the South Central coast of Viet Nam

    Hai, Doan-Nhu; Lam, Nguyen-Ngoc; Dippner, Joachim W.


    Blooms of haptophyte algae in the south central coastal waters of Viet Nam often occur in association with upwelling phenomenon during the southwest (SW) monsoon. Depending on the magnitude of the blooms, damage to aquaculture farms may occur. Based on two years of data on biology, oceanography, and marine chemistry, the present study suggests a conceptual model of the growth of the haptophyte Phaeocystis globosa. At the beginning of the bloom, low temperature and abundant nutrient supply, especially nitrate from rain and upwelling, favour bloom development. Diatoms utilize available nitrate and phosphate; subsequently, higher ammonium concentration allows P. globosa to grow faster than the diatoms. At the end of the Phaeocystis bloom, free cells may become available as food for a heterotrophic dinoflagellate species, Noctiluca scintillans. During and after the phytoplankton bloom, remineralization by bacteria reduces dissolved oxygen to a very low concentration at depth, and favors growth of nitrate-reducing bacteria.A Lagrangian Harmful Algal Bloom (HAB) model, driven by a circulation model of the area, realistically simulates the transport of microalgae in surface waters during strong and weak SW monsoon periods, suggesting that it may be a good tool for early warning of HABs in Vietnamese coastal waters.

  18. Risk Behaviors for HIV and HCV Infection Among People Who Inject Drugs in Hai Phong, Viet Nam, 2014.

    Duong, Huong Thi; Jarlais, Don Des; Khuat, Oanh Hai Thi; Arasteh, Kamyar; Feelemyer, Jonathan; Khue, Pham Minh; Giang, Hoang Thi; Laureillard, Didier; Hai, Vinh Vu; Vallo, Roselyne; Michel, Laurent; Moles, Jean Pierre; Nagot, Nicolas


    We examined the potential for HIV and hepatitis C (HCV) transmission across persons who inject drugs (PWID), men-who-have-sex-with-men (MSM) and female commercial sex workers (CSW) PWID and the potential for sexual transmission of HIV from PWID to the general population in Hai Phong, Viet Nam. Using respondent driven and convenience sampling we recruited 603 participants in 2014. All participants used heroin; 24% used non-injected methamphetamine. HIV prevalence was 25%; HCV prevalence was 67%. HIV infection was associated with HCV prevalence and both infections were associated with length of injecting career. Reported injecting risk behaviors were low; unsafe sexual behavior was high among MSM-PWID and CSW-PWID. There is strong possibility of sexual transmission to primary partners facilitated by methamphetamine use. We would suggest future HIV prevention programs utilize multiple interventions including "treatment as prevention" to potential sexual transmission of HIV among MSM and CSW-PWID and from PWID to the general population.

  19. Application of groundwater sustainability indicators to the Upper Pliocene aquifer in Ho Chi Minh city, Viet Nam

    Ngo, T. M.; Lee, J.; Lee, H.; Woo, N. C.


    Groundwater plays an importance role for domestic, industrial, and agricultural uses in Ho Chi Minh city, Viet Nam. This study is objected to evaluate the sustainability of groundwater by using groundwater sustainability indicators (GWSIs) defined by UNESCO/IAEA/IAH Working Group on Groundwater Indicators at aquifer scale (the Upper Pliocene aquifer). There are four main indicators selected and one new indicator designed for the particular characteristic of Ho Chi Minh city which is under influence of by saline-water intrusion. The results indicated groundwater of the Upper Pliocene aquifer, the main groundwater supply source, is generally in the unsustainable state. The abstraction of groundwater, which was much greater than its capability, is probably causing the serious state of annual groundwater depletion and saline-water intrusion. The GWSIs, which expressed in such a simple way but scientifically-based and policy-relevant, proved its usefulness in evaluating the sustainability of groundwater at the aquifer scale in Ho Chi Minh city, and subsequently should be incorporated in water resource management practices.

  20. Des habitations à bon marché au Việt Nam. La question du logement social en situation coloniale Public Housing Projects in Việt Nam: the Problem of Habitation in a Colonial Situation

    Caroline Herbelin


    Full Text Available La crise du logement dans les grandes villes du Việt Nam est récurrente pendant toute la colonisation. Elle touche les Européens, mais surtout les populations locales qui vivent en majorité dans des habitats précaires. A partir des années 1920, face à l’ampleur de la situation, le gouvernement général décide d’adapter dans la colonie les récentes lois françaises en faveur du logement social. Si quelques prototypes d’habitations à bon marché vont être mis en place par la municipalité de Hanoi dans les années 1930, ce n’est que dans les années 1950, pour répondre à la crise sociale que les politiques de logement vont commencer à être significatives. Entre inertie et projets enthousiastes, les politiques de logement révèlent les contradictions du système colonial face à un problème aussi crucial que complexe, mettant en jeu différents acteurs à différents niveaux : le gouvernement général d’Indochine, la résidence supérieure du Tonkin, les municipalités, les associations privées et dans une moindre mesure les sociétés de construction. Du point de vue architectural, les projets mis en place sont des créations hybrides qui montrent une volonté manifeste de s’adapter au style de vie vietnamien.During the colonial period, the main cities of Việt Nam periodically experienced social housing crises. While Europeans did not remain immune from the consequences of a lack of adequate housing, local populations, who constituted the majority in these makeshift constructs, were most deeply affected. Beginning in the 1920s, faced with the urgency of this problem, the general government sought to adapt contemporaneous French laws in favor of social housing to the local colonial situation. Even though some prototypes of affordable housing were constructed by the Hanoi municipality in the 1930s, it was only in the 1950s that government efforts began to have a significant impact. The politics of housing, and

  1. Factors Influencing Blood Cadmium and Mercury Concentrations in Residents of Agro-Industries along Nam Phong River, Thailand

    Wannanapa Srathonghon


    Full Text Available This cross-sectional analytical study aimed to determine the blood levels of cadmium (B-Cd and mercury (B-Hg and identify the factors influencing heavy metal accumulation in residents of Agro-Industries along the Nam Phong River. Quantitative data were collected, and systematic random sampling was used to obtain 420 samples for questionnaire interview and serum heavy metal testing for B-Cd and B-Hg. Multiple regression analysis was used to identify factors influencing the accumulation of heavy metals in the population and report mean differences, 95% confidence intervals and p-values. The results indicated that B-Cd levels were within the recommended safety limits for human health (5 µg/dL. However, 4.29% of respondents had Hg levels higher than the recommended safety limits for human health (10 µg/dL. Factors influencing Cd levels included sex (mean difference=0.13 µg/L, 95% CI: 0.03-0.24, p-value=0.02 and smoking (mean difference=0.14 µg/L, 95% CI: 0.09-0.19, p-value<0.001. Factors influencing Hg levels included smoking (mean difference=1.06 µg/L, 95% CI: 0.52-1.61, p-value<0.001, fish consumption (mean difference=1.11 µg/L, 95% CI: 0.22-2.01, p-value=0.01 and river snail consumption (mean difference=0.56 µg/L, 95% CI: 0.03-0.19, p-value=0.03.

  2. Cross-sectional study of sexual behaviour and knowledge about HIV among urban, rural, and minority residents in Viet Nam.

    Bui, T D; Pham, C K; Pham, T H; Hoang, L T; Nguyen, T V; Vu, T Q; Detels, R


    A cross-sectional survey was conducted in three districts of Quang Ninh province, Viet Nam, to find out what proportion of the people who lived there engaged in behaviour that put them at risk of becoming infected with HIV, and to measure their knowledge about HIV infection and AIDS. The survey was conducted in a rural district, Yen Hung; a mountainous district inhabited primarily by ethnic minority groups, Binh Lieu; and an urban district, Ha Long. Participants aged 15-45 years were randomly selected from the general population to be interviewed. A total of 630 people from 707 households were interviewed; 8% were not home despite repeated visits and 3% refused to participate. The prevalence of premarital intercourse ranged from 9% to 16% among married men and 4% to 7% among married women. Among single men the proportion who had ever had intercourse ranged from 6% to 16%. Fewer than 3% reported having ever had sex with a sex worker. The median number of extramarital sex partners was 1. Knowledge about HIV/AIDS was high in the urban and rural areas but low in the mountainous area. Being male and being 20-29 years old were associated with having multiple sex partners. The low prevalence of individuals reporting that they had had intercourse with sex workers and partners other than their spouse may explain the low rates of HIV infection among the heterosexual population; these rates are in contrast to the high rates of HIV infection found among injecting drug users. The association between having extramarital partners and being a younger man suggests that the tendency to have more sexual partners may increase in the future. If this happens, the potential for HIV to be spread through heterosexual sex will increase.

  3. Fool’s Gold: Understanding Social, Economic and Environmental Impacts from Gold Mining in Quang Nam Province, Vietnam

    Nhi Nguyen


    Full Text Available Extractive industries are often claimed to contribute to both poverty reduction and economic growth. Yet, there is also a body of research that suggests natural resource dependence can result in limited development, environmental degradation and social upheaval. This paper examines differences in the socioeconomic and environmental state of mining and non-mining communities in rural Vietnam in order to understand the extent to which mining contributes to livelihood development and socioeconomic well-being. In particular, we examine the role that “corporate social responsibility” (CSR plays in supporting community development in Phuoc Son and Phu Ninh districts, Quang Nam province. Content analysis of newspapers, government documents and mining company reports provided a contextual overview of mining operations and community relations in each study area. Semi-structured interviews were used to collect information from local and regional stakeholders to further understand perceived impacts of mining operations on local communities. Our study finds that in comparison to non-mining communities, communities with active mines demonstrated increased job development, decreased poverty rates, enhanced infrastructure and social development along with increased incidences of CSR initiatives. However, a number of adverse effects from mining activities were reported including environmental degradation (e.g., deforestation, water pollution, etc. increased criminal activity and drug addiction. Dependence on mine-related employment in local communities becomes acutely apparent when temporary mine closures result in widespread unemployment. Local governments may be the greatest beneficiaries of mining with increased tax revenues and enhanced management potential of leased land. Non-mining communities without direct benefits from mining activities maintained economic diversity and were therefore more resilient to economic shocks such as nearby mine closures.

  4. Prevalence and Risk Factors of Dengue Infection in Khanh Hoa Province, Viet Nam: A Stratified Cluster Sampling Survey.

    Mai, Vien Quang; Mai, Trịnh Thị Xuan; Tam, Ngo Le Minh; Nghia, Le Trung; Komada, Kenichi; Murakami, Hitoshi


    Dengue is a clinically important arthropod-borne viral disease with increasing global incidence. Here we aimed to estimate the prevalence of dengue infections in Khanh Hoa Province, central Viet Nam, and to identify risk factors for infection. We performed a stratified cluster sampling survey including residents of 3-60 years of age in Nha Trang City, Ninh Hoa District and Dien Khanh District, Khanh Hoa Province, in October 2011. Immunoglobulin G (IgG) and immunoglobulin M (IgM) against dengue were analyzed using a rapid test kit. Participants completed a questionnaire exploring clinical dengue incidence, socio-economic status, and individual behavior. A household checklist was used to examine environment, mosquito larvae presence, and exposure to public health interventions. IgG positivity was 20.5% (urban, 16.3%; rural, 23.0%), IgM positivity was 6.7% (urban, 6.4%; rural, 6.9%), and incidence of clinically compatible dengue during the prior 3 months was 2.8 per 1,000 persons (urban, 1.7; rural, 3.4). For IgG positivity, the adjusted odds ratio (AOR) was 2.68 (95% confidence interval [CI], 1.24-5.81) for mosquito larvae presence in water pooled in old tires and was 3.09 (95% CI, 1.75-5.46) for proximity to a densely inhabited area. For IgM positivity, the AOR was 3.06 (95% CI, 1.50-6.23) for proximity to a densely inhabited area. Our results indicated rural penetration of dengue infections. Control measures should target densely inhabited areas, and may include clean-up of discarded tires and water-collecting waste.

  5. Evidence for the Convergence Model: The Emergence of Highly Pathogenic Avian Influenza (H5N1 in Viet Nam.

    Sumeet Saksena

    Full Text Available Building on a series of ground breaking reviews that first defined and drew attention to emerging infectious diseases (EID, the 'convergence model' was proposed to explain the multifactorial causality of disease emergence. The model broadly hypothesizes disease emergence is driven by the co-incidence of genetic, physical environmental, ecological, and social factors. We developed and tested a model of the emergence of highly pathogenic avian influenza (HPAI H5N1 based on suspected convergence factors that are mainly associated with land-use change. Building on previous geospatial statistical studies that identified natural and human risk factors associated with urbanization, we added new factors to test whether causal mechanisms and pathogenic landscapes could be more specifically identified. Our findings suggest that urbanization spatially combines risk factors to produce particular types of peri-urban landscapes with significantly higher HPAI H5N1 emergence risk. The work highlights that peri-urban areas of Viet Nam have higher levels of chicken densities, duck and geese flock size diversities, and fraction of land under rice or aquaculture than rural and urban areas. We also found that land-use diversity, a surrogate measure for potential mixing of host populations and other factors that likely influence viral transmission, significantly improves the model's predictability. Similarly, landscapes where intensive and extensive forms of poultry production overlap were found at greater risk. These results support the convergence hypothesis in general and demonstrate the potential to improve EID prevention and control by combing geospatial monitoring of these factors along with pathogen surveillance programs.

  6. New Triangular and Rectangular NAM Representation Algorithm for Color Images%一种新的TRNAM彩色图像表示算法



    The Non-symmetry and Anti-packing Model (NAM) is suitable for representations of image pattern, audio pattern, video pattern, and text pattern, and it is a general pattern representation model. Inspired by the idea of representing the pixels by the Gray code, a new triangular and rectangular NAM representation algorithm for color images, which is called the NTRNAM algorithm, is proposed. The principium and the description of the NTRNAM algorithm are presented and the storage structure, the total data a-mount, and the time and space complexities of the proposed algorithm are analyzed. The theoretical and experimental results show that the NTRNAM algorithm can greatly reduce the number of subpatterns and simultaneously save the storage room, and therefore it is an effective algorithm for color image representation.%非对称逆布局模型(NAM)适用于图像模式、语音模式、文本模式、视频模式的表示,是一个通用型的模式表示模型.借助于格雷码表示图像像素的思想,提出了一种新的三角形和矩形NAM彩色图像表示算法(简称NTRNAM算法).给出了算法的原理及形式化描述,并对其存储结构、总数据量和时空复杂性进行了分析.理论分析和实验结果表明:NTRNAM算法能够显著降低子模式数和存储空间,是一种有效的彩色图像表示算法.

  7. Comparative study of nasoalveolar molding methods: nasal elevator plus DynaCleft® versus NAM-Grayson in patients with complete unilateral cleft lip and palate.

    Monasterio, Luis; Ford, Alison; Gutiérrez, Carolina; Tastets, María Eugenia; García, Jacqueline


    Objective : To compare nasoalveolar molding (NAM) effect employing a nasal elevator plus DynaCleft® and NAM-Grayson system in patients with complete unilateral cleft lip and palate. Method : Prospective study in two groups. Group A included 20 consecutive patients treated with DynaCleft® and a nasal elevator before lip surgery. Group B included 20 patients treated with NAM-Grayson system. Maxillary casts and standard view photographs were done before and after treatment. Columella deviation angle, soft tissue distance of the cleft, intercommisural distance, and nostril height and width were traced and measured on the printed photos; a ratio was obtained and compared before and after treatment. Cleft width, anterior width, and anteroposterior distances were measured on the maxillary cast. Results : Group A began treatment at an average age of 14.3 days and group B at an average age of 16.9 days; no complications were observed. For group A, the initial average alveolar cleft within the cast was 10.7 mm, and after treatment it was 6.6 mm. For group B, pretreatment width was 11.2 mm, and after treatment it was 5.9 mm. No differences were found on the anterior and posterior width, and A-P distance of both groups. The initial mean columellar angle in group A was 38.1°, and after treatment it was 61.5°; for group B the initial mean columellar angle was 33.6°, and after treatment it was 59.5°. Results of Mann-Whitney U and Student's t tests showed no differences (P > .05). Width and height dimensions of the nostril showed minor differences. Conclusions : Both methods significantly reduced the cleft width and improved the nasal asymmetry. Our findings show that both methods produced similar results.

  8. Impacts on Breastfeeding Practices of At-Scale Strategies That Combine Intensive Interpersonal Counseling, Mass Media, and Community Mobilization: Results of Cluster-Randomized Program Evaluations in Bangladesh and Viet Nam.

    Menon, Purnima; Nguyen, Phuong Hong; Saha, Kuntal Kumar; Khaled, Adiba; Kennedy, Andrew; Tran, Lan Mai; Sanghvi, Tina; Hajeebhoy, Nemat; Baker, Jean; Alayon, Silvia; Afsana, Kaosar; Haque, Raisul; Frongillo, Edward A; Ruel, Marie T; Rawat, Rahul


    Despite recommendations supporting optimal breastfeeding, the number of women practicing exclusive breastfeeding (EBF) remains low, and few interventions have demonstrated implementation and impact at scale. Alive & Thrive was implemented over a period of 6 y (2009-2014) and aimed to improve breastfeeding practices through intensified interpersonal counseling (IPC), mass media (MM), and community mobilization (CM) intervention components delivered at scale in the context of policy advocacy (PA) in Bangladesh and Viet Nam. In Bangladesh, IPC was delivered through a large non-governmental health program; in Viet Nam, it was integrated into government health facilities. This study evaluated the population-level impact of intensified IPC, MM, CM, and PA (intensive) compared to standard nutrition counseling and less intensive MM, CM, and PA (non-intensive) on breastfeeding practices in these two countries. A cluster-randomized evaluation design was employed in each country. For the evaluation sample, 20 sub-districts in Bangladesh and 40 communes in Viet Nam were randomized to either the intensive or the non-intensive group. Cross-sectional surveys (n ~ 500 children 0-5.9 mo old per group per country) were implemented at baseline (June 7-August 29, 2010, in Viet Nam; April 28-June 26, 2010, in Bangladesh) and endline (June 16-August 30, 2014, in Viet Nam; April 20-June 23, 2014, in Bangladesh). Difference-in-differences estimates (DDEs) of impact were calculated, adjusting for clustering. In Bangladesh, improvements were significantly greater in the intensive compared to the non-intensive group for the proportion of women who reported practicing EBF in the previous 24 h (DDE 36.2 percentage points [pp], 95% CI 21.0-51.5, p Viet Nam, EBF increases were greater in the intensive group (27.9 pp, 95% CI 17.7-38.1, p Viet Nam than standard counseling with less intensive MM, CM, and PA. To our knowledge, this study is the first to document implementation and impacts of

  9. Trends in Second-Hand Tobacco Smoke Exposure Levels at Home among Viet Nam School Children Aged 13-15 and Associated Factors.

    Lam, Nguyen Tuan; Nga, Pham Thi Quynh; Minh, Hoang Van; Giang, Kim Bao; Hai, Phan Thi; Huyen, Doan Thu; Linh, Nguyen Thuy; Van, Duong Khanh; Khue, Luong Ngoc


    Second-hand tobacco smoke (SHS) exposure at home, especially among children, is a serious issue in Viet Nam. During the past decade, much effort has been taken for tobacco control in the country, including various prgorammes aiming to reduce SHS exposure among adults and children. This article analysed trends and factors associated with SHS exposure at home among school children aged 13-15 in Viet Nam, using the Global Youth Tobacco Surveys conducted in 2007 and 2014. Descriptive and inferential statistical methods with logistic regression were applied. Overall, there was a significant reduction in the level of exposure, from 58.5% (95%CI: 57.6-59.3) in 2007 to 47.1% (95%CI: 45.4-48.8) in 2014. Of the associated factors, having one or both parents smoking was significantly associated with the highest odds of SHS exposure at home (OR=5.0; 95%CI: 4.2-6.1). Conversely, having a mother with a college or higher education level was found to be a protective factor (OR=0.5; 95%CI: 0.3-0.8).

  10. Patterns and risk factors of inconsistent condom use among men who have sex with men in Viet Nam: Results from an Internet-based cross-sectional survey.

    García, Macarena C; Duong, Quyen L; Mercer, Licelot C Eralte; Meyer, Samantha B; Koppenhaver, Todd; Ward, Paul R


    Survey data from men who have sex with men (MSM) in Asian cities indicate drastic increases in HIV prevalence. It is unknown which factors are most important in driving these epidemics. The objective of this study was to identify patterns of condom use among MSM Internet users living in Viet Nam, as well as risk factors associated with inconsistent condom use and non-condom use. A national Internet-based survey of sexual behaviours was administered in 2011. Results showed that 44.9% of MSM reported not using a condom during their last anal sex encounter with a male partner. MSM were less likely to report condom use during anal sex with long-term partners than with casual partners. Twenty-three and a half per cent of MSM surveyed had ever taken an HIV test and received the results. Study findings highlight the urgent need for targeted strategies focused on increasing the rate of consistent condom use during anal sex with male partners among MSM in Viet Nam.

  11. Using exceedance probabilities to detect anomalies in routinely recorded animal health data, with particular reference to foot-and-mouth disease in Viet Nam.

    Richards, K K; Hazelton, M L; Stevenson, M A; Lockhart, C Y; Pinto, J; Nguyen, L


    The widespread availability of computer hardware and software for recording and storing disease event information means that, in theory, we have the necessary information to carry out detailed analyses of factors influencing the spatial distribution of disease in animal populations. However, the reliability of such analyses depends on data quality, with anomalous records having the potential to introduce significant bias and lead to inappropriate decision making. In this paper we promote the use of exceedance probabilities as a tool for detecting anomalies when applying hierarchical spatio-temporal models to animal health data. We illustrate this methodology through a case study data on outbreaks of foot-and-mouth disease (FMD) in Viet Nam for the period 2006-2008. A flexible binomial logistic regression was employed to model the number of FMD infected communes within each province of the country. Standard analyses of the residuals from this model failed to identify problems, but exceedance probabilities identified provinces in which the number of reported FMD outbreaks was unexpectedly low. This finding is interesting given that these provinces are on major cattle movement pathways through Viet Nam. Copyright © 2014 Elsevier Ltd. All rights reserved.

  12. The context of HIV risk behaviours among HIV-positive injection drug users in Viet Nam: Moving toward effective harm reduction

    Thanh Duong


    Full Text Available Abstract Background Injection drug users represent the largest proportion of all HIV reported cases in Viet Nam. This study aimed to explore the perceptions of risk and risk behaviours among HIV-positive injection drug users, and their experiences related to safe injection and safe sex practices. Methods This study used multiple qualitative methods in data collection including in-depth interviews, focus group discussions and participant observation with HIV-positive injection drug users. Results The informants described a change in the sharing practices among injection drug users towards more precautions and what was considered 'low risk sharing', like sharing among seroconcordant partners and borrowing rather than lending. However risky practices like re-use of injection equipment and 'syringe pulling' i.e. the use of left-over drugs in particular, were frequently described and observed. Needle and syringe distribution programmes were in place but carrying needles and syringes and particularly drugs could result in being arrested and fined. Fear of rejection and of loss of intimacy made disclosure difficult and was perceived as a major obstacle for condom use among recently diagnosed HIV infected individuals. Conclusion HIV-positive injection drug users continue to practice HIV risk behaviours. The anti-drug law and the police crack-down policy appeared as critical factors hampering ongoing prevention efforts with needle and syringe distribution programmes in Viet Nam. Drastic policy measures are needed to reduce the very high HIV prevalence among injection drug users.

  13. Diversity and uses of Zingiberaceae in Nam Nao National Park, Chaiyaphum and Phetchabun provinces, Thailand, with a new record for Thailand

    Surapon Saensouk


    Full Text Available Three tribes, 12 genera and 38 species of the ginger family (Zingiberaceae along five routes in Nam Nao National Park were surveyed between January 2012 and December 2013 to determine their diversity, ecological data, phenology, uses and conservation status. The highest diversity was found in the tribe Zingibereae (6 genera and 21 species, of which the genera Curcuma and Zingiber comprised the highest number species (eight species each. A species key was constructed based on morphology. The ginger family was found in four forest-types—deciduous dipterocarp forest, mixed deciduous forest, dry evergreen forest and pine forest. The most flowering bloom of the ginger family in Nam Nao National Park was during March to August and the most fruiting bloom was during June to September. The popular uses of Zingiberaceae were as a food, spice, in medicine, as ornamentation and in rituals. Eight species have been evaluated as of least concern and are presented in the IUCN Red List, while two rare species were reported in Thailand Red Data: Plants, while six rare Zingiberaceae species were identified based on the evaluation criteria of Saensouk (2011. Four species were endemic to Thailand. Moreover, Etlingera yunnanensis (T. L. Wu & S. J. Chen R. M. Smith was a new record for Thailand.

  14. Growth and population dynamics during early stages of the mangrove Kandelia candel in Halong Bay, North Viet Nam

    Thi Ha, Hoang; Duarte, Carlos M.; Tri, Nguyen Hoang; Terrados, Jorge; Borum, Jens


    Quantifying the dynamics of the early stages in the life cycle of mangroves is essential to predict the distribution, species composition and structure of mangrove forests, and their maintenance and recovery from perturbations. The growth and population dynamics of two stands of the mangrove Kandelia candel in Halong Bay (Viet Nam) were examined for 1 year. Growth was highly seasonal, with high growth rates and fast internode formation in the summer, dropping to extremely low growth during January-February, the coldest and driest months in the year. In addition, growth and internode formation rates showed important inter-annual variability during the last decade. The complete reproductive period required 7-8 months. Flower initiation was maximal in June and peak propagule maturity occurred in December-January. Only one mature propagule developed for every 67 and 127 inflorescence buds formed at Site 1 and Site 2, respectively. Kandelia candel propagules begun to sink 10 days after being released, and after 18 days all propagules had negative buoyancy. The propagules developed roots within 19-68 days, depending on whether they were held on the water or sediment, and were capable of long range dispersal, for 15-20% of them dispersed more than 100 m within 1 day. The median age of K. candel plants ranged between 8.7 and 5.6 years, with a density of 1900 and 470 plants ha -1, in Sites 1 and 2. Plant mortality was high, with 64 and 74% of the plants surviving after a year at Sites 1 and 2. Life expectancy (i.e. median age-at-death) of only 2.2 and 2.7 years at Sites 1 and 2, respectively, indicates that mortality of young K. candel plants was specially high. Recruitment occurred in early spring, and did not suffice to balance the mortality within the annual period examined. These results suggest that the K. candel stands in Halong Bay might be maintained by a few years of high recruitment which would compensate for generally high mortality rates.

  15. Descriptive results of a prospective cohort study of avian influenza in the Mekong River Delta of Viet Nam.

    Nguyen, Long V; Stevenson, M; Schauer, B; Nguyen, D T; Tran, Q D; Tien, T N; Tran, P T T; Jones, G; Prattley, D; Morris, R


    A prospective cohort study of avian influenza infection in poultry flocks was carried out in the Mekong River Delta of Viet Nam between December 2008 and April 2010. Our objectives were to (i) estimate the prevalence and incidence of avian influenza virus infection and (ii) assess the efficacy of H5N1 vaccination programmes as indicated by the presence of H5 antibody in vaccinated and unvaccinated poultry. Real-time PCR and H5 multiplex assays were used to detect the antigen of avian influenza viruses from swab samples. The haemagglutination inhibition test was used to detect H5 antibody. A total of 17 968 swab and 14 878 blood samples were collected from 5476 birds over the study period. The overall incidence rate of influenza type A virus infection was 5 (95% CI 4-7) positive birds per 100 bird-months at risk. The overall incidence rate of H5 virus infection was 0.2 (95% CI 0.1-0.5) positive birds per 100 bird-months at risk. Fifty (95% CI 48-52) birds per 100 tested birds were H5 HI positive in the unvaccinated group compared with 71 (95% CI 69-73) birds per 100 in the vaccinated group. Influenza type A and H5 viruses were circulating in village poultry throughout the study period with no recorded signs of clinical disease. This implies that interventions need to be carried out continuously throughout the year rather than only focusing on the established high-risk periods. Broiler ducks had an incidence rate of influenza H5 virus infection approximately four times greater than that of layer ducks and in-contact species. We conclude that broiler ducks are likely to be the main entry route for H5 virus into poultry flocks in the MRD. Control efforts would benefit from understanding why there is a difference between villages in H5 incidence and developing strategies to provide greater protection to broiler ducks. © 2013 Blackwell Verlag GmbH.

  16. The Text of the Agreement between Viet-Nam and the Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons



    The text of the Agreement between the Republic of Viet-Nam and the Agency for the application of safeguards in connection with the Treaty on the Non-Proliferation of Nuclear Weapons is reproduced in this document for the information of all Members. The Agreement entered into force on 9 January 1974, pursuant to Article 25.

  17. Based on the Materials of IV Scientific Session of the Institute of Gastroenterology of the NAMS of Ukraine «New Technologies in Theoretical and Clinical Gastroenterology»

    I.Yu. Skyrda


    Scientific supervisor of the conference — Yuri M. Stepanov, doctor of Sciences, Professor, honored doctor of Ukraine, Director of SI "Institute gastroenterology of NAMS of Ukraine", head of the Department of gastroenterology and therapy SI "Dnepropetrovsk medical Academy", the Chairman of the Union "Association for the study and treatment of diseases of the digestive system in Ukraine".

  18. Ground subsidence as a result of natural gas exploitation. NAM-fields in Groningen, Friesland and North-Drente. State-of-the-art report 2010 and prognosis up to the year 2070


    Based on present knowledge of and insights a prognosis is given of ground subsidence as a result of natural gas exploration in the title provinces in the Netherlands. The prognosis will be repeated every five years according to an agreement between the province Groningen and the NAM (Dutch Petroleum Company). This is the third prognosis. [nl

  19. Ground subsidence as a result of natural gas exploitation. NAM-fields in Groningen, Friesland and North-Drente. State-of-the-art report 2005 and prognosis up to the year 2050. Summary


    Based on present knowledge of and insights a prognosis is given of ground subsidence as a result of natural gas exploration in the title provinces in the Netherlands. The prognosis will be repeated every five years according to an agreement between the province Groningen and the NAM (Dutch Petroleum Company). This is the second prognosis [nl

  20. The Text of the Agreement between Viet-Nam and the Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons


    The text of the Agreement between the Republic of Viet-Nam and the Agency for the application of safeguards in connection with the Treaty on the Non-Proliferation of Nuclear Weapons is reproduced in this document for the information of all Members. The Agreement entered into force on 9 January 1974, pursuant to Article 25.

  1. Where "Sign Language Studies" Has Led Us in Forty Years: Opening High School and University Education for Deaf People in Viet Nam through Sign Language Analysis, Teaching, and Interpretation

    Woodward, James; Hoa, Nguyen Thi


    This paper discusses how the Nippon Foundation-funded project "Opening University Education to Deaf People in Viet Nam through Sign Language Analysis, Teaching, and Interpretation," also known as the Dong Nai Deaf Education Project, has been implemented through sign language studies from 2000 through 2012. This project has provided deaf…

  2. Potential Impact of the REDD+ Program on Poverty Reduction in Nghe An Province, Vietnam

    Nguyen Dinh Tien


    Full Text Available The REDD+ program provides a mechanism for providing financial rewards to forest owners and users who contribute to the reduction of carbon emissions from deforestation and forest degradation. This paper determines the potential impact of the REDD+ program on poverty reduction by comparing income and poverty rate between two household groups that were willing to participate in this study, but that will not participate in the REDD+. The results showed that carbon payment from forests is a significant contributor to the increase in household income of poor people. The average income of households participating in the program is VND 20.68 million in contrast to those not participating whose average income is VND 14.72 million. Results showed that the REDD+ program intervention helped reduce the poverty rate in the two communes by 6.40% (from 39.4% to 33%. The paper recommends that the REDD+ program should facilitate the distribution of land titles to provide security of tenure for individual households that are participating in the program. While the program can contribute to poverty reduction, the program payments can increase income inequality and conflicts between those involved and those not involved in the program and legal ownership of the lands. In addition, a comprehensive research study on the impact of the program on forest conservation and poverty reduction is necessary. Stakeholders of the program should recognize and acknowledge the trade-offs between conservation and economic development or poverty reduction. A comprehensive trade-off analysis of program implementation and a business-as-usual option of commodity production is needed, which could reveal the indirect economic, political, and social costs and benefits of the program.

  3. Deforestation in Viet Nam

    PO Box 8500, Ottawa, ON, Canada K1G 3H9 ..... Nothing so efficiently reduces the impact of heavy downpours as the thick tropical moist forest. ..... economic growth; an increasing demand for food and export crops; and an increasing demand for ...... 1 210. 359 331. 1 110. Tay-Thai. 108 950. 1 510. 180 028. 1 370. 244 373.

