On the effect of hyperaldosteronism-inducing mutations in Na/K pumps.

Science.gov (United States)

Meyer, Dylan J; Gatto, Craig; Artigas, Pablo

2017-11-06

Primary aldosteronism, a condition in which too much aldosterone is produced and that leads to hypertension, is often initiated by an aldosterone-producing adenoma within the zona glomerulosa of the adrenal cortex. Somatic mutations of ATP1A1, encoding the Na/K pump α1 subunit, have been found in these adenomas. It has been proposed that a passive inward current transported by several of these mutant pumps is a "gain-of-function" activity that produces membrane depolarization and concomitant increases in aldosterone production. Here, we investigate whether the inward current through mutant Na/K pumps is large enough to induce depolarization of the cells that harbor them. We first investigate inward currents induced by these mutations in Xenopus Na/K pumps expressed in Xenopus oocytes and find that these inward currents are similar in amplitude to wild-type outward Na/K pump currents. Subsequently, we perform a detailed functional evaluation of the human Na/K pump mutants L104R, delF100-L104, V332G, and EETA963S expressed in Xenopus oocytes. By combining two-electrode voltage clamp with [ 3 H]ouabain binding, we measure the turnover rate of these inward currents and compare it to the turnover rate for outward current through wild-type pumps. We find that the turnover rate of the inward current through two of these mutants (EETA963S and L104R) is too small to induce significant cell depolarization. Electrophysiological characterization of another hyperaldosteronism-inducing mutation, G99R, reveals the absence of inward currents under many different conditions, including in the presence of the regulator FXYD1 as well as with mammalian ionic concentrations and body temperatures. Instead, we observe robust outward currents, but with significantly reduced affinities for intracellular Na + and extracellular K + Collectively, our results point to loss-of-function as the common mechanism for the hyperaldosteronism induced by these Na/K pump mutants. © 2017 Meyer et al.

Electrogenic properties of the Na+/K+ ATPase control transitions between normal and pathological brain states

Science.gov (United States)

Krishnan, Giri P.; Filatov, Gregory; Shilnikov, Andrey

2015-01-01

Ionic concentrations fluctuate significantly during epileptic seizures. In this study, using a combination of in vitro electrophysiology, computer modeling, and dynamical systems analysis, we demonstrate that changes in the potassium and sodium intra- and extracellular ion concentrations ([K+] and [Na+], respectively) during seizure affect the neuron dynamics by modulating the outward Na+/K+ pump current. First, we show that an increase of the outward Na+/K+ pump current mediates termination of seizures when there is a progressive increase in the intracellular [Na+]. Second, we show that the Na+/K+ pump current is crucial in maintaining the stability of the physiological network state; a reduction of this current leads to the onset of seizures via a positive-feedback loop. We then present a novel dynamical mechanism for bursting in neurons with a reduced Na+/K+ pump. Overall, our study demonstrates the profound role of the current mediated by Na+/K+ ATPase on the stability of neuronal dynamics that was previously unknown. PMID:25589588

Alloxan-induced diabetes reduces sarcolemmal Na+-K+ pump function in rabbit ventricular myocytes.

Science.gov (United States)

Hansen, Peter S; Clarke, Ronald J; Buhagiar, Kerrie A; Hamilton, Elisha; Garcia, Alvaro; White, Caroline; Rasmussen, Helge H

2007-03-01

The effect of diabetes on sarcolemmal Na(+)-K(+) pump function is important for our understanding of heart disease associated with diabetes and design of its treatment. We induced diabetes characterized by hyperglycemia but no other major metabolic disturbances in rabbits. Ventricular myocytes isolated from diabetic rabbits and controls were voltage clamped and internally perfused with the whole cell patch-clamp technique. Electrogenic Na(+)-K(+) pump current (I(p), arising from the 3:2 Na(+)-to-K(+) exchange ratio) was identified as the shift in holding current induced by Na(+)-K(+) pump blockade with 100 micromol/l ouabain in most experiments. There was no effect of diabetes on I(p) recorded when myocytes were perfused with pipette solutions containing 80 mmol/l Na(+) to nearly saturate intracellular Na(+)-K(+) pump sites. However, diabetes was associated with a significant decrease in I(p) measured when pipette solutions contained 10 mmol/l Na(+). The decrease was independent of membrane voltage but dependent on the intracellular concentration of K(+). There was no effect of diabetes on the sensitivity of I(p) to extracellular K(+). Pump inhibition was abolished by restoration of euglycemia or by in vivo angiotensin II receptor blockade with losartan. We conclude that diabetes induces sarcolemmal Na(+)-K(+) pump inhibition that can be reversed with pharmacological intervention.

Reduced levels of skeletal muscle Na+K+ -ATPase in McArdle disease

Science.gov (United States)

Haller, R. G.; Clausen, T.; Vissing, J.; Blomqvist, C. G. (Principal Investigator)

1998-01-01

We evaluated the hypothesis that impaired sarcolemmal function associated with exaggerated potassium release, impaired potassium uptake, or both may contribute to exertional fatigue and abnormal circulatory responses to exercise in McArdle disease (MD). The cellular mechanism of exertional fatigue and muscle injury in MD is unknown but likely involves impaired function of the ATPases that couple ATP hydrolysis to cellular work, including the muscle sodium potassium pump (Na+K+-ATPase). However, the concentration of muscle Na+K+ pumps in MD is not known, and no studies have related exercise increases in blood potassium concentrations to muscle Na+K+ pump levels. We measured muscle Na+K+ pumps (3H-ouabain binding) and plasma K+ in response to 20 minutes of cycle exercise in six patients with MD and in six sex-, age-, and weight-matched sedentary individuals. MD patients had lower levels of 3H-ouabain binding (231 +/- 18 pmol/g w.w., mean +/- SD, range, 210 to 251) than control subjects (317 +/- 37, range, 266 to 371, p Na+K+ pump levels are low in MD patients compared with healthy subjects and identify a limitation of potassium reuptake that could result in sarcolemmal failure during peak rates of membrane activation and may promote exaggerated potassium-activated circulatory responses to submaximal exercise. The mechanism of the low Na+K+ pump concentrations in MD is unknown but may relate to deconditioning or to disruption of a close functional relationship between membrane ion transport and glycolysis.

Synchronization modulation increases transepithelial potentials in MDCK monolayers through Na/K pumps.

Directory of Open Access Journals (Sweden)

Vu Tran

Full Text Available Transepithelial potential (TEP is the voltage across a polarized epithelium. In epithelia that have active transport functions, the force for transmembrane flux of an ion is dictated by the electrochemical gradient in which TEP plays an essential role. In epithelial injury, disruption of the epithelial barrier collapses the TEP at the wound edge, resulting in the establishment of an endogenous wound electric field (∼100 mV/mm that is directed towards the center of the wound. This endogenous electric field is implicated to enhance wound healing by guiding cell migration. We thus seek techniques to enhance the TEP, which may increase the wound electric fields and enhance wound healing. We report a novel technique, termed synchronization modulation (SM using a train of electric pulses to synchronize the Na/K pump activity, and then modulating the pumping cycles to increase the efficiency of the Na/K pumps. Kidney epithelial monolayers (MDCK cells maintain a stable TEP and transepithelial resistance (TER. SM significantly increased TEP over four fold. Either ouabain or digoxin, which block Na/K pump, abolished SM-induced TEP increases. In addition to the pump activity, basolateral distribution of Na/K pumps is essential for an increase in TEP. Our study for the first time developed an electrical approach to significantly increase the TEP. This technique targeting the Na/K pump may be used to modulate TEP, and may have implication in wound healing and in diseases where TEP needs to be modulated.

Evidence for coordinate genetic control of Na,K pump density in erythrocytes and lymphocytes

International Nuclear Information System (INIS)

DeLuise, M.; Flier, J.S.

1985-01-01

The erythrocyte is widely used as a model cell for studies of the Na,K pump in health and disease. However, little is known about the factors that control the number of Na,K pumps expressed on the erythrocytes of a given individual, nor about the extent to which erythrocytes can be used to validly assess the pump density on other cell types. In this report, the authors have compared the interindividual variance of Na,K pump density in erythrocytes of unrelated individuals to that seen with identical twins. Unlike unrelated individuals, in whom pump parameters, i.e., ouabain binding sites, 86 Rb uptake, and cell Na concentration vary widely, identical twin pairs showed no significant intrapair variation for these values. Thus, a role for genetic factors is suggested. In addition, the authors established and validated a method for determining Na,K pump density and pump-mediated 86 Rb uptake in human peripheral lymphocytes. Using this method, they show that whereas Na,K pump density differs markedly between erythrocytes (mean of 285 sites per cell) and lymphocytes (mean 40,600 sites per cell), there is a strong and highly significant correlation (r = 0.79, P less than 0.001) between the pump density in these cell types in any given individual. Taken together, these studies suggest that genetic factors are important determinants of Na,K pump expression, and that pump density appears to be coordinately regulated in two cell types in healthy individuals

Quantification of Na+,K+ pumps and their transport rate in skeletal muscle: Functional significance

Science.gov (United States)

2013-01-01

During excitation, muscle cells gain Na+ and lose K+, leading to a rise in extracellular K+ ([K+]o), depolarization, and loss of excitability. Recent studies support the idea that these events are important causes of muscle fatigue and that full use of the Na+,K+-ATPase (also known as the Na+,K+ pump) is often essential for adequate clearance of extracellular K+. As a result of their electrogenic action, Na+,K+ pumps also help reverse depolarization arising during excitation, hyperkalemia, and anoxia, or from cell damage resulting from exercise, rhabdomyolysis, or muscle diseases. The ability to evaluate Na+,K+-pump function and the capacity of the Na+,K+ pumps to fill these needs require quantification of the total content of Na+,K+ pumps in skeletal muscle. Inhibition of Na+,K+-pump activity, or a decrease in their content, reduces muscle contractility. Conversely, stimulation of the Na+,K+-pump transport rate or increasing the content of Na+,K+ pumps enhances muscle excitability and contractility. Measurements of [3H]ouabain binding to skeletal muscle in vivo or in vitro have enabled the reproducible quantification of the total content of Na+,K+ pumps in molar units in various animal species, and in both healthy people and individuals with various diseases. In contrast, measurements of 3-O-methylfluorescein phosphatase activity associated with the Na+,K+-ATPase may show inconsistent results. Measurements of Na+ and K+ fluxes in intact isolated muscles show that, after Na+ loading or intense excitation, all the Na+,K+ pumps are functional, allowing calculation of the maximum Na+,K+-pumping capacity, expressed in molar units/g muscle/min. The activity and content of Na+,K+ pumps are regulated by exercise, inactivity, K+ deficiency, fasting, age, and several hormones and pharmaceuticals. Studies on the α-subunit isoforms of the Na+,K+-ATPase have detected a relative increase in their number in response to exercise and the glucocorticoid dexamethasone but have not

Quantification of Na+,K+ pumps and their transport rate in skeletal muscle: functional significance.

Science.gov (United States)

Clausen, Torben

2013-10-01

During excitation, muscle cells gain Na(+) and lose K(+), leading to a rise in extracellular K(+) ([K(+)]o), depolarization, and loss of excitability. Recent studies support the idea that these events are important causes of muscle fatigue and that full use of the Na(+),K(+)-ATPase (also known as the Na(+),K(+) pump) is often essential for adequate clearance of extracellular K(+). As a result of their electrogenic action, Na(+),K(+) pumps also help reverse depolarization arising during excitation, hyperkalemia, and anoxia, or from cell damage resulting from exercise, rhabdomyolysis, or muscle diseases. The ability to evaluate Na(+),K(+)-pump function and the capacity of the Na(+),K(+) pumps to fill these needs require quantification of the total content of Na(+),K(+) pumps in skeletal muscle. Inhibition of Na(+),K(+)-pump activity, or a decrease in their content, reduces muscle contractility. Conversely, stimulation of the Na(+),K(+)-pump transport rate or increasing the content of Na(+),K(+) pumps enhances muscle excitability and contractility. Measurements of [(3)H]ouabain binding to skeletal muscle in vivo or in vitro have enabled the reproducible quantification of the total content of Na(+),K(+) pumps in molar units in various animal species, and in both healthy people and individuals with various diseases. In contrast, measurements of 3-O-methylfluorescein phosphatase activity associated with the Na(+),K(+)-ATPase may show inconsistent results. Measurements of Na(+) and K(+) fluxes in intact isolated muscles show that, after Na(+) loading or intense excitation, all the Na(+),K(+) pumps are functional, allowing calculation of the maximum Na(+),K(+)-pumping capacity, expressed in molar units/g muscle/min. The activity and content of Na(+),K(+) pumps are regulated by exercise, inactivity, K(+) deficiency, fasting, age, and several hormones and pharmaceuticals. Studies on the α-subunit isoforms of the Na(+),K(+)-ATPase have detected a relative increase in their

Intracellular Na(+) and metabolic modulation of Na/K pump and excitability in the rat suprachiasmatic nucleus neurons.

Science.gov (United States)

Wang, Yi-Chi; Yang, Jyh-Jeen; Huang, Rong-Chi

2012-10-01

Na/K pump activity and metabolic rate are both higher during the day in the suprachiasmatic nucleus (SCN) that houses the circadian clock. Here we investigated the role of intracellular Na(+) and energy metabolism in regulating Na/K pump activity and neuronal excitability. Removal of extracellular K(+) to block the Na/K pump excited SCN neurons to fire at higher rates and return to normal K(+) to reactivate the pump produced rebound hyperpolarization to inhibit firing. In the presence of tetrodotoxin to block the action potentials, both zero K(+)-induced depolarization and rebound hyperpolarization were blocked by the cardiac glycoside strophanthidin. Ratiometric Na(+) imaging with a Na(+)-sensitive fluorescent dye indicated saturating accumulation of intracellular Na(+) in response to pump blockade with zero K(+). The Na(+) ionophore monensin also induced Na(+) loading and hyperpolarized the membrane potential, with the hyperpolarizing effect of monensin abolished in zero Na(+) or by pump blockade. Conversely, Na(+) depletion with Na(+)-free pipette solution depolarized membrane potential but retained residual Na/K pump activity. Cyanide inhibition of oxidative phosphorylation blocked the Na/K pump to depolarize resting potential and increase spontaneous firing in most cells, and to raise intracellular Na(+) levels in all cells. Nonetheless, the Na/K pump was incompletely blocked by cyanide but completely blocked by iodoacetate to inhibit glycolysis, indicating the involvement of both oxidative phosphorylation and glycolysis in fueling the Na/K pump. Together, the results indicate the importance of intracellular Na(+) and energy metabolism in regulating Na/K pump activity as well as neuronal excitability in the SCN neurons.

Modification of NaK (Na and K) dissolution device at the L.E.C.I

International Nuclear Information System (INIS)

Mansard, Bernard; Ducas, Serge; Riviere, Michel

1969-12-01

As three NaK dissolution devices had been operated since 1965 and as irradiation assemblies with a greater capacity (2 to 3 times) are now to be used, the modification of these dissolution devices is addressed. This requires a better control of the dissolution reaction (the NaK + alcohol reaction is highly exothermic and results in an effervescence which requires a greater volume). The objectives are therefore to delay the dissolution, to trigger it, to stop it, to control it at will, and to release heat. The new device is then described with its vessel, its cap, its ball valve, and its two tight sleeves. The operation principle is described, as well as the NaK draining process, and the NaK dissolution. Safety, time saving and raw matter saving issues are finally outlined

The two C-terminal tyrosines stabilize occluded Na/K pump conformations containing Na or K ions.

Science.gov (United States)

Vedovato, Natascia; Gadsby, David C

2010-07-01

Interactions of the three transported Na ions with the Na/K pump remain incompletely understood. Na/K pump crystal structures show that the extended C terminus of the Na,K-adenosine triphosphatase (ATPase) alpha subunit directly contacts transmembrane helices. Deletion of the last five residues (KETYY in almost all Na/K pumps) markedly lowered the apparent affinity for Na activation of pump phosphorylation from ATP, a reflection of cytoplasmic Na affinity for forming the occluded E1P(Na3) conformation. ATPase assays further suggested that C-terminal truncations also interfere with low affinity Na interactions, which are attributable to extracellular effects. Because extracellular Na ions traverse part of the membrane's electric field to reach their binding sites in the Na/K pump, their movements generate currents that can be monitored with high resolution. We report here electrical measurements to examine how Na/K pump interactions with extracellular Na ions are influenced by C-terminal truncations. We deleted the last two (YY) or five (KESYY) residues in Xenopus laevis alpha1 Na/K pumps made ouabain resistant by either of two kinds of point mutations and measured their currents as 10-mM ouabain-sensitive currents in Xenopus oocytes after silencing endogenous Xenopus Na/K pumps with 1 microM ouabain. We found the low affinity inhibitory influence of extracellular Na on outward Na/K pump current at negative voltages to be impaired in all of the C-terminally truncated pumps. Correspondingly, voltage jump-induced transient charge movements that reflect pump interactions with extracellular Na ions were strongly shifted to more negative potentials; this signals a several-fold reduction of the apparent affinity for extracellular Na in the truncated pumps. Parallel lowering of Na affinity on both sides of the membrane argues that the C-terminal contacts provide important stabilization of the occluded E1P(Na3) conformation, regardless of the route of Na ion entry into the

alpha-Adducin mutations increase Na/K pump activity in renal cells by affecting constitutive endocytosis: implications for tubular Na reabsorption.

Science.gov (United States)

Torielli, Lucia; Tivodar, Simona; Montella, Rosa Chiara; Iacone, Roberto; Padoani, Gloria; Tarsini, Paolo; Russo, Ornella; Sarnataro, Daniela; Strazzullo, Pasquale; Ferrari, Patrizia; Bianchi, Giuseppe; Zurzolo, Chiara

2008-08-01

Genetic variation in alpha-adducin cytoskeletal protein is implicated in the polymerization and bundling of actin and alteration of the Na/K pump, resulting in abnormal renal sodium transport and hypertension in Milan hypertensive rats and humans. To investigate the molecular involvement of alpha-adducin in controlling Na/K pump activity, wild-type or mutated rat and human alpha-adducin forms were, respectively, transfected into several renal cell lines. Through multiple experimental approaches (microscopy, enzymatic assays, coimmunoprecipitation), we showed that rat and human mutated forms increased Na/K pump activity and the number of pump units; moreover, both variants coimmunoprecipitate with Na/K pump. The increased Na/K pump activity was not due to changes in its basolateral localization, but to an alteration of Na/K pump residential time on the plasma membrane. Indeed, both rat and human mutated variants reduced constitutive Na/K pump endocytosis and similarly affected transferrin receptor trafficking and fluid-phase endocytosis. In fact, alpha-adducin was detected in clathrin-coated vesicles and coimmunoprecipitated with clathrin. These results indicate that adducin, besides its modulatory effects on actin cytoskeleton dynamics, might play a direct role in clathrin-dependent endocytosis. The constitutive reduction of the Na/K pump endocytic rate induced by mutated adducin variants may be relevant in Na-dependent hypertension.

Decontamination and decommissioning plan for processing contaminated NaK at the INEL

Energy Technology Data Exchange (ETDEWEB)

LaRue, D.M.; Dolenc, M.R.

1986-09-01

This decontamination and decommissioning (D&D) plan describes the work elements and project management plan for processing four containers of contaminated sodium/potassium (NaK) and returning the Army Reentry Vehicle Facility Site (ARVFS) to a reusable condition. The document reflects the management plan for this project before finalizing the conceptual design and preliminary prototype tests of the reaction kinetics. As a result, the safety, environmental, and accident analyses are addressed as preliminary assessments before completion at a later date. ARVFS contains an earth-covered bunker, a cylindrical test pit and metal shed, and a cable trench connecting the two items. The bunker currently stores the four containers of NaK from the meltdown of the EBR-1 Mark II core. The D&D project addressed in this plan involves processing the contaminated NaK and returning the ARVFS to potential reuse after cleanup.

Decontamination and decommissioning plan for processing contaminated NaK at the INEL

Energy Technology Data Exchange (ETDEWEB)

LaRue, D.M.; Dolenc, M.R.

1986-09-01

This decontamination and decommissioning (D D) plan describes the work elements and project management plan for processing four containers of contaminated sodium/potassium (NaK) and returning the Army Reentry Vehicle Facility Site (ARVFS) to a reusable condition. The document reflects the management plan for this project before finalizing the conceptual design and preliminary prototype tests of the reaction kinetics. As a result, the safety, environmental, and accident analyses are addressed as preliminary assessments before completion at a later date. ARVFS contains an earth-covered bunker, a cylindrical test pit and metal shed, and a cable trench connecting the two items. The bunker currently stores the four containers of NaK from the meltdown of the EBR-1 Mark II core. The D D project addressed in this plan involves processing the contaminated NaK and returning the ARVFS to potential reuse after cleanup.

Reduced levels of skeletal muscle Na+K+ -ATPase in McArdle disease

Science.gov (United States)

Haller, R. G.; Clausen, T.; Vissing, J.; Blomqvist, C. G. (Principal Investigator)

1998-01-01

We evaluated the hypothesis that impaired sarcolemmal function associated with exaggerated potassium release, impaired potassium uptake, or both may contribute to exertional fatigue and abnormal circulatory responses to exercise in McArdle disease (MD). The cellular mechanism of exertional fatigue and muscle injury in MD is unknown but likely involves impaired function of the ATPases that couple ATP hydrolysis to cellular work, including the muscle sodium potassium pump (Na+K+-ATPase). However, the concentration of muscle Na+K+ pumps in MD is not known, and no studies have related exercise increases in blood potassium concentrations to muscle Na+K+ pump levels. We measured muscle Na+K+ pumps (3H-ouabain binding) and plasma K+ in response to 20 minutes of cycle exercise in six patients with MD and in six sex-, age-, and weight-matched sedentary individuals. MD patients had lower levels of 3H-ouabain binding (231 +/- 18 pmol/g w.w., mean +/- SD, range, 210 to 251) than control subjects (317 +/- 37, range, 266 to 371, p < 0.0004), higher peak increases in plasma potassium in response to 45 +/- 7 W cycle exercise (MD, 1.00 +/- 0.15 mmol/L; control subjects, 0.48 +/- 0.09; p < 0.0001), and mean exercise heart rate responses to exercise that were 45 +/- 12 bpm greater than control subjects. Our results indicate that Na+K+ pump levels are low in MD patients compared with healthy subjects and identify a limitation of potassium reuptake that could result in sarcolemmal failure during peak rates of membrane activation and may promote exaggerated potassium-activated circulatory responses to submaximal exercise. The mechanism of the low Na+K+ pump concentrations in MD is unknown but may relate to deconditioning or to disruption of a close functional relationship between membrane ion transport and glycolysis.

Functional and operational design requirements for decontamination and decommissioning of the EBR-I Mark-II NaK: Final report

International Nuclear Information System (INIS)

Brown, B.W.; Crandall, D.L.; Dafoe, R.E.; Dolenc, M.R.; LaRue, D.M.

1987-09-01

Approximately 180 gal of sodium/potassium (NaK) eutectic liquid metal were severely radioactively contaminated during a meltdown of the Mark-II core of the Experimental Breeder Reactor-I (EBR-I) in November 1955. This contaminated NaK, which is contained in four vessels, is currently stored in an underground bunker located at the Army Reentry Vehicle Facility Site (ARVFS) located approximately at the center of the Idaho National Engineering Laboratory (INEL). This document presents the Functional and Operational Requirements (F and ORs) for the D and D of the contaminated NaK and the ARVFS bunker site. This project will chemically deactivate the NaK; dispose of the radioactively contaminated product at a designated burial site; chemically deactivate any residual NaK in the containers, and dispose of the containers at a designated burial site; decontaminate and decommission any contaminated process equipment used in these operations, and decontaminate and decommission the ARVFS bunker site. Completion of the above technical objectives will allow for the effective disposition of the NaK, and will return the ARFVS bunker and immediate area to a reusable condition. Upon completion, the ARVFS NaK, which is now considered a significant potential hazard, will be removed from the Surplus Facilities Management Program priority listing of projects. 33 refs., 8 figs

Structural analysis of the α subunit of Na(+)/K(+) ATPase genes in invertebrates.

Science.gov (United States)

Thabet, Rahma; Rouault, J-D; Ayadi, Habib; Leignel, Vincent

2016-01-01

The Na(+)/K(+) ATPase is a ubiquitous pump coordinating the transport of Na(+) and K(+) across the membrane of cells and its role is fundamental to cellular functions. It is heteromer in eukaryotes including two or three subunits (α, β and γ which is specific to the vertebrates). The catalytic functions of the enzyme have been attributed to the α subunit. Several complete α protein sequences are available, but only few gene structures were characterized. We identified the genomic sequences coding the α-subunit of the Na(+)/K(+) ATPase, from the whole-genome shotgun contigs (WGS), NCBI Genomes (chromosome), Genomic Survey Sequences (GSS) and High Throughput Genomic Sequences (HTGS) databases across distinct phyla. One copy of the α subunit gene was found in Annelida, Arthropoda, Cnidaria, Echinodermata, Hemichordata, Mollusca, Placozoa, Porifera, Platyhelminthes, Urochordata, but the nematodes seem to possess 2 to 4 copies. The number of introns varied from 0 (Platyhelminthes) to 26 (Porifera); and their localization and length are also highly variable. Molecular phylogenies (Maximum Likelihood and Maximum Parsimony methods) showed some clusters constituted by (Chordata/(Echinodermata/Hemichordata)) or (Plathelminthes/(Annelida/Mollusca)) and a basal position for Porifera. These structural analyses increase our knowledge about the evolutionary events of the α subunit genes in the invertebrates. Copyright © 2016 Elsevier Inc. All rights reserved.

The effect of deferoxamine on brain lipid peroxide levels and Na-K ATPase activity following experimental subarachnoid hemorrhage.

Science.gov (United States)

Bilgihan, A; Türközkan, N; Aricioğlu, A; Aykol, S; Cevik, C; Göksel, M

1994-05-01

1. In the present study we have studied the effects of deferoxamine treatment on lipid peroxidation and Na-K ATPase activity after experimental induction of subarachnoid haemorrhage (SAH) in guinea pigs. 2. We assessed the extent of lipid peroxidation by measuring the level of malondialdehyde and Na-K ATPase activity in 3 different groups (sham-operated, SAH, SAH + deferoxamine). 3. There was no significant difference in lipid peroxide content between sham-operated and haemorrhagic animals, but Na-K ATPase activity decreased after SAH. 4. Deferoxamine treatment reduced the malondialdehyde content and induced the recovery of Na-K ATPase activity, exerting a brain protective role against the detrimental effects of the haemorrhage.

Lithium-induced inhibition of Na-K ATPase and Ca ATPase activities in rat brain synaptosome.

Science.gov (United States)

Cho, Y. W.

1995-01-01

To explore the action mechanism of lithium in the brain, the author investigated the effects of lithium on Na-K ATPase and Ca ATPase in rat brain synaptosomes prepared from forebrains by the method of Booth and Clark. The activities of Na-K ATPase and Ca ATPase were assayed by the level of inorganic phosphate liberated from the hydrolysis of ATP. Lithium at the optimum therapeutic concentration of 1 mM decreased the activity of Na-K ATPase from the control value of 19.08 +/- 0.29 to 18.27 +/- 0.10 micromoles Pi/mg protein/h and also reduced the activity of Ca ATPase from 6.38 +/- 0.12 to 5.64 +/- 0.12 micromoles Pi/mg protein/h. The decreased activity of Na-K ATPase will decrease the rate of Ca2+ efflux, probably via an Na-Ca exchange mechanism and will increase the rate of Ca2+ entry by the depolarization of nerve terminals. The reduced activity of Ca ATPase will result in the decreased efflux of Ca2+. As a Conclusion, it can be speculated that lithium elevates the intrasynaptosomal Ca2+ concentration via inhibition of the activities of Na-K ATPase and Ca ATPase, and this increased [Ca2+]i will cause the release of neurotransmitters and neurological effects of lithium. PMID:7598829

Angiotensin II inhibits the Na+-K+ pump via PKC-dependent activation of NADPH oxidase.