  4. The Volatility of Market Risk In Viet Nam Listed Public Utilities Company Groups during and after the Financial Crisis 2007-2009

    Dinh Tran Ngoc Huy


    Full Text Available This study estimates market risk of total 45 listed companies in Viet Nam public utilities, natural gas and oil industry during the financial crisis period 2007-2009. Firstly, we found out in the research sample that there are 82% of firms, of total listed firms, with beta values lower than ( 1, meaning having stock returns fluctuating more than the market benchmark. Thirdly, among three (3 groups, the systemic risk in the electric power industry is the smallest, shown by estimated values of equity and asset beta mean, and asset beta variance in this industry is also the smallest. Finally, this paper generates some analytical outcomes that enable companies and government to have more evidence in establishing their policies in investments and in governance

  5. Risk factors for the presence of Aedes aegypti and Aedes albopictus in domestic water-holding containers in areas impacted by the Nam Theun 2 hydroelectric project, Laos.

    Hiscox, Alexandra; Kaye, Angela; Vongphayloth, Khamsing; Banks, Ian; Piffer, Michele; Khammanithong, Phasouk; Sananikhom, Pany; Kaul, Surinder; Hill, Nigel; Lindsay, Steven W; Brey, Paul T


    We assessed risk factors for vectors of dengue and chikungunya viruses near a new hydroelectric project, Nam Theun 2, in Laos. Immature stages of Aedes aegypti were found only in sites within 40 km of the urban provincial capital, but Aedes albopictus was found throughout. Aedes aegypti pupae were most common in water storage jars (odds ratio [OR] = 4.72) and tires (OR = 2.99), and Ae. albopictus pupae were associated with tires in 2009 (OR = 10.87) and drums, tires, and jars in 2010 (drums OR = 3.05; tires OR = 3.45, jars OR = 6.59). Compared with water storage vessels, containers used for hygiene, cooking, and drinking were 80% less likely to harbor Ae. albopictus pupae in 2010 (OR = 0.20), and discarded waste was associated with a 3.64 increased odds of infestation. Vector control efforts should focus on source reduction of water storage containers, particularly concrete jars and tires.

  6. Home-Based Care and Perceived Quality of Life Among People Living with HIV in Ho Chi Minh City, Viet Nam.

    Bui, Quyen Thi Tu; Brickley, Deborah Bain; Tieu, Van Thi Thu; Hills, Nancy K


    We conducted a cross-sectional study to examine the perceptions of quality of life among people living with HIV who received home-based care services administered through outpatient clinics in Ho Chi Minh City, Viet Nam. Data were collected from a sample of 180 consecutively selected participants (86 cases, 94 controls) at four outpatient clinics, all of whom were on antiretroviral therapy. Quality of life was evaluated using the WHOQOL-BREF instrument. In adjusted analysis, those who received home-based care services had a quality of life score 4.08 points higher (on a scale of 100) than those who did not receive home-based care services (CI 95%, 2.32-5.85; p < 0.001). The findings suggest that home-based care is associated with higher self-perceptions of quality of life among people living with HIV.

  7. Removal of emulsified and dissolved traces of organic compounds from industrial wastewaters using nature and synthesized (Na A and Nam) zeolites

    Modirshahla, N.; Tabatabaii, S.


    The main object of this study was to compare the natural and synthetic (Na A and Nam) zeolites as absorbents in removing emulsified and dissolved traces of organic compounds, which appear in the wastewater of power plants, refinery and petrochemical complexes. The specific objections of the work was: a) to select the best species that have the highest amount of absorption; b) to measure the rate of absorption of traces organic compounds and emulsions on the natural and synthesized zeolites; c) to establish the absorption isotherms for the organics and emulsions with selected samples; d) to select readily available regenerants, and e ) to examine the ph dependence of the process and to establish a simple and practical method to detect and to measure the pollution after the treatment process. The BOD and COD of the treated and feed waters were compared

  8. Los misioneros salesianos y la polémica sobre la extinción de los Selk’nam de Tierra del Fuego

    María Andrea Nicoletti


    Full Text Available El proceso de extinción de los selk’nam generó una polémica dentro de la congregación de los salesianos alrededor de las causas que suscitaron su desaparición. Por medio de la reducción «Nuestra Señora de la Candelaria» llevada a cabo por monseñor Fagnano en 1893, se puso en marcha un plan de evangelización y «civilización» de los selk’nam. Estos aborígenes buscaban refugio en la reducción ante la persecución y asesinato perpetrados por los estancieros fueguinos. Las acechanzas, el contagio de enfermedades a las que los aborígenes no eran inmunes y el impacto cultural que provocó el sistema de reducciones, contribuyeron a su extinción. Los misioneros salesianos, protagonistas del proceso reduccional, analizaron las causas de la extinción poniendo el acento fundamentalmente en las matanzas de los estancieros y la violencia aplicada por las autoridades estatales, aun admitiendo las ocasionadas por el cambio cultural. La siguiente generación de salesianos, desde el estudio de las fuentes y la construcción de su propia historia, desplazó la causa violenta hacia motivos fisiológicos y culturales, con el fin de no poner en tela de juicio el rol que las familias de estancieros Braun Menéndez y Menéndez Behety, colaboradoras con la obra salesiana, tuvieron en este nefasto proceso.

  9. Prevalence of resistance to second-line tuberculosis drug among multidrug-resistant tuberculosis patients in Viet Nam, 2011.

    Nguyen, Hoa Binh; Nguyen, Nhung Viet; Tran, Huong Thi Giang; Nguyen, Hai Viet; Bui, Quyen Thi Tu


    Extensively drug-resistant tuberculosis (XDR-TB) represents an emerging public health problem worldwide. According to the World Health Organization, an estimated 9.7% of multidrug-resistant TB (MDR-TB) cases are defined as XDR-TB globally. The objective of this study was to determine the prevalence of drug resistance to second-line TB drugs among MDR-TB cases detected in the Fourth National Anti-Tuberculosis Drug Resistance Survey in Viet Nam. Eighty clusters of TB cases were selected using a probability-proportion-to-size approach. To identify MDR-TB cases, drug susceptibility testing (DST) was performed for the four major first-line TB drugs. DST of second-line drugs (ofloxacin, amikacin, kanamycin, capreomycin) was performed on isolates from MDR-TB cases to identify pre-XDR and XDR cases. A total of 1629 smear-positive TB cases were eligible for culture and DST. Of those, DST results for first-line drugs were available for 1312 cases, and 91 (6.9%) had MDR-TB. Second-line DST results were available for 84 of these cases. Of those, 15 cases (17.9%) had ofloxacin resistance and 6.0% were resistant to kanamycin and capreomycin. Five MDR-TB cases (6.0%) met the criteria of XDR-TB. This survey provides the first estimates of the proportion of XDR-TB among MDR-TB cases in Viet Nam and provides important information for local policies regarding second-line DST. Local policies and programmes that are geared towards TB prevention, early diagnosis and treatment with effective regimens are of high importance.

  10. Cigarette Smoking among Adolescents aged 13-15 in Viet Nam and Correlates of Current Cigarette Smoking: Results from GYTS 2014 Data.

    Huong, Le Thi; Vu, Nga Thi Thu; Dung, Nguyen Ngoc; Xuan, Le Thi Thanh; Giang, Kim Bao; Hai, Phan Thi; Huyen, Doan Thu; Khue, Luong Ngoc; Lam, Nguyen Tuan; Minh, Hoang Van; Nga, Pham Thi Quynh


    The aim of this paper is to report the rate of current and ever cigarette smoking and explore correlates of current cigarette smoking among adolescents aged 13-15 in Viet Nam. This analysis was derived from GYTS survey, which comprised of 3,430 adolescents aged 13-15, conducted in 2014 in 13 cities and provinces of Viet Nam. We calculated the weighted rates of current and ever cigarette smoking and reported patterns of smoking behavior. We also performed logistic regression to explore correlates of current cigarette smoking behavior. The weighted rate of ever cigarette smoking was 9.5% (95% confidence interval (CI): 8.5 %-10.5%), in which the weighted rate among males (15.4%; 95% CI: 13.6%-17.0%) was higher than that among females (4.2%; 95% CI: 3.3%-5.1%). The weighted rate of current cigarette smoking was relatively low at 2.5% (95%CI: 2.0%- 3.0%) with higher weighted rate among males (4.9%; 95% CI: 3.8%-5.9%) compared to the corresponding figure among females (0.2%; 95% CI: 0.0 %-0.5%). Current cigarette smoking was significantly higher among males than females, in students aged 15 versus 13 years old, and in students who had several or all close friends smoking and students with daily observation of smoking at school. For greater smoking reduction outcomes, we recommend that tobacco interventions for adolescents should consider targeting more male students at older ages, establish stricter adherence to school-based banning of cigarette smoking, engage both smoking and nonsmoking adolescents and empower adolescents to resist peer smoking influence as well as changing their norms or beliefs towards smoking benefits.

  11. Shared epitopes of glycoprotein A and protein 4.1 defined by antibody NaM10-3C10.

    Rasamoelisolo, M; Czerwinski, M; Willem, C; Blanchard, D


    We have produced the murine monoclonal antibody (MAb) NaM70-3C10 (IgM) from splenocytes of mice immunized with human red blood cells (RBCs). The MAb agglutinated untreated as well as trypsin, chymotrypsin, neuraminidase, or ficin-treated RBCs from controls. In contrast, control RBCs treated with papaine or bromelaine were not agglutinated. On immunoblots, the MAb bound to glycophorin A (GPA) and to a 80 kDa protein identified as protein 4.1. Analysis by agglutination of variant RBCs carrying hybrid glycophorins made of the N-terminus (amino acids 1-58) of GPA and of the C-terminus (amino acids 27-72) of glycophorin B (GPB) and competition-inhibition test using purified GPA and a synthetic peptide corresponding to the amino acid sequence 48-58 of GPA demonstrated that the epitope is located within residues 48-58 of GPA. Epitope analysis with immobilized peptides showed that the MAb recognizes the sequence 53Pro-Pro-Glu-Glu-GIu58 of GPA. A homologous sequence is also present within amino acids 395 to 405 of protein 4.1. Finally, the MAb bound to 16 kDa chymotryptic peptide of protein 4.1, which carries the above amino acid sequence. In conclusion, it may be assumed that NaM70-3C10 specifically recognizes a common epitope on the extracellular domain of GPA and on the intracellular protein 4.1; this specificity explains the persistence of the 80 kDa band on blots when RBCs are treated with papain.

  12. Protocol Additional to the Agreement between the Socialist Republic of Viet Nam and the International Atomic Energy Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons


    The text of the Protocol Additional to the Agreement between the Socialist Republic of Viet Nam and the International Atomic Energy Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons is reproduced in this document for the information of all Members. The Board of Governors approved the Additional Protocol on 6 March 2007. It was signed on 10 August 2007 in Vienna, Austria. Pursuant to Article 17 of the Additional Protocol, the Protocol entered into force on 17 September 2012, the date on which the Agency received from the Socialist Republic of Viet Nam written notification that Vietnam's statutory and constitutional requirements for entry into force had been met [fr

  13. Protocol Additional to the Agreement between the Socialist Republic of Viet Nam and the International Atomic Energy Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons


    The text of the Protocol Additional to the Agreement between the Socialist Republic of Viet Nam and the International Atomic Energy Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons is reproduced in this document for the information of all Members. The Board of Governors approved the Additional Protocol on 6 March 2007. It was signed on 10 August 2007 in Vienna, Austria. Pursuant to Article 17 of the Additional Protocol, the Protocol entered into force on 17 September 2012, the date on which the Agency received from the Socialist Republic of Viet Nam written notification that Vietnam's statutory and constitutional requirements for entry into force had been met

  14. Protocol Additional to the Agreement between the Socialist Republic of Viet Nam and the International Atomic Energy Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons


    The text of the Protocol Additional to the Agreement between the Socialist Republic of Viet Nam and the International Atomic Energy Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons is reproduced in this document for the information of all Members. The Board of Governors approved the Additional Protocol on 6 March 2007. It was signed on 10 August 2007 in Vienna, Austria. Pursuant to Article 17 of the Additional Protocol, the Protocol entered into force on 17 September 2012, the date on which the Agency received from the Socialist Republic of Viet Nam written notification that Vietnam's statutory and constitutional requirements for entry into force had been met [es

  15. Agreement of 2 October 1989 between the Socialist Republic of Viet Nam and the International Atomic Energy Agency for the application of safeguards in connection with the Treaty on the Non-Proliferation of Nuclear Weapons


    The document contains two parts. The first part stipulates the agreement of Viet Nam to accept safeguards on all source or special fissionable material in all peaceful nuclear activities within its territory, under its jurisdiction or carried out under its control anywhere, for the exclusive purpose of verifying that such material is not diverted to nuclear weapons or other nuclear explosive devices. The second part specifies the procedures to be applied in the implementation of the safeguards provisions of Part I

  16. Carbon dioxide emissions from the flat bottom and shallow Nam Theun 2 Reservoir: drawdown area as a neglected pathway to the atmosphere

    Deshmukh, Chandrashekhar; Guérin, Frédéric; Vongkhamsao, Axay; Pighini, Sylvie; Oudone, Phetdala; Sopraseuth, Saysoulinthone; Godon, Arnaud; Rode, Wanidaporn; Guédant, Pierre; Oliva, Priscia; Audry, Stéphane; Zouiten, Cyril; Galy-Lacaux, Corinne; Robain, Henri; Ribolzi, Olivier; Kansal, Arun; Chanudet, Vincent; Descloux, Stéphane; Serça, Dominique


    Freshwater reservoirs are a significant source of CO2 to the atmosphere. CO2 is known to be emitted at the reservoir surface by diffusion at the air-water interface and downstream of dams or powerhouses by degassing and along the river course. In this study, we quantified total CO2 emissions from the Nam Theun 2 Reservoir (Lao PDR) in the Mekong River watershed. The study started in May 2009, less than a year after flooding and just a few months after the maximum level was first reached and lasted until the end of 2013. We tested the hypothesis that soils from the drawdown area would be a significant contributor to the total CO2 emissions.Total inorganic carbon, dissolved and particulate organic carbon and CO2 concentrations were measured in 4 pristine rivers of the Nam Theun watershed, at 9 stations in the reservoir (vertical profiles) and at 16 stations downstream of the monomictic reservoir on a weekly to monthly basis. CO2 bubbling was estimated during five field campaigns between 2009 and 2011 and on a weekly monitoring, covering water depths ranging from 0.4 to 16 m and various types of flooded ecosystems in 2012 and 2013. Three field campaigns in 2010, 2011 and 2013 were dedicated to the soils description in 21 plots and the quantification of soil CO2 emissions from the drawdown area. On this basis, we calculated total CO2 emissions from the reservoir and carbon inputs from the tributaries. We confirm the importance of the flooded stock of organic matter as a source of carbon (C) fuelling emissions. We show that the drawdown area contributes, depending on the year, from 40 to 75 % of total annual gross emissions in this flat and shallow reservoir. Since the CO2 emissions from the drawdown zone are almost constant throughout the years, the large interannual variations result from the significant decrease in diffusive fluxes and downstream emissions between 2010 and 2013. This overlooked pathway in terms of gross emissions would require an in-depth evaluation

  17. High-resolution OSL chronology of a sediment core from Lake Nam Co on the southern Tibetan Plateau: Comparison with radiocarbon dating

    Long, Hao; Shen, Ji; Haberzettl, Torsten; Fuchs, Markus; Frechen, Manfred; Wang, Junbo


    Numerous studies on lake sediment cores from the Tibetan Plateau aimed to reconstruct spatial and temporal changes of the late Glacial and Holocene monsoon variations, which are characterized by fluctuations in precipitation and expansion of monsoonal air masses across the Plateau. Accurate and reliable dating of lacustrine deposits is of crucial importance in both the reconstruction of palaeolake and palaeoclimate evolution and the understanding of the mechanisms for climate changes, especially abrupt changes of regional-hemispheric hydrological circulation. Radiocarbon dating is the most commonly used method for establishing chronologies of lake sediments. However, 14C dating of such sediments could be problematic due to the lack of organic matter or a reservoir effect, which appears common in radiocarbon dating of lacustrine sediments from the Tibetan Plateau. In this study, ca. 10.5 m long core (NC core) was retrieved from the water depth of 93 m at Nam Co Lake, which is the second largest saline lake in China, located on the southern Tibetan Plateau. For this core, high-resolution samples (23 samples) were obtained for optically stimulated luminescence (OSL) dating. Quartz of fine-grain (4-11 μm) fraction were extracted from this samples for OSL dating, which is compared with the 14C chronology of NC core based on accelerator mass spectrometry (AMS) dating of bulk organic matter of 22 samples. The sample from the top of NC core was dated to approximate zero age, indicating the sediments bleached well before deposition. Luminescence behaviors of the study samples further confirmed the robustness of OSL ages. Comparison between OSL and 14C ages suggested that: (1) two kinds of ages are in agreement within error from top to 1.8 m, (2) from 1.8 m to the base of NC core, the 14C ages show a general trend to ca. 4 ka higher ages than the OSL ages. Although 14C dating overestimate the ages from 1.8 m to base, they still show the general trend in sedimentation rate

  18. Carbon dioxide emissions from the flat bottom and shallow Nam Theun 2 Reservoir: drawdown area as a neglected pathway to the atmosphere

    C. Deshmukh


    Full Text Available Freshwater reservoirs are a significant source of CO2 to the atmosphere. CO2 is known to be emitted at the reservoir surface by diffusion at the air–water interface and downstream of dams or powerhouses by degassing and along the river course. In this study, we quantified total CO2 emissions from the Nam Theun 2 Reservoir (Lao PDR in the Mekong River watershed. The study started in May 2009, less than a year after flooding and just a few months after the maximum level was first reached and lasted until the end of 2013. We tested the hypothesis that soils from the drawdown area would be a significant contributor to the total CO2 emissions.Total inorganic carbon, dissolved and particulate organic carbon and CO2 concentrations were measured in 4 pristine rivers of the Nam Theun watershed, at 9 stations in the reservoir (vertical profiles and at 16 stations downstream of the monomictic reservoir on a weekly to monthly basis. CO2 bubbling was estimated during five field campaigns between 2009 and 2011 and on a weekly monitoring, covering water depths ranging from 0.4 to 16 m and various types of flooded ecosystems in 2012 and 2013. Three field campaigns in 2010, 2011 and 2013 were dedicated to the soils description in 21 plots and the quantification of soil CO2 emissions from the drawdown area. On this basis, we calculated total CO2 emissions from the reservoir and carbon inputs from the tributaries. We confirm the importance of the flooded stock of organic matter as a source of carbon (C fuelling emissions. We show that the drawdown area contributes, depending on the year, from 40 to 75 % of total annual gross emissions in this flat and shallow reservoir. Since the CO2 emissions from the drawdown zone are almost constant throughout the years, the large interannual variations result from the significant decrease in diffusive fluxes and downstream emissions between 2010 and 2013. This overlooked pathway in terms of gross emissions would require

  19. Bērnu ar uzvedības traucējumiem problēmu risinājums bērnu namā

    Degterjova, Ella


    Izvēlētā diplomdarba tēma ir „Bērnu ar uzvedības traucējumiem problēmu risinājums bērnu namā”. Izvirzītais diplomdarba mērķis ir pētīt uzvedības traucējumu problēmu risināšanas veidus ilgstošās sociālās aprūpes un sociālās rehabilitācijas institūcijās dzīvojošiem bērniem ar uzvedības traucējumiem. Diplomdarbs sastāv no četrām darba nodaļām. Pirmajā nodaļā ir teorētiski analizēti bērnu uzvedības traucējumu veidi un bērnu uzvedības traucējumu jēdziens. Otrajā nodaļā autore analizē bērnu uz...

  20. Estuarine Turbidity Maxima and Variations of Aggregate Parameters in the Cam-Nam Trieu Estuary, North Vietnam, in Early Wet Season

    Vu Duy Vinh


    Full Text Available This study aims at exploring the characteristic parameters of the Estuarine Turbidity Maxima (ETM and at investigating their tidal variations within the Cam-Nam Trieu estuary (North Vietnam during the early wet season. Six longitudinal river transects were performed at spring tide. Two types of ETM were observed: an upper well mixed ETM with high Suspended Particulate Matter (SPM concentrations up to the surface at low salinity (0.11 to <1 psu, and a lower ETM confined in a bottom layer over stratified waters at salinities between ~1 psu and 15 psu. Their length depended on the longitudinal salinity gradient and was highest at low tide than at high tide. D50 of the flocs varied between 35 and 90 μm, their excess of density between 60 and 300 kg m−3 and their settling velocity ranged from 0.07 to 0.55 mm s−1 with values between 0.12 and 0.40 mm s−1 in the core of ETMs. The average fractal dimension of flocs was estimated to vary between 1.93 (at high tide to 2.04 (at low tide.

  1. Physiological changes in pre-harvest dropped fruits in the pummelo cultivars ‘Thong Dee’ and ‘Khao Nam Phueng’

    Pongnart Nartvaranant


    Full Text Available This investigation of physiological changes in pummelo pre-harvest dropped fruit, termed “yellow fruit calyx symptoms” in Thailand, aimed to examine in two particular cultivars Thong Dee and Khao Nam Phueng grown in the central regionof Thailand. The results show that the normal pummelo fruits of either variety had statistically more total non-structuralcarbohydrate (TNC in their peel and pulp than did those of the dropped fruits. On the other hand, the leaves of normal fruittrees of both cultivars show less TNC than those found in the leaves of pre-harvest dropped fruit trees. There were significantdifferences in some plant nutrients in the leaves, peel and pulp of the dropped and normal pummelo cultivars. IAA concentration in fruit was determined with the result that normal fruits had a statistically higher IAA concentration than did those inpre-harvest dropped fruits. The PCR technique used for the greening disease test identified infections in leaves taken fromthe pre-harvest dropped fruit trees but none in leaves from the normal fruit trees. There were no differences in soil chemicalproperties between soil samples taken from the normal and pre-harvest dropped fruit trees. It seems likely that greeningdisease is the cause of ‘yellow fruit calyx symptom’ in Thailand and is the resulting from low TNC concentrations, low plantnutrients and low IAA concentrations in the pre-harvest dropped fruits in the pummelo cultivars.

  2. Veselības aprūpes iemaņas pusaudžiem bērnu namā

    Zūpe, Daira


    Pētniecības darbā „Veselības aprūpes iemaņas pusaudžiem bērnu namā” autore Daira Zūpe izpēta un analizē vienu no bērnu namu aktuālajām problēmām veselības profilakses veicināšanā – veselības aprūpes iemaņu attīstīšanu. Pētījumā uzmanība pievērsta māsas lomai bērnu nama pusaudžu veselības aprūpes procesā, kur akcentēta veselības aprūpes pamatiemaņu nozīme veselības vecināšanā - fiziskās aktivitātes, ēšanas paradumi, kaitīgie ieradumi un higiēnas iemaņas. Pētniecības darba zinātniskā vadītā...

  3. Simulating the Impact of Future Land Use and Climate Change on Soil Erosion and Deposition in the Mae Nam Nan Sub-Catchment, Thailand

    Nitin Kumar Tripathi


    Full Text Available This paper evaluates the possible impacts of climate change and land use change and its combined effects on soil loss and net soil loss (erosion and deposition in the Mae Nam Nan sub-catchment, Thailand. Future climate from two general circulation models (GCMs and a regional circulation model (RCM consisting of HadCM3, NCAR CSSM3 and PRECIS RCM ware downscaled using a delta change approach. Cellular Automata/Markov (CA_Markov model was used to characterize future land use. Soil loss modeling using Revised Universal Soil Loss Equation (RUSLE and sedimentation modeling in Idrisi software were employed to estimate soil loss and net soil loss under direct impact (climate change, indirect impact (land use change and full range of impact (climate and land use change to generate results at a 10 year interval between 2020 and 2040. Results indicate that soil erosion and deposition increase or decrease, depending on which climate and land use scenarios are considered. The potential for climate change to increase soil loss rate, soil erosion and deposition in future periods was established, whereas considerable decreases in erosion are projected when land use is increased from baseline periods. The combined climate and land use change analysis revealed that land use planning could be adopted to mitigate soil erosion and deposition in the future, in conjunction with the projected direct impact of climate change.

  4. Senescence-associated barley NAC (NAM, ATAF1,2, CUC) transcription factor interacts with radical-induced cell death 1 through a disordered regulatory domain

    Kjaersgaard, Trine; Jensen, Michael K; Christiansen, Michael W


    as a transcriptional activator suggesting that an involvement of HvNAC013 and HvNAC005 in senescence will be different. HvNAC013 interacted with barley radical-induced cell death 1 (RCD1) via the very C-terminal part of its TRD, outside of the region containing the LP motif. No significant secondary structure...... (NAM, ATAF1,2, CUC) TF family are up-regulated during senescence in barley (Hordeum vulgare). Both HvNAC005 and HvNAC013 bound the conserved NAC DNA target sequence. Computational and biophysical analyses showed that both proteins are intrinsically disordered in their large C-terminal domains, which...... was induced in the HvNAC013 TRD upon interaction with RCD1. RCD1 also interacted with regions dominated by intrinsic disorder in TFs of the MYB and basic helix-loop-helix families. We propose that RCD1 is a regulatory protein capable of interacting with many different TFs by exploiting their intrinsic...

  5. The harmony of family and the silence of women: sexual attitudes and practices among rural married women in northern Viet Nam.

    Ha, Vu Song


    Women in Viet Nam have long had to face various sexual and reproductive health problems, ranging from abortion to reproductive tract infections (RTIs) and sexual coercion. These issues have increasingly been addressed by scholars in the fields of public health and social sciences through sexual and reproductive health research and in other ways. Despite this, there remains a lack of in-depth information on attitudes and practices regarding sex and sexuality of Vietnamese women today. This paper in part responds to the knowledge gap by reporting on findings from qualitative research on sexual attitudes and practices among rural married women in a Northern rural community, measured against the broader social and cultural context. Twenty-five women in total were interviewed; and two focus group discussions were conducted. The findings show that women generally believe that men are (or should be) the initiators in sexual relations. Many women feel reluctant to refuse sex to their husbands or communicate openly about sex and sexuality. However, this paper also demonstrates that women are not totally passive in sexual relations. Women in this study used a range of strategies to negotiate their sexual life, and sometimes 'silence' is used as a form of agency in order to maintain harmony and happiness within the family.

  6. Turbulent flux modelling with a simple 2-layer soil model and extrapolated surface temperature applied at Nam Co Lake basin on the Tibetan Plateau

    T. Gerken


    Full Text Available This paper introduces a surface model with two soil-layers for use in a high-resolution circulation model that has been modified with an extrapolated surface temperature, to be used for the calculation of turbulent fluxes. A quadratic temperature profile based on the layer mean and base temperature is assumed in each layer and extended to the surface. The model is tested at two sites on the Tibetan Plateau near Nam Co Lake during four days during the 2009 Monsoon season. In comparison to a two-layer model without explicit surface temperature estimate, there is a greatly reduced delay in diurnal flux cycles and the modelled surface temperature is much closer to observations. Comparison with a SVAT model and eddy covariance measurements shows an overall reasonable model performance based on RMSD and cross correlation comparisons between the modified and original model. A potential limitation of the model is the need for careful initialisation of the initial soil temperature profile, that requires field measurements. We show that the modified model is capable of reproducing fluxes of similar magnitudes and dynamics when compared to more complex methods chosen as a reference.

  7. Evaluation of the integrated clinic model for HIV/AIDS services in Ho Chi Minh City, Viet Nam, 2013-2014.

    Hung, V; Nguyen, S T; Tieu, V T T; Nguyen, T T T; Duong, T H; Lyss, S; Oeltmann, J E


    Setting: Ho Chi Minh City (HCMC), Viet Nam. Objective: To evaluate a new integrated service model for human immunodeficiency virus/acquired immune-deficiency syndrome (HIV/AIDS) care. Design: In HCMC, co-located services, including voluntary HIV counseling and testing (VCT), HIV treatment at out-patient clinics (OPC), and methadone maintenance therapy (MMT) for persons who inject drugs, have operated under different administrative structures. In the context of decreasing international financial support, integration of these services into one administrative structure with reduced staff occurred in seven districts in HCMC between October 2013 and June 2014. We used a pre-post study design to compare service-related outcomes from routinely collected data at health facilities 6 months before and 6 months after integration. Results: The proportion of HIV-infected persons linked from VCT to OPCs was unchanged or increased following integration. A higher percentage of patients eligible for antiretroviral therapy (ART) were started on ART. The proportion of ART patients lost to follow-up remained unchanged. The proportions of MMT patients who tested positive for heroin or other substances decreased or were unchanged. Conclusions: VCT, OPC and MMT service delivery quality remained the same or improved during the 6 months following the integration. Expansion of the integrated model should be considered for HIV-related services.

  8. The use of public participation and economic appraisal for public involvement in large-scale hydropower projects: Case study of the Nam Theun 2 Hydropower Project

    Mirumachi, Naho; Torriti, Jacopo


    Gaining public acceptance is one of the main issues with large-scale low-carbon projects such as hydropower development. It has been recommended by the World Commission on Dams that to gain public acceptance, public involvement is necessary in the decision-making process (). As financially-significant actors in the planning and implementation of large-scale hydropower projects in developing country contexts, the paper examines the ways in which public involvement may be influenced by international financial institutions. Using the case study of the Nam Theun 2 Hydropower Project in Laos, the paper analyses how public involvement facilitated by the Asian Development Bank had a bearing on procedural and distributional justice. The paper analyses the extent of public participation and the assessment of full social and environmental costs of the project in the Cost-Benefit Analysis conducted during the project appraisal stage. It is argued that while efforts were made to involve the public, there were several factors that influenced procedural and distributional justice: the late contribution of the Asian Development Bank in the project appraisal stage; and the issue of non-market values and discount rate to calculate the full social and environmental costs. - Highlights: ► Public acceptance in large-scale hydropower projects is examined. ► Both procedural and distributional justice are important for public acceptance. ► International Financial Institutions can influence the level of public involvement. ► Public involvement benefits consideration of non-market values and discount rates.

  9. Report of year 2000 version on feasibility study. Feasibility study on the diffusion of fluidized bed cement kiln system in Socialist Republic of Viet Nam



    Evaluations were given on the possibility of saving energies and reducing CO2 emission by renewing the shaft kilns operated in four factories in Viet Nam into fluidized bed kilns. The feasibility study is intended to be linked to the clean development mechanism (CDM) in the future. The fluidized bed kiln is a most advanced technology developed to deal with social, economic and technological demands such as global environment preservation, energy conservation, effective utilization of resources, enhancement of economic performance, and diversification of cement needs. The technology is capable of largely reducing greenhouse effect gases, eliminating the problem of dust scattering from sintering facilities, producing stabilized and high-quality clinker, making possible of using inexpensive fuels including low-order coal, using less installation space, and reducing the production cost. The amount of energy reduction in all of the four factories is calculated 8,101 to 9,551 toe/year at an energy saving effect rate of 37 to 44%. CO2 emission is reduced as a result of reduction in fuel for sintering furnaces and in electric power consumption. The reduction amount would be 24,393 to 38,794 tons/year (converted into CO2), and the reduction effect rate would be 36 to 44%. The investment effect looks sufficient as payout of 10 to 12 years if the environment special Yen loan is used. Trial calculation was also performed for the nation-wide proliferation effect. (NEDO)

  10. Physical and chemical properties of Nam Prig Noom, a Thai green-chili paste, following ultra-high pressure and thermal processes

    Apichartsrangkoon, Arunee; Srisajjalertwaja, Siriwan; Chaikham, Pittaya; Hirun, Sathira


    A study of processing green-chili pastes (Nam Prig Noom) by pressurization (100-600 MPa/30-50°C/20 min), pasteurization (90°C/3-5 min) or sterilization (121°C/4 min), subsequently, their physical, biochemical and microbiological qualities as well as the sensory acceptance were assessed. It was found that pressure at low levels (100-300 MPa) could improve activities of enzyme peroxidase (POD), polyphenoloxidase (PPO) and lypoxygenase (LOX) in the chili paste by more than 100%, while pressures above 500 or 300 MPa combined with heat would significantly inactivate these enzyme activities. Both color parameters and enzyme activities illustrated that though some enzymatic browning occurred with the pressurized products indicated by b* (yellowish) parameter, the magnitude of these browning was still milder than those thermally treated products indicated by-a* (greenness) and L (lightness) parameters, presumably as a consequence of the Maillard reaction. Moreover, the sensory scores were found in accordance with color parameters, firmness and capsaicin contents.

  11. Community-based intervention for depression management at the primary care level in Ha Nam Province, Vietnam: a cluster-randomised controlled trial.

    Niemi, Maria; Kiel, Simone; Allebeck, Peter; Hoan, Le Thi


    To evaluate the effectiveness of an intervention including psychoeducation and yoga for depression management at the primary healthcare level in one district in the Hà Nam province, Vietnam. The Patient Health Questionnaire-9 (PHQ-9) was used for depression screening and follow-up. Screened patients were further diagnosed with the Mini-International Neuropsychiatric Diagnostic Interview, by a trained general doctor. A linear regression model, adjusted for age, gender and baseline PHQ-9 score was used to assess whether the intervention leads to decreased depression severity compared to standard care in the control communes. Both groups had similar PHQ-9 scores at baseline. The intervention group had on average significantly lower PHQ-9 scores after the intervention than the control group. Almost half of the patients in the intervention group recovered from depression, whereas nobody did in the control group. The results indicate that the intervention can be more effective than standard care in treating depression. The mean change of the PHQ-9 score after the intervention is deemed to be of clinical relevance. © 2016 John Wiley & Sons Ltd.

  12. Collision-induced basalt eruptions at Pleiku and Buôn Mê Thuột, south-central Viet Nam

    Hoàng, Nguyễn; Flower, Martin F. J.; Chí, Cung Thu'ọ'ng; Xuân, Phạm Tích; Quý, Hoàng Văn; Sơn, Trần Thanh


    Neogene-Quaternary basalts occur as dispersed volcanic clusters in the vicinity of the Tethyan tectonic belt, possibly representing 'far-field' effects of the Early Tertiary collisions of Gondwana fragments with the southern margin of Eurasia. In Indochina, such a 'Diffuse Igneous Province' post-dates the 45-42 Ma 'hard' India-Asia collision and southeastward, collision induced (c. 30-17 Ma.), extrusion of Indochina. Extrusion was accommodated by left-lateral strike-slip shearing on the Ailao Shan-Red River Fault, coeval with seafloor spreading in the East Viet Nam (South China) Sea. The Indochina basalts mostly comprise shield-building tholeiites capped by small-volume undersaturated types, the latter often bearing mantle xenoliths and 'exotic' xenocrysts such as sapphire, zircon. They appeared at c. 17 Ma, more-or-less coinciding with the cessation of both continental extrusion and seafloor spreading. At this point extensional stress appears to have shifted westwards to continental Indochina, with magmatic activity appearing, characteristically, at 'pull-apart' basins. However, the relationship of mantle melting beneath this region to its geodynamic setting is controversial, being variously attributed to mantle plumes, extreme lithospheric stretching, and lateral asthenospheric displacement. There is little or no definitive evidence for regional mantle upwelling while lithosphere stretching alone appears to be insufficient to allow for melting, Here, we present geochemical and Sr, Nd, and Pb isotopic (and paleomagnetic data), for cored sections from the Pleiku and Buon Mê Thuột plateaus in south-central Viet Nam, representative in most respects of the Indochina province as a whole. In the Pleiku shield olivine tholeiite flows are intercalated with quartz tholeiites while, in contrast, alkali basalts predominate over olivine tholeiite in the Buon Mê Thuột (BMT) shield. The first of these features (in Pleiku) probably reflects crustal wall-rock reaction while

  13. Dengue virus in sub-tropical northern and central Viet Nam: population immunity and climate shape patterns of viral invasion and maintenance.

    Maia A Rabaa

    Full Text Available Dengue virus transmission occurs in both epidemic and endemic cycles across tropical and sub-tropical regions of the world. Incidence is particularly high in much of Southeast Asia, where hyperendemic transmission plagues both urban and rural populations. However, endemicity has not been established in some areas with climates that may not support year-round viral transmission. An understanding of how dengue viruses (DENV enter these environments and whether the viruses persist in inapparent local transmission cycles is central to understanding how dengue emerges in areas at the margins of endemic transmission. Dengue is highly endemic in tropical southern Vietnam, while increasingly large seasonal epidemics have occurred in northern Viet Nam over the last decade. We have investigated the spread of DENV-1 throughout Vietnam to determine the routes by which the virus enters northern and central regions of the country. Phylogeographic analysis of 1,765 envelope (E gene sequences from Southeast Asia revealed frequent movement of DENV between neighboring human populations and strong local clustering of viral lineages. Long-distance migration of DENV between human population centers also occurred regularly and on short time-scales, indicating human-mediated viral invasion into northern Vietnam. Human populations in southern Vietnam were found to be the primary source of DENV circulating throughout the country, while central and northern Vietnam acted as sink populations, likely due to reduced connectedness to other populations in the case of the central regions and to the influence of temperature variability on DENV replication and vector survival and competence in the north. Finally, phylogeographic analyses suggested that viral movement follows a gravity model and indicates that population immunity and physical and economic connections between populations may play important roles in shaping patterns of DENV transmission.

  14. Knowledge and Attitude Towards Tobacco Smoking among 13-15 Year-Old School Children in Viet Nam - Findings from GYTS 2014.

    Huong, Nguyen Thanh; Kien, Nguyen Trung; Giang, Kim Bao; Minh, Hoang Van; Hai, Phan Thi; Huyen, Doan Thu; Khue, Luong Ngoc; Linh, Nguyen Thuy; Lam, Nguyen Tuan; Nga, Pham Thi Quynh


    Studies have shown that smoking is a learnt behavior, often initiated during adolescence. This paper aims to describe tobacco-related knowledge, attitude and associations among school adolescents aged 13-15 with exposure to anti-smoking information. Using data from the Global Youth Tobacco Survey (GYTS) in Viet Nam, 2014, knowledge was measured through 4 questions about tobacco use, and attitude was assessed through 3 questions on personal, social and environmental aspects. Students giving most anti-tobacco responses to all questions were considered as having correct knowledge or appropriate attitude or both. Access to anti-smoking information was determined by exposure to any media messages on tobacco control during the past 30 days and teaching in school about the danger of tobacco use during the past 12 months. A substantial percentage of students thought that being near others who smoke might be harmful to them and smoking is harmful to health (89.4% and 89.6% respectively). However, only 46.4% reported that it is definitely difficult to quit smoking and 66.9% thought that smoking for only 1 or 2 years, once stopped, is harmful to health. Slightly more than half of the respondents reported appropriate attitude that young smokers have fewer friends than others and smoking makes them less attractive and less comfortable at social events. Noticing anti-smoking messages in the media together with having lessons in school about the dangers of tobacco substantially increased the likelihood of having correct knowledge, appropriate attitude and both. Despite relatively high awareness about smoking harms, effective educational communication is still highly needed to improve the level of comprehensive knowledge and an appropriate attitude regarding tobacco use.

  15. Genome-wide analysis and identification of stress-responsive genes of the NAM-ATAF1,2-CUC2 transcription factor family in apple.

    Su, Hongyan; Zhang, Shizhong; Yuan, Xiaowei; Chen, Changtian; Wang, Xiao-Fei; Hao, Yu-Jin


    NAC (NAM, ATAF1,2, and CUC2) proteins constitute one of the largest families of plant-specific transcription factors. To date, little is known about the NAC genes in the apple (Malus domestica). In this study, a total of 180 NAC genes were identified in the apple genome and were phylogenetically clustered into six groups (I-VI) with the NAC genes from Arabidopsis and rice. The predicted apple NAC genes were distributed across all of 17 chromosomes at various densities. Additionally, the gene structure and motif compositions of the apple NAC genes were analyzed. Moreover, the expression of 29 selected apple NAC genes was analyzed in different tissues and under different abiotic stress conditions. All of the selected genes, with the exception of four genes, were expressed in at least one of the tissues tested, which indicates that the NAC genes are involved in various aspects of the physiological and developmental processes of the apple. Encouragingly, 17 of the selected genes were found to respond to one or more of the abiotic stress treatments, and these 17 genes included not only the expected 7 genes that were clustered with the well-known stress-related marker genes in group IV but also 10 genes located in other subgroups, none of which contains members that have been reported to be stress-related. To the best of our knowledge, this report describes the first genome-wide analysis of the apple NAC gene family, and the results should provide valuable information for understanding the classification and putative functions of this family. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

  16. Arsenic and other trace elements in groundwater and human urine in Ha Nam province, the Northern Vietnam: contamination characteristics and risk assessment.

    Pham, Long Hai; Nguyen, Hue Thi; Van Tran, Cuong; Nguyen, Ha Manh; Nguyen, Tung Hoang; Tu, Minh Binh


    The contamination characteristics of arsenic and other trace elements in groundwater and the potential risks of arsenic from the groundwater were investigated. Elevated contamination of arsenic, barium and manganese was observed in tube-well water of two villages (Chuyen Ngoai and Chau Giang) in Ha Nam province in the Northern Vietnam. Concentrations of As in the groundwater ranged from 12.8 to 884 µg/L with mean values in Chuyen Ngoai and Chau Giang were 614.7 and 160.1 µg/L, respectively. About 83 % of these samples contained As concentrations exceeding WHO drinking water guideline of 10 μg/L. The mean values of Mn and Ba in groundwater from Chuyen Ngoai and Chau Giang were 300 and 657 μg/L and 650 and 468 μg/L, respectively. The mean value of Ba concentration in groundwater in both Chuyen Ngoai and Chau Giang was about 22 % of the samples exceeded the WHO guideline (700 µg/L). Arsenic concentrations in human urine of residents from Chuyen Ngoai and Chau Giang were the range from 8.6 to 458 µg/L. The mean values of Mn and Ba in human urine of local people from Chuyen Ngoai were 46.9 and 62.8 μg/L, respectively, while those in people from Chau Giang were 25.9 and 45.9 μg/L, respectively. The average daily dose from ingesting arsenic for consuming both untreated and treated groundwater is from 0.02 to 11.5 and 0.003 to 1.6 μg/kg day, respectively. Approximately, 57 % of the families using treated groundwater and 64 % of the families using untreated groundwater could be affected by elevated arsenic exposure.

  17. Petrochemistry and zircon U-Pb geochronology of granitic rocks in the Wang Nam Khiao area, Nakhon Ratchasima, Thailand: Implications for petrogenesis and tectonic setting

    Fanka, Alongkot; Tsunogae, Toshiaki; Daorerk, Veerote; Tsutsumi, Yukiyasu; Takamura, Yusuke; Sutthirat, Chakkaphan


    Carboniferous biotite granite, Late Permian hornblende granite, and Triassic biotite-hornblende granite, all of which belong to the Eastern Granite Belt, expose in the Wang Nam Khiao area, Nakhon Ratchasima, northeastern Thailand. The Carboniferous biotite granite is dominated by quartz, K-feldspar, plagioclase, and biotite. The Late Permian hornblende granite contains dominant assemblages of plagioclase, quartz, K-feldspar, hornblende, and minor amount of biotite, while the Triassic biotite-hornblende granite consists of quartz, plagioclase, K-feldspar with small amounts of biotite, and hornblende. The REE patterns with steep decrease from light to heavy REE together with the LILE (e.g. K, Sr) enrichment and depletion of some particular HFSE (e.g. Nb, Ti) indicate low degree of partial melting. Mineral chemistry of biotite and hornblende in the granites reflects crystallization from hydrous calc-alkaline arc-derived magmas possibly formed by subduction. Amphibole-plagioclase thermometry and Al-in-hornblende barometry indicate that the Late Permian hornblende granite and the Triassic biotite-hornblende granite may have equilibrated at 3.0-5.8 kbar/700-820 °C and 2.0-3.2 kbar/600-750 °C, respectively, in the middle-upper crust (about 10-15 km depth). Zircon U-Pb geochronology of the Carboniferous biotite granite, Late Permian hornblende granite and Triassic biotite-hornblende granite yielded intrusion ages of 314.6-284.9 Ma, 253.4 Ma, and 237.8 Ma, respectively, which implies multiple episodes of arc-magmatism formed by Palaeo-Tethys subduction beneath Indochina Terrane during Late Carboniferous/Early Permian, Late Permian and Middle Triassic.

  18. Polymorphism of Plasmodium falciparum Na+/H+ exchanger is indicative of a low in vitro quinine susceptibility in isolates from Viet Nam

    Thanh Nguyen


    Full Text Available Abstract Background The Plasmodium falciparum NA+/H+ exchanger (pfnhe1, gene PF13_0019 has recently been proposed to influence quinine (QN susceptibility. However, its contribution to QN resistance seems to vary geographically depending on the genetic background of the parasites. Here, the role of this gene was investigated in in vitro QN susceptibility of isolates from Viet Nam. Method Ninety-eight isolates were obtained from three different regions of the Binh Phuoc and Dak Nong bordering Cambodia provinces during 2006-2008. Among these, 79 were identified as monoclonal infection and were genotyped at the microsatellite pfnhe1 ms4760 locus and in vitro QN sensitivity data were obtained for 51 isolates. Parasite growth was assessed in the field using the HRP2 immunodetection assay. Results Significant associations were found between polymorphisms at pfnhe1 microsatellite ms4760 and susceptibility to QN. Isolates with two or more DNNND exhibited much lower susceptibility to QN than those harbouring zero or one DNNND repeats (median IC50 of 682 nM versus median IC50 of 300 nM; p = 0.0146 while isolates with one NHNDNHNNDDD repeat presented significantly reduced QN susceptibility than those who had two (median IC50 of 704 nM versus median IC50 of 375 nM; p pfcrt76T and wild-type pfmdr1 (> 95% thus preventing analysis of associations with these mutations. Interestingly, area with the highest median QN IC50 showed also the highest percentage of isolates carrying the pfnhe1 haplotype 7. Conclusions The haplotype 7 which is the typical Asian profile is likely well-adapted to high drug pressure in this area and may constitute a good genetic marker to evaluate the dissemination of QNR in this part of the world.

  19. Characterizing the relationship between temperature and mortality in tropical and subtropical cities: a distributed lag non-linear model analysis in Hue, Viet Nam, 2009-2013.

    Dang, Tran Ngoc; Seposo, Xerxes T; Duc, Nguyen Huu Chau; Thang, Tran Binh; An, Do Dang; Hang, Lai Thi Minh; Long, Tran Thanh; Loan, Bui Thi Hong; Honda, Yasushi


    The relationship between temperature and mortality has been found to be U-, V-, or J-shaped in developed temperate countries; however, in developing tropical/subtropical cities, it remains unclear. Our goal was to investigate the relationship between temperature and mortality in Hue, a subtropical city in Viet Nam. We collected daily mortality data from the Vietnamese A6 mortality reporting system for 6,214 deceased persons between 2009 and 2013. A distributed lag non-linear model was used to examine the temperature effects on all-cause and cause-specific mortality by assuming negative binomial distribution for count data. We developed an objective-oriented model selection with four steps following the Akaike information criterion (AIC) rule (i.e. a smaller AIC value indicates a better model). High temperature-related mortality was more strongly associated with short lags, whereas low temperature-related mortality was more strongly associated with long lags. The low temperatures increased risk in all-category mortality compared to high temperatures. We observed elevated temperature-mortality risk in vulnerable groups: elderly people (high temperature effect, relative risk [RR]=1.42, 95% confidence interval [CI]=1.11-1.83; low temperature effect, RR=2.0, 95% CI=1.13-3.52), females (low temperature effect, RR=2.19, 95% CI=1.14-4.21), people with respiratory disease (high temperature effect, RR=2.45, 95% CI=0.91-6.63), and those with cardiovascular disease (high temperature effect, RR=1.6, 95% CI=1.15-2.22; low temperature effect, RR=1.99, 95% CI=0.92-4.28). In Hue, the temperature significantly increased the risk of mortality, especially in vulnerable groups (i.e. elderly, female, people with respiratory and cardiovascular diseases). These findings may provide a foundation for developing adequate policies to address the effects of temperature on health in Hue City.

  20. Identification of entomopathogenic nematodes and symbiotic bacteria from Nam Nao National Park in Thailand and larvicidal activity of symbiotic bacteria against Aedes aegypti and Aedes albopictus.

    Yooyangket, Temsiri; Muangpat, Paramaporn; Polseela, Raxsina; Tandhavanant, Sarunporn; Thanwisai, Aunchalee; Vitta, Apichat


    Entomopathogenic nematodes (EPNs) that are symbiotically associated with Xenorhabdus and Photorhabdus bacteria can kill target insects via direct infection and toxin action. There are limited reports identifying such organisms in the National Park of Thailand. Therefore, the objectives of this study were to identify EPNs and symbiotic bacteria from Nam Nao National Park, Phetchabun Province, Thailand and to evaluate the larvicidal activity of bacteria against Aedes aegypti and Ae. albopictus. A total of 12 EPN isolates belonging to Steinernema and Heterorhabditis were obtained form 940 soil samples between February 2014 and July 2016. EPNs were molecularly identified as S. websteri (10 isolates) and H. baujardi (2 isolates). Symbiotic bacteria were isolated from EPNs and molecularly identified as P. luminescens subsp. akhurstii (13 isolates), X. stockiae (11 isolates), X. vietnamensis (2 isolates) and X. japonica (1 isolate). For the bioassay, bacterial suspensions were evaluated for toxicity against third to early fourth instar larvae of Aedes spp. The larvae of both Aedes species were orally susceptible to symbiotic bacteria. The highest larval mortality of Ae. aegypti was 99% after exposure to X. stockiae (bNN112.3_TH) at 96 h, and the highest mortality of Ae. albopictus was 98% after exposure to P. luminescens subsp. akhurstii (bNN121.4_TH) at 96 h. In contrast to the control groups (Escherichia coli and distilled water), the mortality rate of both mosquito larvae ranged between 0 and 7% at 72 h. Here, we report the first observation of X. vietnamensis in Thailand. Additionally, we report the first observation of P. luminescens subsp. akhurstii associated with H. baujardi in Thailand. X. stockiae has potential to be a biocontrol agent for mosquitoes. This investigation provides a survey of the basic diversity of EPNs and symbiotic bacteria in the National Park of Thailand, and it is a bacterial resource for further studies of bioactive compounds.

  1. Preharvest bagging with wavelength-selective materials enhances development and quality of mango (Mangifera indica L.) cv. Nam Dok Mai #4.

    Chonhenchob, Vanee; Kamhangwong, Damrongpol; Kruenate, Jittiporn; Khongrat, Krittaphat; Tangchantra, Nantavat; Wichai, Uthai; Singh, S Paul


    Preharvest bagging has been shown to improve development and quality of fruits. Different light transmittance bags showed different effects on fruit quality. This study presents the benefits of using newly developed plastic bagging materials with different wavelength-selective characteristics for mangoes (cv. Nam Dok Mai #4). Mangoes were bagged at 45 days after full bloom (DAFB) and randomly harvested at 65, 75, 85, 95, and 105 DAFB. The bags were removed on the harvest days. The wavelength-selective bags (no pigment, yellow, red, blue/violet, blue) were compared with the Kraft paper bag with black paper liner, which is currently used commercially for several fruits, and with non-bagging as a control. Bagging significantly (p⩽0.05) reduced diseases and blemishes. Mango weight at 95 DAFB was increased approximately 15% by VM and V plastic bagging, as compared to paper bagging and control. Plastic bagging accelerated mango ripening as well as growth. Plastic-bagged mangoes reached maturity stage at 95 DAFB, while non-bagged mangoes reached maturity stage at 105 DAFB. Paper bagging resulted in a pale-yellow peel beginning at 65 DAFB, while plastic bagging improved peel glossiness. Preharvest bagging with different wavelength-selective materials affected mango development and quality. Bagging mangoes with VM and V materials could reduce peel defects and diseases, increase weight, size, and sphericity, improve peel appearance, and shorten the development periods of mangoes. The results suggest a favorable practice using the newly developed VM and V plastic bags in the production of mangoes, and possibly other fruits as well. Copyright © 2010 Society of Chemical Industry.

  2. VU6010608, a Novel mGlu7 NAM from a Series of N-(2-(1H-1,2,4-Triazol-1-yl)-5-(trifluoromethoxy)phenyl)benzamides.

    Reed, Carson W; McGowan, Kevin M; Spearing, Paul K; Stansley, Branden J; Roenfanz, Hanna F; Engers, Darren W; Rodriguez, Alice L; Engelberg, Eileen M; Luscombe, Vincent B; Loch, Matthew T; Remke, Daniel H; Rook, Jerri M; Blobaum, Anna L; Conn, P Jeffrey; Niswender, Colleen M; Lindsley, Craig W


    Herein, we report the structure-activity relationships within a series of mGlu 7 NAMs based on an N -(2-(1 H -1,2,4-triazol-1-yl)-5-(trifluoromethoxy)phenyl)benzamide core with excellent CNS penetration ( K p 1.9-5.8 and K p,uu 0.4-1.4). Analogues in this series displayed steep SAR. Of these, VU6010608 ( 11a ) emerged with robust efficacy in blocking high frequency stimulated long-term potentiation in electrophysiology studies.

  3. Exploration drilling and ecology. A contribution to the MER (Environmental Effect Report) of the NAM (Netherlands Petroleum Company) for the benefit of exploration drilling for natural gas in the Waddenzee and the North Sea coastal area

    Dankers, N.; Wintermans, G.J.M.


    Within the framework of the title drilling activities the NAM carries out a MER. Several research institutes were asked to contribute to the MER. The authors' institute was asked to describe the ecology of the exploration areas in the Wadden Sea, as well as the possible effects of the exploration drilling on the ecology. In this report only the impact for the Wadden Sea is dealt with. In chapter 1 the ecology of the Wadden Sea is discussed in detail for the subjects primary production (photosynthesis), secondary production (consumption of vegetable organic materials), birds, seals, and societal functions. In chapter 2 specific aspects of specific sites are outlined. In chapter 3 an overview (the so-called factor train) is given of the activities around the exploration drilling of the NAM in the Wadden Sea and the disturbances that can be the result of those activities. In chapter 4 the possible effects of exploration drilling on birds and seals are discussed for each drilling site

  4. Lessons learned from implementation of a demonstration program to reduce the burden of anemia and hookworm in women in Yen Bai Province, Viet Nam

    Thach Tran D


    Full Text Available Abstract Background Iron deficiency, anemia and hookworm disease are important public health problems for women of reproductive age living in developing countries and affect the health of newborns and infants. Iron supplementation and deworming treatment are effective in addressing these problems in both pregnant and non-pregnant women. Daily iron supplementation and deworming after the first trimester is recommended for pregnant women although these programs usually do not operate efficiently or effectively. Weekly iron-folic acid supplementation and regular deworming for non-pregnant women may be a viable approach for improving iron status and preventing anemia during the reproductive years. Addressing these diseases at a population level before women become pregnant could significantly improve women's health before and during pregnancy, as well as their infants' growth and development. Methods and Results This paper describes the major processes undertaken in a demonstration intervention of preventive weekly iron-folic acid supplementation with regular deworming for all 52,000 women aged 15–45 years in two districts of Yen Bai province, in northern Viet Nam. The intervention strategy included extensive consultation with community leaders and village, commune, district and provincial health staff, and training for village health workers. Distribution of the drugs was integrated with the existing health service infrastructure and the village health workers were the direct point of contact with women. Iron-folic acid tablets and deworming treatment were provided free of charge from May 2006. An independent Vietnamese NGO was commissioned to evaluate compliance and identify potential problems. The program resulted in effective distribution of iron-folic acid tablets and deworming treatment to all villages in the target districts, with full or partial compliance of 85%. Conclusion Training for health staff, the strong commitment of all partners

  5. Estimation of soil respiration using automated chamber systems in an oak (Quercus mongolica) forest at the Nam-San site in Seoul, Korea.

    Joo, Seung Jin; Park, Soon-Ung; Park, Moon-Soo; Lee, Chang Seok


    Soil respiration (R(soil)) is the largest component of ecosystem respiration produced by the autotrophic and heterotrophic respirations. Its variability on multiple time scales strongly depends on environmental variables such as temperature and moisture. To investigate the temporal variations of R(soil) in a cool-temperate oak (Quercus mongolica) forest at the Nam-San site in Seoul, Korea, continuous measurements of R(soil) using the automated chamber systems, air and soil temperatures and soil moisture are made for the period from April 2010 to March 2011. The observed data indicate that the R(soil) shows a remarkable seasonal variation in accordance with temperatures with high in summer and low in winter. The R(soil) is found to be strongly correlated with soil temperature (T(s)) at the 5cm depth throughout the year. However, the high fluctuation of R(soil) is found to be related with soil moisture content (M(s)) during the forest growing season. The estimated annual Q(10) value using the 1.5m-high air temperature is found to be 2.4 that is comparable with other studies in temperate forest ecosystems. The optimal regression equation of R(soil) with the T(s) at 5cm depth and the M(s) at 15cm depth is found to be R(soil)=124.3 exp (0.097T(s))-55.3 (M(s))(2)+2931.9 (M(s))-38516 for T(s)≥0°C and R(soil)=0 for T(s)soil). The annual total soil respiration estimated by the optimal regression equation is found to be 1264gCm(-2) with a maximum of 685gCm(-2) in the summer season and a minimum of 33gCm(-2) in the winter season. The present study can be implemented for the determination of the carbon balance of a cool-temperate Q. mongolica forest with the provision of photosynthesis. Copyright © 2011 Elsevier B.V. All rights reserved.

  6. Characterizing the relationship between temperature and mortality in tropical and subtropical cities: a distributed lag non-linear model analysis in Hue, Viet Nam, 2009–2013

    Dang, Tran Ngoc; Seposo, Xerxes T.; Duc, Nguyen Huu Chau; Thang, Tran Binh; An, Do Dang; Hang, Lai Thi Minh; Long, Tran Thanh; Loan, Bui Thi Hong; Honda, Yasushi


    Background The relationship between temperature and mortality has been found to be U-, V-, or J-shaped in developed temperate countries; however, in developing tropical/subtropical cities, it remains unclear. Objectives Our goal was to investigate the relationship between temperature and mortality in Hue, a subtropical city in Viet Nam. Design We collected daily mortality data from the Vietnamese A6 mortality reporting system for 6,214 deceased persons between 2009 and 2013. A distributed lag non-linear model was used to examine the temperature effects on all-cause and cause-specific mortality by assuming negative binomial distribution for count data. We developed an objective-oriented model selection with four steps following the Akaike information criterion (AIC) rule (i.e. a smaller AIC value indicates a better model). Results High temperature-related mortality was more strongly associated with short lags, whereas low temperature-related mortality was more strongly associated with long lags. The low temperatures increased risk in all-category mortality compared to high temperatures. We observed elevated temperature-mortality risk in vulnerable groups: elderly people (high temperature effect, relative risk [RR]=1.42, 95% confidence interval [CI]=1.11–1.83; low temperature effect, RR=2.0, 95% CI=1.13–3.52), females (low temperature effect, RR=2.19, 95% CI=1.14–4.21), people with respiratory disease (high temperature effect, RR=2.45, 95% CI=0.91–6.63), and those with cardiovascular disease (high temperature effect, RR=1.6, 95% CI=1.15–2.22; low temperature effect, RR=1.99, 95% CI=0.92–4.28). Conclusions In Hue, the temperature significantly increased the risk of mortality, especially in vulnerable groups (i.e. elderly, female, people with respiratory and cardiovascular diseases). These findings may provide a foundation for developing adequate policies to address the effects of temperature on health in Hue City. PMID:26781954

  7. Characterizing the relationship between temperature and mortality in tropical and subtropical cities: a distributed lag non-linear model analysis in Hue, Viet Nam, 2009–2013

    Tran Ngoc Dang


    Full Text Available Background: The relationship between temperature and mortality has been found to be U-, V-, or J-shaped in developed temperate countries; however, in developing tropical/subtropical cities, it remains unclear. Objectives: Our goal was to investigate the relationship between temperature and mortality in Hue, a subtropical city in Viet Nam. Design: We collected daily mortality data from the Vietnamese A6 mortality reporting system for 6,214 deceased persons between 2009 and 2013. A distributed lag non-linear model was used to examine the temperature effects on all-cause and cause-specific mortality by assuming negative binomial distribution for count data. We developed an objective-oriented model selection with four steps following the Akaike information criterion (AIC rule (i.e. a smaller AIC value indicates a better model. Results: High temperature-related mortality was more strongly associated with short lags, whereas low temperature-related mortality was more strongly associated with long lags. The low temperatures increased risk in all-category mortality compared to high temperatures. We observed elevated temperature-mortality risk in vulnerable groups: elderly people (high temperature effect, relative risk [RR]=1.42, 95% confidence interval [CI]=1.11–1.83; low temperature effect, RR=2.0, 95% CI=1.13–3.52, females (low temperature effect, RR=2.19, 95% CI=1.14–4.21, people with respiratory disease (high temperature effect, RR=2.45, 95% CI=0.91–6.63, and those with cardiovascular disease (high temperature effect, RR=1.6, 95% CI=1.15–2.22; low temperature effect, RR=1.99, 95% CI=0.92–4.28. Conclusions: In Hue, the temperature significantly increased the risk of mortality, especially in vulnerable groups (i.e. elderly, female, people with respiratory and cardiovascular diseases. These findings may provide a foundation for developing adequate policies to address the effects of temperature on health in Hue City.

  8. Review of monograph of Doctor of Medicine, Professor Prokopov V.O. «Drinking water of Ukraine: medical-ecologic and sanitary-hygiene aspects» edited by Doctor of Medicine, Academician of NAMS of Ukraine A.M. Serdiuk. – K.: Academic Press «Medicine», 2016.

    Shevchenko, O. A.


    Review of monograph of Doctor ofMedicine, Professor Prokopov V.O. «Drinking water ofUkraine: medical-ecologic and sanitary-hygiene aspects»edited by Doctor of Medicine, Academician of NAMS ofUkraine A.M. Serdiuk. – K.: Academic Press «Medicine»,2016. – 400 p.

  9. Radiation accident in Viet Nam

    Wheatley, J.