Science.gov (United States)

White, Caroline N; Figtree, Gemma A; Liu, Chia-Chi; Garcia, Alvaro; Hamilton, Elisha J; Chia, Karin K M; Rasmussen, Helge H

2009-04-01

The sarcolemmal Na(+)-K(+) pump, pivotal in cardiac myocyte function, is inhibited by angiotensin II (ANG II). Since ANG II activates NADPH oxidase, we tested the hypothesis that NADPH oxidase mediates the pump inhibition. Exposure to 100 nmol/l ANG II increased superoxide-sensitive fluorescence of isolated rabbit ventricular myocytes. The increase was abolished by pegylated superoxide dismutase (SOD), by the NADPH oxidase inhibitor apocynin, and by myristolated inhibitory peptide to epsilon-protein kinase C (epsilonPKC), previously implicated in ANG II-induced Na(+)-K(+) pump inhibition. A role for epsilonPKC was also supported by an ANG II-induced increase in coimmunoprecipitation of epsilonPKC with the receptor for the activated kinase and with the cytosolic p47(phox) subunit of NADPH oxidase. ANG II decreased electrogenic Na(+)-K(+) pump current in voltage-clamped myocytes. The decrease was abolished by SOD, by the gp91ds inhibitory peptide that blocks assembly and activation of NADPH oxidase, and by epsilonPKC inhibitory peptide. Since colocalization should facilitate NADPH oxidase-dependent regulation of the Na(+)-K(+) pump, we examined whether there is physical association between the pump subunits and NADPH oxidase. The alpha(1)-subunit coimmunoprecipitated with caveolin 3 and with membrane-associated p22(phox) and cytosolic p47(phox) NADPH oxidase subunits at baseline. ANG II had no effect on alpha(1)/caveolin 3 or alpha(1)/p22(phox) interaction, but it increased alpha(1)/p47(phox) coimmunoprecipitation. We conclude that ANG II inhibits the Na(+)-K(+) pump via PKC-dependent NADPH oxidase activation.

Angiotensin-(1-7) attenuates hyposmolarity-induced ANP secretion via the Na+-K+ pump.

Science.gov (United States)

Shah, Amin; Oh, Young-Bin; Shan, Gao; Song, Chang Ho; Park, Byung-Hyun; Kim, Suhn Hee

2010-09-01

The alteration in osmolarity challenges cell volume regulation, a vital element for cell survival. Hyposmolarity causes an increase in cell volume. Recently, it has been reported that the renin-angiotensin system (RAS) plays a role in cell volume regulation. We investigated the effect of angiotensin-(1-7) [Ang-(1-7)] on hyposmolarity-induced atrial natriuretic peptide (ANP) secretion in normal and diabetic (DM) rat atria and modulation of the effect of Ang-(1-7) by the Na(+)-K(+) pump. Using isolated control rat atria, we observed that perfusion of hyposmotic solution into the atria increased ANP secretion. When Ang-(1-7) [0.1 microM or 1 microM] was perfused in a hyposmolar solution, it decreased the hyposmolarity-induced ANP secretion in a dose-dependent manner. This effect of Ang-(1-7) could be mediated by the Na(+)-K(+) pump, since ouabain, an Na(+)-K(+) pump inhibitor, significantly decreased the effect of Ang-(1-7) on hyposmolarity-induced ANP secretion. In contrast, N(omega) Nitro-l-arginine methyl ester hydrochloride (l-NAME) did not modify the effect of Ang-(1-7) on the hyposmolarity-induced ANP secretion. Interestingly, the ANP secretion was increased robustly by the perfusion of the hyposmolar solution in the DM atria, as compared to the control atria. However, the inhibitory effect of Ang-(1-7) on the hyposmolarity-induced ANP secretion was not observed in the DM atria. In the DM atria, atrial contractility was significantly increased. Taken together, we concluded that Ang-(1-7) attenuated hyposmolarity-induced ANP secretion via the Na(+)-K(+) pump and a lack of Ang-(1-7) response in DM atria may partly relate to change in Na(+)-K(+) pump activity. Copyright 2010 Elsevier Inc. All rights reserved.

Differential regulation of cystic fibrosis transmembrane conductance regulator and Na+,K+ -ATPase in gills of striped bass, Morone saxatilis: effect of salinity and hormones

DEFF Research Database (Denmark)

Madsen, Steffen; Jensen, Lars Nørholm; Tipsmark, Christian Kølbaek

2007-01-01

-regulated kinase (ERK) 1/2 was stimulated by EGF but not affected by IGF-I. This study is the first to report a branchial EGF response and to demonstrate a functional ERK 1/2 pathway in the teleost gill. In conclusion, CFTR and Na(+),K(+) -ATPase are differentially regulated by salinity and hormones in gills...

Characterization of thyroid hormone effects on Na-K pump and membrane potential of cultured rat skeletal myotubes

International Nuclear Information System (INIS)

Brodie, C.; Sampson, S.R.

1988-01-01

The purpose of this study was to characterize the effects of thyroid hormone on the Na-K pump and resting membrane potential (EM) of rat skeletal myotubes in culture. Myotubes were obtained from fetal (19-21 day) or neonatal rats (1-2 day) by serial trypsinization and maintained in culture for up to 10 days. Cells were treated with T4 or T3 on day 6 or 7, and measurements were made of EM, [ 3 H]ouabain binding, and ouabain-sensitive 86 Rb uptake at various times thereafter. Hormone treatment increased the values of all three variables within 24 h, plateau levels being attained by 48-72 h. Cycloheximide and actinomycin D totally blocked the effects of thyroid hormone when added together to the cells, thus suggesting that protein synthesis is necessary for the effects of these hormones. Scatchard analysis showed that the new receptors have lower ouabain affinity than those in control. Blockade of spontaneously occurring action potentials with tetrodotoxin, which blocks voltage-dependent Na channels, or Na/H antiporter with amiloride, abolished the hormone effects seen after 24 h and significantly reduced those obtained after 48 h of hormone treatment. The results demonstrate that thyroid hormone-induced increased amount and activity of the electrogenic Na-K pump in cultured myotubes occurs, at least in part, in response to an initial effect to increase Na influx. Moreover, the findings are consistent with the concept that the Na-K pump plays an important role in regulation of EM in this preparation

Na/K pump inactivation, subsarcolemmal Na measurements, and cytoplasmic ion turnover kinetics contradict restricted Na spaces in murine cardiac myocytes.

Science.gov (United States)

Lu, Fang-Min; Hilgemann, Donald W

2017-07-03

Decades ago, it was proposed that Na transport in cardiac myocytes is modulated by large changes in cytoplasmic Na concentration within restricted subsarcolemmal spaces. Here, we probe this hypothesis for Na/K pumps by generating constitutive transsarcolemmal Na flux with the Na channel opener veratridine in whole-cell patch-clamp recordings. Using 25 mM Na in the patch pipette, pump currents decay strongly during continuous activation by extracellular K (τ, ∼2 s). In contradiction to depletion hypotheses, the decay becomes stronger when pump currents are decreased by hyperpolarization. Na channel currents are nearly unchanged by pump activity in these conditions, and conversely, continuous Na currents up to 0.5 nA in magnitude have negligible effects on pump currents. These outcomes are even more pronounced using 50 mM Li as a cytoplasmic Na congener. Thus, the Na/K pump current decay reflects mostly an inactivation mechanism that immobilizes Na/K pump charge movements, not cytoplasmic Na depletion. When channel currents are increased beyond 1 nA, models with unrestricted subsarcolemmal diffusion accurately predict current decay (τ ∼15 s) and reversal potential shifts observed for Na, Li, and K currents through Na channels opened by veratridine, as well as for Na, K, Cs, Li, and Cl currents recorded in nystatin-permeabilized myocytes. Ion concentrations in the pipette tip (i.e., access conductance) track without appreciable delay the current changes caused by sarcolemmal ion flux. Importantly, cytoplasmic mixing volumes, calculated from current decay kinetics, increase and decrease as expected with osmolarity changes (τ >30 s). Na/K pump current run-down over 20 min reflects a failure of pumps to recover from inactivation. Simulations reveal that pump inactivation coupled with Na-activated recovery enhances the rapidity and effectivity of Na homeostasis in cardiac myocytes. In conclusion, an autoregulatory mechanism enhances cardiac Na/K pump activity when

Multichannel modeling and two-photon coherent transfer paths in NaK

Science.gov (United States)

Schulze, T. A.; Temelkov, I. I.; Gempel, M. W.; Hartmann, T.; Knöckel, H.; Ospelkaus, S.; Tiemann, E.

2013-08-01

We explore possible pathways for the creation of ultracold polar NaK molecules in their absolute electronic and rovibrational ground state starting from ultracold Feshbach molecules. In particular, we present a multichannel analysis of the electronic ground and K(4p)+Na(3s) excited-state manifold of NaK, analyze the spin character of both the Feshbach molecular state and the electronically excited intermediate states and discuss possible coherent two-photon transfer paths from Feshbach molecules to rovibronic ground-state molecules. The theoretical study is complemented by the demonstration of stimulated Raman adiabatic passage from the X1Σ+(v=0) state to the a3Σ+ manifold on a molecular beam experiment.

Modulation of Na+/K+ ATPase Activity by Hydrogen Peroxide Generated through Heme in L. amazonensis.

Directory of Open Access Journals (Sweden)

Nathália Rocco-Machado

Full Text Available Leishmania amazonensis is a protozoan parasite that occurs in many areas of Brazil and causes skin lesions. Using this parasite, our group showed the activation of Na+/K+ ATPase through a signaling cascade that involves the presence of heme and protein kinase C (PKC activity. Heme is an important biomolecule that has pro-oxidant activity and signaling capacity. Reactive oxygen species (ROS can act as second messengers, which are required in various signaling cascades. Our goal in this work is to investigate the role of hydrogen peroxide (H2O2 generated in the presence of heme in the Na+/K+ ATPase activity of L. amazonensis. Our results show that increasing concentrations of heme stimulates the production of H2O2 in a dose-dependent manner until a concentration of 2.5 μM heme. To confirm that the effect of heme on the Na+/K+ ATPase is through the generation of H2O2, we measured enzyme activity using increasing concentrations of H2O2 and, as expected, the activity increased in a dose-dependent manner until a concentration of 0.1 μM H2O2. To investigate the role of PKC in this signaling pathway, we observed the production of H2O2 in the presence of its activator phorbol 12-myristate 13-acetate (PMA and its inhibitor calphostin C. Both showed no effect on the generation of H2O2. Furthermore, we found that PKC activity is increased in the presence of H2O2, and that in the presence of calphostin C, H2O2 is unable to activate the Na+/K+ ATPase. 100 μM of Mito-TEMPO was capable of abolishing the stimulatory effect of heme on Na+/K+ ATPase activity, indicating that mitochondria might be the source of the hydrogen peroxide production induced by heme. The modulation of L. amazonensis Na+/K+ ATPase by H2O2 opens new possibilities for understanding the signaling pathways of this parasite.

Profound regulation of Na/K pump activity by transient elevations of cytoplasmic calcium in murine cardiac myocytes.

Science.gov (United States)

Lu, Fang-Min; Deisl, Christine; Hilgemann, Donald W

2016-09-14

Small changes of Na/K pump activity regulate internal Ca release in cardiac myocytes via Na/Ca exchange. We now show conversely that transient elevations of cytoplasmic Ca strongly regulate cardiac Na/K pumps. When cytoplasmic Na is submaximal, Na/K pump currents decay rapidly during extracellular K application and multiple results suggest that an inactivation mechanism is involved. Brief activation of Ca influx by reverse Na/Ca exchange enhances pump currents and attenuates current decay, while repeated Ca elevations suppress pump currents. Pump current enhancement reverses over 3 min, and results are similar in myocytes lacking the regulatory protein, phospholemman. Classical signaling mechanisms, including Ca-activated protein kinases and reactive oxygen, are evidently not involved. Electrogenic signals mediated by intramembrane movement of hydrophobic ions, such as hexyltriphenylphosphonium (C6TPP), increase and decrease in parallel with pump currents. Thus, transient Ca elevation and Na/K pump inactivation cause opposing sarcolemma changes that may affect diverse membrane processes.

Route, mechanism, and implications of proton import during Na+/K+ exchange by native Na+/K+-ATPase pumps

Science.gov (United States)

Vedovato, Natascia

2014-01-01

A single Na+/K+-ATPase pumps three Na+ outwards and two K+ inwards by alternately exposing ion-binding sites to opposite sides of the membrane in a conformational sequence coupled to pump autophosphorylation from ATP and auto-dephosphorylation. The larger flow of Na+ than K+ generates outward current across the cell membrane. Less well understood is the ability of Na+/K+ pumps to generate an inward current of protons. Originally noted in pumps deprived of external K+ and Na+ ions, as inward current at negative membrane potentials that becomes amplified when external pH is lowered, this proton current is generally viewed as an artifact of those unnatural conditions. We demonstrate here that this inward current also flows at physiological K+ and Na+ concentrations. We show that protons exploit ready reversibility of conformational changes associated with extracellular Na+ release from phosphorylated Na+/K+ pumps. Reversal of a subset of these transitions allows an extracellular proton to bind an acidic side chain and to be subsequently released to the cytoplasm. This back-step of phosphorylated Na+/K+ pumps that enables proton import is not required for completion of the 3 Na+/2 K+ transport cycle. However, the back-step occurs readily during Na+/K+ transport when external K+ ion binding and occlusion are delayed, and it occurs more frequently when lowered extracellular pH raises the probability of protonation of the externally accessible carboxylate side chain. The proton route passes through the Na+-selective binding site III and is distinct from the principal pathway traversed by the majority of transported Na+ and K+ ions that passes through binding site II. The inferred occurrence of Na+/K+ exchange and H+ import during the same conformational cycle of a single molecule identifies the Na+/K+ pump as a hybrid transporter. Whether Na+/K+ pump–mediated proton inflow may have any physiological or pathophysiological significance remains to be clarified. PMID

Route, mechanism, and implications of proton import during Na+/K+ exchange by native Na+/K+-ATPase pumps.