    In November 1992 a Vietnamese research physicist was working with a microtron accelerator when he received a radiation overexposure that required the subsequent amputation of his right hand. A team from the International Atomic Energy Agency visited Hanoi in March 1993 to carry out an investigation. It was concluded that the accident occurred primarily due to a lack of safety systems although the lack of both written procedures and training in basic radiation safety were also major contributors. (author)

  10. Biomass Business Opportunities Viet Nam

    Zwebe, D [SNV Netherlands Development Organisation, Ha Noi (Viet Nam)


    The goal of this survey is to provide a more specific and integral perspective in which niches, relevant policy development by the Vietnamese government, legislation and sustainability criteria are clearly addressed to benefit both the Dutch Private sector as well as to stimulate Dutch-Vietnamese cooperation and support the Vietnamese government in its search for tangible options to develop the desired enabling environment for a sustainable biomass/biofuel market. The following activities are defined to be executed to reach the goal of the project: Biomass availability in Vietnam (Chapter 2); Government of Vietnam and Energy (Chapter 3); The opportunities and barriers to enter the market in Vietnam (Chapter 4 and 5); Stakeholder analysis of the bio-energy sector (Chapter 6); and Recommendations (Chapter 7)

  11. First simultaneous measurements of peroxyacetyl nitrate (PAN and ozone at Nam Co in the central Tibetan Plateau: impacts from the PBL evolution and transport processes

    X. Xu


    Full Text Available Both peroxyacetyl nitrate (PAN and ozone (O3 are key photochemical products in the atmosphere. Most of the previous in situ observations of both gases have been made in polluted regions and at low-altitude sites. Here we present the first simultaneous measurements of PAN and O3 at Nam Co (NMC; 30°46′ N, 90°57′ E, 4745 m a.s.l., a remote site in the central Tibetan Plateau (TP. The observations were made during summer periods in 2011 and 2012. The PAN levels averaged 0.36 ppb (range: 0.11–0.76 ppb and 0.44 ppb (range: 0.21–0.99 ppb during 17–24 August 2011 and 15 May to 13 July 2012, respectively. The O3 level varied from 27.9 to 96.4 ppb, with an average of 60.0 ppb. Profound diurnal cycles of PAN and O3 were observed with minimum values around 05:00 LT, steep rises in the early morning, and broader platforms of high values during 09:00–20:00 LT. The evolution of the planetary boundary layer (PBL played a key role in shaping the diurnal patterns of both gases, particularly the rapid increases of PAN and O3 in the early morning. Air entrainment from the free troposphere into the PBL seemed to cause the early-morning increase and be a key factor for sustaining the daytime high concentrations of both gases. The days with higher daytime PBL (about 3 km showed stronger diurnal variations in both gases and were mainly distributed in the drier pre-monsoon period, while those with shallower daytime PBL (about 2 km showed minor diurnal variations and were mainly distributed in the humid monsoon period. Episodes of higher PAN levels were occasionally observed at NMC. These PAN episodes were caused either by rapid downward transport of air masses from the middle/upper troposphere or by long-range transport of PAN plumes from north India, north Pakistan, and Nepal. The maximum PAN level in the downward transport cases ranged from 0.5 to 0.7 ppb. In the long-range transport case, the PAN level varied in the

  12. First simultaneous measurements of peroxyacetyl nitrate (PAN) and ozone at Nam Co in the central Tibetan Plateau: impacts from the PBL evolution and transport processes

    Xu, Xiaobin; Zhang, Hualong; Lin, Weili; Wang, Ying; Xu, Wanyun; Jia, Shihui


    Both peroxyacetyl nitrate (PAN) and ozone (O3) are key photochemical products in the atmosphere. Most of the previous in situ observations of both gases have been made in polluted regions and at low-altitude sites. Here we present the first simultaneous measurements of PAN and O3 at Nam Co (NMC; 30°46' N, 90°57' E, 4745 m a.s.l.), a remote site in the central Tibetan Plateau (TP). The observations were made during summer periods in 2011 and 2012. The PAN levels averaged 0.36 ppb (range: 0.11-0.76 ppb) and 0.44 ppb (range: 0.21-0.99 ppb) during 17-24 August 2011 and 15 May to 13 July 2012, respectively. The O3 level varied from 27.9 to 96.4 ppb, with an average of 60.0 ppb. Profound diurnal cycles of PAN and O3 were observed with minimum values around 05:00 LT, steep rises in the early morning, and broader platforms of high values during 09:00-20:00 LT. The evolution of the planetary boundary layer (PBL) played a key role in shaping the diurnal patterns of both gases, particularly the rapid increases of PAN and O3 in the early morning. Air entrainment from the free troposphere into the PBL seemed to cause the early-morning increase and be a key factor for sustaining the daytime high concentrations of both gases. The days with higher daytime PBL (about 3 km) showed stronger diurnal variations in both gases and were mainly distributed in the drier pre-monsoon period, while those with shallower daytime PBL (about 2 km) showed minor diurnal variations and were mainly distributed in the humid monsoon period. Episodes of higher PAN levels were occasionally observed at NMC. These PAN episodes were caused either by rapid downward transport of air masses from the middle/upper troposphere or by long-range transport of PAN plumes from north India, north Pakistan, and Nepal. The maximum PAN level in the downward transport cases ranged from 0.5 to 0.7 ppb. In the long-range transport case, the PAN level varied in the range of 0.3-1.0 ppb, with an average of 0.6 ppb. This long

  13. Do canopy disturbances drive forest plantations into more natural conditions? — A case study from Can Gio Biosphere Reserve, Viet Nam

    Vogt, Juliane; Kautz, Markus; Fontalvo Herazo, Martha Liliana; Triet, Tran; Walther, Denny; Saint-Paul, Ulrich; Diele, Karen; Berger, Uta


    Large areas of mangrove forests were devastated in South Viet Nam during the second Indochina war. After its end in 1975, extensive reforestation with monocultures took place. Can Gio, one of the biggest replanted sites with about 20,000 ha of mangroves mainly Rhizophora apiculata, was declared a biosphere reserve by the UNESCO in 2000. Although this status now enables progressive forest dynamics, there are still drawbacks resulting from the unnatural character of the plantations. For example, the homogeneous size and age structure as well as the regular arrangement of the planted trees make larger forest stands more vulnerable to synchronized collapsing which can be triggered by stronger winds and storms. A transformation into a more natural forest characterized by a heterogeneous age and size structure and a mixed species composition is of urgent need to avoid a synchronized dieback. In this study we test the capability of natural canopy disturbances (e.g. lightning strikes) to facilitate this transformation.Canopy gaps created by lightning strikes were detected and quantified by remote sensing techniques. SPOT satellite images from the years 2003, 2005 and 2007 provided information about the spatial distribution, size, shape, and formation frequency of the gaps. Lightning strike gaps were identified based on their shape and size. They form small openings (mean: 0.025 ha) and their yearly probability of occurrence was determined to be approximately 0.012 per hectare. Selected gaps were surveyed in the field in 2008 to complement the remote sensing data and to provide information upon forest structure and regeneration.Simulation experiments were carried out with the individual-based KiWi mangrove model for quantifying the influence of different lightning regimes on the vertical and horizontal structure of the R. apiculata plantation. In addition, we conducted simulations with a natural and thus randomly generated forest to compare the structure of the two

  14. French Policies towards the Chinese in Vietnam Les politiques françaises envers les Chinois du Viêt Nam : études des migrations et des réponses du colonisateur

    Ramses Amer


    Full Text Available This study examines the patterns of Chinese migration to and from Vietnam as well as the demographic changes relating to the Chinese residing in the country. It also outlines how the French authorities responded to the arrival of the Chinese and how they treated them. The focus is on the period of French control over the whole of Vietnam from 1883 to 1954. The French authorities did pay considerable attention to the Chinese migration to Vietnam. The policies of the French aimed at keeping a close surveillance on the Chinese. To administer the Chinese communities the French opted to maintain the system of indirect control introduced by the Vietnamese Emperors. During the period of French rule the Chinese population grew considerably. Chinese migration to and from Vietnam was influenced by the political evolution in China and by repercussions of international economic developments. Thus, the French authorities could influence the migrants when they arrived or departed, but the decision to migrate was primarily due to other factors.Cette étude examine les modèles de la migration chinoise à destination et en provenance du Viêt Nam de même que les changements démographiques concernant les Chinois résidant dans le pays. Elle précise également les réponses des autorités françaises à l’arrivée des Chinois et le traitement qui leur était réservé. Elle traite tout spécialement la période du contrôle français sur le Viêt Nam de 1883 à 1954. Car les autorités françaises ont porté un intérêt considérable à la migration des Chinois au Viêt Nam. La politique française consistait à surveiller de près les Chinois. Pour l’administration des communautés chinoises les Français ont choisi de conserver le système de contrôle indirect mis en place par les empereurs vietnamiens. La population chinoise connut une croissance considérable pendant la période française. La migration vers et depuis le Viêt Nam était influenc

  15. DYNAMIQUES PAYSAGÈRES ET GUERRE DANS LA PROVINCE DE THUA THIÊN HUÊ (VIÊT NAM CENTRAL), 1954-2007 - Entre défoliation, déforestation et reconquêtes végétales

    Robert, Amélie


    The Viêt Nam war put the forest at the heart of military stakes. The controversies over the environmental consequences of herbicide spraying inspire the hypothesis that the impacts of this practice are differential according to landscape units, worsened by the human disturbances prior to and after the war. Coming under biogeography, the geohistorical analysis compares sources, that are often divergent, and favors primary ones to reconstruct, at key dates, the landscapes of a province at the h...

  16. Situation of the Kinh poor and minority women and their use of the Maternal Care and Family Planning Service in Nam Dong Mountainous District, Thuathien-Hue Province, Vietnam.

    Vo Van, T; Hoat, L N; Jan van Schie, T


    This study aimed to determine the barriers to the use of maternal care and family planning (MCFP) services by the disadvantaged Kinh people and Katu ethnic minority people in the remote and mountainous area of Nam Dong District in Central Vietnam. A survey was conducted using a random sample of 420 mothers with at least one child under the age of 5 years. These data were supplemented by interviews with key informants, focus group discussions and observations. Many barriers were identified. The difficulty of the terrain made travel to healthcare centers difficult. The cost of treatment was a barrier for the poorest people. The quality of the services and facilities, as well as the management of these services was perceived to be unsatisfactory. Traditional practices were often described as being contrary to the doctor's advice, and were presented as the reason for unsafe and unassisted home deliveries. Communication was difficult because of the minority languages of the client groups, the prevalence of illiteracy, and the absence of mass communication in this region. Finally, consulting a male healthcare worker was reported to bring the women shame. There is an urgent need for the MCFP services to build both clinical capacity and health promotion activities in a way that is gender sensitive, cognisant of traditional practices and accessible by both illiterate and minority language speaking people.

  17. Control of aedes vectors of dengue in three provinces of Vietnam by use of Mesocyclops (Copepoda) and community-based methods validated by entomologic, clinical, and serological surveillance.

    Kay, Brian H; Nam, Vu Sinh; Tien, Tran Van; Yen, Nguyen Thi; Phong, Tran Vu; Diep, Vu Thi Bich; Ninh, Truong Uyen; Bektas, Ahmet; Aaskov, John G


    We describe remarkable success in controlling dengue vectors, Aedes aegypti (L.) and Aedes albopictus (Skuse), in 6 communes with 11,675 households and 49,647 people in the northern provinces of Haiphong, Hung Yen, and Nam Dinh in Vietnam. The communes were selected for high-frequency use of large outdoor concrete tanks and wells. These were found to be the source of 49.6-98.4% of Ae. aegypti larvae, which were amenable to treatment with local Mesocyclops, mainly M. woutersi Van der Velde, M. aspericornis (Daday) and M. thermocyclopoides Harada. Knowledge, attitude, and practice surveys were performed to determine whether the communities viewed dengue and dengue hemorrhagic fever as a serious health threat; to determine their knowledge of the etiology, attitudes, and practices regarding control methods including Mesocyclops; and to determine their receptivity to various information methods. On the basis of the knowledge, attitude, and practice data, the community-based dengue control program comprised a system of local leaders, health volunteer teachers, and schoolchildren, supported by health professionals. Recycling of discards for economic gain was enhanced, where appropriate, and this, plus 37 clean-up campaigns, removed small containers unsuitable for Mesocyclops treatment. A previously successful eradication at Phan Boi village (Hung Yen province) was extended to 7 other villages forming Di Su commune (1,750 households) in the current study. Complete control was also achieved in Nghia Hiep (Hung Yen province) and in Xuan Phong (Nam Dinh province); control efficacy was > or = 99.7% in the other 3 communes (Lac Vien in Haiphong, Nghia Dong, and Xuan Kien in Nam Dinh). Although tanks and wells were the key container types of Ae. aegypti productivity, discarded materials were the source of 51% of the standing crop of Ae. albopictus. Aedes albopictus larvae were eliminated from the 3 Nam Dinh communes, and 86-98% control was achieved in the other 3 communes

  18. Namık Kemal’in Sanat/Sanatçı Algısında Romantizm ve Victor Hugo Etkisi Influence of Romanticism and Victor Hugo on Namık Kemal’s Perception of Art/Artist

    Abdulhalim AYDIN


    ağdaşlaşma, yenilenme ihtiyacıyla yüzünü Batı’ya çevirdiği bir yapılanma dönemidir. Tanzimat edebiyatı da bu sürecin edebi tarafını oluşturmuştur. Dönemin diğer yazarları gibi bu edebiyatın en büyük simalarından N. Kemal’in üzerinde de romantizmin ve özellikle Hugo’nun etkilerinin büyük boyutlarda olduğu bilinen bir şeydir. Hugo’nun şiirlerini de okumakla beraber tiyatroları ve romanlarına daha büyük ilgi duyan N. Kemal’de bu ilginin sonuçları kendini göstermekte gecikmez. Eserlerinde, büyük bir Hugo hayranlığı sonucu, romantizmin ve şefinin etkileri aslında artık herkesin bildiği “Hernani-Zavallı Çocuk” ve “Cromwell Önsözü-Celaleddin Önsözü” ile sınırlı değildir. Ama bu çalışmada asıl üzerinde durmak istediğimiz şey, N. Kemal’in sanat ve sanatçı algısında romantizm ve Hugo’nun etki veya katkısının mahiyetidir. Klasik okulun akılcılığı, kuralcılığı ve hitapta benimsediği seçkinciliğine karşı bir devrim gerçekleştiren romantik okulla, edebiyatı geniş bir perspektife yaymakla beraber bir tezin savunulması (litterature engagée biçiminde de algılayan Hugo’nun yazarımız üzerindeki etki ve/ya yönlendirmelerin ne kadar etkin olduğu çalışmamızın cevabını bulmaya çalıştığı temel soru olacaktır. Çalışmada da üzerinde durduğumuz gibi, esasen Hugo tarzı sanat ve edebiyat yapma biçimi Namık Kemal’in edebiyattan beklentilerine büyük ölçüde uyuyordu. Ne de olsa o da Hugo gibi, kemal de yeni bir toplum oluşturmada sanat ve edebiyatın büyük rolüne inanıyordu. Bu bağlamda, “Realizme ve temsilcilerine yönelseydi acaba bu gün karşımızda yine aynı Kemal’i bulur muyduk? Kemal’in gür halkçı sesiyle romantik bireyciliği nasıl bağdaştırmalı?” gibi sorular çalışmada bizi meşgul edecek sorulardır.

  19. Access to Anti-smoking Information among School Children and its Potential Impact on Preventing Smoking Initiation: Results from the Global Youth Tobacco Use Survey (GYTS) 2014 in Viet Nam.

    Minh, Hoang Van; Minh, Hoang Van; Giang, Kim Bao; Hai, Phan Thi; Hoang, Trinh Dinh; Huyen, Doan Thu; Khue, Luong Ngoc; Linh, Nguyen Thuy; Lam, Nguyen Tuan; Nga, Pham Thi Quynh


    Scientific evidence on all aspects of smoking amongst youth is very important for designing appropriate interventions to reduce smoking among this vulnerable population. This paper describes current access to antismoking information among school children aged 13 to 15 years in Vietnam in 2014 and examines its potential impact on preventing smoking initiation. The data used in this paper were obtained from the 2014 Global Youth Tobacco Survey (GYTS) in Vietnam. Students were asked questions about their level of awareness of anti-smoking information from various sources in the past 30 days and about lessons in school regarding the dangers of tobacco use during the last 12 months. Those who have never smoked were asked "whether or not they thought about avoiding cigarettes because of health warnings on cigarette packages" and answers were analyzed in combination with data on access to anti-smoking information from other sources. The prevalence of exposure to antismoking campaigns was high among school children in Viet Nam: 55.3% of current smokers reported thoughts of smoking cessation because of health warnings on cigarette packages; 60.5% of never smokers avoided initiating smoking because of the same health warnings. The potential impact of graphic health warnings to prevent school-aged children from smoking initiation would be stronger if there was concurrent access to anti-smoking programs on the dangers of tobacco use in schools. However, school education for tobacco prevention and control has not been as strong as expected. A more comprehensive school curriculum on tobacco prevention and control is recommended to reinforce antismoking messages among school children.

  20. Parent-youth communication and concordance between parents and adolescents on reported engagement in social relationships and sexually intimate behaviors in Ha Noi and Khanh Hoa Province, Viet Nam

    Kaljee, Linda M.; Green, Mackenzie; Lerdboon, Porntip; Riel, Rosemary; Pham, Van; Tho, Le Huu; Ha, Nguyen T; Minh, Truong Tan; Li, Xiaoming; Chen, Xinguang; Stanton, Bonita


    Purpose Parent-child communication is associated with positive outcomes for youths’ engagement in sexual behaviors. Limited data are available regarding parent-child communication in transitional countries. We present data from Vietnamese parent-youth dyads on parent reproductive health knowledge, comfort of communication, frequency of talk, and discordancy between youths’ reported and parents’ perceptions for engagement in relationships and sexually intimate behaviors. Methods 185 randomly selected parent-youth dyads in four communes in Ha Noi and Khanh Hoa Province. Descriptive and comparative analysis included chi-square tests, independent samples t-tests, and ANOVA. Linear regression analysis was utilized to assess relationships between parental knowledge, level of comfort, frequency of talk, and discordancy. Results Seventy-six percent of parents and 44% of youth were female. Youth mean age was 17.2 years. For parental “reproductive health knowledge” mean score was 24.74 (SD 3.84: range 15–34). Lower parental reproductive health knowledge was positively associated with lower levels of education [F=2.983, df 184: p=0.014]. Data indicate a linear model in which knowledge is related to “comfort” (β =0.17; p=0.048) and “comfort” to frequency of “talk” (β =0.6; psexual touching (β =0.57; p=0.60). Conclusions Parent and youth in Viet Nam are engaged in limited communication about reproductive health. There is need for more data to assess the impact of these communication patterns on youths’ engagement in sexual behaviors and for development of family-centered interventions to increase parental knowledge and skills for positive communication. PMID:21338898

  1. Effect of low-dose versus higher-dose antenatal iron supplementation on child health outcomes at 36 months of age in Viet Nam: longitudinal follow-up of a cluster randomised controlled trial.

    Hanieh, Sarah; Ha, Tran T; Simpson, Julie A; Braat, Sabine; Thuy, Tran T; Tran, Thach D; King, Janet; Tuan, Tran; Fisher, Jane; Biggs, Beverley-Ann


    Intermittent iron-folic acid supplementation (IFA) is currently recommended for pregnant women in populations where anaemia prevalence among pregnant women is Viet Nam among children of 36 months of age, born to women previously enrolled in a cluster randomised controlled trial of antenatal micronutrient supplementation (daily IFA (60 mg elemental iron) vs twice-weekly IFA (60 mg elemental iron) vs twice-weekly multiple micronutrient (MMN) supplementation (60 mg elemental iron)). Primary outcomes were height-for-age z-scores (HAZ), according to WHO growth standards and cognitive composite scores (Bayley Scales of Infant and Toddler Development, third edition) at 36 months of age. A total of 1017 children born to mothers enrolled in the cluster randomised trial were assessed at 36 months of age. Adjusted mean differences (MDs) in HAZ were -0.14 (95% CI -0.28 to -0.01) and -0.15 (95% CI -0.29 to -0.01) in children born to mothers who received twice-weekly IFA or MMN compared with those who received daily IFA. Children born to mothers who received twice-weekly MMN had lower composite motor scores compared with those who received daily IFA (MD -2.07, 95% CI -4.11 to -0.03). There were no differences in composite cognitive scores in the twice-weekly compared with daily regimens. Low-dose antenatal IFA supplementation (120 mg elemental iron per week) resulted in lower HAZ and motor composite scores in children compared with higher-dose antenatal IFA supplementation (420 mg elemental iron per week). This highlights the importance of adequate iron stores during pregnancy and the need for careful monitoring when lower-dose antenatal iron regimens are used. Australia New Zealand Clinical Trials Registry: 12610000944033.

  2. Application of the Consolidated Framework for Implementation Research to assess factors that may influence implementation of tobacco use treatment guidelines in the Viet Nam public health care delivery system.

    VanDevanter, Nancy; Kumar, Pritika; Nguyen, Nam; Nguyen, Linh; Nguyen, Trang; Stillman, Frances; Weiner, Bryan; Shelley, Donna


    Services to treat tobacco dependence are not readily available to smokers in low-middle income countries (LMICs) where smoking prevalence remains high. We are conducting a cluster randomized controlled trial comparing the effectiveness of two strategies for implementing tobacco use treatment guidelines in 26 community health centers (CHCs) in Viet Nam. Guided by the Consolidated Framework for Implementation Research (CFIR), prior to implementing the trial, we conducted formative research to (1) identify factors that may influence guideline implementation and (2) inform further modifications to the intervention that may be necessary to translate a model of care delivery from a high-income country (HIC) to the local context of a LMIC. We conducted semi-structured qualitative interviews with CHC medical directors, health care providers, and village health workers (VHWs) in eight CHCs (n = 40). Interviews were transcribed verbatim and translated into English. Two qualitative researchers used both deductive (CFIR theory driven) and inductive (open coding) approaches to analysis developed codes and themes relevant to the aims of this study. The interviews explored four out of five CFIR domains (i.e., intervention characteristics, outer setting, inner setting, and individual characteristics) that were relevant to the analysis. Potential facilitators of the intervention included the relative advantage of the intervention compared with current practice (intervention characteristics), awareness of the burden of tobacco use in the population (outer setting), tension for change due to a lack of training and need for skill building and leadership engagement (inner setting), and a strong sense of collective efficacy to provide tobacco cessation services (individual characteristics). Potential barriers included the perception that the intervention was more complex (intervention characteristic) and not necessarily compatible (inner setting) with current workflows and staffing

  3. Viet Nam National Atomic Energy Commission


    Vietnam National Atomic Energy Commission (VINATOM) is a governmental body in charge of organizing and coordinating activities related to use of nuclear energy for peaceful purpose. VINATOM in structure consists of the Nuclear Research Institute (Dalat), the Institute of Nuclear Science and Technology (Hanoi), the Institute for Technology of Radioactive and Rare Elements (Hanoi), and the Centre for Nuclear Technique Application (Ho Chi Minh City). This catalogue introduces profiles of nuclear R and D activities under management by VINATOM. (N.H.A)

  4. Deforestation in Viet Nam | IDRC - International Development ...

    Increased soil erosion, reduced water-storage capacity, changes in ... gibbons could have travelled from China to Singapore by swinging from tree to tree. ... IDRC congratulates first cohort of Women in Climate Change Science Fellows.

  5. Tshto god grjadushtshii nam... / Lev Golub

    Golub, Lev


    Autor analüüsib Eesti majanduse hetkeolukorda ja tulevikku. Ta leiab, et meie valitsus ja peaminister ei näe riigi majanduses mingeid erilisi probleeme ja raskusi, räägitakse nn. pehmest maandumisest

  6. Fish marketing and credit in Viet Nam

    Lem, Audun


    .... State-owned financial institutions play a major role in financing capital expenditure while working capital requirements are mainly met by informal sources of credit. However, future investment requirements and credit needs are greater than currently available.

  7. Sladkaja zhizn oboidjotsja nam dorogo / Jekaterina Rodina

    Rodina, Jekaterina


    Kui pärast Nõukogude Liidu lagunemist oldi mures ajude äravoolu pärast, siis praegu teeb muret töökäte lahkumine ja kvalifitseeritud spetsialistide puudus. Mitteametlikel andmetel töötavad ligi 30 000 Eesti elanikku välisriikides. Töökäte puudus on kaasa toonud kiire palgatõusu, millega omakorda kaasneb tarbimise kasv. Välistööjõud Eesti turul

  8. Na koi nam "Nokia" / Jekaterina Rodina

    Rodina, Jekaterina


    OÜ Krimelte, AS-i Estonia Klaverivabrik, AS-i Silbet, AS-i Standard, AS-i Wendre, BLRT Grupi ja Viru Keemia Grupi kui Eesti olulisemate ettevõtete majandusnäitajatest ning kohast Eestis ja maailmaturul. Lisa: Juhtivate eksportijate mitteametlik reiting

  9. Finnõ nam pomogut / Andrei Sharomov

    Sharomov, Andrei


    Narva linnavolikogu esimees Mihhail Stalnuhhin, linnavolikogu liige Vladimir Homjakov, Riigikogu liige Eldar Efendijev ja energeetika ekspert Lev Kelman tutvusid Helsingis soojusenergiat tootva ettevõtte tööga

  10. Gaz nam ne ukaz / Josef Kats

    Kats, Josef, 1977-


    Valitsuse eitavast otsusest Vene-Saksa gaasijuhtme uuringute taotlusele, välisminister Urmas Paeti kommentaaridest pressikonverentsil. Välisminister leiab, et antud olukorras oli valitsuse otsus ainuõige

  11. Livan ne po nam / Josef Kats

    Kats, Josef, 1977-


    Välisminister Urmas Paet tutvustas ÜRO Julgeolekunõukogu Liibanoni resolutsiooni täitmise käiku. Eestil puudub hetkel ressurss sõjaväelaste saatmiseks pingekoldesse, kuid ollakse valmis osutama humanitaarabi

  12. JICA -- working from the grass roots up. Vietnam.


    The fact that Japan has reduced its foreign aid by 10% for fiscal 1998 will require the Japan International Cooperation Agency's (JICA) Medical Cooperation Department (MCD) to review both the number of projects it funds and program management. The MCD is developing new guidelines for primary health care programs that will reflect the principles embedded in the Program of Action of the 1994 International Conference on Population and Development. The managing director of the MCD believes that an effective way to promote primary health care is to focus on reproductive health/family planning and then broaden the scope of activities. The current reproductive health project being implemented in Nghe An Province of Viet Nam is expected to make a great contribution to the improvement of community health. The MCD also wants to explore bottom-up primary health care approaches with the cooperation of nongovernmental organizations (NGOs). Thus, the Viet Nam project is being conducted in collaboration with the NGO JOICFP and may pioneer new avenues in governmental/NGO cooperation worldwide. The new budget cuts will force JICA to review its disbursement and project management procedures. Thus, all future projects will use the project cycle management approach, including the use of a participatory project design matrix. JICA will also be fostering a sense of ownership of projects from the grassroots to the national level that will allow projects to become sustainable.

  13. Mobilization for HIV Voluntary Counseling and Testing Services in Vietnam: Clients' Risk Behaviors, Attitudes and Willingness to Pay.

    Nguyen, Long Hoang; Tran, Bach Xuan; Nguyen, Nhung Phuong; Phan, Huong Thu Thi; Bui, Trang Thu; Latkin, Carl A


    A multi-site survey was conducted on a sample of 365 clients to assess their willingness to pay for HIV voluntary counseling and testing (VCT) services in Ha Noi and Nam Dinh province, two epicenters of Vietnam. By using contingent valuation technique, the results showed that most of respondents (95.1 %) were willing to pay averagely 155 (95 % CI 132-177) thousands Vietnam Dong (~US $7.75, 2013) for a VCT service. Clients who were female, had middle income level, and current opioid users were willing to pay less; meanwhile clients who had university level of education were willing to pay more for a VCT service. The results highlighted the high rate of willingness to pay for the service at a high amount by VCT clients. These findings contribute to the implementation of co-payment scheme for VCT services toward the financial sustainability of HIV/AIDS programs in Vietnam.

  14. Use of radon-222 as tracer to estimate groundwater infiltration velocity in a river bank area

    Trinh Van Giap


    Naturally occurring isotope Rn-222 has been used as a natural tracer to determine the residence time of groundwater infiltrated from river into an aquifer in a riverbank area. The applied method is based on the increasing radon concentration in infiltrating water during it passes through the riverbank and reaches an equilibrium value. Solid-state nuclear track detector technique is used to measure directly radon concentration in water of a well. In order to confirm the relationship between radon concentration and it's residence time, a model was constructed in the laboratory. Experiment carried out in Nam Dinh are showed that mean infiltrating velocity of groundwater in the studied area as high as 5.1 m/day. (author)

  15. Population dynamics of the minute intestinal trematode Haplorchis pumilio following experimental infection of young dogs

    Nissen, Sofie; Nguyen, Lan Anh; Thamsborg, Stig Milan


    technique, temperature and weight of the dogs were measured as was total white blood cells, eosinophils and microhaemotocrit values. Subsets of dogs were examined post-mortem for presence of adult FZT at three different time points post infection. Patent infections established in all eight infected dogs......Fishborne zoonotic trematodes (FZT) are highly prevalent in Southeast Asia. Recent studies on domestic animal’s role in the transmission of FZT in Northern Vietnam found that the most prevalent FZT was Haplorchis pumilio. The importance of dogs, cats and pigs was assessed, and dogs were found...... to have the highest intensity of infection and contribute the most to the contamination of the environment with FZT eggs in the Nam Dinh province - a highly endemic area for FZTs. Given the free roaming and fish-eating behaviour of many dogs in rural Vietnam controlling the infection in dogs represents...

  16. L’instabilité organisationnelle des districts industriels. Dynamiques des transformations internes d’un village de métier au nord du Viêt Nam The Organizational Instability of Industrial Districts: Dynamic Internal Transformations of a Craft Village in Northern Vietnam

    Nguyen Quy Nghi


    Full Text Available Le village de métier est un sujet d’étude attractif, mais rarement traité comme une forme d’agglomération industrielle ou abordé sous l’angle de la sociologie industrielle. Le développement actuel des villages de métier montre bien la présence intensive des entreprises de tailles variées et l’implication d’autres acteurs en dehors du milieu de production (par exemple les autorités locales, le milieu de l’éducation. L’introduction d’acteurs nouveaux implique le changement des relations existantes, contribuant ainsi à la mise en place d’une nouvelle configuration. L’objectif de cet article est de montrer que l’organisation des villages de métier, qui est conçue comme un type de district industriel, est marquée par l’instabilité ou le changement permanent de la configuration générale, mais aussi par une transformation interne des acteurs au sein du district. À travers une étude de cas à Bát Tràng – un centre de production céramique au nord du Viêt Nam – cet article a pour objectif de montrer comment des entreprises familiales se réorganisent en structure plus formalisée, comment elles mobilisent du capital social pour régler leurs difficultés et les stratégies d’innovation qu’elles développent.Craft village is an attractive research subject, however it is rarely treated as a form of industrial agglomeration or studied from industrial sociology perspective. The current development of craft villages demonstrates the intensive presence of entreprises of all sizes and involvement of non productive actors (e.g. local authorities, education sector. The introduction of new actors therefore implies a change of existing relationships, contributing to the formulation of new configuration. The objective of this paper is to demonstrate that the organization of craft villages, as a type of industrial district, is marked by instability or permanent change in the overall configuration, but also by

  17. Socioeconomic Renovation in Viet Nam : The Origin, Evolution, and ...

    En 1986, le Vietnam a commencé à libéraliser de façon générale tous les secteurs de son économie auparavant rigide, centralisée et fermée. Appelée doi moi, cette " rénovation " a modifié du tout au tout la vie des agriculteurs et des travailleurs vietnamiens, de même que celle de leur famille. La production agricole a ...

  18. Socioeconomic Renovation in Viet Nam: The Origin, Evolution, and ...

    Referred to as doi moi, this "renovation" has produced dramatic changes in ... In this book, Vietnamese scholars describe the origins and impacts of these changes. ... for two Colombian cities were discussed at ADAPTO's second international ...

  19. The energy and electric development in Viet Nam

    Nguyen Khac, Nhan


    After a description of the Vietnamese geography and economy, this report presents the Vietnamese energy system, comments the status and origin of electricity production in this country (shares of hydraulic, gas turbine, coal production, and imports). Then, the author presents the various aspects defined within the electric energy development plan for 2011-2020 with a projection until 2030: development principles, objectives, instructions for production plants and for grids, and investments. He proposes a focus on hydroelectricity (meteorological data regarding precipitations, status and power of existing dams, situation and negotiation about the Mekong, problems associated with the development of hydroelectricity in Vietnam), and a focus on the relationship between nuclear energy and climate change (safety issues due to climate change, nuclear plant projects are postponed, the only strategic choice is a massive exploitation of renewable energies). In the last part, the author discusses predictions regarding energy demand, and the associated planning and programming to face this increasing demand

  20. On Measuring Human Capital: A Case Study of Viet Nam

    Son, Hyun Hwa


    Human capital refers to the ability and efficiency of people to transform raw materials and capital into goods and services, the consensus being that these skills can be learned through the educational system. The concept of human capital, necessarily, is related to the productivity of workers. Thus, this paper develops a productivity-based single measure of human capital, taking account of different levels of education and productivity differentials across workers. Using this new measure, th...

  1. Tshto nesjot nam mirnõi atom / Julia Zalutskaja

    Zalutskaja, Julia


    Kui Eestisse otsustatakse rajada tuumaelektrijaam, ei lähe see ekspluatatsiooni enne 2025. aastat. Eesti Energia juhi Sandor Liive hinnangul ei asendaks tuumaelektrijaam ei põlevkivienergeetikat, vaid need täiendaksid teineteist

  2. Synthesis of Cascadable DDCC-Based Universal Filter Using NAM

    Huu-Duy Tran


    Full Text Available A novel systematic approach for synthesizing DDCC-based voltage-mode biquadratic universal filters is proposed. The DDCCs are described by infinity-variables’ models of nullor-mirror elements which can be used in the nodal admittance matrix expansion process. Applying the proposed method, the obtained 12 equivalent filters offer the following features: multi-input and two outputs, realization of all five standard filter functions, namely lowpass, bandpass, highpass, notch and allpass, high-input impedance, employing only grounded capacitors and resistors, orthogonal controllability between pole frequency and quality factor, and cascadable, low active and passive sensitivities. The workability of some synthesized filters is verified by HSPICE simulations to demonstrate the feasibility of the proposed method.