Science.gov (United States)

Vedovato, Natascia; Gadsby, David C

2014-04-01

A single Na(+)/K(+)-ATPase pumps three Na(+) outwards and two K(+) inwards by alternately exposing ion-binding sites to opposite sides of the membrane in a conformational sequence coupled to pump autophosphorylation from ATP and auto-dephosphorylation. The larger flow of Na(+) than K(+) generates outward current across the cell membrane. Less well understood is the ability of Na(+)/K(+) pumps to generate an inward current of protons. Originally noted in pumps deprived of external K(+) and Na(+) ions, as inward current at negative membrane potentials that becomes amplified when external pH is lowered, this proton current is generally viewed as an artifact of those unnatural conditions. We demonstrate here that this inward current also flows at physiological K(+) and Na(+) concentrations. We show that protons exploit ready reversibility of conformational changes associated with extracellular Na(+) release from phosphorylated Na(+)/K(+) pumps. Reversal of a subset of these transitions allows an extracellular proton to bind an acidic side chain and to be subsequently released to the cytoplasm. This back-step of phosphorylated Na(+)/K(+) pumps that enables proton import is not required for completion of the 3 Na(+)/2 K(+) transport cycle. However, the back-step occurs readily during Na(+)/K(+) transport when external K(+) ion binding and occlusion are delayed, and it occurs more frequently when lowered extracellular pH raises the probability of protonation of the externally accessible carboxylate side chain. The proton route passes through the Na(+)-selective binding site III and is distinct from the principal pathway traversed by the majority of transported Na(+) and K(+) ions that passes through binding site II. The inferred occurrence of Na(+)/K(+) exchange and H(+) import during the same conformational cycle of a single molecule identifies the Na(+)/K(+) pump as a hybrid transporter. Whether Na(+)/K(+) pump-mediated proton inflow may have any physiological or

Na-K pump site density and ouabain binding affinity in cultured chick heart cells

International Nuclear Information System (INIS)

Lobaugh, L.A.; Lieberman, M.

1987-01-01

The possible existence of multiple [ 3 H]ouabain binding sites and the relationship between ouabain binding and Na-K pump inhibition in cardiac muscle were studied using cultured embryonic chick heart cells. [ 3 H]ouabain bound to a single class of sites in 0.5 mM K (0.5 Ko) with an association rate constant (k+1) of 3.4 X 10(4) M-1.s-1 and a dissociation rate constant (k-1) of 0.0095 s. Maximal specific [ 3 H]ouabain binding RT to myocyte-enriched cultures is 11.7 pmol/mg protein and Kd is 0.43 microM in 0.5 Ko, whereas Kd,apparent is 6.6 microM in 5.4 Ko. The number of binding sites per myocyte was calculated by correcting for the contribution of fibroblasts in myocyte-enriched cultures using data from homogeneous fibroblast cultures (RT = 3.3 pmol/mg protein; Kd = 0.19 microM in 0.5 Ko). Equivalence of [ 3 H]ouabain binding sites and Na-K pumps was implied by agreement between maximal specific binding of [ 3 H]ouabain and 125 I-labeled monoclonal antibody directed against Na+-K+-ATPase (approximately 2 X 10(6) sites/cell). However, [ 3 H]ouabain binding occurred at lower concentrations than inhibition of ouabain-sensitive 42 K uptake in 0.5 Ko. Further studies in both 0.5 K and 5.4 Ko showed that ouabain caused cell Na content Nai to increase over the same range of concentrations that binding occurred, implying that increased Nai may stimulate unbound Na-K pumps and prevent a proportional decrease in 42 K uptake rate. The results show that Na-K pump inhibition occurs as a functional consequence of specific ouabain binding and indicate that the Na-K pump is the cardiac glycoside receptor in cultured heart cells

Cardiac glycoside activities link Na(+)/K(+) ATPase ion-transport to breast cancer cell migration via correlative SAR.

Science.gov (United States)

Magpusao, Anniefer N; Omolloh, George; Johnson, Joshua; Gascón, José; Peczuh, Mark W; Fenteany, Gabriel

2015-02-20

The cardiac glycosides ouabain and digitoxin, established Na(+)/K(+) ATPase inhibitors, were found to inhibit MDA-MB-231 breast cancer cell migration through an unbiased chemical genetics screen for cell motility. The Na(+)/K(+) ATPase acts both as an ion-transporter and as a receptor for cardiac glycosides. To delineate which function is related to breast cancer cell migration, structure-activity relationship (SAR) profiles of cardiac glycosides were established at the cellular (cell migration inhibition), molecular (Na(+)/K(+) ATPase inhibition), and atomic (computational docking) levels. The SAR of cardiac glycosides and their analogs revealed a similar profile, a decrease in potency when the parent cardiac glycoside structure was modified, for each activity investigated. Since assays were done at the cellular, molecular, and atomic levels, correlation of SAR profiles across these multiple assays established links between cellular activity and specific protein-small molecule interactions. The observed antimigratory effects in breast cancer cells are directly related to the inhibition of Na(+)/K(+) transport. Specifically, the orientation of cardiac glycosides at the putative cation permeation path formed by transmembrane helices αM1-M6 correlates with the Na(+) pump activity and cell migration. Other Na(+)/K(+) ATPase inhibitors that are structurally distinct from cardiac glycosides also exhibit antimigratory activity, corroborating the conclusion that the antiport function of Na(+)/K(+) ATPase and not the receptor function is important for supporting the motility of MDA-MB-231 breast cancer cells. Correlative SAR can establish new relationships between specific biochemical functions and higher-level cellular processes, particularly for proteins with multiple functions and small molecules with unknown or various modes of action.

FXYD proteins reverse inhibition of the Na+-K+ pump mediated by glutathionylation of its beta1 subunit.

Science.gov (United States)

Bibert, Stéphanie; Liu, Chia-Chi; Figtree, Gemma A; Garcia, Alvaro; Hamilton, Elisha J; Marassi, Francesca M; Sweadner, Kathleen J; Cornelius, Flemming; Geering, Käthi; Rasmussen, Helge H

2011-05-27

The seven members of the FXYD protein family associate with the Na(+)-K(+) pump and modulate its activity. We investigated whether conserved cysteines in FXYD proteins are susceptible to glutathionylation and whether such reactivity affects Na(+)-K(+) pump function in cardiac myocytes and Xenopus oocytes. Glutathionylation was detected by immunoblotting streptavidin precipitate from biotin-GSH loaded cells or by a GSH antibody. Incubation of myocytes with recombinant FXYD proteins resulted in competitive displacement of native FXYD1. Myocyte and Xenopus oocyte pump currents were measured with whole-cell and two-electrode voltage clamp techniques, respectively. Native FXYD1 in myocytes and FXYD1 expressed in oocytes were susceptible to glutathionylation. Mutagenesis identified the specific cysteine in the cytoplasmic terminal that was reactive. Its reactivity was dependent on flanking basic amino acids. We have reported that Na(+)-K(+) pump β(1) subunit glutathionylation induced by oxidative signals causes pump inhibition in a previous study. In the present study, we found that β(1) subunit glutathionylation and pump inhibition could be reversed by exposing myocytes to exogenous wild-type FXYD3. A cysteine-free FXYD3 derivative had no effect. Similar results were obtained with wild-type and mutant FXYD proteins expressed in oocytes. Glutathionylation of the β(1) subunit was increased in myocardium from FXYD1(-/-) mice. In conclusion, there is a dependence of Na(+)-K(+) pump regulation on reactivity of two specifically identified cysteines on separate components of the multimeric Na(+)-K(+) pump complex. By facilitating deglutathionylation of the β(1) subunit, FXYD proteins reverse oxidative inhibition of the Na(+)-K(+) pump and play a dynamic role in its regulation.

F2α-isoprostane, Na+-K+ ATPase and membrane fluidity of placental syncytiotrophoblast cell in preeclamptic women with vitamin E supplementation

Directory of Open Access Journals (Sweden)

Franciscus D. Suyatna

2012-11-01

Full Text Available Background: The aim of our study was to analyze F2α-isoprostane level, Na+-K+ ATPase activity and placental syncytiotrophoblast cell membrane fluidity in preeclamptic women who received vitamin E supplementation.Methods: The study was conducted between September 2003 and February 2005 at Budi Kemuliaan Maternity Hospital, Central Jakarta. Samples were 6 preeclamptic women with vitamin E supplementation, 6 preeclamptic women without vitamin E supplementation and 6 normal pregnant women. The dose of vitamin E was 200 mg daily. F2α-isoprostane was measured with ELISA reader at λ of 450 nm. Cell membrane fluidity was measured by comparing the molar ratio of total cholesterol and cell membrane phospholipid concentration. The cholesterol was measured by Modular C800 using Roche reagent. Phospholipid was measured by Shimadzu RF5301PC spectrofluorometer (excitation 267 nm, emission 307 nm. Na+-K+ ATPase activity was inhibited by ouabain. Pi production was measured with Fiske and Subbarow method using spectrophotometer at λ of 660 nm. Data was analyzed using F test with one-way ANOVA.Results: Vitamin E supplementation in preeclamptic women decreased the oxidative stress, indicated by significantly lower level of F2α-isoprostane compared to those without vitamin E (26.72 ± 11.21 vs 41.85 ± 7.09 ng/mL, respectively, p = 0.017. Membrane fluidity in syncytiotrophoblast cell of preeclampsia with vitamin E group was maintained at 0.39 ± 0.08 while in those without vitamin E was 0.53 ± 0.14 (p = 0.04. Na+-K+ ATPase activity in syncytiotrophoblast cell membrane was not affected by vitamin E (p = 0.915.Conclusion: Vitamin E supplementation in preeclamptic women decreases F2α-isoprostane level and maintains cell membrane fluidity of syncytiotrophoblast cells; however, it does not increase Na+-K+ ATPase enzyme activity. (Med J Indones. 2012;21:225-9Keywords: F2α-isoprostane, membrane fluidity, Na+-K+ ATPase, preeclampsia, vitamin E

Temperature-specific inhibition of human red cell Na+/K+ ATPase by 2450-MHz microwave radiation

Energy Technology Data Exchange (ETDEWEB)

Allis, J.W.; Sinha-Robinson, B.L.

1987-01-01

The ATPase activity in human red blood cell membranes was investigated in vitro as a function of temperature and exposure to 2450-MHz continuous wave microwave radiation to confirm and extend a report of Na+ transport inhibition under certain conditions of temperature and exposure. Assays were conducted spectrophotometrically during microwave exposure with a custom-made spectrophotometer-waveguide apparatus. Temperature profiles of total ATPase and Ca+2 ATPase (ouabain-inhibited) activity between 17 and 31 degrees C were graphed as an Arrhenius plot. Each data set was fitted to two straight lines which intersect between 23 and 24 degrees C. The difference between the total and Ca+2 ATPase activities, which represented the Na+/K+ ATPase activity, was also plotted and treated similarly to yield an intersection near 25 degrees C. Exposure of membrane suspensions to electromagnetic radiation, at a dose rate of 6 W/kg and at five temperatures between 23 and 27 degrees C, resulted in an activity change only for the Na+/K+ ATPase at 25 degrees C. The activity decreased by approximately 35% compared to sham-irradiated samples. A possible explanation for the unusual temperature/microwave interaction is proposed.

A marked animal-vegetal polarity in the localization of Na(+),K(+) -ATPase activity and its down-regulation following progesterone-induced maturation.

Science.gov (United States)

Mohanty, Basant Kumar; Gupta, Brij L

2012-02-01

The stage-VI Xenopus oocyte has a very distinct animal-vegetal polarity with structural and functional asymmetry. In this study, we show the expression and distribution pattern of Na(+),K(+) -ATPase in stage-VI oocytes, and its changes following progesterone-induced maturation. Using enzyme-specific electron microscopy phosphatase histochemistry, [(3) H]-ouabain autoradiography, and immunofluorescence cytochemistry at light microscopic level, we find that Na(+),K(+) -ATPase activity is mainly confined to the animal hemisphere. Electron microscopy histochemical results also suggest that polarized distribution of Na(+),K(+) -ATPase activity persists following progesterone-induced maturation, and it becomes gradually more polarized towards the animal pole. The time course following progesterone-induced maturation suggests that there is an initial up-regulation and then gradual down-regulation of Na(+),K(+) -ATPase activity leading to germinal vesicle breakdown (GVBD). By GVBD, the Na(+),K(+) -ATPase activity is completely down-regulated due to endocytotic removal of pump molecules from the plasma membrane into the sub-cortical region of the oocyte. This study provides the first direct evidence for a marked asymmetric localization of Na(+),K(+) -ATPase activity in any vertebrate oocyte. Here, we propose that such asymmetry in Na(+),K(+) -ATPase activity in stage-VI oocytes, and their down-regulation following progesterone-induced maturation, is likely to have a role in the active state of the germinal vesicle in stage-VI oocytes and chromosomal condensation after GVBD. Copyright © 2011 Wiley Periodicals, Inc.

Effect of various Na/K ratios in low-salinity well water on growth performance and physiological response of Pacific white shrimp Litopenaeus vannamei

Science.gov (United States)

Liu, Hongyu; Tan, Beiping; Yang, Jinfang; Lin, Yingbo; Chi, Shuyan; Dong, Xiaohui; Yang, Qihui

2014-09-01

To investigate the influence of sodium to potassium (Na/K) ratios on the growth performance and physiological response of the Pacific white shrimp ( Litopenaeus vananmei), various concentrations of KCl were added to low-salinity well water (salinity 4) in an 8-week culture trial. Six treatments with Na/K ratios of 60:1, 42:1, 33:1, 23:1, 17:1, and 14:1 were replicated in triplicate. The highest weight-gain rate (3 506±48)% and survival rate (89.38±0.88)% was observed in well water with Na/K ratios of 23:1 and 42:1, respectively, while the feed conversion ratio (1.02±0.01), oxygen consumption, and ammonia-N excretion rate was the lowest in the medium with a Na/K ratio of 23:1. Gill Na+-K+-ATPase activity, as an indicator of osmoregulation, peaked in the treatment where the Na/K ratio was 17:1. The total hemocyte count, respiratory burst, and immune-related enzyme activities (ALP, LSZ, PO, and SOD) of L. vananmei were affected significantly by Na/K ratios ( Pshrimp reared in a Na/K ratio of 23:1 (30±14.14)% was significantly lower than the control (75±7.07)%. In conclusion, the addition of K+ to low-salinity well water in L. vannamei cultures is feasible. Na/K ratios ranging from 23:1 to 33:1 might improve survival and growth. Immunity and disease resistance are also closely related to the Na/K ratio of the low-salinity well water. The findings may contribute to the development of more efficient K + remediation strategies for L. vananmei culture in low-salinity well water.

Na+,K+ pumpen vedbliver at overraske

DEFF Research Database (Denmark)

Vilsen, Bente

2008-01-01

This article provides an overview of news about the Na+,K+ pump, an indispensable enzyme whose protein structure has been described in a recent article in Nature, 50 years after its discovery. In combination with mutational analysis, the structure reveals the binding pocket for the K+ ions...... and the regulation of Na+ transport by a strategically located C-terminus of the protein. Focus is also on the pathophysiology of two neurological disorders, familial hemiplegic migraine and rapid-onset dystonia-parkinsonism, recently shown to be caused by mutations in the Na+,K+-ATPase. Udgivelsesdato: may 19...

Response of saliva Na/K ratio to changing Na supply of lactating cows under tropical conditions.

Science.gov (United States)

Thiangtum, Wandee; Schonewille, J Thomas; Verstegen, Martin Wa; Arsawakulsudhi, Supot; Rukkwamsuk, Theera; Hendriks, Wouter H

2017-06-01

Factorial determination of the sodium (Na) requirement of heat-stressed lactating cows is hindered by accurate estimates of the Na losses through sweat. Direct studies, therefore, may be needed requiring information on the time course of healthy animals to become Na depleted and the subsequent rate of repletion. The rate of Na depletion and subsequent rate of Na repletion with two levels of dietary Na to lactating dairy cows housed under tropical conditions were investigated using the salivary Na/K. The 12 lactating cows (salivary Na/K ratio 14.6) rapidly developed clinical signs of Na deficiency, including pica, polyuria and polydipsia, reduced body weight and reduced milk yield when fed a low-Na ration (0.33 g kg -1 dry matter (DM)) for 3 weeks. Deficiency symptoms were associated with a rapid decrease in salivary Na/K ratio to cows with NaCl to a ration concentration of 1.1 or 1.6 g Na kg -1 DM for 5 weeks did not restore salivary Na/K ratio to values of >6. A daily Na intake of heat-stressed lactating cows to a ration intake of 1.6 g Na kg -1 DM was insufficient to restore Na deficiency. One week was sufficient to deplete heat-stressed lactating cows of Na, allowing for rapid dose-response studies utilizing the salivary Na/K ratio as a parameter for Na status of cows under tropical conditions. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

Variable Thermal Conductivity on Compressible Boundary Layer ...

African Journals Online (AJOL)

In this paper, variable thermal conductivity on heat transfer over a circular cylinder is presented. The concept of assuming constant thermal conductivity on materials is however not efficient. Hence, the governing partial differential equation is reduced using non-dimensionless variables into a system of coupled non-linear ...

HCO3(-)-coupled Na+ influx is a major determinant of Na+ turnover and Na+/K+ pump activity in rat hepatocytes

International Nuclear Information System (INIS)

Fitz, J.G.; Lidofsky, S.D.; Weisiger, R.A.; Xie, M.H.; Cochran, M.; Grotmol, T.; Scharschmidt, B.F.

1991-01-01

Recent studies in hepatocytes indicate that Na(+)-coupled HCO3- transport contributes importantly to regulation of intracellular pH and membrane HCO3- transport. However, the direction of net coupled Na+ and HCO3- movement and the effect of HCO3- on Na+ turnover and Na+/K+ pump activity are not known. In these studies, the effect of HCO3- on Na+ influx and turnover were measured in primary rat hepatocyte cultures with 22Na+, and [Na+]i was measured in single hepatocytes using the Na(+)-sensitive fluorochrome SBFI. Na+/K+ pump activity was measured in intact perfused rat liver and hepatocyte monolayers as Na(+)-dependent or ouabain-suppressible 86Rb uptake, and was measured in single hepatocytes as the effect of transient pump inhibition by removal of extracellular K+ on membrane potential difference (PD) and [Na+]i. In hepatocyte monolayers, HCO3- increased 22Na+ entry and turnover rates by 50-65%, without measurably altering 22Na+ pool size or cell volume, and HCO3- also increased Na+/K+ pump activity by 70%. In single cells, exposure to HCO3- produced an abrupt and sustained rise in [Na+]i from approximately 8 to 12 mM. Na+/K+ pump activity assessed in single cells by PD excursions during transient K+ removal increased congruent to 2.5-fold in the presence of HCO3-, and the rise in [Na+]i produced by inhibition of the Na+/K+ pump was similarly increased congruent to 2.5-fold in the presence of HCO3-. In intact perfused rat liver, HCO3- increased both Na+/K+ pump activity and O2 consumption. These findings indicate that, in hepatocytes, net coupled Na+ and HCO3- movement is inward and represents a major determinant of Na+ influx and Na+/K+ pump activity. About half of hepatic Na+/K+ pump activity appears dedicated to recycling Na+ entering in conjunction with HCO3- to maintain [Na+]i within the physiologic range

Social Marketing in Malaysia: Cognitive, Affective, and Normative Mediators of the TAK NAK Antismoking Advertising Campaign.

Science.gov (United States)

Lee, Wonkyong Beth; Fong, Geoffrey T; Dewhirst, Timothy; Kennedy, Ryan D; Yong, Hua-Hie; Borland, Ron; Awang, Rahmat; Omar, Maizurah

2015-01-01

Antismoking mass media campaigns are known to be effective as part of comprehensive tobacco control programs in high-income countries, but such campaigns are relatively new in low- and middle-income countries and there is a need for strong evaluation studies from these regions. This study examines Malaysia's first national antismoking campaign, TAK NAK. The data are from the International Tobacco Control Malaysia Survey, which is an ongoing cohort survey of a nationally representative sample of adult smokers (18 years and older; N = 2,006). The outcome variable was quit intentions of adult smokers, and the authors assessed the extent to which quit intentions may have been strengthened by exposure to the antismoking campaign. The authors also tested whether the impact of the campaign on quit intentions was related to cognitive mechanisms (increasing thoughts about the harm of smoking), affective mechanisms (increasing fear from the campaign), and perceived social norms (increasing perceived social disapproval about smoking). Mediational regression analyses revealed that thoughts about the harm of smoking, fear arousal, and social norms against smoking mediated the relation between TAK NAK impact and quit intentions. Effective campaigns should prompt smokers to engage in both cognitive and affective processes and encourage consideration of social norms about smoking in their society.

[Protective effects of luteolin on neurons against oxygen-glucose deprivation/reperfusion injury via improving Na+/K+ -ATPase activity].

Science.gov (United States)

Fang, Lumei; Zhang, Mingming; Ding, Yuemin; Fang, Yuting; Yao, Chunlei; Zhang, Xiong

2010-04-01

Luteolin, a flavone, has considerable neuroprotective effects by its anti-oxidative mechanism. However, it is still unclear whether luteolin can protect neurons against oxygen-glucose deprivation/reperfusion (OGD/R) induced injury. After 2 hours oxygen-glucose deprivation and 24 hours reperfusion treatment in primary cultured hippocampal neurons, the neuron viability, survival rate and apoptosis rate were evaluated by MTT assay, lactate dehydrogenase (LDH) leakage assay and Hoechst staining, respectively. The activity of Na+/K+ -ATPase was examined in cultured neurons or in the hippocampus of SD rats treated by 10 minutes global cerebral ischemia and followed 24 hours reperfusion. Treatment by OGD/R markedly reduced neuronal viability, increased LDH leakage rate and increased apoptosis rate. Application of luteolin (10-100 micromol x L(-1)) during OGD inhibited OGD/R induced neuron injury and apoptosis in a dose-dependent manner. Compared to the control group or OGP/R-treated neurons, the activity of Na+/K+ -ATPase was significantly suppressed in global ischemia/reperfusion group or OGD/R-treated neurons. Application of luteolin during ischemia or OGD preserved the Na+/K+ -ATPase activity. Furthermore, inhibition of Na+/K+ -ATPase with ouabain attenuated the protective effect afforded by luteolin. The data provide the evidence that luteolin has neuroprotective effect against OGD/R induced injury and the protective effect may be associated with its ability to improve Na+/K+ -ATPase activity after OGD/R.

Effect of dexamethasone on skeletal muscle Na+,K+ pump subunit specific expression and K+ homeostasis during exercise in humans

DEFF Research Database (Denmark)

Nordsborg, Nikolai; Ovesen, Jakob; Thomassen, Martin

2008-01-01

The effect of dexamethasone on Na(+),K(+) pump subunit expression and muscle exchange of K(+) during exercise in humans was investigated. Nine healthy male subjects completed a randomized double blind placebo controlled protocol, with ingestion of dexamethasone (Dex: 2 x 2 mg per day) or placebo...... (Pla) for 5 days. Na(+),K(+) pump catalytic alpha1 and alpha2 subunit expression was approximately 17% higher (P ...). The results indicate that an increased Na(+),K(+) pump expression per se is of importance for thigh K(+) reuptake at the onset of low and moderate intensity exercise, but less important during high intensity exercise....

Evidence that the Na+-K+ leak/pump ratio contributes to the difference in endurance between fast- and slow-twitch muscles.

Science.gov (United States)

Clausen, T; Overgaard, K; Nielsen, O B

2004-02-01

Muscles containing predominantly fast-twitch (type II) fibres [ext. dig. longus (EDL)] show considerably lower contractile endurance than muscles containing mainly slow-twitch (type I) fibres (soleus). To assess whether differences in Na+-K+ fluxes and excitability might contribute to this phenomenon, we compared excitation-induced Na+-K+ leaks, Na+ channels, Na+-K+ pump capacity, force and compound action potentials (M-waves) in rat EDL and soleus muscles. Isolated muscles were mounted for isometric contractions in Krebs-Ringer bicarbonate buffer and exposed to direct or indirect continuous or intermittent electrical stimulation. The time-course of force decline and concomitant changes in Na+-K+ exchange and M-waves were recorded. During continuous stimulation at 60-120 Hz, EDL showed around fivefold faster rate of force decline than soleus. This was associated with a faster loss of excitability as estimated from the area and amplitude of the M-waves. The net uptake of Na+ and the release of K+ per action potential were respectively 6.5- and 6.6-fold larger in EDL than in soleus, which may in part be due to the larger content of Na+ channels in EDL. During intermittent stimulation with 1 s 60 Hz pulse trains, EDL showed eightfold faster rate of force decline than soleus. The considerably lower contractile endurance of fast-twitch compared with slow-twitch muscles reflects differences in the rate of excitation-induced loss of excitability. This is attributed to the much larger excitation-induced Na+ influx and K+ efflux, leading to a faster rise in [K+]o in fast-twitch muscles. This may only be partly compensated by the concomitant activation of the Na+-K+ pumps, in particular in fibres showing large passive Na+-K+ leaks or reduced content of Na+-K+ pumps. Thus, endurance depends on the leak/pump ratio for Na+ and K+.

Insulin regulation of Na/K pump activity in rat hepatoma cells

International Nuclear Information System (INIS)

Gelehrter, T.D.; Shreve, P.D.; Dilworth, V.M.

1984-01-01

Insulin rapidly increases Na/K pump activity in HTC rat hepatoma cells in tissue culture, as measured by the ouabain-sensitive influx of the potassium analogue 86Rb+. Increased influx is observed within minutes and is maximal (70% above control) within 1-2 h. The effect appears to be mediated by the insulin receptors, as: the concentration dependence on insulin is identical to that for insulin induction of tyrosine aminotransferase and stimulation of 2-aminoisobutyric acid transport, proinsulin is 6% as potent as insulin, and the effect is blocked by anti-receptor antibodies. The early stimulation of potassium influx is not blocked by cycloheximide and is not associated with an increased number of pump sites as measured by 3 H-ouabain binding. The insulin effect is blocked by amiloride, which blocks sodium influx, and is mimicked by the sodium ionophore monensin, which increases sodium influx and intracellular accumulation. Insulin also rapidly increases the initial rate of 22 Na+ influx, suggesting that insulin may enhance Na/K pump activity, in part, by increasing intracellular sodium concentration. Incubation of HTC cells with insulin for 24 h causes complete unresponsiveness to the insulin induction of transaminase and stimulation of amino acid transport, a phenomenon mediated by postbinding mechanisms. In contrast, similar incubation with insulin does not cause unresponsiveness to the insulin stimulation of Na/K pump activity. Therefore, the site of regulation of responsiveness to insulin must be distal to, or separate from, those events causing stimulation of ion fluxes

Ventricular performance and Na+-K+ ATPase activity are reduced early and late after myocardial infarction in rats

Directory of Open Access Journals (Sweden)

I. Stefanon

2009-10-01

Full Text Available Myocardial infarction leads to compensatory ventricular remodeling. Disturbances in myocardial contractility depend on the active transport of Ca2+ and Na+, which are regulated by Na+-K+ ATPase. Inappropriate regulation of Na+-K+ ATPase activity leads to excessive loss of K+ and gain of Na+ by the cell. We determined the participation of Na+-K+ ATPase in ventricular performance early and late after myocardial infarction. Wistar rats (8-10 per group underwent left coronary artery ligation (infarcted, Inf or sham-operation (Sham. Ventricular performance was measured at 3 and 30 days after surgery using the Langendorff technique. Left ventricular systolic pressure was obtained under different ventricular diastolic pressures and increased extracellular Ca2+ concentrations (Ca2+e and after low and high ouabain concentrations. The baseline coronary perfusion pressure increased 3 days after myocardial infarction and normalized by 30 days (Sham 3 = 88 ± 6; Inf 3 = 130 ± 9; Inf 30 = 92 ± 7 mmHg; P < 0.05. The inotropic response to Ca2+e and ouabain was reduced at 3 and 30 days after myocardial infarction (Ca2+ = 1.25 mM; Sham 3 = 70 ± 3; Inf 3 = 45 ± 2; Inf 30 = 29 ± 3 mmHg; P < 0.05, while the Frank-Starling mechanism was preserved. At 3 and 30 days after myocardial infarction, ventricular Na+-K+ ATPase activity and contractility were reduced. This Na+-K+ ATPase hypoactivity may modify the Na+, K+ and Ca2+ transport across the sarcolemma resulting in ventricular dysfunction.