  3. Tshto nam dast Jevroparlament? / Siiri Oviir ; interv. Nelli Kuznetsova

    Oviir, Siiri, 1947-


    Siiri Oviir vastab küsimustele, mis puudutavad tema eesmärke ja töösuundi Euroopa Parlamendis, kuulumist liberaalide fraktsiooni, Toomas Hendrik Ilvese valimist europarlamenti, migratsioonilaine võimalikkust, Eesti vene saadikute kõrvalejäämist europarlamendist,

  4. Vse teatrõ v gosti k nam / Irina Butjajeva

    Butjajeva, Irina


    25.-27. märtsini toimub Vene Kultuurikeskuses esimene rahvusvaheline festival "Baltiiski bereg" (Balti kallas). Tutvustatakse festivalil osalevaid lasteteatreid. Ürituse organisaatoriks on Teater Grotesk

  5. Nam ljubõje dorogi dorogi / Sergei Kolikov

    Kolikov, Sergei


    Tänavu on remonditakse Tallinn-Tartu maanteed 183 miljoni krooni eest, 60 kilomeetrise Tallinn-Peterburi maanteelõigu rekonstrueerimiseks määras Euroopa Komisjon küll 392 miljonit krooni, kuid töö lükkub järgmisse aastasse. Teetööde vähenemine võib mõned ettevõtted viia pankroti piirile

  6. Kto s ognjom k nam prijedjet... / Vladimir Fridljand

    Fridljand, Vladimir


    22. septembril Tallinnas Tõnismäe pronkssõduri juures kavandatavast fašismi ohvritele pühendatud üritusest, mille initsiaatoriteks on Eesti neonatsismi ja rahvustevahelise vaenu vastane komitee ning Venemaa partei Ühtne Venemaa Peterburi regionaalne osakond. Eesti poliitikute reageeringutest

  7. Rossiiskije artistõ objavili nam boikot? / Nikolai Karajev

    Karajev, Nikolai, 1978-


    Venemaa artistid ei soovi tulla Eestisse külalisesinemistele poliitilistel põhjustel ja väidetavalt valmistub Venemaa suurejooneliseks propagandasõjaks, kaitstes pronkssõduri jäämist samale kohale

  8. Dorogi, kotorõje nam võbirajut / Eteri Kekelidze

    Kekelidze, Eteri, 1944-


    Eestis jätkub aktiivne elamu- ja tee-ehitus, suuri probleeme ehitusmaterjalide tarnimisega elamuehituse või tee-ehituse tarbeks sel aastal ei ole olnud. Ehitusmaterjalide tootmise probleemideks on kujunemas loodusressursside kaevandamise perspektiivid ja planeeritav keskkonnamaksude tõus

  9. A REMF's View of Viet Nam War Literature Bibliography.

    Willson, David A.

    An academic librarian who is a Vietnam War veteran was inspired by the exemplary collection of Vietnam War literature at the Colorado State University Library to begin his own personal collection of mass market paperbacks dealing with the Vietnam War. Although Vietnam War fiction was common on the mass market racks in the mid 1980s, it has been…

  10. FY 2000 report on the survey project on potentiality of the environmental harmony coal utilization system. Potential study of the circulating fluidized bed boiler model project in Vietnam; 2000 nendo kankyo chowagata sekitan riyo system kanosei chosa jigyo hokokusho. Vietnam ni okeru junkan ryudosho boiler model jigyo jisshi kanosei chosa



    In Vietnam, survey was conducted of the project in which the adoption of circulating fluidized bed boiler (CFB) makes energy conservation and greenhouse effect gas reduction possible. CFB makes a marked decrease in SOx emission possible by using limestone as combustion bed material. As a result of the survey, the thermal power plant was not suitable for the model project due to its large size. However, it was found that two cement plants and one fiber plant having coal-fired boiler were suitable for survey. Nghi Son and Bim Son cement plants are typical cement plants in Vietnam. As a result of the hearing, they were eager to adopt CFB equipment. As to environmental improvement effects, in the thermal power plant with power source loads, emissions of SOx and NOx can be reduced by 79.0% and 72.5%, respectively. Further, in Nam Dinh Textile Company, emissions of SOx and NOx can be reduced by 79.8% and 84.6%, respectively, in case of converting boiler from the existing stoker boiler to CFB boiler. (NEDO)

  11. Spatio-Temporal Occurrence Modeling of Highly Pathogenic Avian Influenza Subtype H5N1: A Case Study in the Red River Delta, Vietnam

    Chinh C. Tran


    Full Text Available Highly Pathogenic Avian Influenza (HPAI subtype H5N1 poses severe threats to both animals and humans. Investigating where, when and why the disease occurs is important to help animal health authorities develop effective control policies. This study takes into account spatial and temporal occurrence of HPAI H5N1 in the Red River Delta of Vietnam. A two-stage procedure was used: (1 logistic regression modeling to identify and quantify factors influencing the occurrence of HPAI H5N1; and (2 a geostatistical approach to develop monthly predictive maps. The results demonstrated that higher average monthly temperatures and poultry density in combination with lower average monthly precipitation, humidity in low elevation areas, roughly from November to January and April to June, contribute to the higher occurrence of HPAI H5N1. Provinces near the Gulf of Tonkin, including Hai Phong, Hai Duong, Thai Binh, Nam Dinh and Ninh Binh are areas with higher probability of occurrence of HPAI H5N1.

  12. Poultry as reservoir hosts for fishborne zoonotic trematodes in Vietnamese fish farms.

    Anh, Nguyen Thi Lan; Madsen, Henry; Dalsgaard, Anders; Phuong, Nguyen Thi; Thanh, Dao Thi Ha; Murrell, K Darwin


    Fishborne zoonotic trematodes (FZT) are widespread in Vietnam and Southeast Asia. It is now recognized that the risk of being infected from eating raw fish dishes applies not only to humans, but also to domestic animals (e.g., cats, dogs, and pigs) and fish-eating birds. The role of ducks and chicken, commonly raised on fish farms, as reservoir hosts, however, has not been adequately investigated. To study this question, chickens and ducks from integrated poultry-fish farms in Nghia Lac and Nghia Phu communes, Nam Dinh province, Vietnam were surveyed for FZT infections. A total of 50 ducks and 50 chickens from each commune were examined. Results revealed that 12% of chickens and 30% of ducks were infected with various species of trematodes, including two zoonotic species, Centrocestus formosanus and Echinostoma cinetorchis. Both occurred in chickens whereas only E. cinetorchis was found in ducks. Prevalence of these zoonotic species was 12% and 7% in ducks and chickens, respectively. Among other trematodes, Hypoderaeum conoideum, also a zoonotic fluke, was the most prevalent (20-30%). The feeding of snails and fish remains to poultry, either intentionally or by discharge of waste from the slaughter of ducks and chickens into the ponds, was identified as risk factors for trematode infection. The FZT species and low prevalence found in poultry in these communes indicate their role as reservoir hosts is minor. (c) 2010 Elsevier B.V. All rights reserved.

  13. 100% anthracite burning at the Hoang Mai cement factory (Viet-Nam); Calcination 100% anthracite a la cimenterie de Hoang Mai (Viet-Nam)

    Jorget, S. [Fcb Ciment, 59 - Villeneuve d' Ascq (France)


    The Hoang Mai cement factory is a greenfield plant whose contract (design and supply of equipment) was awarded o the French company Fcb.ciment, while the owner kept the responsibility of civil works and of erection. The contract was signed in late 1997. The commissioning began in September 2001, and the burning line was started on February 27, 2002. Clinker production started from this day, and after two months devoted to equipment adjustments, performance tests were carried out. The provisional acceptance certificate was delivered in August 2002. (author)

  14. Geostatistical Approach to Estimating the Gold Ore Characteristics and Gold Reserves: A Case Study Daksa Area, Quang Nam Province, Viet Nam

    Luan Truong, Xuan; Luong Le, Van; Quang Truong, Xuan


    Daksa gold deposit is the biggest gold deposits in Vietnam. The Daksa geological structure complicated, distributed mainly metamorphosed sedimentary NuiVu formation (PR3-?1nv2). The sulfide gold ore bodies distributed in quartz schist, quartz - biotite related to faut and distribution wing anticline. The gold ore bodies form circuits, network circuits, circuits lenses; fill the cup surface layer of the developing northeast - southwest; is the less than or west longitude north - SE. The results show that, Au and accompanying elements (Ag, Pb and Zn) have correlated pretty closely. All of its consistent with the logarithmic distribution standard, in accordance with the law of distribution of content mineral rare. The structure functions have nugget effect and spherical models with show that Au and accompanying elements special variation are changes. Au contents shown local anisotropy, no clearly anisotropy (K=1,17) and weakly anisotropy (K=1,4). Intensity mineralization of the ore bodies are quite high with demand spherical conversion coefficient ranging from 0.49 to 0.75 and from 0.66 to 0.97 (for other body). With nugget effects, ore bodies shown that it is consistent with mineralization in the ore bodies study, ore erasable, micro vein, infilling fractures in quartz vein. All of variogram presents local anisotropy, indicated gold mineralization at study area has least two-mineralization stages, consistent with the analysis of mineralography samples. By the results of the structure function study, the authors present the system optimization for exploration deposit and used to evaluate gold reserves by Ordinary Kriging. High accuracy of Kriging estimation results are expressed in the minimum Kriging variance, by compare the results calculated by some other methods (such as distance inverse weighting method, ..) and specially compare to the results of a some blocks have been exploited. Key words: Geostat and gold deposits VN. Daksa and gold mineralization. Geostat and gold mine Daksa.

  15. Biomedical photonics handbook fundamentals, devices, and techniques

    Vo-Dinh, Tuan


    Photonics and Tissue OpticsOptical Properties of TissuesJoel Mobley, Tuan Vo-Dinh and Valery TuchinLight-Tissue InteractionsValery V. TuchinTheoretical Models and Algorithms in Optical Diffusion TomographyStephen J. Norton and Tuan Vo-DinhBasic InstrumentationBasic Instrumentation in PhotonicsTuan Vo-DinhOptical Fibers and Waveguides for Medical ApplicationsIsrael Gannot and Moshe Ben DavidFiberoptics Probe DesignUrs Ut

  16. Biomedical photonics handbook

    Vo-Dinh, Tuan


    1.Biomedical Photonics: A Revolution at the Interface of Science and Technology, T. Vo-DinhPHOTONICS AND TISSUE OPTICS2.Optical Properties of Tissues, J. Mobley and T. Vo-Dinh3.Light-Tissue Interactions, V.V. Tuchin 4.Theoretical Models and Algorithms in Optical Diffusion Tomography, S.J. Norton and T. Vo-DinhPHOTONIC DEVICES5.Laser Light in Biomedicine and the Life Sciences: From the Present to the Future, V.S. Letokhov6.Basic Instrumentation in Photonics, T. Vo-Dinh7.Optical Fibers and Waveguides for Medical Applications, I. Gannot and

  17. Métropolisation, habitat précaire et relogement forcé: entre phénomènes d'exclusion et tactiques populaires d'intégration: le cas du canal Nhieu Loc-Thi Nghe à Ho Chi Minh-Ville, Vietnam

    Wust, Sébastien


    This work was carried out within the interdisciplinary scientific program named "Sustainable Development, Metropolisation and Pollution of Natural Resources in Ho Chi Minh-City, Vietnam". This program, launched in 1994, is financed by the Swiss National Science Foundation (Priority Program Environment, Module 7 "Environment and development"). The main goal of this thesis is to grasp the social, economic and spatial dimensions at stake of involuntary ...

  18. Culture and cooperation: cooperative learning in Asian Confucian heritage cultures. The case of Viet Nam

    Nguyen, P.M.


    The study is concerned with the influence of western educational approaches upon non-western societies and cultural groups. In applying western educational approaches, often a detailed consideration of its consequences to the culture and heritage of a non-western civilization is neglected. This is

  19. Characteristics of tuberculosis patients at intake in Cambodia, two provinces in China, and Viet Nam

    Hoa, Nguyen B; Wei, Chen; Sokun, Chay


    The tuberculosis register is a critical data source for the information system of national tuberculosis control programs. From the information in the tuberculosis case register, it is possible to extend the standard analysis of age and sex characteristics among sputum smear-positive cases to all...

  20. Habitat et environnement urbain au Viet-Nam : Hanoi et Hô Chi ...

    Carrières · Communiquez avec nous · Plan du site. Abonnez-vous à notre bulletin pour recevoir les nouvelles du CRDI chaque mois. Abonnez-vous · Droits d'auteur · Éthique de la recherche · Politique de libre accès · Politique de confidentialité · Transparence · Utilisation du site Web. Suivez-nous; Facebook · Twitter ...

  1. Growth and Structural Transformation in Viet Nam during the 2000s

    Thu Hoai, Dang Thi; Tarp, Finn; van Seventer, Dirk

    the period 2000–12, while moving from primary production (agriculture) towards more value adding manufacturing activities. This transformation has been broad-based and in large measure driven by external demand. We conclude that it will be challenging to sustain growth without bold moves in technological......We study structural transformation and change in the Vietnamese economy using two Social Accounting Matrices (SAMs), one for the year 2000 and a recently compiled SAM for the year 2012. This period is of particular interest as it features an important shift in terms of more economic integration...

  2. Health Costs Attributable to Smoking in Viet Nam | CRDI - Centre de ...

    The burden of disease caused by smoking, and the medical and social costs associated with it, are not well quantified in low- and middle income countries. This is largely due to less systematic maintenance of medical records, and death and disease registries, and lower levels of chronic care services than in higher income ...

  3. Economics of Nuclear Power Plant and the development of nuclear power in Viet Nam

    Thanh, Thuy Nguyen Thi; Song, JinHo; Ha, Kwang Soon


    There are many factors affecting the capital costs like: increased plant size, multiple unit construction, improved construct methods, increase the lifetime of plant and so on, and beside is technical to enhancing the safety for NPPs. For the question that whether building a NPP is really economic than other energy resources or not, we will find the answer by comparing the USD per kWh of different energy sources as: nuclear power, coal, oil, hydro natural energy sources. The situation of energy in Vietnam was also mentioned in this paper. Vietnam has an abundant natural resources likes: coal, gas, hydro power etc, but from year 2013 to now Vietnam facing of electricity shortage and to solve the problem, Vietnam Government has chosen nuclear power energy to achieve energy balance between the rate of energy consumption and the ability to energy supply. Eight units will be built in Vietnam and in October 2014 Vietnamese officials have chosen Rosatom's AES-2006 design with VVER-1200/v-491 reactors for country's first nuclear power plant at Ninh Thuan and a second plant should follow based on a partnership with Japan. In this paper, the breakdown of NPP costs is considered. All the costs for building a NPP includes: the investment costs are the largest components (about 60%), fuel costs (15%), O and M costs (25%) and external costs are lower than 1% of the kWh costs. The situation for energy in Vietnam was mentioned with increase annually by 5.5 %, and now the shortage electricity is the big problem in power section. The purpose of this report is to give a general picture to consider the cost of nuclear power. It includes all the costs for building a nuclear power plant like total capital investment costs, production costs, external costs in which the capital investment costs is the largest component of the kWh cost. Nuclear energy Power was chosen to deal with situation of diminishing resources shortages

  4. Culture and cooperation: cooperative learning in Asian Confucian heritage cultures. The case of Viet Nam

    Nguyen, P.M.


    The study is concerned with the influence of western educational approaches upon non-western societies and cultural groups. In applying western educational approaches, often a detailed consideration of its consequences to the culture and heritage of a non-western civilization is neglected. This is both the case of a multicultural classroom where students come from different backgrounds and the case of homogeneous classroom in non-western countries where the western teaching and learning appro...

  5. Kak eto nam poljubitsa, ili Ljubov i nenavist Timofeja Sopoleva / Timofei Sopoljov ; interv. Boris Tuch

    Sopoljov, Timofei


    William Shakespeare'i "Kuidas teile meeldib", lavastaja Timofei Sopoljov, muusika autor helilooja Aleksei Shelõgin. Lavastaja meenutab ka oma teatriõpinguid lavastaja ja teatripedagoogi Andrei Gontsharovi käe all

  6. CASE STUDY: Viet Nam — Emphasis on people, not things, calms ...


    Dec 15, 2010 ... The loss of their traditional fishing grounds generated conflict between the ... were just starting to experiment with participatory methods. .... and shared information from joint mapping, focus group surveys, and group analysis.

  7. Nam et al., Afr J Tradit Complement Altern Med. (2018) 15 (1): 183 ...


    Dec 29, 2017 ... ... BC) are used as traditional medicines for the treatment of skin diseases. .... contributes to rapid wound healing in oral epithelia. ... Chinese medicine use for children with allergic rhinitis: a nationwide population-based study.

  8. Dose intercomparison studies for standardization of high-dose dosimetry in Viet Nam

    Mai Hoang Hoa; Duong Nguyen Dinh; Kojima, T.


    The Irradiation Center of the Vietnam Atomic Energy Commission (IC-VAEC) is planning to establish a traceability system for high-dose dosimetry and to provide high-dose standards as a secondary standard dosimetry laboratory (SSDL) level in Vietnam. For countries which do not have a standard dosimetry laboratory, the participation in the International Dose Assurance Service (IDAS) operated by the International Atomic Energy Agency (IAEA) is the most common means to verify own dosimetry performance with a certain uncertainty. This is, however, only one-direction dose intercomparison with evaluation by IAEA including unknown parameter at participant laboratories. The SSDL level laboratory should have traceability as well as compatibility, ability to evaluate uncertainties of its own dosimetry performance by itself In the present paper, we reviewed our dosimetry performance through two-way dose intercomparison studies and self-evaluation of uncertainty in our dosimetry procedure. The performance of silver dichromate dosimeter as reference transfer dosimeter in IC-VAEC was studied through two-way blind dose intercomparison experiments between the IC-VAEC and JAERI. As another channel of dose intercomparison with IAEA, alanine dosimeters issued by IDAS were simultaneously irradiated with the IC-VAEC dichromate dosimeters at IC-VAEC and analyzed by IAEA. Dose intercomparison between IC-VAEC and JAERI results into a good agreement (better than ±2.5%), and IDAS results also show similar agreement within ±3.0%. The uncertainty was self-estimated on the basis of the JAERI alanine dosimetry, and a preliminary value of about 1.86% at a 68% confidence level is established. The results from these intercomparisons and our estimation of the uncertainty are consistent. We hope that our experience is valuable to other countries which do not have dosimetry standard laboratories and/or are planning to establish them. (author)

  9. Economics of Nuclear Power Plant and the development of nuclear power in Viet Nam

    Thanh, Thuy Nguyen Thi; Song, JinHo [University of Science and Technology, Daejeon (Korea, Republic of); Ha, Kwang Soon [KAERI, Daejeon (Korea, Republic of)


    There are many factors affecting the capital costs like: increased plant size, multiple unit construction, improved construct methods, increase the lifetime of plant and so on, and beside is technical to enhancing the safety for NPPs. For the question that whether building a NPP is really economic than other energy resources or not, we will find the answer by comparing the USD per kWh of different energy sources as: nuclear power, coal, oil, hydro natural energy sources. The situation of energy in Vietnam was also mentioned in this paper. Vietnam has an abundant natural resources likes: coal, gas, hydro power etc, but from year 2013 to now Vietnam facing of electricity shortage and to solve the problem, Vietnam Government has chosen nuclear power energy to achieve energy balance between the rate of energy consumption and the ability to energy supply. Eight units will be built in Vietnam and in October 2014 Vietnamese officials have chosen Rosatom's AES-2006 design with VVER-1200/v-491 reactors for country's first nuclear power plant at Ninh Thuan and a second plant should follow based on a partnership with Japan. In this paper, the breakdown of NPP costs is considered. All the costs for building a NPP includes: the investment costs are the largest components (about 60%), fuel costs (15%), O and M costs (25%) and external costs are lower than 1% of the kWh costs. The situation for energy in Vietnam was mentioned with increase annually by 5.5 %, and now the shortage electricity is the big problem in power section. The purpose of this report is to give a general picture to consider the cost of nuclear power. It includes all the costs for building a nuclear power plant like total capital investment costs, production costs, external costs in which the capital investment costs is the largest component of the kWh cost. Nuclear energy Power was chosen to deal with situation of diminishing resources shortages.

  10. TLALOCNet continuous GPS-Met Array in Mexico supporting the 2017 NAM GPS Hydrometeorological Network.

    Cabral-Cano, E.; Salazar-Tlaczani, L.; Adams, D. K.; Vivoni, E. R.; Grutter, M.; Serra, Y. L.; DeMets, C.; Galetzka, J.; Feaux, K.; Mattioli, G. S.; Miller, M. M.


    TLALOCNet is a network of continuous GPS and meteorology stations in Mexico to study atmospheric and solid earth processes. This recently completed network spans most of Mexico with a strong coverage emphasis on southern and western Mexico. This network, funded by NSF, CONACyT and UNAM, recently built 40 cGPS-Met sites to EarthScope Plate Boundary Observatory standards and upgraded 25 additional GPS stations. TLALOCNet provides open and freely available raw GPS data, and high frequency surface meteorology measurements, and time series of daily positions. This is accomplished through the development of the TLALOCNet data center ( that serves as a collection and distribution point. This data center is based on UNAVCO's Dataworks-GSAC software and also works as part of UNAVCO's seamless archive for discovery, sharing, and access to GPS data. The TLALOCNet data center also contains contributed data from several regional GPS networks in Mexico for a total of 100+ stations. By using the same protocols and structure as the UNAVCO and other COCONet regional data centers, the scientific community has the capability of accessing data from the largest Mexican GPS network. This archive provides a fully queryable and scriptable GPS and Meteorological data retrieval point. In addition, real-time 1Hz streams from selected TLALOCNet stations are available in BINEX, RTCM 2.3 and RTCM 3.1 formats via the Networked Transport of RTCM via Internet Protocol (NTRIP) for real-time seismic and weather forecasting applications. TLALOCNet served as a GPS-Met backbone for the binational Mexico-US North American Monsoon GPS Hydrometeorological Network 2017 campaign experiment. This innovative experiment attempts to address water vapor source regions and land-surface water vapor flux contributions to precipitation (i.e., moisture recycling) during the 2017 North American Monsoon in Baja California, Sonora, Chihuahua, and Arizona. Models suggest that moisture recycling is a large contributor to summer rainfall. This experiment represents a first attempt to quantify the surface water vapor flux contribution to GPS-derived precipitable water vapor. Preliminary results from this campaign are presented.

  11. Livelihood strategies under climate change vulnerability in Quang Nam province, Vietnam

    Casse, Thorkil

    Analysis of the transformation of primary to plantation forest under risk of severe natural disasters in central Vietnam. The articles argues that the process could be seen as an example of government induced vulnerability......Analysis of the transformation of primary to plantation forest under risk of severe natural disasters in central Vietnam. The articles argues that the process could be seen as an example of government induced vulnerability...

  12. Livelihood strategies under the constraints of climate change vulnerability in Quang Nam

    Casse, Thorkil


    This chapter examines how vulnerability can be measured in quantitative terms. Households whose livelihoods are based on economic activities like acacia production and shrimp farming suffered the most....

  13. Alcohol Use and HIV Risk Behaviors among Rural Adolescents in Khanh Hoa Province Viet Nam

    Kaljee, L. M.; Genberg, B. L.; Minh, T. T.; Tho, L. H.; Thoa, L. T. K.; Stanton, B.


    Research suggests that youth are consuming more alcohol and at younger ages than in the past. Data also indicate that alcohol consumption is associated with participation in other risk behaviors including aggression and sexual behaviors. As part of a randomized control effectiveness trial for an HIV prevention program, 480 Vietnamese youth (15-20…

  14. An Analysis of the Community College Concept in the Socialist Republic of Viet Nam

    Epperson, Cynthia K.


    The purpose of this study was to discover if core characteristics exist forming a Vietnamese community college model and to determine if the characteristics would explain the model. This study utilized three theoretical orientations while reviewing the existing literature, formulating the research questions, examining the data and drawing…

  15. Globalisation of English Language Programs for Young Children in Viet Nam

    Hall, Beverley


    The specific purpose of education is to "prepare" children so that they are able to maximise their potential and participate in the society or community around them. In order for many Third World nations to access information technology, the provision of language programs, particularly English, has become necessary. However, in the…

  16. Project P.R.O.U.D. Book 5. Viet Nam.

    Mid-State Literacy Council, State College, PA.

    This reader, the fifth in a series of six, was developed to support one-to-one tutoring of adults in a reading program. It contains language experience stories and their accompanying skills exercises and comprehension questions. The reading level of the readers correlates to the reading levels of the Laubach Skill Books available from Laubach…

  17. Manual on sample-based data collection for fisheries assessment: examples from Viet Nam

    Sparre, Per


    .... The data collection programme is developed through a top-down approach, from the identification of the objectives down to the practical recording and management of data obtained from the fishery...

  18. Foreign Direct Investment and the Survival of Domestic Private Firms in Viet Nam

    Kokko, Ari; Thang, Tran Toan


    Foreign direct investment (FDI) may benefit local firms in the host country through various kinds of spillovers, but it may also raise competition and result in the crowding out of domestic firms. Using detailed firm-level data for the period 2001–2008, this paper examines the aggregate effect...... significantly, while downstream FDI may reduce the hazard. The presence of SOEs has a direct negative effect on the survival odds of local private firms in the same industry, but there is also an indirect impact on the exit hazard from FDI. Local firms are more vulnerable to foreign entry in sectors with high...

  19. Skoro nam pjatnadtsat. Mõ belõje i pushistõje? / Arvo Sirendi ; interv. Tatjana Opekina

    Sirendi, Arvo, 1939-


    Põllumajandusdoktor, ERL-i liige vastab küsimustele, mis on seotud Eesti taasiseseisvumisega, toimunud muutustega maaelus ja põllumajanduses ning tervishoius viimasel viieteistkümnel aastal, Eesti-Vene suhetega

  20. Võ k nam, a mõ k vam... / Nelli Kuznetsova

    Kuznetsova, Nelli


    Vene Kunstnike Ühenduse 10. aastapäevale pühendatud kevadnäitus toimus Würthi galeriis ja Kohtla-Järve Linnagaleriis. Filmi näituste avamistest, eksponeeritud töödest ja aruteludest näidati Vene kultuurikeskuses. Slava Semerikovi, Anatoli Strahhovi ja Valeri Smirnovi maalidest. Vene Kunstnike Ühenduse tegemisi kommenteerib Valeri Smirnov

  1. Paet : "Nam ne vsjo ravno, kto investirujet v ER" / Aivar Reinap

    Reinap, Aivar, 1968-


    Välisminister Urmas Paet viitas välispoliitika arutelul Riigikogus vajadusele kontrollida Vene välisinvesteeringute julgeolekuriske, seda peamiselt tundlikes valdkondades nagu energeetika ja infrastruktuurid

  2. Samozvantsev nam ne nado, komandirom budu ja / Maksim Shmeljov, Aleksandr Tshaplõgin, Leivi Sher

    Shmeljov, Maksim


    Kas Konstitutsioonipartei nimekirjas parlamendivalimistel kandideeriv Dmitri Linter ja tema kaaslased võivad kasutada liikumise Notshnoi dozor brändi ND omakasupüüdlikel eesmärkidel, küsivad autorid

  3. Explaining tourists satisfaction and intention to revisit Nha Trang, Viet Nam

    Tran, Thi Ai Cam


    The first purpose of the thesis is to find how visitors evaluate the quality of different facets or attributes of a destination image of Nha Trang, how satisfied they are with Nha Trang, loyalty intention to revisit and willingness to recommend Nha Trang to others. The second is to investigate what “image” is most important to explain global satisfaction with visiting Nha Trang. The third is to investigate how perceived quality, satisfaction and other motivational or dismotivational factors ...

  4. Neoliberalizm polskich 'gender studies'. Czy to 'backlash' odbiera nam słuchaczki/słuchaczy?

    Maciej Duda


    Full Text Available "Neoliberalism of Polish 'gender studies'. Is 'backlash' a reaction, which collects our students?" In this text I present today’s condition of Polish gender studies that are conducted as postgraduate studies. In most of the cities it is impossible to form groups of students. It is believed that “responsible” for this state are backlash and campaign called “gender ideology”. Unfortunately these problems with enrollment have appeared earlier. In my presentation I describe the neoliberal shape of chargeable postgraduate studies that are conducted in large cities. Joining these groups depends on economic factors and free time of the students. An important aspect is also practical dimension of gender studies – students should develop themselves and their abilities. In accordance with the guidelines of postgraduate studies students should improve their professional skills. There is also a problem with the language of information/promotion campaign, as we use it as an instrument to encourage people to take part in these group activities. The language very often uses capitalist and stereotypical concepts profit and investment in yourself. The presentation is the critical voice of lecturer, who was teaching gender studies in Warsaw and was participating in forming “genders” in Poznan and Szczecin.

  5. Drug addiction stigma in relation to methadone maintenance treatment by different service delivery models in Vietnam.

    Tran, Bach Xuan; Vu, Phuong Bich; Nguyen, Long Hoang; Latkin, Sophia Knowlton; Nguyen, Cuong Tat; Phan, Huong Thu Thi; Latkin, Carl A


    The rapid expansion of methadone maintenance treatment (MMT) services has significantly improved health status and quality of life of patients. However, little is known about its impacts on addiction-related stigma and associated factors. A cross-sectional survey was conducted in 2013 in Vietnam's capital, Hanoi, and Nam Dinh province among 1016 methadone maintenance patients; 26.6 % at provincial AIDS centers (PAC) and 73.4 % at district health centers (DHC), respectively. Drug addiction history and related stigma, health status, MMT-related covariates, and sociodemographic characteristics were interviewed. More than one-sixth of the sample reported experiencing felt or enacted stigma, including Blame or Judgement (17.2 %), Shame (19.9 %), or Others' fear of HIV transmission (17.1 %). These proportions were higher in PACs than in DHCs, which are integrated with other HIV or general health care services. Very few patients reported being discriminated at the workplace (2.5 %) or at health care services (1.7 %); however, 15.6 % of patients at PACs and 10.6 % of patients at DHCs reported discrimination in their communities. Drug users taking MMT for longer periods were less likely to report felt stigma. Other factors associated with stigma against MMT patients included the lack of comprehensive services, higher education, presence of pain/discomfort, and anxiety/depression, self-reported HIV positive, and number of previous drug rehabilitation episodes. The study shows a high level of stigma against MMT patients and emphasizes the necessity to integrate MMT with comprehensive health and support services. Mass communication campaigns to reduce stigma against people with drug addiction and HIV/AIDS, as well as vocational trainings and jobs referrals for MMT patients, are needed to maximize the benefits of MMT programs in Vietnam.

  6. Mesoniviruses are mosquito-specific viruses with extensive geographic distribution and host range.

    Vasilakis, Nikos; Guzman, Hilda; Firth, Cadhla; Forrester, Naomi L; Widen, Steven G; Wood, Thomas G; Rossi, Shannan L; Ghedin, Elodie; Popov, Vsevolov; Blasdell, Kim R; Walker, Peter J; Tesh, Robert B


    The family Mesoniviridae (order Nidovirales) comprises of a group of positive-sense, single-stranded RNA ([+]ssRNA) viruses isolated from mosquitoes. Thirteen novel insect-specific virus isolates were obtained from mosquitoes collected in Indonesia, Thailand and the USA. By electron microscopy, the virions appeared as spherical particles with a diameter of ~50 nm. Their 20,129 nt to 20,777 nt genomes consist of positive-sense, single-stranded RNA with a poly-A tail. Four isolates from Houston, Texas, and one isolate from Java, Indonesia, were identified as variants of the species Alphamesonivirus-1 which also includes Nam Dinh virus (NDiV) from Vietnam and Cavally virus (CavV) from Côte d'Ivoire. The eight other isolates were identified as variants of three new mesoniviruses, based on genome organization and pairwise evolutionary distances: Karang Sari virus (KSaV) from Java, Bontag Baru virus (BBaV) from Java and Kalimantan, and Kamphaeng Phet virus (KPhV) from Thailand. In comparison with NDiV, the three new mesoniviruses each contained a long insertion (180 - 588 nt) of unknown function in the 5' region of ORF1a, which accounted for much of the difference in genome size. The insertions contained various short imperfect repeats and may have arisen by recombination or sequence duplication. In summary, based on their genome organizations and phylogenetic relationships, thirteen new viruses were identified as members of the family Mesoniviridae, order Nidovirales. Species demarcation criteria employed previously for mesoniviruses would place five of these isolates in the same species as NDiV and CavV (Alphamesonivirus-1) and the other eight isolates would represent three new mesonivirus species (Alphamesonivirus-5, Alphamesonivirus-6 and Alphamesonivirus-7). The observed spatiotemporal distribution over widespread geographic regions and broad species host range in mosquitoes suggests that mesoniviruses may be common in mosquito populations worldwide.

  7. Co-financing for viral load monitoring during the course of antiretroviral therapy among patients with HIV/AIDS in Vietnam: A contingent valuation survey.