Effect of 2-wk intensified training and inactivity on muscle Na+-K+ pump expression, phospholemman (FXYD1) phosphorylation, and performance in soccer players.

Science.gov (United States)

Thomassen, Martin; Christensen, Peter M; Gunnarsson, Thomas P; Nybo, Lars; Bangsbo, Jens

2010-04-01

The present study examined muscle adaptations and alterations in performance of highly trained soccer players with intensified training or training cessation. Eighteen elite soccer players were, for a 2-wk period, assigned to either a group that performed high-intensity training with a reduction in the amount of training (HI, n = 7), or an inactivity group without training (IN, n = 11). HI improved (P Na(+)-K(+) pump alpha(2)-isoform was 15% higher (P Na(+)-K(+) pump expression was not changed. In HI, the FXYD1ser68-to-FXYD1 ratio was 27% higher (P Na(+)-K(+) pump alpha(2)-isoform expression, and that cessation of training for 2 wk does not affect the expression of Na(+)-K(+) pump isoforms. Resting phosphorylation status of the Na(+)-K(+) pump is changed by training and inactivity and may play a role in performance during repeated, intense exercise.

Treatment of EBR-I NaK mixed waste at Argonne National Laboratory and subsequent land disposal at the Idaho National Engineering and Environmental Laboratory

International Nuclear Information System (INIS)

Herrmann, S. D.; Buzzell, J. A.; Holzemer, M. J.

1998-01-01

Sodium/potassium (NaK) liquid metal coolant, contaminated with fission products from the core meltdown of Experimental Breeder Reactor I (EBR-I) and classified as a mixed waste, has been deactivated and converted to a contact-handled, low-level waste at Argonne's Sodium Component Maintenance Shop and land disposed at the Radioactive Waste Management Complex. Treatment of the EBR-I NaK involved converting the sodium and potassium to its respective hydroxide via reaction with air and water, followed by conversion to its respective carbonate via reaction with carbon dioxide. The resultant aqueous carbonate solution was solidified in 55-gallon drums. Challenges in the NaK treatment involved processing a mixed waste which was incompletely characterized and difficult to handle. The NaK was highly radioactive, i.e. up to 4.5 R/hr on contact with the mixed waste drums. In addition, the potential existed for plutonium and toxic characteristic metals to be present in the NaK, resultant from the location of the partial core meltdown of EBR-I in 1955. Moreover, the NaK was susceptible to degradation after more than 40 years of storage in unmonitored conditions. Such degradation raised the possibility of energetic exothermic reactions between the liquid NaK and its crust, which could have consisted of potassium superoxide as well as hydrated sodium/potassium hydroxides

Treatment of EBR-I NaK mixed waste at Argonne National Laboratory and subsequent land disposal at the Idaho National Engineering and Environmental Laboratory.

Energy Technology Data Exchange (ETDEWEB)

Herrmann, S. D.; Buzzell, J. A.; Holzemer, M. J.

1998-02-03

Sodium/potassium (NaK) liquid metal coolant, contaminated with fission products from the core meltdown of Experimental Breeder Reactor I (EBR-I) and classified as a mixed waste, has been deactivated and converted to a contact-handled, low-level waste at Argonne's Sodium Component Maintenance Shop and land disposed at the Radioactive Waste Management Complex. Treatment of the EBR-I NaK involved converting the sodium and potassium to its respective hydroxide via reaction with air and water, followed by conversion to its respective carbonate via reaction with carbon dioxide. The resultant aqueous carbonate solution was solidified in 55-gallon drums. Challenges in the NaK treatment involved processing a mixed waste which was incompletely characterized and difficult to handle. The NaK was highly radioactive, i.e. up to 4.5 R/hr on contact with the mixed waste drums. In addition, the potential existed for plutonium and toxic characteristic metals to be present in the NaK, resultant from the location of the partial core meltdown of EBR-I in 1955. Moreover, the NaK was susceptible to degradation after more than 40 years of storage in unmonitored conditions. Such degradation raised the possibility of energetic exothermic reactions between the liquid NaK and its crust, which could have consisted of potassium superoxide as well as hydrated sodium/potassium hydroxides.

Na/K citrate versus sodium bicarbonate in prevention of contrast-induced nephropathy

Directory of Open Access Journals (Sweden)

Sameh Mohamed Abouzeid

2016-01-01

Full Text Available Contrast-induced nephropathy (CIN is one of the important complications of radiographic procedures, especially in patients with chronic kidney disease. It is also one of the common causes of acute kidney injury. The pathogenesis is postulated to be the effect of oxygen- free radicals and hyperosmolar stress on the renal medulla. It is reported that the production of superoxide is most active at acid environment. K/Na citrate is well known as a urine alkalini- zation medium, and this has been evaluated earlier with standard hydration for reduction of CIN and was stated to be efficient. We aimed to determine the efficacy of Na/K citrate in reducing the frequency of CIN in comparison to sodium bicarbonate in patients after coronary angiography. Two hundred and ten patients with renal dysfunction [estimated glomerular filtration rate (eGFR, 60 mL/min/1.73 m2or less] who underwent elective or emergency coronary angiography (CAG with/without percutaneous coronary intervention (PCI at our institution were enrolled into the study. The patients were randomized into two groups, Group 1-Taking Na/K citrate and Group 2-Taking sodium bicarbonate. Radiographic contrast agent iohexol was used. Change in creatinine, percent change in creatinine, percent change in eGFR, change in serum potassium, and urine pH were all compared between the two groups. There was no significant difference for prevention of CIN when comparing the Na/K citrate with sodium bicarbonate solution in patients exposed to CAG with or without PCI. Mean absolute change in eGFR after 48 h after administration of contrast between sodium bicarbonate group and Na/K citrate group was −0.60 ± 1.58 versus −0.71 ± 1.38. Serum potassium decreased postprocedure in the sodium bicarbonate group than in the citrate group (3.90 ± 0.33 vs. 4.14 ± 0.39. Both agents are equally effective in reducing the incidence of CIN, but the citrate would possibly be a safer option for patients at risk of

The effect of different doses of epidermal growth factor on liver ornithine decarboxylase and Na-K ATPase activities in newborn rats.

Science.gov (United States)

Bilgihan, A; Turkozkan, N; Isman, F; Kilinc, M; Demirsoy, S

1998-08-01

1. Ornithine decarboxylase and Na-K ATPase activities were studied in rat livers that were treated with different doses of epidermal growth factor (EGF). 2. The ornithine decarboxylase activities were studied with spectrophotometry, and results were expressed as micromoles of putrescine per hour per milligram of protein. Na-K ATPase activities were studied on the basis of the principle of measuring the amount of inorganic phosphates released by the hydrolysis of ATP, and the results were expressed as micromoles of inorganic phosphate per hour per milligram of protein. 3. When compared with the controls, although the Na-K ATPase activities were decreased at low doses of EGF, their activities were found to be increased at high doses of EGF. On the other hand, there was a positive correlation between ornithine decarboxylase activities and EGF doses. 4. The results of this study suggest that, whereas the decrease in Na-K ATPase activities at low doses of EGF can be due to the utilization of the enzyme, the increase in Na-K ATPase activities at high doses of EGF can be attributed to its enhanced synthesis.

Dual throat NaK pump performance evaluation (conceptual design of prototype)

International Nuclear Information System (INIS)

Johnson, J.L.

1972-01-01

An evaluation of the performance of the dual throat NaK pump for the 5 Kwe Reactor TE System is discussed. Performance at nominal operating conditions and at startup conditions is predicted. The basis for selection of this pump design is presented. (U.S.)

Thermodynamic evaluation and optimization of the (Na+K+S) system

Energy Technology Data Exchange (ETDEWEB)

Lindberg, Daniel [Abo Akademi Process Chemistry Centre, Abo Akademi University, Biskopsgatan 8, FI-20500 Turku (Finland)]. E-mail: Daniel.Lindberg@abo.fi; Backman, Rainer [Abo Akademi Process Chemistry Centre, Abo Akademi University, Biskopsgatan 8, FI-20500 Turku (Finland); Energy Technology and Thermal Process Chemistry, Umea University, SE-90187 Umea (Sweden); Hupa, Mikko [Abo Akademi Process Chemistry Centre, Abo Akademi University, Biskopsgatan 8, FI-20500 Turku (Finland); Chartrand, Patrice [Centre de Recherche en Calcul Thermochimique (CRCT), Ecole Polytechnique, Box 6079, Station Downtown, Montreal, Que., H3C 3A7 (Canada)

2006-07-15

The (Na+K+S) system is of primary importance for the combustion of black liquor in the kraft recovery boilers in pulp and paper mills. A thermodynamic evaluation and optimization for the (Na+K+S) system has been made. All available data for the system have been critically evaluated to obtain optimized parameters of thermodynamic models for all phases. The liquid model is the quasichemical model in the quadruplet approximation, which evaluates 1st- and 2nd-nearest-neighbour short-range-order. In this model, cations (Na{sup +} and K{sup +}) are assumed to mix on a cationic sublattice, while anions (S{sup 2-},S{sub 2}{sup 2-},S{sub 3}{sup 2-},S{sub 4}{sup 2-},S{sub 5}{sup 2-},S{sub 6}{sup 2-},S{sub 7}{sup 2-},S{sub 8}{sup 2-},Va{sup -}) are assumed to mix on an anionic sublattice. The thermodynamic data of the liquid polysulphide components M{sub 2}S{sub 1+n} (M=Na, K and n=1-7) are fitted to {delta}G=A(n)+B(n).T for the reaction M{sub 2}S(l)+nS(l)=M{sub 2}S{sub n+1}(l). The solid phases are the alkali alloys, alkali sulphides, several different alkali polysulphides and sulphur. The solid solutions (Na,K) (Na,K){sub 2}S and (Na,K){sub 2}S{sub 2} are modelled using the compound energy formalism. The models can be used to predict the thermodynamic properties and phase equilibria in the multicomponent heterogeneous system. The experimental data are reproduced within experimental error limits for equilibria between solid, liquid and gas. The ternary phase diagram of the system (Na{sub 2}S+K{sub 2}S+S) has been predicted as no experimental determinations of the phase diagram have been made previously.

Characterization of the cardiac Na+/K+ pump by development of a comprehensive and mechanistic model.

Science.gov (United States)

Oka, Chiaki; Cha, Chae Young; Noma, Akinori

2010-07-07

A large amount of experimental data on the characteristics of the cardiac Na(+)/K(+) pump have been accumulated, but it remains difficult to predict the quantitative contribution of the pump in an intact cell because most measurements have been made under non-physiological conditions. To extrapolate the experimental findings to intact cells, we have developed a comprehensive Na(+)/K(+) pump model based on the thermodynamic framework (Smith and Crampin, 2004) of the Post-Albers reaction cycle combined with access channel mechanisms. The new model explains a variety of experimental results for the Na(+)/K(+) pump current (I(NaK)), including the dependency on the concentrations of Na(+) and K(+), the membrane potential and the free energy of ATP hydrolysis. The model demonstrates that both the apparent affinity and the slope of the substrate-I(NaK) relationship measured experimentally are affected by the composition of ions in the extra- and intracellular solutions, indirectly through alteration in the probability distribution of individual enzyme intermediates. By considering the voltage dependence in the Na(+)- and K(+)-binding steps, the experimental voltage-I(NaK) relationship could be reconstructed with application of experimental ionic compositions in the model, and the view of voltage-dependent K(+) binding was supported. Re-evaluation of charge movements accompanying Na(+) and K(+) translocations gave a reasonable number for the site density of the Na(+)/K(+) pump on the membrane. The new model is relevant for simulation of cellular functions under various interventions, such as depression of energy metabolism. (c) 2010 Elsevier Ltd. All rights reserved.

Erythrocyte Na+/K+ ATPase activity measured with sup 23 Na NMR

Energy Technology Data Exchange (ETDEWEB)

Ouwerkerk, R.; van Echteld, C.J.; Staal, G.E.; Rijksen, G. (University Hospital, Utrecht (Netherland))

1989-11-01

A {sup 23}Na NMR assay for measurement of erythrocyte Na+/K+ ATPase activity is presented. Using the nonpermeant shift reagent dysprosium tripolyphosphate the signals of intra- and extracellular sodium are separated, enabling measurement of sodium fluxes nondestructively, without the need to physically separate the cells from their environment. By increasing membrane permeability with nystatin we have shown that the assay allows the detection of differences in membrane permeability. With low doses of nystatin the ouabain-sensitive sodium flux increased more than twofold. With high doses of nystatin the Na+/K+ pump could not prevent an almost total equilibration of intra- and extracellular sodium. All sodium that entered the cells remained NMR visible, proving that sodium influx can be measured quantitatively. {sup 31}P NMR spectra taken before and after the assay revealed a slight acidification of the cells and no significant change in ATP concentration. No evidence of Dy3+ entering the cell was observed.

β(3) adrenergic stimulation of the cardiac Na+-K+ pump by reversal of an inhibitory oxidative modification.