    Nguyen, Quyen Le Thi; Nguyen, Long Hoang; Tran, Bach Xuan; Phan, Huong Thi Thu; Le, Huong Thi; Nguyen, Hinh Duc; Tran, Tho Dinh; Do, Cuong Duy; Nguyen, Cuong Manh; Thuc, Vu Thi Minh; Latkin, Carl; Zhang, Melvyn W B; Ho, Roger C M


    Viral load testing is considered the gold standard for monitoring HIV treatment; however, given its high cost, some patients cannot afford viral load testing if this testing is not subsidized. Since foreign aid for HIV/AIDS in Vietnam is rapidly decreasing, we sought to assess willingness to pay (WTP) for viral load and CD4 cell count tests among HIV-positive patients, and identified factors that might inform future co-payment schemes. A multi-site cross-sectional survey was conducted with 1133 HIV-positive patients on antiretroviral therapy (ART) in Hanoi and Nam Dinh. Patients' health insurance coverage, quality of life, and history of illicit drug use were assessed. A contingent valuation approach was employed to measure patients' WTP for CD4 cell count and viral load testing. HIV-positive patients receiving ART at provincial sites reported more difficulty obtaining health insurance (HI) and had the overall the poorest quality of life. Most patients (90.9%) were willing to pay for CD4 cell count testing; here, the mean WTP was valued at US$8.2 (95%CI = 7.6-8.8 US$) per test. Most patients (87.3%) were also willing to pay for viral load testing; here, mean WTP was valued at US$18.6 (95%CI = 16.3-20.9 US$) per test. High income, high education level, and hospitalization were positively associated with WTP, while co-morbidity with psychiatric symptoms and trouble paying for health insurance were both negatively related to WTP. These findings raise concerns that HIV-positive patients in Vietnam might have low WTP for CD4 cell count and viral load testing. This means that without foreign financial subsidies, many of these patients would likely go without these important tests. Treating psychiatric co-morbidities, promoting healthcare services utilization, and removing barriers to accessing health insurance may increase WTP for monitoring of HIV/AIDS treatment among HIV+-positive Vietnamese patients.

  8. Behavioral and quality-of-life outcomes in different service models for methadone maintenance treatment in Vietnam.

    Tran, Bach Xuan; Nguyen, Long Hoang; Nong, Vuong Minh; Nguyen, Cuong Tat; Phan, Huong Thu Thi; Latkin, Carl A


    Integrating HIV/AIDS and methadone maintenance treatment (MMT) services with existing health care delivery system is critical in sustaining efforts to fight HIV/AIDS in large injection-driven epidemics. However, efficiency of different integrative service models is unknown. This study assessed behavioral and health-related quality-of-life (HRQOL) outcomes of MMT in four service delivery models and explored factors associated with these outcomes of interest. A cross-sectional survey was conducted in two HIV epicenters in Vietnam: Hanoi and Nam Dinh Province. All patients in five selected MMT clinics were invited to participate, and 1016 were interviewed (80-90% response rate). Respondents had a mean age of 35.8, taken MMT for average 16.5 months and 3.3% on MMT for 36-60 months. The MMT integrated with rural district health center (DHC) has the highest prevalence of concurrent drug use (11.3%). The percentage of condom use (last sexual intercourse) with primary and casual partners was lowest in the MMT at urban DHCs. Patients at the rural DHC reported very high proportions of pain/discomfort (37.8%), anxiety/depression (43.1%), and mobility (13.3%). In regression models, poorer HRQOL outcomes were found in MMT models in the rural areas or without general health care, and among those patients who were HIV positive, reported concurrent drug use, and had higher numbers of previous drug rehabilitation episodes. Mobility and anxiety/depression are factors that increased the likelihood of concurrent drug use among MMT patients. Outcomes of MMT were diverse across different integrative service models. Policies on rapid expansion of the MMT program in Vietnam should also emphasize on the integration with comprehensive health care services including psychological supports for patients.

  9. Farm-level risk factors for fish-borne zoonotic trematode infection in integrated small-scale fish farms in northern Vietnam.

    Van Thi Phan

    Full Text Available BACKGROUND: Northern Vietnam is an endemic region for fish-borne zoonotic trematodes (FZT, including liver and intestinal flukes. Humans acquire the FZT infection by eating raw or inadequately cooked fish. The production of FZT-free fish in aquaculture is a key component in establishing a sustainable program to prevent and control the FZT transmission to humans. Interventions in aquaculture should be based on knowledge of the main risk factors associated with FZT transmission. METHODOLOGY/PRINCIPAL FINDINGS: A longitudinal study was carried out from June 2006 to May 2007 in Nam Dinh province, Red River Delta to investigate the development and risk factors of FZT infections in freshwater cultured fish. A total of 3820 fish were sampled six times at two-month intervals from 96 fish farms. Logistic analysis with repeated measurements was used to evaluate potential risk factors based on information collected through questionnaire interviews with 61 fish farm owners. The results showed that the FZT infections significantly increased from first sampling in June to July 2006 (65% to sixth sampling in April to May, 2007 (76%. The liver fluke, Clonorchis sinensis and different zoonotic intestinal flukes including Haplochis pumilio, H. taichui, H. yokogawai, Centrocestus formosanus and Procerovum varium were found in sampled fish. Duration of fish cultured (sampling times, mebendazole drug self-medication of household members, presence of snails in the pond, and feeding fish with green vegetation collected outside fish farms all had a significant effect on the development of FZT prevalence in the fish. CONCLUSIONS/SIGNIFICANCE: The FZT prevalence in fish increased by 11 percentage points during a one-year culture period and the risk factors for the development of infection were identified. Results also highlight that the young fish are already highly infected when stocked into the grow-out systems. This knowledge should be incorporated into control

  10. Barriers to accessing and using health insurance cards among methadone maintenance treatment patients in northern Vietnam.

    Tran, Bach Xuan; Boggiano, Victoria L; Nguyen, Cuong Tat; Nguyen, Long Hoang; Le Nguyen, Anh Tuan; Latkin, Carl A


    Methadone maintenance treatment (MMT) patients face unique costs associated with their healthcare expenditures. As such, it is important that these patients have access to health insurance (HI) to help them pay for both routine and unforeseen health services. In this study, we explored factors related to health insurance enrollment and utilization among MMT patients, to move Vietnam closer to universal coverage among this patient population. A cross-sectional study was conducted with 1003 patients enrolled in MMT in five clinics in Hanoi and Nam Dinh provinces. Patients were asked a range of questions about their health, health expenditures, and health insurance access and utilization. We used multivariate logistic regressions to determine factors associated with health insurance access among participants. The majority of participants (nearly 80%) were not currently enrolled in health insurance at the time of the study. Participants from rural regions were significantly more likely than urban participants to report difficulty using HI. Family members of participants from rural regions were more likely to have overall poor service quality through health insurance compared with family members of participants from urban regions. Overall, 37% of participants endorsed a lack of information about HI, nearly 22% of participants reported difficulty accessing HI, 22% reported difficulty using HI, and more than 20% stated they had trouble paying for HI. Older, more highly educated, and employed participants were more likely to have an easier time accessing HI than their younger, less well educated, and unemployed counterparts. HIV-positive participants were more likely to have sufficient information about health insurance options. Our study highlights the dearth of health insurance utilization among MMT patients in northern Vietnam. It also sheds light on factors associated with increased access to and utilization of health insurance among this underserved population. These

  11. Yield-related salinity tolerance traits identified in a nested association mapping (NAM) population of wild barley

    Saade, Stephanie; Maurer, Andreas; Shahid, Mohammed; Oakey, Helena; Schmö ckel, Sandra M.; Negrã o, Só nia; Pillen, Klaus; Tester, Mark A.


    -validation of loci, which, along with two years of phenotypic data collected from plants irrigated with fresh and saline water, improved statistical power. We dissect the genetic architecture of flowering time under high salinity and we present genes putatively

  12. Findings and Recommendations Based on Two Reports on Insights into the Role of Women in South Viet Nam


    formerly called for training in fine embroidery , in music, in running a household efficiently yet maintaining a good deal of -6- personal charm. This...institutions ... ... 2 Sewing or embroidery ... ... ...... ... ... 2 Weaving cloth (cottage industry) ... ... ... ... 1 Agriculture (raising fish...8217.-oman, but she should have less education than my son. She should know how to sew, do pretty embroidery ; she should manage the house and know how to

  13. Vliv tepelného namáhání na interakci moravské droby s vodou

    Handzelová, B.; Martinec, Petr; Ščučka, Jiří; Vičarová, H.


    Roč. 13, č. 1 (2013), s. 31-38 ISSN 1804-4824 R&D Projects: GA MŠk ED2.1.00/03.0082 Institutional support: RVO:68145535 Keywords : greywacke * water absorption * evaporation * thermal stability * porosity Subject RIV: DB - Geology ; Mineralogy

  14. Situation analysis of quality of abortion care in the main maternity hospital in Hai Phòng, Viet Nam

    Nguyen, My H Ng; Gammeltoft, Tine; Rasch, Vibeke


    observations. Both the women and the staff equated quality of care mainly with improved technical performance of abortion. Insufficient knowledge and skills had a negative impact on provision of information and good quality counselling in relation to understanding and uptake of contraception, treating...

  15. The highest priority: how can the NAM countries continue to expand and improve the ways they learn from each other?

    Suyono, H


    The author opens with a discussion of the content of population programs and the ongoing process of learning from and helping each other. Population programs used to be so narrowly defined that they were detached from important sociocultural, economic, and political realities. That definition, however, is now expanding beyond the notions of demography and family planning to accommodate the need to adjust programs to meet family needs and not vice versa. Family development is called for instead of family planning. His experience in Indonesia has shown him that simple solutions tend not to work; strong and consistent political commitment to the promotion of development is needed; bureaucrats must be honest, competent, and committed to national development; self-sustained development will not happen unless people feel they have a stake in it as both recipients and decision makers; a community-based approach is required; coercion has no place in population programs; and women are more important than men. The author also discusses how advances in science and technology initially exacerbate inequalities, the potentially positive role of governments, keys to a viable population program, making a stronger contribution, and how to pay for South-South collaboration.

  16. Yield-related salinity tolerance traits identified in a nested association mapping (NAM) population of wild barley

    Saade, Stephanie


    Producing sufficient food for nine billion people by 2050 will be constrained by soil salinity, especially in irrigated systems. To improve crop yield, greater understanding of the genetic control of traits contributing to salinity tolerance in the field is needed. Here, we exploit natural variation in exotic germplasm by taking a genome-wide association approach to a new nested association mapping population of barley called HEB-25. The large population (1,336 genotypes) allowed cross-validation of loci, which, along with two years of phenotypic data collected from plants irrigated with fresh and saline water, improved statistical power. We dissect the genetic architecture of flowering time under high salinity and we present genes putatively affecting this trait and salinity tolerance. In addition, we identify a locus on chromosome 2H where, under saline conditions, lines homozygous for the wild allele yielded 30% more than did lines homozygous for the Barke allele. Introgressing this wild allele into elite cultivars could markedly improve yield under saline conditions. © 2016 The Author(s).

  17. Aetiologies of Central Nervous System Infection in Viet Nam: A Prospective Provincial Hospital-Based Descriptive Surveillance Study

    Ho Dang Trung, Nghia; Le Thi Phuong, Tu; Wolbers, Marcel; Nguyen van Minh, Hoang; Nguyen Thanh, Vinh; van, Minh Pham; Thieu, Nga Tran Vu; van, Tan Le; Song, Diep To; Thi, Phuong Le; Thi Phuong, Thao Nguyen; van, Cong Bui; Tang, Vu; Ngoc Anh, Tuan Hoang; Nguyen, Dong; Trung, Tien Phan; Thi Nam, Lien Nguyen; Kiem, Hao Tran; Thi Thanh, Tam Nguyen; Campbell, James; Caws, Maxine; Day, Jeremy; de Jong, Menno D.; van Vinh, Chau Nguyen; van Doorn, H. Rogier; Tinh, Hien Tran; Farrar, Jeremy; Schultsz, Constance; Loi, Tran Quoc; Son, Nguyen Truong; Bay, Phan Van Be; Tham, Nguyen Thi Hong; Phuong, Le Thi; Tri, Le Trung; Binh, Nguyen Thi Nguyet; Du, Doan Cong; Thao, Nguyen Thi Phuong; Tien, Truong Thi My; La, Tran Thi Phi; Cong, Bui Van; Diep, Pham Ngoc; Dong, Duong Phuoc; Lanh, Tran Thi Mong; Dom, Pham Van; Dung, Tran Quang; Tri, Phan Nhut; Ho, Tang Thi; Tai, Nguyen Anh; Luc, Quach Van; Phuoc, Dinh Xuan


    Background: Infectious diseases of the central nervous system (CNS) remain common and life-threatening, especially in developing countries. Knowledge of the aetiological agents responsible for these infections is essential to guide empiric therapy and develop a rational public health policy. To date

  18. Edgar Savisaar : "Nam vmeste reshat problemõ i nahhodit kompromissõ ..." / Edgar Savisaar ; interv. Aleksandr Ikonnikov

    Savisaar, Edgar, 1950-


    Tallinna linnapea Edgar Savisaar Eesti ja Tallinna arengust pärast taasiseseisvumist, ettevõtlusest ja selle soodustamisest pealinnas, tähtsamatest ehitusobjektidest Tallinnas 2007. ja 2008. aastal

  19. The Innovative Structure Solution for Preventing Salt Intrusion and Retaining Freshwater In Mekong Delta VietNam

    Hong, S.T.; Vrijling, J.K.; Stive, M.J.F.


    In the Mekong Delta Vietnam, the construction of sluices with the purpose of retaining fresh water and preventing salt water intrusion potentially plays a very important role. However, the structures constructed in small rivers according to local or traditional technology revealed many disadvantages

  20. Comparison of elevation derived from insar data with dem from topography map in Son Dong, Bac Giang, Viet Nam

    Nguyen, Duy


    Digital Elevation Models (DEMs) are used in many applications in the context of earth sciences such as in topographic mapping, environmental modeling, rainfall-runoff studies, landslide hazard zonation, seismic source modeling, etc. During the last years multitude of scientific applications of Synthetic Aperture Radar Interferometry (InSAR) techniques have evolved. It has been shown that InSAR is an established technique of generating high quality DEMs from space borne and airborne data, and that it has advantages over other methods for the generation of large area DEM. However, the processing of InSAR data is still a challenging task. This paper describes InSAR operational steps and processing chain for DEM generation from Single Look Complex (SLC) SAR data and compare a satellite SAR estimate of surface elevation with a digital elevation model (DEM) from Topography map. The operational steps are performed in three major stages: Data Search, Data Processing, and product Validation. The Data processing stage is further divided into five steps of Data Pre-Processing, Co-registration, Interferogram generation, Phase unwrapping, and Geocoding. The Data processing steps have been tested with ERS 1/2 data using Delft Object-oriented Interferometric (DORIS) InSAR processing software. Results of the outcome of the application of the described processing steps to real data set are presented.

  1. Gender, Alcohol Consumption Patterns, and Engagement in Sexually Intimate Behaviors among Adolescents and Young Adults in Nha Trang, Viet Nam

    Kaljee, Linda M.; Green, Mackenzie S.; Zhan, Min; Riel, Rosemary; Lerdboon, Porntip; Lostutter, Ty W.; Tho, Le Huu; Luong, Vo Van; Minh, Truong Tan


    A randomly selected cross-sectional survey was conducted with 880 youth (16 to 24 years) in Nha Trang City to assess relationships between alcohol consumption and sexual behaviors. A timeline followback method was employed. Chi-square, generalized logit modeling and logistic regression analyses were performed. Of the sample, 78.2% male and 56.1%…

  2. The Impact of Hydrodynamics in Erosion - Deposition Process in Can Gio Mangrove Biosphere Reserve, South Viet Nam

    Vo-Luong, H. P.


    Can Gio Mangrove Biosphere Reserve is always considered as a friendly green belt to protect and bring up the habitants. However, recently some mangrove areas in the Dong Tranh estuary are being eroded seriously. Based on the field measurements in SW and NE monsoons as well as data of topography changes in 10 years, it is proved that hydrodynamics of waves, tidal currents and riverine currents are the main reasons for erosion-deposition processes at the studied site. The erosion-deposition process changes due to monsoon. The analysed results show that high waves and tidal oscillation cause the increase of the erosion rate in NE monsoon. However, high sediment deposition occurs in SW monsoon due to weak waves and more alluvium from upstream. Many young mangrove trees grow up and develop in the SW monsoon. From the research, it is strongly emphasized the role of mangrove forests in soil retention and energy dissipation.

  3. Long-term outcomes of patients with Streptococcus suis infection in Viet Nam: A case-control study.

    Huong, Vu T L; Long, Hoang B; Kinh, Nguyen V; Ngan, Ta T D; Dung, Vu T V; Nadjm, Behzad; van Doorn, H Rogier; Hoa, Ngo T; Horby, Peter; Wertheim, Heiman F L


    Streptococcus suis is a zoonotic cause of severe meningitis and sepsis in humans. We aimed to assess the long-term outcomes in patients who survived S. suis infection, in particular the progress and impact of vestibulocochlear sequelae. This case-control study evaluated outcomes of S. suis infection at discharge and 3 and 9 months post-discharge for 47 prospectively enrolled cases and at 11-34 months for 31 retrospectively enrolled cases. Outcomes in patients were compared to 270 controls matched for age, sex and residency. The prevalence ratio (PR) of moderate-to-complete hearing loss was 5.0(95%CI 3.6-7.1) in cases at discharge, 3.7(2.5-5.4) at 3 months, 3.2(2.2-4.7) at 9 months, and 3.1(2.1-4.4) in retrospective cases compared to controls. Hearing improvement occurred mostly within the first 3 months with a change in hearing level of 11.1%(95%CI 7.0-15.1%) compared to discharge. The PR of vestibular dysfunction was 2.4(95%CI 1.7-3.3) at discharge, 2.2(1.4-3.1) at 3 months, 1.8(1.1-2.5) at 9 months, and 1.8(1.1-2.6) for retrospective cases compared to controls. Cases also indicated more problems with mobility, self-care and usual activities. Both hearing and vestibular impairment were common and persist in cases. Appropriate patient management strategies are needed to reduce the incidence and impact of these sequelae. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

  4. Infection control and tuberculosis among health care workers in Viet Nam, 2009-2013: a cross-sectional survey.

    Tiemersma, Edine W; Huong, Nguyen Thien; Yen, Pham Hoang; Tinh, Bui Thi; Thuy, Tran Thi Bich; Van Hung, Nguyen; Mai, Nguyen Thanh; Verver, Suzanne; Gebhard, Agnes; Nhung, Nguyen Viet


    Data on tuberculosis (TB) among health care workers (HCW) and TB infection control (TBIC) indicators are rarely available at national level. We assessed multi-year trends in notification data of TB among HCW and explored possible associations with TBIC indicators. Notified TB incidence among HCW and 3 other TBIC indicators were collected annually from all 64 provincial and 3 national TB facilities in Vietnam. Time trends in TB notification between 2009 and 2013 were assessed using linear regression analysis. Multivariate regression models were applied to assess associations between the facility-specific 5-year notification rate and TBIC indicators. Forty-seven (70 %) of 67 facilities contributed data annually over five years; 15 reported at least one HCW with TB in 2009 compared to six in 2013. The TB notification rate dropped from 593 to 197 per 100,000 HCW (p trend  = 0.02). Among 104 TB cases reported, 30 were employed at TB wards, 24 at other clinical wards, ten in the microbiology laboratory, six at the MDR-TB ward, and 34 in other positions. The proportion of facilities with a TBIC plan and focal person remained relatively stable between 70 % and 84 %. The proportion of facilities providing personal protective equipment (PPE) to their staff increased over time. Facilities with a TBIC focal person were 7.6 times more likely to report any TB cases than facilities without a focal person. The TB notification rates among HCW seemed to decrease over time. Availability of PPE increased over the same period. Appointing a TBIC focal person was associated with reporting of TB cases among HCW. It remains unclear whether TBIC measures helped in reduction of the TB notification rates in HCW.

  5. Sediment budget as affected by construction of a sequence of dams in the lower Red River, Viet Nam

    Lu, Xi Xi; Oeurng, Chantha; Le, Thi Phuong Quynh; Thuy, Duong Thi


    Dam construction is one of the main factors resulting in riverine sediment changes, which in turn cause river degradation or aggradation downstream. The main objective of this work is to examine the sediment budget affected by a sequence of dams constructed upstream in the lower reach of the Red River. The study is based on the longer-term annual data (1960-2010) with a complementary daily water and sediment data set (2008-2010). The results showed that the stretch of the river changed from sediment surplus (suggesting possible deposition processes) into sediment deficit (possible erosion processes) after the first dam (Thac Ba Dam) was constructed in 1972 and changed back to deposition after the second dam (Hoa Binh Dam) was constructed in 1985. The annual sediment deposition varied between 1.9 Mt/y and 46.7 Mt/y with an annual mean value of 22.9 Mt/y (1985-2010). The sediment deposition at the lower reach of the Red River would accelerate river aggradation which would change river channel capacity in the downstream of the Red River. The depositional processes could be sustained or changed back to erosional processes after more dams (the amount of sediment deposit was much less after the latest two dams Tuyen Quang Dam in 2009 and Sonla Dam in 2010) are constructed, depending on the water and sediment dynamics. This study revealed that the erosional and depositional processes could be shifted for the same stretch of river as affected by a sequence of dams and provides useful insights in river management in order to reduce flood frequency along the lower reach of the Red River.

  6. Viet Nam. Grade Six, Unit One. 6.1. Comprehensive Social Studies Curriculum for the Inner City.

    Thompson, Fred

    This sixth grade unit is one of a sequential learning series of the Focus On Inner City Social Studies (FICSS) project developed in accordance with the needs and problems of an urban society. A description of the project is provided in SO 008 271. The units are designed to help students investigate the conditions under which people in other…

  7. Vulnerability and Risk of Agro-ecosystems Facing Increased Salinity Intrusion in the Mekong Delta, Viet Nam

    Renaud, F.; Sebesvari, Z.; Nguyen, M. T.; Hagenlocher, M.


    The Vietnamese portion of the Mekong Delta increasingly suffers from salinity intrusion in its freshwater system, as exemplified by the historically high salinity levels recorded during the 2016 dry season. Although this exceptional situation was linked to the El Niño phenomena, many factors contribute to an increasing salinization of coastal areas. Salinity intrusion is a natural process in this tidal area but its extent is increasing and projected to worsen due to increased demand for water, diversion/storage of water flows in the Mekong river and its tributaries, land subsidence linked to groundwater over-abstraction, changes in land use and water management in coastal areas, and sea level rise. The Mekong Delta remains predominantly an agricultural landscape which contributes the majority of the rice, aquaculture, and fruit production of the country. These systems will need to be adapted to increased salinity levels. We will present results from two research projects, DeltAdapt and DELTAS, which were designed to allow understanding of, respectively (1) the main drivers of change of agro-ecosystems in coastal areas of the delta and (2) the relative vulnerabilities and risks deltaic social-ecological systems face with respect to various environmental hazards. We used the Global Delta Vulnerability Index developed within the DELTAS project to characterize the vulnerabilities and risks faced by coastal provinces of the delta with respect to salinity intrusion. The analysis allows us to understand which social, economic, and ecological variables index explain the relative vulnerability of the provinces. In addition, drivers of change (e.g. policy, economic, social, environmental) of coastal agro-ecosystems were systematically analyzed through 80 interviews and 7 focus group discussions in the provinces of Kien Giang and Soc Trang within the DeltAdapt project. This was combined with the analysis of Vietnamese policies to determine which are the important drivers of change in the region and how these contribute (or not) to the adaptation of agro-ecosystems facing increased salinity intrusion. By combining these results, we will point to potential policies that could be considered by various authorities to allow for a greater adaptability of agro-ecosystems in the coastal provinces of the region.

  8. Carbon dioxide and water vapour exchange in a tropical dry forest as influenced by the North American Monsoon System (NAMS)

    To better understand the effects and relationship between precipitation, net ecosystem carbon dioxide (NEE) and water vapor exchange (ET), we report a study conducted in the tropical dry forest (TDF) in the northwest of Mexico. Ecosystem gas exchange was measured using the eddy correlation technique...

  9. Vliv typu vazby historického zdiva na jeho teplotní namáhání

    Beran, Pavel


    Roč. 22, č. 10 (2013), s. 248-253 ISSN 1805-2576 R&D Projects: GA ČR(CZ) GBP105/12/G059 Institutional support: RVO:68378297 Keywords : thermal expansion * masonry * thermal stress * compatibility Subject RIV: JN - Civil Engineering

  10. Production porcine dans les fermes d'Etat à Ho-Chi-Minh Ville/Viet-nam

    Franceschetto, ML.


    Full Text Available Pig production in State farms at Ho-Chi-Minh Ville. Vietnam. An inquiry carried out in Guinea has revealed that the disappearance of trypanotolerance within some local N'Dama cattle can not be attributed to the vaccination campaign initiated against infectious bovine pleuropneumonia but to diverse environmental and animal management factors prevalant in these areas.

  11. Agent-based modelling of shifting cultivation field patterns, Vietnam

    Jepsen, Martin Rudbeck; Leisz, S.; Rasmussen, K.


    Shifting cultivation in the Nghe An Province of Vietnam's Northern Mountain Region produces a characteristic land-cover pattern of small and larger fields. The pattern is the result of farmers cultivating either individually or in spatially clustered groups. Using spatially explicit agent...

  12. Biodegradation of organ chlorine pesticides in contaminated soil collected from Yen Tap, Cam Khe, Phu Tho

    Nguyen Thuy Binh; Nguyen Van Toan; Pham Thi Thai; Dinh Thi Thu Hang


    Biodegradation of POPs contaminant in soil collected from Phu Tho province and Nghe An province had carried out. The process comprises treating soil, which contains anaerobic and aerobic microbes capable of transforming lindane and DDT into harmless material and being under anaerobic and aerobic steps. Significant biodegradation of POPs contaminants occurred in there tests. But some of toxic organic compounds remained. (author)


    Le, Anh Thi Kim; Vu, Lan Hoang; Schelling, Esther


    Economic transition ( DoiMoi ) in the 1980s in Viet Nam has led to internal migration, particularly rural-to-urban migration. Many studies suggested that there is a difference between non-migrants and migrants in using health care services. Current studies have mostly focused on migrants working in industrial zones (IZs) but migrants working in private small enterprises (PSEs) and seasonal migrants seem to be ignored. However, these two groups of migrants are more vulnerable in health care access than others because they usually work without labor contracts and have no health insurance. The study aims to compare the utilization of health care services and explore its correlated factors among these three groups. This cross-sectional study included 1800 non-migrants and migrants aged 18-55 who were selected through stratified sampling in Long Bien and Ba Dinh districts, Hanoi. These study sites consist of large industrial zones and many slums where most seasonal migrants live in. A structured questionnaire was used to collect information on health service utilization in the last 6 months before the study. Utilization of heath care services was identified as "an ill person who goes to health care centers to seek any treatment (i.e. both private and public health care centers)". 644 of 1800 participants reported having a health problem in the last 6 months before the study. Among these 644 people, 335 people used health care services. The percentage of non-migrants using health care service was the highest (67.6%), followed by migrants working in IZ (53.7%), migrants working in PSE (44%), and seasonal migrants (42%). Multivariate logistic regression showed migrants, especially seasonal migrants and migrants working in PSE, were less likely to use health care services (OR=0.35, p=0.016 and 0.38, p= 0.004, respectively), compared to non-migrants. The study also found that having no health insurance was a risk factor of the utilization (OR=0.29, pincome were not related

  14. Motivation to quit smoking among HIV-positive smokers in Vietnam.

    Nguyen, Nhung Thi Phuong; Tran, Bach Xuan; Hwang, Lu Y; Markham, Christine M; Swartz, Michael D; Vidrine, Jennifer I; Phan, Huong Thu Thi; Latkin, Carl A; Vidrine, Damon J


    Smoking cessation is emerging as an important component in current HIV care to reduce smoking-related adverse health outcomes. This study aimed to examine motivation to quit and its associated factors in a sample of 409 HIV-positive smokers in Vietnam. A cross-sectional survey was conducted from January to September 2013 in Hanoi (the capital) and Nam Dinh (a rural city). Motivation to quit was measured by a 4-point single item, and was dichotomized as having any motivation versus no motivation. Smoking history, nicotine dependence (Fagerstrom Test of Nicotine Dependence), and other covariates were self-reported by participants. Multivariate logistic regression was performed to identify correlates of motivation to quit. The sample was mostly male (97%). Mean age was 36 years (SD = 5.8). Approximately 37% and 69% of the sample were hazardous drinkers and ever drug users, respectively. The mean duration of HIV infection and ART treatment were 6 years (SD = 3.6) and 5 years (SD = 2.2), respectively. Overall, 59% of the sample was motivated to quit. Factors significantly associated with motivation to quit were income, pain, currently taking Methadone, and the interaction between binge drinking and lifetime drug use. Individuals with the highest income level (OR = 2.2, 95% CI = 1.3-3.6), moderate income level (OR = 1.8, 95% CI = 1.1-3.1), and currently feeling pain (OR = 1.6, 95% CI = 1.0-2.5) were more likely to be motivated to quit. Conversely, taking Methadone was associated with a lower likelihood of motivation to quit (OR = 0.4, 95% CI = 0.2-0.9). Also, those who reported binge drinking only (OR = 0.5, 95% CI = 0.3-0.9), lifetime drug use only (OR = 0.3, 95% CI = 0.1, 0.7), or both substance uses (OR = 0.4, 95% CI = 0.2, 0.8) were less motivated to quit smoking. Smoking cessation treatment should be integrated into HIV care in Vietnam, and should be tailored to meet specific needs for

  15. Presurgical nasoalveolar molding therapy in cleft lip and palate individuals: Case series and review

    Narayan H Gandedkar


    Full Text Available The nasoalveolar molding (NAM therapy is advocated to reduce the severity of alveolar cleft and nasal deformity. NAM therapy has demonstrated to be an effective method for reducing cleft and improve nose anatomy. This paper presents a case report of three cleft lip and palate individuals treated with NAM therapy. Furthermore, the paper highlights the advantages of NAM therapy along with an enumeration of literature suggesting in favor of NAM therapy and otherwise. Regardless of controversies and divergent views involved with NAM therapy, the immediate success of NAM therapy facilitating primary lip repair surgery cannot be under-emphasized.

  16. Economic critique of Nam Theun-Hinboun Hydropower Project and electricity development in Laos: proposal for an alternative path to development

    Adams, T.


    A proposed alternative to the development of a large-scale hydropower project in Laos was presented. The alternative is intended to help make electricity development sustainable over the long term and to benefit the citizens of Laos. The author carefully analyzed the Asian Development Bank report RRP: Laos 27325 of October 1994. He concluded that as presently constituted, the project is likely to fail as an investment and is likely to result in a significant net financial liability. Water resources are one of Laos' greatest assets and the future uses of Laotian rivers could be lost in order to achieve near-term electricity development. It was suggested that Laos should follow three key principles in the development of its electricity sector: maximize economic efficiency, ensure that the government acts as a regulator and not as an investor, and ensure the protection of property rights of citizens and investors. Relevant aspects of the experience with electricity development in Canada were also outlined

  17. Od naměřených dat k jejich matematickému popisu pomocí funkce - a zase zpátky

    Segeth, Karel


    Roč. 60, č. 2 (2015), s. 133-147 ISSN 0032-2423 Institutional support: RVO:67985840 Keywords : measurement * interpolation * approximation Subject RIV: BA - General Mathematics

  18. Emergence of New Delhi metallo-beta-lactamase 1 and other carbapenemase-producing Acinetobacter calcoaceticus-baumannii complex among patients in hospitals in Ha Noi, Viet Nam.

    Tran, D N; Tran, H H; Matsui, M; Suzuki, M; Suzuki, S; Shibayama, K; Pham, T D; Van Phuong, T T; Dang, D A; Trinh, H S; Loan, C T; Nga, L T V; van Doorn, H R; Wertheim, H F L


    Acinetobacter baumannii is an important cause of multidrug-resistant hospital acquired infections in the world. Here, we investigate the presence of NDM-1 and other carbapenemases among carbapenem-resistant A. baumannii isolated between August 2010 and December 2014 from three large hospitals in Hanoi, Vietnam. We identified 23/582 isolates (4 %) (11 from hospital A, five from hospital B, and seven from hospital C) that were NDM-1 positive, and among them 18 carried additional carbapenemase genes, including seven isolates carrying NDM-1, IMP-1, and OXA-58 with high MICs for carbapenems. Genotyping indicated that NDM-1 carrying A. baumannii have expanded clonally in these hospitals. Five new STs (ST1135, ST1136, ST1137, ST1138, and ST1139) were identified. One isolate carried NDM-1 on a plasmid belonging to the N-repA replicon type; no NDM-1-positive plasmids were identified in the other isolates. We have shown the extent of the carbapenem resistance and the local clonal spread of A. baumannii carrying NDM-1 in these hospitals; coexistence of NDM-1 and IMP-1 is reported for the first time from Vietnam here, and this will further seriously limit future therapeutic options.

  19. Emergence of New Delhi metallo-beta-lactamase 1 and other carbapenemase-producing Acinetobacter calcoaceticus-baumannii complex among patients in hospitals in Ha Noi, Viet Nam

    Tran, D.N.; Tran, H.H.; Matsui, M.; Suzuki, M.; Suzuki, S.; Shibayama, K.; Pham, T.D.; Phuong, T.T. Van; Dang, D.A.; Trinh, H.S.; Loan, C.T.; Nga, L.T.; Doorn, H.R. van; Wertheim, H.F.L.


    Acinetobacter baumannii is an important cause of multidrug-resistant hospital acquired infections in the world. Here, we investigate the presence of NDM-1 and other carbapenemases among carbapenem-resistant A. baumannii isolated between August 2010 and December 2014 from three large hospitals in

  20. Constraints on efficiency of artificial insemination and effect of nutrition on reproductive performance of dairy cattle in small holder farms in Viet Nam

    Chung Anh Dzung; Le Xuan Cuong; Vuong Ngoc Long; Dinh Van Cai; Dang Phuoc Chung; Pham Ho Hai


    This report is the result of a survey on 564 cows subjected to artificial insemination (AI) from March 1995 to March 1996 in 4 districts around Ho Chi Minh City. Four inseminators filled in questionnaires relating to farms, semen batches, cows and inseminations done. Milk samples were collected and analysed for progesterone by radioimmunoassay (RIA). All raw data were stored and analysed by the computer program AIDA (Artificial Insemination Database Application). Conception rate at first service (FSCR) was 61.7% and overall conception rate (OCR) was 68.4%. The intervals from calving to first service (CSI) and calving to conception (CCI) were 108 days 119 days respectively. Cows with lower percentage of Holstein-Friesian (HF) blood had shorter CSI and CCI than those with higher percentage of HF blood. Other factors which influenced OCR, CSI and CCI were parity, high milk yield (>20 L/cow/day), inappropriate heat signs, slight degree of uterine tone, feeding without green grass, too early or too late intervals from heat signs to AI, time of AI and difficulty in passage of AI pipette. Progesterone measurement in 796 sets of milk samples indicated that AI in 546 cows (68.6%) resulted in conception and they were subsequently diagnosed pregnant, while 24 animals (3%) conceived but underwent late embryo mortality. In 146 cows (18.3%) AI was done in the follicular phase but conception did not occur. There were 73 cows (9.1%) where progesterone values were intermediate (1-3 nmol/L). Ninety-four Holstein crossbred cows (F1 and F2) were assigned into three groups by different metabolisable energy (ME) ratios between demand and supply in order to determine effect of nutritive value of rations on reproduction. The cows in ME-balanced group were also divided into two sub-groups by different quantity of green grass in the ration to evaluate influence of the latter on fertility. Results showed that only cows fed with balanced rations in ME achieved good fertility (calving to first heat 59 days, CSI 74 days, CCI 96 days and services/conception 1.63). Moreover, when the feed fully provided ME and green grass (≥20 kg/head/day) reproductive performance increased considerably (calving to first heat reduced to 50 days, CSI to 64 days, CCI to 82 days and services/conception to 1.4). (author)

  1. Soil knowledge for farmers, farmer knowledge for soil scientists : the case of acid sulphate soils in the Mekong delta, Viet Nam

    Mensvoort, van M.E.F.


    Half the Mekong delta in Vietnam, i.e. around 2 million hectares, suffers soil related problems due to acid sulphate soils. These soils generate sulphuric acid due to the oxidation of pyrite after aeration. Pyrite is most easily formed in tidal swamps. Human interference through land

  2. Dietary exposure to aflatoxin B-1, ochratoxin A and fuminisins of adults in Lao Cai province, Viet Nam: A total dietary study approach

    Bui, Huong Mai; Le Danh Tuyen; Do Huu Tuan


    Aflatoxins, fumonisins and ochratoxin A that contaminate various agricultural commodities are considered of significant toxicity and potent human carcinogens. This study took a total dietary study approach and estimated the dietary exposure of these mycotoxins for adults living in Lao Cai province...... higher than recommended provisional tolerable daily intake (PTDI) values mainly due to contaminated cereals and meat. The exposure to total fumonisins (1400 ng/kg bw/day) was typically lower than the PTDI value (2000 ng/kg bw/day). The estimated risk of liver cancer associated with exposure to aflatoxin...... B1 was 2.7 cases/100,000 person/year. Margin of exposure (MOE) of renal cancer linked to ochratoxin A and liver cancer associated with fumonisins were 1124 and 1954, respectively indicating risk levels of public health concern. Further studies are needed to evaluate the efficiency of technical...

  3. Virus diseases risk-factors associated with shrimp farming practices in rice-shrimp and intensive culture systems in Mekong Delta Viet Nam

    Duc, P.M.; Tuyet Hoa, T.T.; Nguyen Thanh Phuong,; Bosma, R.H.; Huynh V., Hien; Tran N., Tuan


    In Mekong Delta, viral infection, including white spot syndrome virus (WSSV), monodon baculovirus (MBV), heptopancreatic parvovirus (HPV), infectious hypodermal and hematopoietic necrosis virus (IHHNV) and gill-associated nidovirus (GAV) frequently infect cultured shrimp starting at the postlarvae

  4. Dnes mě to mluvení namáhá. Moderní literatura mezi pokračováním a rozpadem

    Olšovský, Miroslav


    Roč. 13, č. 14 (2017), s. 18-19 ISSN 1803-6635 Institutional support: RVO:68378017 Keywords : modern literature * writing * evidence Subject RIV: AJ - Letters, Mass-media, Audiovision OBOR OECD: Specific literatures

  5. Drill bit seismic, vertical seismic profiling, and seismic depth imaging to aid drilling decisions in the Tho Tinh structure, Nam Con Son basin, Vietnam

    Borland, W; Hayashida, N; Kusaka, H; Leaney, W; Nakanishi, S


    This paper reviews the problem of overpressure, a common reason for acquiring look-ahead VSPs, and the seismic trace inversion problem, a fundamental issue in look-ahead prediction. The essential components of intermediate VSPs were examined from acquisition through processing to inversion, and recently acquired real data were provided, which were indicative of the advances being made toward developing an exclusive high resolution VSP service. A simple interpretation method and an end product of predicted mud weight versus depth were also presented, which were obtained from the inverted acoustic impedance and empirical relations. Of paramount importance in predicting the depth to a target was the velocity function used below the intermediate TD. The use of empirical or assumed density functions was an obvious weak link in the procedure. The advent of real-time time-depth measurements from drill bit seismic allowed a continuously updated predicted target depth below the present bit depth. 8 refs., 7 figs.

  6. Society News: GJI celebrates student authors; Celebrating 5000 years of astronomy at Stonehenge; New Fellows; Council nominations; NAM website opens; Going public;


    Geophysical Journal International has announced the winners of its 2009 Student Author Awards for the best papers in the field with young scientists as lead authors. The RAS and English Heritage celebrated the close of IYA2009 at Stonehenge from 16-19 December, with an event bringing archaeologists and astronomers together on the site to talk to the public. The following were elected to Fellowship of the Society on 11 December 2009:

  7. Longitudinal Household Trends in Access to Improved Water Sources and Sanitation in Chi Linh Town, Hai Duong Province, Viet Nam and Associated Factors.

    Tuyet-Hanh, Tran Thi; Long, Tran Khanh; Van Minh, Hoang; Huong, Le Thi Thanh


    This study aims to characterize household trends in access to improved water sources and sanitaton in Chi Linh Town, Hai Duong Province, Vietnam, and to identify factors affecting those trends. Data were extracted from the Chi Linh Health and Demographic Surveillance System (CHILILAB HDSS) database from 2004-2014, which included household access to improved water sources, household access to improved sanitation, and household demographic data. Descriptive statistical analysis and multinominal logistic regression were used. The results showed that over a 10-year period (2004-2014), the proportion of households with access to improved water and improved sanitation increased by 3.7% and 28.3%, respectively. As such, the 2015 Millennium Development Goal targets for safe drinking water and basic sanitation were met. However, 13.5% of households still had unimproved water and sanitation. People who are retired, work in trade or services, or other occupations were 1.49, 1.97, and 1.34 times more likely to have access to improved water and sanitation facilities than farming households, respectively ( p < 0.001). Households living in urban areas were 1.84 times more likely than those living in rural areas to have access to improved water sources and improved sanitation facilities (OR =1.84; 95% CI = 1.73-1.96). Non-poor households were 2.12 times more likely to have access to improved water sources and improved sanitation facilities compared to the poor group (OR = 2.12; 95% CI = 2.00-2.25). More efforts are required to increase household access to both improved water and sanitation in Chi Linh Town, focusing on the 13.5% of households currently without access. Similar to situations observed elsewhere in Vietnam and other low- and middle- income countries, there is a need to address socio-economic factors that are associated with inadequate access to improved water sources and sanitation facilities.

  8. Emergence of the Asian 1 Genotype of Dengue Virus Serotype 2 in Viet Nam: In Vivo Fitness Advantage and Lineage Replacement in South-East Asia

    Ty Hang, Vu Thi; Holmes, Edward C.; Veasna, Duong; Quy, Nguyen Thien; Tinh Hien, Tran; Quail, Michael; Churcher, Carol; Parkhill, Julian; Cardosa, Jane; Farrar, Jeremy; Wills, Bridget; Lennon, Niall J.; Birren, Bruce W.; Buchy, Philippe


    A better description of the extent and structure of genetic diversity in dengue virus (DENV) in endemic settings is central to its eventual control. To this end we determined the complete coding region sequence of 187 DENV-2 genomes and 68 E genes from viruses sampled from Vietnamese patients between 1995 and 2009. Strikingly, an episode of genotype replacement was observed, with Asian 1 lineage viruses entirely displacing the previously dominant Asian/American lineage viruses. This genotype replacement event also seems to have occurred within DENV-2 in Thailand and Cambodia, suggestive of a major difference in viral fitness. To determine the cause of this major evolutionary event we compared both the infectivity of the Asian 1 and Asian/American genotypes in mosquitoes and their viraemia levels in humans. Although there was little difference in infectivity in mosquitoes, we observed significantly higher plasma viraemia levels in paediatric patients infected with Asian 1 lineage viruses relative to Asian/American viruses, a phenotype that is predicted to result in a higher probability of human-to-mosquito transmission. These results provide a mechanistic basis to a marked change in the genetic structure of DENV-2 and more broadly underscore that an understanding of DENV evolutionary dynamics can inform the development of vaccines and anti-viral drugs. PMID:20651932

  9. Dietary exposure to aflatoxin B1, ochratoxin A and fuminisins of adults in Lao Cai province, Viet Nam: A total dietary study approach.

    Huong, Bui Thi Mai; Tuyen, Le Danh; Tuan, Do Huu; Brimer, Leon; Dalsgaard, Anders


    Aflatoxins, fumonisins and ochratoxin A that contaminate various agricultural commodities are considered of significant toxicity and potent human carcinogens. This study took a total dietary study approach and estimated the dietary exposure of these mycotoxins for adults living in Lao Cai province, Vietnam. A total of 42 composite food samples representing 1134 individual food samples were prepared according to normal household practices and analysed for the three mycotoxins. Results showed that the dietary exposure to aflatoxin B1 (39.4 ng/kg bw/day) and ochratoxin A (18.7 ng/kg bw/day) were much higher than recommended provisional tolerable daily intake (PTDI) values mainly due to contaminated cereals and meat. The exposure to total fumonisins (1400 ng/kg bw/day) was typically lower than the PTDI value (2000 ng/kg bw/day). The estimated risk of liver cancer associated with exposure to aflatoxin B1 was 2.7 cases/100,000 person/year. Margin of exposure (MOE) of renal cancer linked to ochratoxin A and liver cancer associated with fumonisins were 1124 and 1954, respectively indicating risk levels of public health concern. Further studies are needed to evaluate the efficiency of technical solutions which could reduce mycotoxin contamination as well as to determine the health effects of the co-exposure to different types of mycotoxins. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Longitudinal Household Trends in Access to Improved Water Sources and Sanitation in Chi Linh Town, Hai Duong Province, Viet Nam and Associated Factors

    Tran Thi Tuyet-Hanh


    Full Text Available Objective: This study aims to characterize household trends in access to improved water sources and sanitaton in Chi Linh Town, Hai Duong Province, Vietnam, and to identify factors affecting those trends. Method: Data were extracted from the Chi Linh Health and Demographic Surveillance System (CHILILAB HDSS database from 2004–2014, which included household access to improved water sources, household access to improved sanitation, and household demographic data. Descriptive statistical analysis and multinominal logistic regression were used. The results showed that over a 10-year period (2004–2014, the proportion of households with access to improved water and improved sanitation increased by 3.7% and 28.3%, respectively. As such, the 2015 Millennium Development Goal targets for safe drinking water and basic sanitation were met. However, 13.5% of households still had unimproved water and sanitation. People who are retired, work in trade or services, or other occupations were 1.49, 1.97, and 1.34 times more likely to have access to improved water and sanitation facilities than farming households, respectively (p < 0.001. Households living in urban areas were 1.84 times more likely than those living in rural areas to have access to improved water sources and improved sanitation facilities (OR =1.84; 95% CI = 1.73–1.96. Non-poor households were 2.12 times more likely to have access to improved water sources and improved sanitation facilities compared to the poor group (OR = 2.12; 95% CI = 2.00–2.25. More efforts are required to increase household access to both improved water and sanitation in Chi Linh Town, focusing on the 13.5% of households currently without access. Similar to situations observed elsewhere in Vietnam and other low- and middle- income countries, there is a need to address socio-economic factors that are associated with inadequate access to improved water sources and sanitation facilities.

  11. Applications of multispectral imagery to water resources development planning in the lower Mekong Basin (Khmer Republic, Laos, Thailand and Viet-Nam)

    Vankiere, W. J.


    The use of ERTS imagery for water resources planning in the lower Mekong Basin relates to three major issues: (1) it complements data from areas, which have been inaccessible in the past because of security; this concerns mainly forest cover of the watersheds, and geological features, (2) it refines ground surveys; this concerns mainly land forms, and soils of existing and planned irrigation perimeters, and (3) it provides new information, which would be almost or entirely impossible to detect with ground surveys or conventional photography; this concerns the mechanism of flooding and drainage of the delta; siltation of the Great Lake and mapping of acidity, possibly also of salinity, in the lower delta; sedimentation and fisheries in the Mekong Delta estuarine areas.

  12. Les chemins de traverse de l'Histoire: Des vues stéréoscopiques du Viêt Nam colonial prises par un Hollandais

    Kleinen, J.


    Négociant de Haarlem, Jan George Mulder a laissé plus d’un millier de photographies stéréoscopiques datant de son séjour dans l’Indochine coloniale française. John Kleinen, historien et anthropologue néerlandais s’est plongé dans cette collection unique pour en faire dire plus à ces images et à

  13. Experimental investigation and modelling approach of the impact of urban wastewater on a tropical river; a case study of the Nhue River, Hanoi, Viet Nam

    Duc, Trinh Anh; Vachaud, Georges; Bonnet, Marie Paule; Prieur, Nicolas; Loi, Vu Duc; Anh, Le Lan


    SummaryAnalyses of water quality and flow regime in combination with laboratory studies and ecological modelling were used to assess the water quality impact of pollution from to To Lich River that drains through Hanoi City and greatly contaminates the Nhue River. With an average discharge of 26.2 m 3/s, the Nhue River receives about 5.8 m 3/s of untreated domestic water from the city's main open-air-sewer - the To Lich River. The studies during 2002-2003 showed high concentrations of BOD (70 mg O 2/l), DOC (15 mg C/l), coliform (2.4e 6 MNP/100 ml), total phosphorus (3.5 mg P/l), and total nitrogen (31.6 mg N/l) in the To Lich, while DO level was less than 1 mg O 2/l. Such high loads of untreated wastewater impacted water quality in the Nhue River where DO decreased at times to as low as 1 mg O 2/l. The accumulation of particulate organic matter and micro-organisms in the sediments of the Nhue represented substantial sources of nutrients and sinks for DO. They are also considerable production of dissolved carbon dioxide at concentrations up to two orders of magnitude higher than pressure. Such pressures ( EpCO 2) are expected in polluted environments, but the results presented here are new for Vietnam and much of developing countries. A number of factors linked to field monitoring and laboratory measurements clearly indicate the importance of autotrophic over heterotrophic biological processes and sediments. An ecological model for management purposes has been developed that reliably estimates of the pollutant loads. An opportunity was taken to examine the changing impacts and processes when the To Lich was diverted from the Nhue. The monitoring and modelling of this opportunity showed low dissolved oxygen levels even if the impact from the To Lich was lessened. Alternatives are proposed to alleviate problems of water quality in the Nhue. It is concluded that the treatment of the To Lich River's water is highly recommended; otherwise a reduction to one third of current wastewater discharge is needed to bring water quality back to the environmental standard.

  14. A tool for sexual minority mental health research: The Patient Health Questionnaire (PHQ-9) as a depressive symptom severity measure for sexual minority women in Viet Nam.

    Nguyen, Trang Quynh; Bandeen-Roche, Karen; Bass, Judith K; German, Danielle; Nguyen, Nam Thi Thu; Knowlton, Amy R

    In a context with limited attention to mental health and prevalent sexual prejudice, valid measurements are a key first step to understanding the psychological suffering of sexual minority populations. We adapted the Patient Health Questionnaire as a depressive symptom severity measure for Vietnamese sexual minority women, ensuring its cultural relevance and suitability for internet-based research. Psychometric evaluation found that the scale is mostly unidimensional and has good convergent validity, good external construct validity, and excellent reliability. The sample's high endorsement of scale items emphasizes the need to study minority stress and mental health in this population.

  15. On the Armillary Sphere of NAM Byeong-Cheol-II: Translation of a chapter on how to use an armillary sphere in Uigijipseol

    Sang-Hyuk Kim


    Full Text Available This study is about , which constitutes Honcheonui(an armillary sphere part of "Uigijipseol" (Volume I together with and -dealt with earlier than this subject. The study's construction on the text of is organized into 15 categories, including installation, observations, instructions for use, astronomical theories and formulas, etc. This study provides easy-to-understand illustrations of the figures shown in the original and contains detailed descriptions of the related calculation procedures. In the ``Instructions for Use of Honcheonui" discussed here, the readers are introduced to astronomical computation systems, mainly based on spherical trigonometry and proportional methods. The section also provides systematic and detailed reviews of astronomical theories and calculation procedures, allowing you to assess the level of astronomy knowledge at that time.

  16. Integrated soil and water management in acid sulphate soils : balancing agricultural production and environmental requirements in the Mekong Delta, Viet Nam

    Le, Q.M.


    The objectives of this study in the Mekong delta, Vietnam, were: (1) to obtain a better understanding of the effects of soil physical properties and flow types on solute transport in ASS emphasing aluminum; (2) to quantify environmental hazards resulting from amelioration activities in

  17. Progress report on research of nuclear data and applied nuclear physics at nuclear research institute Viet Nam. For the period January 1 - December 31 1996

    Vuong Huu Tan


    This report contains information on activities of nuclear data and applied physics at the Nuclear Research Institute, Dalat, Vietnam for the period January 1st-December 31st 1996. The specific topics covered are the following: Development of filtered neutron beams. Investigation of average characteristics of nuclei in the unresolved enrgy region, Nuclear structure, Nuclear data for applications, Neutron beam utilization for applications, Nuclear analytical techniques and sedimentology

  18. Health services for reproductive tract infections among female migrant workers in industrial zones in Ha Noi, Viet Nam: an in-depth assessment

    Kim Le


    Full Text Available Abstract Background Rural-to-urban migration involves a high proportion of females because job opportunities for female migrants have increased in urban industrial areas. Those who migrate may be healthier than those staying in the village and they may benefit from better health care services at destination, but the 'healthy' effect can be reversed at destination due to migration-related health risk factors. The study aimed to explore the need for health care services for reproductive tract infections (RTIs among female migrants working in the Sai Dong industrial zone as well as their services utilization. Methods The cross sectional study employed a mixed method approach. A cohort of 300 female migrants was interviewed to collect quantitative data. Two focus groups and 20 in-depth interviews were conducted to collect qualitative data. We have used frequency and cross-tabulation techniques to analyze the quantitative data and the qualitative data was used to triangulate and to provide more in-depth information. Results The needs for health care services for RTI were high as 25% of participants had RTI syndromes. Only 21.6% of female migrants having RTI syndromes ever seek helps for health care services. Barriers preventing migrants to access services were traditional values, long working hours, lack of information, and high cost of services. Employers had limited interests in reproductive health of female migrants, and there was ineffective collaboration between the local health system and enterprises. These barriers were partly caused by lack of health promotion programs suitable for migrants. Most respondents needed more information on RTIs and preferred to receive these from their employers since they commonly work shifts - and spend most of their day time at work. Conclusion While RTIs are a common health problem among female migrant workers in industrial zones, female migrants had many obstacles in accessing RTI care services. The findings from this study will help to design intervention models for RTI among this vulnerable group such as communication for behavioural impact of RTI health care, fostered collaboration between local health care services and employer enterprises, and on-site service (e.g. local or enterprise health clinics strengthening.

  19. Influence of nasoalveolar molding on skeletal development in patients with unilateral cleft lip and palate at 5 years of age.

    Akarsu-Guven, Bengisu; Arisan, Arda; Ozgur, Figen; Aksu, Muge


    The aim of this retrospective study was to assess the influence of presurgical nasoalveolar molding (NAM) on skeletal development in patients with operated unilateral cleft lip and palate at 5 years of age. Lateral cephalometric radiographs of 26 unilateral cleft lip and palate patients who had undergone presurgical NAM (NAM group) and 20 unilateral cleft lip and palate patients who did not have any presurgical NAM (non-NAM group) were analyzed. The radiographs were digitally traced using Quick Ceph Studio software (version 3.5.1.r (1151); Quick Ceph Systems, San Diego, Calif). Independent samples t tests were performed for statistical analysis. No significant differences were observed in sagittal and vertical skeletal measurements between the NAM and non-NAM groups. NAM resulted in no significant difference in skeletal development in unilateral cleft lip and palate patients compared with those without NAM in early childhood. Copyright © 2018. Published by Elsevier Inc.

  20. Optimizing culture conditions for the production of endo-β-1,4 ...



    Sep 20, 2010 ... Vietnam Type Culture Collection (VTCC)-F099. Van Tuan Nguyen and Dinh Thi Quyen. Institute of Biotechnology, Vietnam Academy of Science and Technology, 18 Hoang Quoc Viet Road, Distr. Caugiay, ... sources (coconut fiber, coffee shell, corncob, dried tangerine skin, peanut shell, rice bran, saw dust,.

  1. Project CHECO Southeast Asia Report. USAF Civic Action in Republic of Vietnam


    designating each family as to religious affiliation, political aspiration , and economic status. Arrangements were made to secure building materials from...CA in Go Vap and Tan Binh Districts, Gia Dinh, 19 Jan 67. 17. (U) Interview with Lt Col J. F. Tarpley, 12 Feb 68; Various BCAO Reports. 18. (U) Ltr

  2. Bulletin of Materials Science | Indian Academy of Sciences

    Home; Journals; Bulletin of Materials Science. TRAN NGOC TUYEN. Articles written in Bulletin of Materials Science. Volume 41 Issue 1 February 2018 pp 6. Lead ions removal from aqueous solution using modified carbon nanotubes · NGUYEN DUC VU QUYEN TRAN NGOC TUYEN DINH QUANG KHIEU HO VAN MINH ...

  3. Resonance Ops: How Developing Social Movements Can Operationalize Ideologies


    Mobilization: An International Journal 1, no. 1 (September 1996): 1–15. Tzu , Sun . The Art of War. Translated by Samuel B. Griffith. New York: Oxford...PROFILE ....................................................................111  BIBLIOGRAPHY ...113 BIBLIOGRAPHY Andrews, William R. The Village War: Vietnamese Communist Revolutionary Activities in Dinh Tuong


    Home; Journals; Bulletin of Materials Science. PHAM THI NGOC LAN. Articles written in Bulletin of Materials Science. Volume 41 Issue 1 February 2018 pp 6. Lead ions removal from aqueous solution using modified carbon nanotubes · NGUYEN DUC VU QUYEN TRAN NGOC TUYEN DINH QUANG KHIEU HO VAN MINH ...

  5. nguyen duc vu quyen

    Home; Journals; Bulletin of Materials Science. NGUYEN DUC VU QUYEN. Articles written in Bulletin of Materials Science. Volume 41 Issue 1 February 2018 pp 6. Lead ions removal from aqueous solution using modified carbon nanotubes · NGUYEN DUC VU QUYEN TRAN NGOC TUYEN DINH QUANG KHIEU HO VAN ...


    Arumugam M. Optical fiber communication – An overview. 849. Arumugam P ... Spinning solitons in cubic-quintic nonlinear media. 1041. Dang Nguyen Dinh. E1 resonances in .... Measuring the top quark mass in the eµ chan- nel: A study. 689.

  7. Bibliography of Soviet Laser Developments, Number 20. April-June 1975


    SOURCE ABBREVIATION’S Acta physica polonica Bulletin de 1 Academie Polonaise des Sciences. Serie des Sciences Techniques Akademiya nauk Belorusskoy...Ponath, J, Klein, A. Lau, and Chu Dinh Thuy (NS). Raman backscattering by polaritons in LilO-j sirgle crystals. Physica status...izobreteniya, promyshlennyye obrazts/, tovarnyye znaki Physica status solidi Radiotekhnika Radiotekhnika i elektronika Referativnyy zhurnal

  8. Who is Responsible for Training the Civilian Members of the Provincial Reconstruction Teams (PRTs)


    Quoted from an interview conducted by AI. Hemingway , "CORDS: Winning Hearts and Minds in Vietnam," Vietnam Magazine, (February 1994). 82 Brig. Gen Dinh...Team-a model for coordination." Air University Review, July-August 1967. Hemingway , AI. "CORDS: Winning Hearts and Minds in Vietnam." Vietnam Magazine

  9. EDITORIAL: Precision proteins Precision proteins

    Demming, Anna


    large molecular weight, net negative charge and hydrophilicity of synthetic small interfering RNAs makes it hard for the molecules to cross the plasma membrane and enter the cell cytoplasm. Immune responses can also diminish the effectiveness of this approach. In this issue, Shiri Weinstein and Dan Peer from Tel Aviv University provide an overview of the challenges and recent progress in the use of nanocarriers for delivering RNAi effector molecules into target tissues and cells more effectively [5]. Also in this issue, researchers in Korea report new results that demonstrate the potential of nanostructures in neural network engineering [6]. Min Jee Jang et al report directional growth of neurites along linear carbon nanotube patterns, demonstrating great progress in neural engineering and the scope for using nanotechnology to treat neural diseases. Modern medicine cannot claim to have abolished the pain and suffering that accompany disease. But a comparison between the ghastly and often ineffective iron implements of early medicine and the smart gadgets and treatments used in hospitals today speaks volumes for the extraordinary progress that has been made, and the motivation behind this research. References [1] Wallis F 2000 Signs and senses: diagnosis and prognosis in early medieval pulse and urine texts Soc. Hist. Med. 13 265-78 [2] Arntz Y, Seelig J D, Lang H P, Zhang J, Hunziker P, Ramseyer J P, Meyer E, Hegner M and Gerber Ch 2003 Label-free protein assay based on a nanomechanical cantiliever array Nanotechnology 14 86-90 [3] Gowtham S, Scheicher R H, Pandey R, Karna S P and Ahuja R 2008 First-principles study of physisorption of nucleic acid bases on small-diameter carbon nanotubes Nanotechnology 19 125701 [4] Wang H-N and Vo-Dinh T 2009 Multiplex detection of breast cancer biomarkers using plasmonic molecular sentinel nanoprobes Nanotechnology 20 065101 [5] Weinstein S and Peer D 2010 RNAi nanomedicines: challenges and opportunities within the immune system

  10. Analysis of recombination QTLs, segregation distortion, and epistasis for fitness in maize multiple populations using ultra-high-density markers

    Understanding the maize genomic features would be useful for the study of genetic diversity and evolution and for maize breeding. Here, we used two maize nested association mapping (NAM) populations separately derived in China (CN-NAM) and the US (US-NAM) to explore the maize genomic features. The t...

  11. Review of the odd chrysidid genus Loboscelidia Westwood, 1874 (Hymenoptera, Chrysididae, Loboscelidiinae

    Lynn Kimsey


    Full Text Available The chrysidid genus Loboscelidia is reviewed and 11 new species are described, including L. cinnamonea (Borneo, L. fulgens (Viet Nam, L. fulva (Thailand, L. incompleta (India, L. kafae (Borneo, L. laminata (Viet Nam, L. meifungae (Borneo, L. nasiformis (Thailand, L. nitidula (Thailand, L. pecki (Viet Nam, and L. sisik (Borneo. A key to males of the species of Loboscelidia is given.

  12. Assessment of genetic diversity and population structure of Vietnamese indigenous cattle populations by microsatellites

    Pham, Lan Doan; Do, Duy Ngoc; Binh, Nguyen Trong


    Cattle play a very important role in agriculture and food security in Vietnam. A high level of cattle diversity exists and serves different needs of Vietnamese cattle keepers but has not yet been molecularly characterized. This study evaluates the genetic diversity and structure of Vietnamese...... geographic distances. Structure analysis indicated five homogeneous clusters. The Brahman, Lang Son, Ha Giang and U Dau Riu cattle were assigned to independent clusters while Nghe An, Thanh Hoa and Phu Yen cattle were grouped in a single cluster. We conclude that Vietnamese indigenous cattle have high levels...

  13. Transcriptional regulation by an NAC (NAM-ATAF1,2-CUC2) transcription factor attenuates ABA signalling for efficient basal defence towards Blumeria graminis f. sp hordei in Arabidopsis

    Jensen, Michael Krogh; Hagedorn, Peter; De Torres-Zabala, Marta


    -representation of abscisic acid (ABA)-responsive genes, including the ABA biosynthesis gene AAO3, which is significantly induced in ataf1 plants compared to wild-type plants following inoculation with Bgh. Additionally, we show that Bgh inoculation results in decreased endogenous ABA levels in an ATAF1-dependent manner...

  14. News and Views: Life on Mars? Astronomical model is world's biggest; Prizes for identifying dark matter; NAM 2013: call for sessions; Paintballing to save the planet; Happy Birthday ESO; Dark sky park grows


    The University of Edinburgh, crowdsourcing website Kaggle and Winton Capital Management have joined forces to launch a competition to identify dark matter haloes. The Scientific Organizing Committee of the RAS National Astronomy Meeting 2013, the UK Solar Physics and Magnetosphere, Ionosphere and Solar-Terrestrial meetings, are seeking nominations for parallel discussion session themes. A winner of the 2012 Move an Asteroid Technical Paper Competition suggests painting asteroids white in order to boost their albedo and take advantage of solar radiation pressure to alter their orbits.


    Stjepan Šikoronja


    Full Text Available U radu autori ukazuju na nelogičnosti koje vladaju u području međunarodno priznatih ljudskih prava. Rad se temelji na tvrdnji kako sve ranjivije skupine, kao što su starije osobe, djeca i osobe s invaliditetom, zahtijevaju od društva povećanu zaštitu njihovih prava i interesa, uz uvažavanje dodatnih razlika unutar tih samih skupina. Zaštitu su do sada, pod okriljem Ujedinjenih naroda dobili djeca i osobe s invaliditetom. Autori stoga u radu analiziraju postoji li, iz perspektive Republike Hrvatske, potreba za podržavanjem izrade i donošenja Konvencije za zaštitu prava starijih osoba pod okriljem Ujedinjenih naroda. Nastavno je prikazano trenutno stanje regulacije posebnih prava starijih osoba na međunarodnoj, europskoj i nacionalnoj razini. Autori se ujedno i osvrću na relevantne presude Europskog suda za ljudska prava u izlaganju glavnih problema s kojima se susreću starije osobe, a pogotovo one s duševnim smetnjama, u Republici Hrvatskoj. Na temelju analize postojećeg stanja predlažu koja bi prava, potencijalno, Konvencija UN-a o pravima starijih osoba mogla, odnosno trebala sadržavati.