Science.gov (United States)

Bundgaard, Henning; Liu, Chia-Chi; Garcia, Alvaro; Hamilton, Elisha J; Huang, Yifei; Chia, Karin K M; Hunyor, Stephen N; Figtree, Gemma A; Rasmussen, Helge H

2010-12-21

inhibition of L-type Ca(2+) current contributes to negative inotropy of β(3) adrenergic receptor (β(3) AR) activation, but effects on other determinants of excitation-contraction coupling are not known. Of these, the Na(+)-K(+) pump is of particular interest because of adverse effects attributed to high cardiac myocyte Na(+) levels and upregulation of the β(3) AR in heart failure. we voltage clamped rabbit ventricular myocytes and identified electrogenic Na(+)-K(+) pump current (I(p)) as the shift in holding current induced by ouabain. The synthetic β(3) AR agonists BRL37344 and CL316,243 and the natural agonist norepinephrine increased I(p). Pump stimulation was insensitive to the β(1)/β(2) AR antagonist nadolol and the protein kinase A inhibitor H-89 but sensitive to the β(3) AR antagonist L-748,337. Blockade of nitric oxide synthase abolished pump stimulation and an increase in fluorescence of myocytes loaded with a nitric oxide-sensitive dye. Exposure of myocytes to β(3) AR agonists decreased β(1) Na(+)-K(+) pump subunit glutathionylation, an oxidative modification that causes pump inhibition. The in vivo relevance of this was indicated by an increase in myocardial β(1) pump subunit glutathionylation with elimination of β(3) AR-mediated signaling in β(3) AR(-/-) mice. The in vivo effect of BRL37344 on contractility of the nonfailing and failing heart in sheep was consistent with a beneficial effect of Na(+)-K(+) pump stimulation in heart failure. the β(3) AR mediates decreased β(1) subunit glutathionylation and Na(+)-K(+) pump stimulation in the heart. Upregulation of the receptor in heart failure may be a beneficial mechanism that facilitates the export of excess Na(+).

Changes in the expression and current of the Na+/K+ pump in the snail nervous system after exposure to a static magnetic field.

Science.gov (United States)

Nikolić, Ljiljana; Bataveljić, Danijela; Andjus, Pavle R; Nedeljković, Miodrag; Todorović, Dajana; Janać, Branka

2013-09-15

Compelling evidence supports the use of a moderate static magnetic field (SMF) for therapeutic purposes. In order to provide insight into the mechanisms underlying SMF treatment, it is essential to examine the cellular responses elicited by therapeutically applied SMF, especially in the nervous system. The Na(+)/K(+) pump, by creating and maintaining the gradient of Na(+) and K(+) ions across the plasma membrane, regulates the physiological properties of neurons. In this study, we examined the expression of the Na(+)/K(+) pump in the isolated brain-subesophageal ganglion complex of the garden snail Helix pomatia, along with the immunoreactivity and current of the Na(+)/K(+) pump in isolated snail neurons after 15 min exposure to a moderate (10 mT) SMF. Western blot and immunofluorescence analysis revealed that 10 mT SMF did not significantly change the expression of the Na(+)/K(+) pump α-subunit in the snail brain and the neuronal cell body. However, our immunofluorescence data showed that SMF treatment induced a significant increase in the Na(+)/K(+) pump α-subunit expression in the neuronal plasma membrane area. This change in Na(+)/K(+) pump expression was reflected in pump activity as demonstrated by the pump current measurements. Whole-cell patch-clamp recordings from isolated snail neurons revealed that Na(+)/K(+) pump current density was significantly increased after the 10 mT SMF treatment. The SMF-induced increase was different in the two groups of control snail neurons, as defined by the pump current level. The results obtained could represent a physiologically important response of neurons to 10 mT SMF comparable in strength to therapeutic applications.

Stimulation of the cardiac myocyte Na+-K+ pump due to reversal of its constitutive oxidative inhibition.

Science.gov (United States)

Chia, Karin K M; Liu, Chia-Chi; Hamilton, Elisha J; Garcia, Alvaro; Fry, Natasha A; Hannam, William; Figtree, Gemma A; Rasmussen, Helge H

2015-08-15

Protein kinase C can activate NADPH oxidase and induce glutathionylation of the β1-Na(+)-K(+) pump subunit, inhibiting activity of the catalytic α-subunit. To examine if signaling of nitric oxide-induced soluble guanylyl cyclase (sGC)/cGMP/protein kinase G can cause Na(+)-K(+) pump stimulation by counteracting PKC/NADPH oxidase-dependent inhibition, cardiac myocytes were exposed to ANG II to activate NADPH oxidase and inhibit Na(+)-K(+) pump current (Ip). Coexposure to 3-(5'-hydroxymethyl-2'-furyl)-1-benzylindazole (YC-1) to stimulate sGC prevented the decrease of Ip. Prevention of the decrease was abolished by inhibition of protein phosphatases (PP) 2A but not by inhibition of PP1, and it was reproduced by an activator of PP2A. Consistent with a reciprocal relationship between β1-Na(+)-K(+) pump subunit glutathionylation and pump activity, YC-1 decreased ANG II-induced β1-subunit glutathionylation. The decrease induced by YC-1 was abolished by a PP2A inhibitor. YC-1 decreased phosphorylation of the cytosolic p47(phox) NADPH oxidase subunit and its coimmunoprecipitation with the membranous p22(phox) subunit, and it decreased O2 (·-)-sensitive dihydroethidium fluorescence of myocytes. Addition of recombinant PP2A to myocyte lysate decreased phosphorylation of p47(phox) indicating the subunit could be a substrate for PP2A. The effects of YC-1 to decrease coimmunoprecipitation of p22(phox) and p47(phox) NADPH oxidase subunits and decrease β1-Na(+)-K(+) pump subunit glutathionylation were reproduced by activation of nitric oxide-dependent receptor signaling. We conclude that sGC activation in cardiac myocytes causes a PP2A-dependent decrease in NADPH oxidase activity and a decrease in β1 pump subunit glutathionylation. This could account for pump stimulation with neurohormonal oxidative stress expected in vivo. Copyright © 2015 the American Physiological Society.

Changes in the corneal Na-K ATPase levels in eyes stored in moist chamber at 4°C

Directory of Open Access Journals (Sweden)

Devi B

1996-01-01

Full Text Available This report deals with a chronological measurement of Na-K ATPase enzyme activity in human and bovine corneas stored in a moist chamber at 4°C. Paired human and bovine eyes were sterilized by the standard eye bank procedure and stored up to 6 days. At the desired time, the corneal endothelium was assayed for Na-K ATPase activity. The protein content of each tissue sample was also determined. In a parallel set of experiments, the viability of identical stored corneas was determined by trypan blue and alizarin red staining technique, and morphometric analysis was done to quantify the extent of the corneal endothelial damage. The human corneas showed that there was a significant progressive decrease in the Na-K ATPase activity as the storage time increased. The decrease was related to morphological endothelial damage.

Mechanisms of isoform-specific Na/K pump regulation by short- and long-term adrenergic activation in rat ventricular myocytes.

Science.gov (United States)

Yin, Jian; Guo, Hui-Cai; Yu, Ding; Wang, Hui-Ci; Li, Jun-Xia; Wang, Yong-Li

2014-01-01

Many stressful conditions, including cardiovascular diseases, induce long-term elevations in circulating catecholamines, thereby leading to changes of the Na/K pump and thus affecting myocardial functions. However, only short-term adrenergic regulation of the Na/K pump has been reported. The present study is the first investigation of long-term adrenergic regulation of the Na/K pump and the potential mechanism. After acutely isolated Sprague-Dawley rat myocytes were incubated with noradrenaline or isoprenaline for 24 h, Na/K pump high- (IPH) and low-affinity current (IPL), α-isoform mRNA, and α-isoform protein were examined using patch-clamp, RT-PCR, and Western blotting techniques, respectively. After the short-term incubation, isoprenaline reduced the IPL through a PKA-dependent pathway that involves α1-isoform translocation from the membrane to early endosomes, and noradrenaline increased the IPH through a PKC-dependent pathway that involves α2-isoform translocation from late endosomes to the membrane. After long-term incubation, isoprenaline increased the IPL, α1-isoform mRNA, and α1-isoform protein, and noradrenaline reduced the IPH, α2-isoform mRNA, and α1-isoform protein through a PKA-or PKC-dependent pathway, respectively. These results suggest that long-term adrenergic Na/K pump regulation is isoform-specific and negatively feeds back on the short-term response. Furthermore, long-term regulation involves transcription and translation of the respective α-isoform, whereas short-term regulation involves the translocation of the available α-isoform to the plasma membrane. © 2014 S. Karger AG, Basel.

Mechanisms of Isoform-Specific Na/K Pump Regulation by Short- and Long-Term Adrenergic Activation in Rat Ventricular Myocytes

Directory of Open Access Journals (Sweden)

Jian Yin

2014-05-01

Full Text Available Background: Many stressful conditions, including cardiovascular diseases, induce long-term elevations in circulating catecholamines, thereby leading to changes of the Na/K pump and thus affecting myocardial functions. However, only short-term adrenergic regulation of the Na/K pump has been reported. The present study is the first investigation of long-term adrenergic regulation of the Na/K pump and the potential mechanism. Methods: After acutely isolated Sprague-Dawley rat myocytes were incubated with noradrenaline or isoprenaline for 24 h, Na/K pump high- (IPH and low-affinity current (IPL, α-isoform mRNA, and α-isoform protein were examined using patch-clamp, RT-PCR, and Western blotting techniques, respectively. Results: After the short-term incubation, isoprenaline reduced the IPL through a PKA-dependent pathway that involves α1-isoform translocation from the membrane to early endosomes, and noradrenaline increased the IPH through a PKC-dependent pathway that involves α2-isoform translocation from late endosomes to the membrane. After long-term incubation, isoprenaline increased the IPL, α1-isoform mRNA, and α1-isoform protein, and noradrenaline reduced the IPH, α2-isoform mRNA, and α1-isoform protein through a PKA-or PKC-dependent pathway, respectively. Conclusions: These results suggest that long-term adrenergic Na/K pump regulation is isoform-specific and negatively feeds back on the short-term response. Furthermore, long-term regulation involves transcription and translation of the respective α-isoform, whereas short-term regulation involves the translocation of the available α-isoform to the plasma membrane.

Serotonin-mediated modulation of Na+/K+ pump current in rat hippocampal CA1 pyramidal neurons.

Science.gov (United States)

Zhang, Li Nan; Su, Su Wen; Guo, Fang; Guo, Hui Cai; Shi, Xiao Lu; Li, Wen Ya; Liu, Xu; Wang, Yong Li

2012-01-19

The aim of this study was to investigate whether serotonin (5-hydroxytryptamine, 5-HT) can modulate Na+/K+ pump in rat hippocampal CA1 pyramidal neurons. 5-HT (0.1, 1 mM) showed Na+/K+ pump current (Ip) densities of 0.40 ± 0.04, 0.34 ± 0.03 pA/pF contrast to 0.63 ± 0.04 pA/pF of the control of 0.5 mM strophanthidin (Str), demonstrating 5-HT-induced inhibition of Ip in a dose-dependent manner in hippocampal CA1 pyramidal neurons. The effect was partly attenuated by ondasetron, a 5-HT3 receptor (5-HT3R) antagonist, not by WAY100635, a 5-HT1AR antagonist, while 1-(3-Chlorophenyl) biguanide hydrochloride (m-CPBG), a 5-HT3R specific agonist, mimicked the effect of 5-HT on Ip. 5-HT inhibits neuronal Na+/K+ pump activity via 5-HT3R in rat hippocampal CA1 pyramidal neurons. This discloses novel mechanisms for the function of 5-HT in learning and memory, which may be a useful target to benefit these patients with cognitive disorder.

Sodium and Proton Effects on Inward Proton Transport through Na/K Pumps

Science.gov (United States)

Mitchell, Travis J.; Zugarramurdi, Camila; Olivera, J. Fernando; Gatto, Craig; Artigas, Pablo

2014-01-01

The Na/K pump hydrolyzes ATP to export three intracellular Na (Nai) as it imports two extracellular K (Ko) across animal plasma membranes. Within the protein, two ion-binding sites (sites I and II) can reciprocally bind Na or K, but a third site (site III) exclusively binds Na in a voltage-dependent fashion. In the absence of Nao and Ko, the pump passively imports protons, generating an inward current (IH). To elucidate the mechanisms of IH, we used voltage-clamp techniques to investigate the [H]o, [Na]o, and voltage dependence of IH in Na/K pumps from ventricular myocytes and in ouabain-resistant pumps expressed in Xenopus oocytes. Lowering pHo revealed that Ho both activates IH (in a voltage-dependent manner) and inhibits it (in a voltage-independent manner) by binding to different sites. Nao effects depend on pHo; at pHo where no Ho inhibition is observed, Nao inhibits IH at all concentrations, but when applied at pHo that inhibits pump-mediated current, low [Na]o activates IH and high [Na]o inhibits it. Our results demonstrate that IH is a property inherent to Na/K pumps, not linked to the oocyte expression environment, explains differences in the characteristics of IH previously reported in the literature, and supports a model in which 1), protons leak through site III; 2), binding of two Na or two protons to sites I and II inhibits proton transport; and 3), pumps with mixed Na/proton occupancy of sites I and II remain permeable to protons. PMID:24940773

The conserved potassium channel filter can have distinct ion binding profiles: structural analysis of rubidium, cesium, and barium binding in NaK2K.

Science.gov (United States)

Lam, Yee Ling; Zeng, Weizhong; Sauer, David Bryant; Jiang, Youxing

2014-08-01

Potassium channels are highly selective for K(+) over the smaller Na(+). Intriguingly, they are permeable to larger monovalent cations such as Rb(+) and Cs(+) but are specifically blocked by the similarly sized Ba(2+). In this study, we used structural analysis to determine the binding profiles for these permeant and blocking ions in the selectivity filter of the potassium-selective NaK channel mutant NaK2K and also performed permeation experiments using single-channel recordings. Our data revealed that some ion binding properties of NaK2K are distinct from those of the canonical K(+) channels KcsA and MthK. Rb(+) bound at sites 1, 3, and 4 in NaK2K, as it does in KcsA. Cs(+), however, bound predominantly at sites 1 and 3 in NaK2K, whereas it binds at sites 1, 3, and 4 in KcsA. Moreover, Ba(2+) binding in NaK2K was distinct from that which has been observed in KcsA and MthK, even though all of these channels show similar Ba(2+) block. In the presence of K(+), Ba(2+) bound to the NaK2K channel at site 3 in conjunction with a K(+) at site 1; this led to a prolonged block of the channel (the external K(+)-dependent Ba(2+) lock-in state). In the absence of K(+), however, Ba(2+) acts as a permeating blocker. We found that, under these conditions, Ba(2+) bound at sites 1 or 0 as well as site 3, allowing it to enter the filter from the intracellular side and exit from the extracellular side. The difference in the Ba(2+) binding profile in the presence and absence of K(+) thus provides a structural explanation for the short and prolonged Ba(2+) block observed in NaK2K. © 2014 Lam et al.