  16. Kūdikių namų auklėtinių emocijų raiškos plėtotės galimybės

    Radzevičienė, Liuda; Ruškus, Jonas


    The aim of our research is to reveal effectiveness of pedagogical input for emotional reactions according to the structural and dynamical aspects. 17 infants from 15 to 24 months of age of Šiauliai Infant Home were observed and took part in the pedagogical experiment that lasted 9 months. We used such methods of research: analysis of documents of child development, pedagogical experiment, observation of emotional reactions of infants. Methods of Descriptive Statistic, Cluster and Regressive A...

  17. Population aging: opportunity for business expansion, an invitational paper presented at the Asia-Pacific Economic Cooperation (APEC) International Workshop on Adaptation to Population Aging Issues, July 17, 2017, Ha Noi, Viet Nam.

    Arensberg, Mary Beth


    A longer life brings opportunities for older adults and their families as well as for their communities. Commercial businesses can be successful in innovating on these opportunities and achieving business expansion when they better understand the market dynamics and spectrum of older adults as consumers and view them more as assets rather than as burdens to society. While there is no "typical" older adult consumer, some traits, characteristics, and physical realities may be more common, including those related to family and community, the shopping experience, brand marketing and packaging, food and nutrition, and health. The opportunities of longer life are impacted by health and underscore the importance of positive, healthy aging-related behaviors like good nutrition and active lifestyles. Healthy aging also requires a sustained commitment and action from country leaders to formulate evidence-based polices--like systematic nutrition screening and intervention-and healthcare workforce training and education that can strengthen and support an active aging population. In addition, governments should consider engaging commercial businesses to help set sustainable policies that can advance products for older adults. Finally, governments should set national and local goals to incentivize commercial business development and investment in public-private partnerships to improve quality of care, promote healthy aging, and impact outcomes for noncommunicable diseases, ultimately benefitting population health for Asia-Pacific Economic Cooperation (APEC) countries.

  18. A new tomato NAC (NAM/ATAF1/2/CUC2) transcription factor, SlNAC4, functions as a positive regulator of fruit ripening and carotenoid accumulation.

    Zhu, Mingku; Chen, Guoping; Zhou, Shuang; Tu, Yun; Wang, Yi; Dong, Tingting; Hu, Zongli


    Fruit ripening in tomato (Solanum lycopersicum) is a complicated development process affected by both endogenous hormonal and genetic regulators and external signals. Although the role of NOR, a member of the NAC domain family, in mediating tomato fruit ripening has been established, its underlying molecular mechanisms remain unclear. To explore further the role of NAC transcription factors in fruit ripening, we characterized a new tomato NAC domain protein, named SlNAC4, which shows high accumulation in sepal and at the onset of fruit ripening. Various stress treatments including wounding, NaCl, dehydration and low temperature significantly increased the expression of SlNAC4. Reduced expression of SlNAC4 by RNA interference (RNAi) in tomato resulted in delayed fruit ripening, suppressed Chl breakdown and decreased ethylene synthesis mediated mainly through reduced expression of ethylene biosynthesis genes of system-2, and reduced carotenoids by alteration of the carotenoid pathway flux. Transgenic tomato fruits also displayed significant down-regulation of multiple ripening-associated genes, indicating that SlNAC4 functions as a positive regulator of fruit ripening by affecting ethylene synthesis and carotenoid accumulation. Moreover, we also noted that SlNAC4 could not be induced by ethylene and may function upstream of the ripening regulator RIN and positively regulate its expression. Yeast two-hybrid assay further revealed that SlNAC4 could interact with both RIN and NOR protein. These results suggested that ethylene-dependent and -independent processes are regulated by SlNAC4 in the fruit ripening regulatory network.

  19. Analýza naměřených vibračních projevů v kostelní věži

    Lednická, Markéta; Kaláb, Z.


    Roč. 18, č. 3 (2011), s. 53-61 ISSN 1803-1447 Grant - others:GA ČR(CZ) GA103/09/2007 Institutional research plan: CEZ:AV0Z30860518 Keywords : resonant vibration * wavelet decomposition * seismic record Subject RIV: DC - Siesmology, Volcanology, Earth Structure

  20. Observation des influences du changement du couvert forestier sur le comportement hydrologique de grands bassins versants tropicaux a l'aide de la teledetection numerique: Cas du bassin versant de Dong Nai, Viet Nam

    Pham, Trinh Hung

    Monitoring hydrological behavior of a large tropical watershed following a forest cover variation has an important role in water resource management planning as well as for forest sustainable management. Traditional methods in forest hydrology studies are Experimental watersheds, Upstream-downstream, Experimental plots, Statistical regional analysis and Watershed simulation. Those methodes have limitations for large watersheds concerning the monitoring time, the lack of input data especially about forest cover and the capacity of extrapolating results accurately in terms of large watersheds. Moreover, there is still currently a scientific debate in forest ecology on relation between water and forest. The reason of this problem comes from geographical differences in publication concerning study zones, experimental watershed size and applied methods. It gives differences in the conclusions on the influence of tropical forest cover change on the changes of outlet water and yet on the yearly runoff in terms of large watershed. In order to exceed the limitations of actual methods, to solve the difficulty of acquiring forest cover data and to have a better understanding of the relation between tropical forest cover change and hydrological behavior evolution of a large watershed, it is necessary to develop a new approach by using numeric remote sensing. We used the watershed of Dong Nai as a case study. Results show that a fusion between TM and ETM+ Landsat image series and hydro-meteorologic data allow us to observe and detect flooding trends and flooding peaks after an intensive forest cover change from 16% to 20%. Flooding frequency and flooding peaks have clearly decreased when there is an increase of the forest cover from 1983 to 1990. The influence of tropical forest cover on the hydrological behavior is varying with geographical locations of watershed. There is a significant relation between forest cover evolution and environmental facteurs as the runoff coefficient (R = 0,87) and the yearly precipitation (R = 0,93).

  1. The Drop-Out Problem in Primary Education: Towards Universalization of Primary Education in Asia and the Pacific--Some Case Studies: China, India, Peninsular Malaysia, Socialist Republic of Viet Nam, Sri Lanka, and Thailand.

    United Nations Educational, Scientific, and Cultural Organization, Bangkok (Thailand). Regional Office for Education in Asia and the Pacific.

    The ways in which six developing countries in Asia are dealing with the problem of children dropping out of elementary school are discussed in these essays. One of the persistent problems that has deterred universalization of primary education is the early dropping out of children from schools. Case studies describing the magnitude and causes of…

  2. Interactions between plant RING-H2 and plant-specific NAC (NAM/ATAF1/2/CUC2) proteins: RING-H2 molecular specificity and cellular localization

    Greve, Krestine; Bravo Munoz, Tanja La Cour; Jensen, Michael Krogh


    RING miduler, NAC transkriptionsfatorer, abscisinsyre inducerbar, proteinnedbrydning, subcellulær lo......RING miduler, NAC transkriptionsfatorer, abscisinsyre inducerbar, proteinnedbrydning, subcellulær lo...

  3. Air Conditioner/Dehumidifier


    An ordinary air conditioner in a very humid environment must overcool the room air, then reheat it. Mr. Dinh, a former STAC associate, devised a heat pipe based humidifier under a NASA Contract. The system used heat pipes to precool the air; the air conditioner's cooling coil removes heat and humidity, then the heat pipes restore the overcooled air to a comfortable temperature. The heat pipes use no energy, and typical savings are from 15-20%. The Dinh Company also manufactures a "Z" coil, a retrofit cooling coil which may be installed on an existing heater/air conditioner. It will also provide free hot water. The company has also developed a photovoltaic air conditioner and solar powered water pump.

  4. A Study of China’s Possible Military Intervention in the Event of a Sudden Change in North Korea


    Kim Jong - nam , Kim Jong -chul or Kim Jong -un as Kim‘s successor. Some have asserted that there might not be a third generation of Kim ...The power struggle between Kim Jong - nam (eldest son) who is residing in China and Kim Jong -un has been observed in many places over time. Kim 29... Jong - nam , who is known to be receiving Chinese support, revealed his opposition to a third generation of dynastic succession in

  5. Argentina : tous les projets | Page 7 | CRDI - Centre de recherches ...


  6. ORF Sequence: NC_003070 [GENIUS II[Archive

    Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

  7. Nicotinamide Improves Aspects of Healthspan, but Not Lifespan, in Mice.

    Mitchell, Sarah J; Bernier, Michel; Aon, Miguel A; Cortassa, Sonia; Kim, Eun Young; Fang, Evandro F; Palacios, Hector H; Ali, Ahmed; Navas-Enamorado, Ignacio; Di Francesco, Andrea; Kaiser, Tamzin A; Waltz, Tyler B; Zhang, Ning; Ellis, James L; Elliott, Peter J; Frederick, David W; Bohr, Vilhelm A; Schmidt, Mark S; Brenner, Charles; Sinclair, David A; Sauve, Anthony A; Baur, Joseph A; de Cabo, Rafael


    The role in longevity and healthspan of nicotinamide (NAM), the physiological precursor of NAD + , is elusive. Here, we report that chronic NAM supplementation improves healthspan measures in mice without extending lifespan. Untargeted metabolite profiling of the liver and metabolic flux analysis of liver-derived cells revealed NAM-mediated improvement in glucose homeostasis in mice on a high-fat diet (HFD) that was associated with reduced hepatic steatosis and inflammation concomitant with increased glycogen deposition and flux through the pentose phosphate and glycolytic pathways. Targeted NAD metabolome analysis in liver revealed depressed expression of NAM salvage in NAM-treated mice, an effect counteracted by higher expression of de novo NAD biosynthetic enzymes. Although neither hepatic NAD + nor NADP + was boosted by NAM, acetylation of some SIRT1 targets was enhanced by NAM supplementation in a diet- and NAM dose-dependent manner. Collectively, our results show health improvement in NAM-supplemented HFD-fed mice in the absence of survival effects. Published by Elsevier Inc.

  8. Production and application of radioisotopes in Asian Countries

    He Youfeng


    Production and application of radioisotopes in some Asian countries including Bangladesh, India, Indonesia, Iran, Japan, Republic of Korea, Malaysia, Pakistan, Philippines, Thailand, Uzbekistan, and Viet Nam are introduced

  9. Test Event | Center for Cancer Research

    Lorem ipsum dolor sit amet, consectetur adipiscing elit. Nam posuere egestas risus eget venenatis. Integer in metus a leo sodales pulvinar in sed dolor. Fusce tincidunt iaculis condimentum. Nam semper sapien nec est consequat, eu pretium arcu facilisis. Donec non viverra mauris. Pellentesque porttitor risus sit amet iaculis finibus. Ut quis justo consequat, fermentum sem in,

  10. MultiDay Test | Center for Cancer Research

    Lorem ipsum dolor sit amet, consectetur adipiscing elit. Nam posuere egestas risus eget venenatis. Integer in metus a leo sodales pulvinar in sed dolor. Fusce tincidunt iaculis condimentum. Nam semper sapien nec est consequat, eu pretium arcu facilisis. Donec non viverra mauris. Pellentesque porttitor risus sit amet iaculis finibus. Ut quis justo consequat, fermentum sem in,

  11. Normal Test | Center for Cancer Research

    Lorem ipsum dolor sit amet, consectetur adipiscing elit. Nam posuere egestas risus eget venenatis. Integer in metus a leo sodales pulvinar in sed dolor. Fusce tincidunt iaculis condimentum. Nam semper sapien nec est consequat, eu pretium arcu facilisis. Donec non viverra mauris. Pellentesque porttitor risus sit amet iaculis finibus. Ut quis justo consequat, fermentum sem in,

  12. Repeat Event | Center for Cancer Research

    Lorem ipsum dolor sit amet, consectetur adipiscing elit. Nam posuere egestas risus eget venenatis. Integer in metus a leo sodales pulvinar in sed dolor. Fusce tincidunt iaculis condimentum. Nam semper sapien nec est consequat, eu pretium arcu facilisis. Donec non viverra mauris. Pellentesque porttitor risus sit amet iaculis finibus. Ut quis justo consequat, fermentum sem in,

  13. The Norm Activation Model: An exploration of the functions of anticipated pride and guilt in environmental behaviour

    Onwezen, M.C.; Antonides, G.; Bartels, J.


    The Norm Activation Model (NAM; Schwartz, 1977) is a vested model that explains altruistic and environmentally friendly behaviour. Although research states that anticipated pride and guilt are associated with the NAM, these associations are not yet fully understood. The current study provides an

  14. Research and Policy on Parallel Courses

    Karen Kershaw

    Despite its still considerable economic and social problems ... Some 80% of the Viet Nam's 80 million citizens live in rural ... successor, the five-year Viet Nam Economic and .... system and was therefore in need of research to guide its reforms.

  15. Nuclear analyses in biology and medical science. Measuring on nucleii in stead of atoms

    De Goeij, J.J.M.


    A brief overview is given of the use of nuclear analyses in life sciences. Features of nuclear analytical methods (NAMs) are grouped into four categories: physical basis, isotopic analyses rather than elemental analyses, no interference of electronic and molecular structure, and penetrating character of nuclear radiation. Obstacles in applying NAMs in the life sciences are outlined. 1 tab

  16. Search Results | Page 29 | IDRC - International Development ...

    Results 281 - 290 of 420 ... China 73 Apply China filter · Viet Nam 44 Apply Viet Nam filter .... Indian Telecentre Academy. IDRC's has developed a global program in support of building the capacity of ... The Arab Reform Initiative (ARI) is a consortium of 15 members comprising Arab research and policy institutes, ...

  17. Sadhana | Indian Academy of Sciences

    Permanent link: Keywords. Conceptual hydrological NAM model; calibration; sensitivity analysis; validation; Tapi basin; Purna catchment. Abstract. In present study, a lumped conceptual hydrological model, NAM (MIKE11), is calibrated while optimizing the runoff ...

  18. Genotoxicity of a Low-Dose Nitrosamine Mixture as Drinking Water Disinfection Byproducts in NIH3T3 Cells.

    Wang, Hai-Yan; Qin, Ming; Dong, Lei; Lv, Jia-Ying; Wang, Xia


    N - nitrosamines (NAms), which can arise as byproducts of disinfection agents, are reportedly found in drinking water, and their potential carcinogenicity is a concern; however, little research exists regarding the genotoxicity or carcinogenicity of NAms exposure as a low-dose mixture. The three most common NAms components in China's drinking water are N -nitrosodimethylamine (NDMA), N -nitrosodiethylamine (NDEA) and N -nitrosomethylethylamine (NMEA). Thus, we measured the genotoxic and carcinogenic potential of these compounds and measured the cell cycle and gene expression. The data show that exposure to the NAms-mixture doubled the revertants in the TA98 and TA100 S. typhimurium strains and increased the DNA double-strand breaks and the micronuclear frequency in the NIH3T3 cells compared to a single exposure. After long-term NAms mixture exposure, a malignant transformation of NIH3T3 and a significantly increased G2/M distribution were observed. Furthermore, P53, CDK1, P38, CDC25A and CyclinB expressions were down-regulated in the NAms-mixture exposure group; however, P21 and GADD45A genes were up-regulated. Interestingly, the CHK1/CHK2 and CDC25A genes had two responses, depending on the NAms concentrations. Thus, we observed mutagenic, genotoxic and carcinogenic effects after a low-dose NAms-mixture exposure in drinking water, and DNA repair and apoptosis pathways may contribute to these adverse effects.

  19. Dysplastic vs. Common Naevus-associated vs. De novo Melanomas: An Observational Retrospective Study of 1,021 Patients

    Alejandro Martin-Gorgojo


    Full Text Available The aim of this case-case study was to determine the differences between dysplastic and common naevus-associated melanomas (NAM and de novo melanomas. A total of 1,021 prospectively collected patients with invasive cutaneous melanoma from an oncology referral centre were included in the study. Of these, 75.51% had de novo melanomas, 12.93% dysplastic NAM, and 11.56% common NAM. Dysplastic NAM, compared with de novo melanomas, were associated with intermittently photo-exposed sites, atypical melanocytic naevi, decreased tumour thickness, and presence of MC1R non-synonymous variants. Common NAM were more frequent on the trunk and of superficial spreading type. Comparison of dysplastic with common NAM showed significant difference only with regard to mitoses. Both subtypes of NAM shared less aggressive traits than de novo melanomas, albeit with no significant differences in survival after multivariate adjustment. In conclusion, NAM present with less aggressive traits, mostly due to a greater awareness among patients of changing moles than due to their intrinsic biological characteristics.

  20. Asian Partnership for Avian Influenza Research : Effectiveness of ...

    ... Indonesia, Thailand and Viet Nam for collaboration on research and research capacity building in avian influenza prevention and control. This grant will allow APAIR to investigate the effectiveness of the measures employed by China, Thailand and Viet Nam and evaluate the factors contributing to their success or failure.

  1. Search Results | Page 816 | IDRC - International Development ...

    Results 8151 - 8160 of 8491 ... Marketing Information Products and Services: A Primer for Librarians and Information Professionals. Library and ... Viet Nam at the Crossroads: The Role of Science and Technology. Viet Nam continues ... The literature in this area, however, examines these issues strictly within national contexts.

  2. Livres | Page 24 | CRDI - Centre de recherches pour le ...

    Couverture du livre Socioeconomic Renovation in Viet Nam : The Origin, Evolution, and Impact. Socioeconomic Renovation in Viet Nam : The Origin, Evolution, and Impact of Doi Moi. Maison(s) d'édition : ISEAS, CRDI. ISBN: Épuisé. Couverture du livre Les politiques sociales transnationales : Les nouveaux défis de la ...

  3. The Norm Activation Model: An exploration of the functions of anticipated pride and guilt in pro-environmental behaviour

    Onwezen, M.C.; Antonides, G.; Bartels, J.


    The Norm Activation Model (NAM; Schwartz, 1977) is a vested model that explains altruistic and environmentally friendly behaviour. Although research states that anticipated pride and guilt are associated with the NAM, these associations are not yet fully understood. The current study provides an

  4. Search Results | Page 43 | IDRC - International Development ...

    Results 411 - 420 of 420 ... China 49 Apply China filter · Philippines 30 Apply Philippines filter · Viet Nam 28 Apply Viet Nam filter · Cambodia 27 Apply Cambodia filter · Thailand 26 Apply Thailand filter · Indonesia 25 Apply Indonesia filter · Laos 12 Apply Laos filter · Malaysia 12 Apply Malaysia filter · Singapore 7 Apply ...




  6. Search Results | Page 6 | IDRC - International Development ...

    Remove Mongolia filter Mongolia; China 367 Apply China filter · Indonesia 245 Apply Indonesia filter · Thailand 216 Apply Thailand filter · Philippines 213 Apply Philippines filter · Viet Nam 198 Apply Viet Nam filter · Cambodia 149 Apply Cambodia filter · South of Sahara 1913 Apply South of Sahara filter · North of Sahara ...

  7. Treatment of bastnaesite ore from Vietnamese Socialist Republic

    Formanek, J.; Jerabek, J.; Jancarek, J.


    From the Vietnamese deposit at Nam Nam Xe Czechoslovakia imported several hundred tons of ore. Several methods of ore dressing were used: gravitational, preconcentration in electromagnetic field, magnetic separation, high-intesity electromagnetic separation. Flotation evidently was the best dressing method tried. The results are presented of testing using different flotation agents. (E.S.)

  8. Nicotinamide Promotes Adipogenesis in Umbilical Cord-Derived Mesenchymal Stem Cells and Is Associated with Neonatal Adiposity: The Healthy Start BabyBUMP Project.

    Allison L B Shapiro

    Full Text Available The cellular mechanisms whereby excess maternal nutrition during pregnancy increases adiposity of the offspring are not well understood. However, nicotinamide (NAM, a fundamental micronutrient that is important in energy metabolism, has been shown to regulate adipogenesis through inhibition of SIRT1. Here we tested three novel hypotheses: 1 NAM increases the adipogenic response of human umbilical cord tissue-derived mesenchymal stem cells (MSCs through a SIRT1 and PPARγ pathway; 2 lipid potentiates the NAM-enhanced adipogenic response; and 3 the adipogenic response to NAM is associated with increased percent fat mass (%FM among neonates. MSCs were derived from the umbilical cord of 46 neonates born to non-obese mothers enrolled in the Healthy Start study. Neonatal %FM was measured using air displacement plethysmography (Pea Pod shortly after birth. Adipogenic differentiation was induced for 21 days in the 46 MSC sets under four conditions, +NAM (3mM/-lipid (200 μM oleate/palmitate mix, +NAM/+lipid, -NAM/+lipid, and vehicle-control (-NAM/-lipid. Cells incubated in the presence of NAM had significantly higher PPARγ protein (+24%, p <0.01, FABP4 protein (+57%, p <0.01, and intracellular lipid content (+51%, p <0.01. Lipid did not significantly increase either PPARγ protein (p = 0.98 or FABP4 protein content (p = 0.82. There was no evidence of an interaction between NAM and lipid on adipogenic response of PPARγ or FABP4 protein (p = 0.99 and p = 0.09. In a subset of 9 MSC, SIRT1 activity was measured in the +NAM/-lipid and vehicle control conditions. SIRT1 enzymatic activity was significantly lower (-70%, p <0.05 in the +NAM/-lipid condition than in vehicle-control. In a linear model with neonatal %FM as the outcome, the percent increase in PPARγ protein in the +NAM/-lipid condition compared to vehicle-control was a significant predictor (β = 0.04, 95% CI 0.01-0.06, p <0.001. These are the first data to support that chronic NAM exposure

  9. The fear of awful smell: risk perceptions among farmers in Vietnam using wastewater and human excreta in agriculture

    Knudsen, Line G; Phuc, Pham D; Hiep, Nguyen T


    Vietnamese farmers' health-risk awareness, knowledge, and practices related to their use of wastewater and human excreta was investigated in an anthropological study by a multidisciplinary team in peri-urban Hanoi and Nghe An Province. Farmers identified health risks associated with their use...... of excreta and wastewater, but they viewed these as unavoidable risks related to production. They perceived the health risks as different for the use of wastewater and human feces. They perceived health risks from wastewater as non-serious because it remained on the skin and only caused skin problems......, but they considered health risks from non-composted smelly feces serious because it entered the body through 'polluted' air. Most farmers were more aware of threats to health from 'dirt' entering the domestic environment than of the health risks during their work. The concept of 'dirt' should be separated from...


    Kureš, Anita


    Stres je tegoba sedanjega časa. Zmeraj več ljudi trpi za posledicami stresa na delovnem mestu, saj nam delo povzroča preveliko odgovornost, njemu tudi namenimo večino svojega časa, kar nam posledično zmanjšuje čas za sprostitev. Tako nam primanjkuje časa za zabavo, druženje s prijatelji, sprehode v naravi, telesno aktivnost in druge možnosti za sprostitev. Življenje nam prinaša nenehno nove izzive in obremenitve, pritiske, bojazni, ki sčasoma kopičijo stres v našem telesu. Vse to se nam odraž...

  11. Die New Age beweging - oorsig en beoordeling

    P. J. de Bruyn


    Full Text Available The New Age Movement (NAM is a leaderless but powerful network, working to bring about radical change in the world. In fact the NAM is a transplantation of Hindu philosophy, with Buddist elements from the East to the West. This article explicates the origin of the NAM and describes its mystic, occult and feminist character. In the article it is stated that the NAM rests on monistic and astrological pillars and that its main doctrines are as follows: pantheism, emanation (instead of creation, reincarnation and the fact that Christ is one of the great Masters controlling the world. The views and doctrines of the NAM are then judged in the light of Scripture.

  12. Factors affecting ultraviolet irradiation/hydrogen peroxide (UV/H2O2) degradation of mixed N-nitrosamines in water

    Zhou, Chao; Gao, Naiyun; Deng, Yang; Chu, Wenhai; Rong, Wenlei; Zhou, Shengdong


    Highlights: ► NAms with three-induced toxicity, as emerging DBPs, has caused a great public attention. ► No paper regards UV/H 2 O 2 oxidation of mixed NAms in an aquatic environment. ► The treatment effect is typically affected by a few factors in water. ► NPIP and NDPhA are the most readily and difficult to be degraded due to unique structure. ► All the NAms degradation exhibited a pseudo-first-order kinetics pattern. - Abstract: Disinfection by-products (DBPs) are a great challenge to our drinking water security. Particularly, nitrosamines (NAms), as emerging DBPs, are potently carcinogenic, mutagenic, and teratogenic, and have increasingly attained public attention. This study was to evaluate the performance of the NAms degradation by the ultraviolet (UV) irradiation (253.7 nm) in the presence of hydrogen peroxide (H 2 O 2 ). In the UV/H 2 O 2 system, hydroxyl radicals (OH·), a type of nonselective and powerful oxidant, was produced to attack the molecules of NAms. Factors affecting the treatment efficiency, including the H 2 O 2 dosage, initial NAms concentration, UV irradiation intensity, initial solution pH, and inorganic anions present in water, were evaluated. All the NAms degradation exhibited a pseudo-first-order kinetics pattern. Within 60 min, 0.1 mg/L of any NAms could be almost decomposed except NDPhA that required 120 min for complete removal, at 25 μmol/L H 2 O 2 and at initial pH 7. Results demonstrate that the UV/H 2 O 2 treatment is a viable option to control NAms in water.

  13. A Study of Strategic Lessons Learned in Vietnam. Volume 5. Planning the War


    VLCCL 9I) 1 0. 0 Iii N 2 -- 3 !Q MR’ THE BDM CORPORATION cni -J u uw wi LU w.. 4 p𔃼 CL 0.C WV U. 4-) ww jW U lm. C-.) 𔃾- ZEC 00 - L ccn U) 0zz up...78. 61, Duncanson, p. 321 and Lewy, p. 25. 62. Tran Dinh Tho, p. 15. 63. William Colby and Peter Forbath, Honourable Men: My Life in the CIA (London...American peace advocate Peter Weiss, Harvard professor Henry Kissinger; and several pacifist clerics 7-25 THE BDM CORPORATION * elicit the assistance of

  14. Nicotinamide clearance by Pnc1 directly regulates Sir2-mediated silencing and longevity.

    Gallo, Christopher M; Smith, Daniel L; Smith, Jeffrey S


    The Saccharomyces cerevisiae Sir2 protein is an NAD(+)-dependent histone deacetylase (HDAC) that functions in transcriptional silencing and longevity. The NAD(+) salvage pathway protein, Npt1, regulates Sir2-mediated processes by maintaining a sufficiently high intracellular NAD(+) concentration. However, another NAD(+) salvage pathway component, Pnc1, modulates silencing independently of the NAD(+) concentration. Nicotinamide (NAM) is a by-product of the Sir2 deacetylase reaction and is a natural Sir2 inhibitor. Pnc1 is a nicotinamidase that converts NAM to nicotinic acid. Here we show that recombinant Pnc1 stimulates Sir2 HDAC activity in vitro by preventing the accumulation of NAM produced by Sir2. In vivo, telomeric, rDNA, and HM silencing are differentially sensitive to inhibition by NAM. Furthermore, PNC1 overexpression suppresses the inhibitory effect of exogenously added NAM on silencing, life span, and Hst1-mediated transcriptional repression. Finally, we show that stress suppresses the inhibitory effect of NAM through the induction of PNC1 expression. Pnc1, therefore, positively regulates Sir2-mediated silencing and longevity by preventing the accumulation of intracellular NAM during times of stress.

  15. Consumer Based-Brand Equity

    Ekinci, Yuksel


    Research Objectives The objectives of this study are to: - Assess external validity of Nam et al.’s (2011) CBBE model in different culture (Turkey) and new service context (fashion retailing). - Compare validity of Nam et al.’s (2011) CBBE model with the brand equity model introduced by Yoo and Donthu (2001). - Expand the Nam et al.’s (2011) model by introducing “brand awareness”. Universidad de Málaga. Campus de Excelencia Internacional Andalucía Tech.

  16. Reduced serum brain-derived neurotrophic factor in patients with first onset vitiligo

    Erfan, Gamze; Yanik,M. Emin; Albayrak,Yakup; Aydin,Murat; Kulac,Mustafa; Kuloglu,Murat


    M Emin Yanik,1 Gamze Erfan,1 Yakup Albayrak,2 Murat Aydin,3 Mustafa Kulac,1 Murat Kuloglu4 1Department of Dermatology, Faculty of Medicine, Namık Kemal University, Tekirdag, Turkey; 2Department of Psychiatry, Faculty of Medicine, Namık Kemal University, Tekirdag, Turkey; 3Department of Biochemistry, Faculty of Medicine, Namık Kemal University, Tekirdag, Turkey; 4Department of Psychiatry, Faculty of Medicine, Akdeniz University, Antalya, Turkey Purpose: Vitiligo...

  17. The degree of doubly charged cation binding in solutions of (co)polymers of 2-acrylamido-2-methylpropanesulfonic acid salts

    Kurenkov, V.F.; Kolesnikova, I.Yu.; Antonovich, O.A.


    The degree of binding the ions of the alkaline-earth metals (M = Mg, Ca, Sr, Ba) by the polysulfate anions in the aqueous solutions of the polymers of the 2-acrylamido-2-methylpropanesulfonic acid (N-AMS) salts and their binary copolymers with the acrylamide (AA) and N-vinylpyrrolidone (VP) is quantitatively evaluated through the Terayama and Wall viscosimetric method. It is established, that the degree of binding decreases in the Sr>Ca>Mg sequence for the N-AMS polymer salts and in the reverse sequence (Mg>Ca>Sr(Ba)) for the binary copolymers of the N-AMS salts with AA and VP [ru

  18. Initial Detection and Molecular Characterization of Namaycush Herpesvirus (Salmonid Herpesvirus 5) in Lake Trout.

    Glenney, Gavin W; Barbash, Patricia A; Coll, John A


    A novel herpesvirus was found by molecular methods in samples of Lake Trout Salvelinus namaycush from Lake Erie, Pennsylvania, and Lake Ontario, Keuka Lake, and Lake Otsego, New York. Based on PCR amplification and partial sequencing of polymerase, terminase, and glycoprotein genes, a number of isolates were identified as a novel virus, which we have named Namaycush herpesvirus (NamHV) salmonid herpesvirus 5 (SalHV5). Phylogenetic analyses of three NamHV genes indicated strong clustering with other members of the genus Salmonivirus, placing these isolates into family Alloherpesviridae. The NamHV isolates were identical in the three partially sequenced genes; however, they varied from other salmonid herpesviruses in nucleotide sequence identity. In all three of the genes sequenced, NamHV shared the highest sequence identity with Atlantic Salmon papillomatosis virus (ASPV; SalHV4) isolated from Atlantic Salmon Salmo salar in northern Europe, including northwestern Russia. These results lead one to believe that NamHV and ASPV have a common ancestor that may have made a relatively recent host jump from Atlantic Salmon to Lake Trout or vice versa. Partial nucleotide sequence comparisons between NamHV and ASPV for the polymerase and glycoprotein genes differ by >5% and >10%, respectively. Additional nucleotide sequence comparisons between NamHV and epizootic epitheliotropic disease virus (EEDV/SalHV3) in the terminase, glycoprotein, and polymerase genes differ by >5%, >20%, and >10%, respectively. Thus, NamHV and EEDV may be occupying discrete ecological niches in Lake Trout. Even though NamHV shared the highest genetic identity with ASPV, each of these viruses has a separate host species, which also implies speciation. Additionally, NamHV has been detected over the last 4 years in four separate water bodies across two states, which suggests that NamHV is a distinct, naturally replicating lineage. This, in combination with a divergence in nucleotide sequence from EEDV

  19. Economy of Vietnam

    Adam McCarty


    Viet Nam was a country ruled by colonists, divided, or at war for most of the 20th century. Unification of the country in 1976 was followed by the invasion of Cambodia in 1978, and a subsequent brief but violent war with the People’s Republic of China. This legacy had profound consequences for economic development in general and for attempts to impose central planning in particular. Central planning was introduced in North Viet Nam in the 1950s, and in South Viet Nam after 1976, but less exte...

  20. Resenha do livro: 'Les Portugais sur les Côtes du ViêtNam et du Campã. Étude sur les routes maritimes et les relations commerciales, d'après les sources portugaises (XVI, XVII, XVIII siècles'

    Haidée Marquiafave Pugliesi


    Full Text Available (primeiro parágrafo do texto Pierre-Yves Manguin é nome que há recuado tempo ultrapassou as fronteiras de seus país, para afirmar-se internacionalmente como um dos mais sérios pesquisadores da École Française d'Extreme-Orient.  O trabalho em epígrafe divide-se em duas partes — a primeira trata das rotas marítimas; a segunda ocupa-se das relações comerciais. Semelhante desdobramento é conforme o sugerido pelo próprio subtítulo do livro que ora se divulga.