Short-term memory of motor network performance via activity-dependent potentiation of Na+/K+ pump function.

Science.gov (United States)

Zhang, Hong-Yan; Sillar, Keith T

2012-03-20

Brain networks memorize previous performance to adjust their output in light of past experience. These activity-dependent modifications generally result from changes in synaptic strengths or ionic conductances, and ion pumps have only rarely been demonstrated to play a dynamic role. Locomotor behavior is produced by central pattern generator (CPG) networks and modified by sensory and descending signals to allow for changes in movement frequency, intensity, and duration, but whether or how the CPG networks recall recent activity is largely unknown. In Xenopus frog tadpoles, swim bout duration correlates linearly with interswim interval, suggesting that the locomotor network retains a short-term memory of previous output. We discovered an ultraslow, minute-long afterhyperpolarization (usAHP) in network neurons following locomotor episodes. The usAHP is mediated by an activity- and sodium spike-dependent enhancement of electrogenic Na(+)/K(+) pump function. By integrating spike frequency over time and linking the membrane potential of spinal neurons to network performance, the usAHP plays a dynamic role in short-term motor memory. Because Na(+)/K(+) pumps are ubiquitously expressed in neurons of all animals and because sodium spikes inevitably accompany network activity, the usAHP may represent a phylogenetically conserved but largely overlooked mechanism for short-term memory of neural network function. Copyright © 2012 Elsevier Ltd. All rights reserved.

Activation of cAMP-dependent signaling induces oxidative modification of the cardiac Na+-K+ pump and inhibits its activity.

Science.gov (United States)

White, Caroline N; Liu, Chia-Chi; Garcia, Alvaro; Hamilton, Elisha J; Chia, Karin K M; Figtree, Gemma A; Rasmussen, Helge H

2010-04-30

Cellular signaling can inhibit the membrane Na(+)-K(+) pump via protein kinase C (PKC)-dependent activation of NADPH oxidase and a downstream oxidative modification, glutathionylation, of the beta(1) subunit of the pump alpha/beta heterodimer. It is firmly established that cAMP-dependent signaling also regulates the pump, and we have now examined the hypothesis that such regulation can be mediated by glutathionylation. Exposure of rabbit cardiac myocytes to the adenylyl cyclase activator forskolin increased the co-immunoprecipitation of NADPH oxidase subunits p47(phox) and p22(phox), required for its activation, and increased superoxide-sensitive fluorescence. Forskolin also increased glutathionylation of the Na(+)-K(+) pump beta(1) subunit and decreased its co-immunoprecipitation with the alpha(1) subunit, findings similar to those already established for PKC-dependent signaling. The decrease in co-immunoprecipitation indicates a decrease in the alpha(1)/beta(1) subunit interaction known to be critical for pump function. In agreement with this, forskolin decreased ouabain-sensitive electrogenic Na(+)-K(+) pump current (arising from the 3:2 Na(+):K(+) exchange ratio) of voltage-clamped, internally perfused myocytes. The decrease was abolished by the inclusion of superoxide dismutase, the inhibitory peptide for the epsilon-isoform of PKC or inhibitory peptide for NADPH oxidase in patch pipette solutions that perfuse the intracellular compartment. Pump inhibition was also abolished by inhibitors of protein kinase A and phospholipase C. We conclude that cAMP- and PKC-dependent inhibition of the cardiac Na(+)-K(+) pump occurs via a shared downstream oxidative signaling pathway involving NADPH oxidase activation and glutathionylation of the pump beta(1) subunit.

Physical Manipulation of the Na/K Pump

Science.gov (United States)

Eve, David; Mathis, Clausell; Chen, Wei

2012-02-01

It has been demonstrated that a well-designed oscillating electric field can synchronize and modulate the functions of the Na+/K+ ATPase pump, a ubiquitous active transporter in the cell membrane. Current work aims to improve this technique in order to synchronize the individual steps in the pumping cycle, allowing all of the individual pumps to run simultaneously. Using frog skeletal muscle fibers and the double Vaseline-gap voltage clamp technique, we are working to design wave pulses, which will isolate the voltage dependent steps of the active ion transport. This will improve the signal-to-noise ratio and provide insight into the protein conformation changes that occur during active transport.

Muscle K+, Na+, and Cl- disturbances and Na+-K+ pump inactivation: implications for fatigue

DEFF Research Database (Denmark)

McKenna, Michael J; Bangsbo, Jens; Renaud, Jean-Marc

2008-01-01

(+)-ATPase activity during exercise stabilizes Na(+) and K(+) concentration gradients and membrane excitability and thus protects against fatigue. However, during intense contraction some Na(+)-K(+) pumps are inactivated and together with further ionic disturbances, likely precipitate muscle fatigue.......Membrane excitability is a critical regulatory step in skeletal muscle contraction and is modulated by local ionic concentrations, conductances, ion transporter activities, temperature, and humoral factors. Intense fatiguing contractions induce cellular K(+) efflux and Na(+) and Cl(-) influx......, causing pronounced perturbations in extracellular (interstitial) and intracellular K(+) and Na(+) concentrations. Muscle interstitial K(+) concentration may increase 1- to 2-fold to 11-13 mM and intracellular K(+) concentration fall by 1.3- to 1.7-fold; interstitial Na(+) concentration may decline by 10 m...

Water permeability of Na+-K+-2Cl- cotransporters in mammalian epithelial cells

DEFF Research Database (Denmark)

Hamann, Steffen; Herrera-Perez, José Jaime; Bundgaard, Magnus

2005-01-01

Water transport properties of the Na+-K+-2Cl- cotransporter (NKCC) were studied in cultures of pigmented epithelial cells (PE) from the ciliary body of the eye. Here, the membrane that faces upwards contains NKCCs and can be subjected to rapid changes in bathing solution composition and osmolarity...

Fluctuation-driven directional flow of energy in biochemical cycle: Electric activation of Na,K ATPase

Science.gov (United States)

Yow Tsong, Tian

1998-03-01

Na,K ATPase is an ion pump which uses chemical bond energy of ATP to pump Na ion out of, and K ion into living cell thus maintaining ionic and osmotic balances of the cell. Both are uphill transport reactions. Surprisingly we have found that electric energy can also substitute chemical energy to fuel the pump activity. However, in this case only electric fields of certain waveforms, amplitudes, and frequencies are effective. Waveform, amplitude and frequency are three elements of signal. In other words, Na,K ATPase can recognize, process, and harvest energy from an oscillating or a fluctuating electric field to drive an endergonic reaction. The enzyme is a molecular transducer of electric signal. This report will describe electric activation experiment to define electric signal. Electric signal will then mixed with electric noise of broad power spectrum for experiment. Effect of white noise (WN) on the efficiency of Na,K ATPase will be investigated. It will be shown that WN of appropriate power level can improve the pump efficiency when a sub-optimal electric field is used. WN can also carry a sub-threshold signal to cross over the threshold. Stochastic resonance will be discussed in reference to these observations.

Alteration of Na-K pump activity in supersensitive rat caudal artery following 6-hydroxydopamine (6-OHDA) treatment

International Nuclear Information System (INIS)

Wong, S.K.; Foley, D.H.

1986-01-01

Contractile response and the Na-K pump activity, measured as ouabain-sensitive 86 Rb-uptake, were determined in caudal artery strips of rats pretreated with 6-OHDA. At 6-7 days after 6-OHDA treatment, the potencies of norepinephrine and serotonin in causing contraction of rat caudal artery were significantly increased by 2.3 - and 1.7 - fold respectively. There was, however, no change in maximum contractile response to either agent. Treatment with 6-OHDA also reduced endogenous catecholamine content of the caudal artery to 7% of the control. Analysis of ouabain-inhibitable 86 Rb-uptake of rat caudal artery by the double-reciprocal plots showed that both the rate of 86 Rb-uptake and the affinity for rubidium were depressed after 6-OHDA treatment. The results indicate that 6-OHDA induced supersensitivity in the rat caudal artery is associated with a decrease in the Na-K pump activity. These data provide additional support to the concept that inhibition of the Na-K pump may result in partial depolarization of the cell membrane which leads to supersensitivity of smooth muscle to excitatory drugs

Oxidative inhibition of the vascular Na+-K+ pump via NADPH oxidase-dependent β1-subunit glutathionylation: implications for angiotensin II-induced vascular dysfunction.

Science.gov (United States)

Liu, Chia-Chi; Karimi Galougahi, Keyvan; Weisbrod, Robert M; Hansen, Thomas; Ravaie, Ramtin; Nunez, Andrea; Liu, Yi B; Fry, Natasha; Garcia, Alvaro; Hamilton, Elisha J; Sweadner, Kathleen J; Cohen, Richard A; Figtree, Gemma A

2013-12-01

Glutathionylation of the Na(+)-K(+) pump's β1-subunit is a key molecular mechanism of physiological and pathophysiological pump inhibition in cardiac myocytes. Its contribution to Na(+)-K(+) pump regulation in other tissues is unknown, and cannot be assumed given the dependence on specific β-subunit isoform expression and receptor-coupled pathways. As Na(+)-K(+) pump activity is an important determinant of vascular tone through effects on [Ca(2+)]i, we have examined the role of oxidative regulation of the Na(+)-K(+) pump in mediating angiotensin II (Ang II)-induced increases in vascular reactivity. β1-subunit glutathione adducts were present at baseline and increased by exposure to Ang II in rabbit aortic rings, primary rabbit aortic vascular smooth muscle cells (VSMCs), and human arterial segments. In VSMCs, Ang II-induced glutathionylation was associated with marked reduction in Na(+)-K(+)ATPase activity, an effect that was abolished by the NADPH oxidase inhibitory peptide, tat-gp91ds. In aortic segments, Ang II-induced glutathionylation was associated with decreased K(+)-induced vasorelaxation, a validated index of pump activity. Ang II-induced oxidative inhibition of Na(+)-K(+) ATPase and decrease in K(+)-induced relaxation were reversed by preincubation of VSMCs and rings with recombinant FXYD3 protein that is known to facilitate deglutathionylation of β1-subunit. Knock-out of FXYD1 dramatically decreased K(+)-induced relaxation in a mouse model. Attenuation of Ang II signaling in vivo by captopril (8 mg/kg/day for 7 days) decreased superoxide-sensitive DHE levels in the media of rabbit aorta, decreased β1-subunit glutathionylation, and enhanced K(+)-induced vasorelaxation. Ang II inhibits the Na(+)-K(+) pump in VSMCs via NADPH oxidase-dependent glutathionylation of the pump's β1-subunit, and this newly identified signaling pathway may contribute to altered vascular tone. FXYD proteins reduce oxidative inhibition of the Na(+)-K(+) pump and may have an

Phosphorylation of rat kidney Na-K pump at Ser938 is required for rapid angiotensin II-dependent stimulation of activity and trafficking in proximal tubule cells.

Science.gov (United States)

Massey, Katherine J; Li, Quanwen; Rossi, Noreen F; Keezer, Susan M; Mattingly, Raymond R; Yingst, Douglas R

2016-02-01

How angiotensin (ANG) II acutely stimulates the Na-K pump in proximal tubules is only partially understood, limiting insight into how ANG II increases blood pressure. First, we tested whether ANG II increases the number of pumps in plasma membranes of native rat proximal tubules under conditions of rapid activation. We found that exposure to 100 pM ANG II for 2 min, which was previously shown to increase affinity of the Na-K pump for Na and stimulate activity threefold, increased the amount of the Na-K pump in plasma membranes of native tubules by 33%. Second, we tested whether previously observed increases in phosphorylation of the Na-K pump at Ser(938) were part of the stimulatory mechanism. These experiments were carried out in opossum kidney cells, cultured proximal tubules stably coexpressing the ANG type 1 (AT1) receptor, and either wild-type or a S938A mutant of rat kidney Na-K pump under conditions found by others to stimulate activity. We found that 10 min of incubation in 10 pM ANG II stimulated activity of wild-type pumps from 2.3 to 3.5 nmol K · mg protein(-1) · min(-1) and increased the amount of the pump in the plasma membrane by 80% but had no effect on cells expressing the S938A mutant. We conclude that acute stimulation of Na-K pump activity in native rat proximal tubules includes increased trafficking to the plasma membrane and that phosphorylation at Ser(938) is part of the mechanism by which ANG II directly stimulates activity and trafficking of the rat kidney Na-K pump in opossum kidney cells.

Lysine and the Na+/K+ Selectivity in Mammalian Voltage-Gated Sodium Channels.

Directory of Open Access Journals (Sweden)

Yang Li

Full Text Available Voltage-gated sodium (Nav channels are critical in the generation and transmission of neuronal signals in mammals. The crystal structures of several prokaryotic Nav channels determined in recent years inspire the mechanistic studies on their selection upon the permeable cations (especially between Na+ and K+ ions, a property that is proposed to be mainly determined by residues in the selectivity filter. However, the mechanism of cation selection in mammalian Nav channels lacks direct explanation at atomic level due to the difference in amino acid sequences between mammalian and prokaryotic Nav homologues, especially at the constriction site where the DEKA motif has been identified to determine the Na+/K+ selectivity in mammalian Nav channels but is completely absent in the prokaryotic counterparts. Among the DEKA residues, Lys is of the most importance since its mutation to Arg abolishes the Na+/K+ selectivity. In this work, we modeled the pore domain of mammalian Nav channels by mutating the four residues at the constriction site of a prokaryotic Nav channel (NavRh to DEKA, and then mechanistically investigated the contribution of Lys in cation selection using molecular dynamics simulations. The DERA mutant was generated as a comparison to understand the loss of ion selectivity caused by the K-to-R mutation. Simulations and free energy calculations on the mutants indicate that Lys facilitates Na+/K+ selection by electrostatically repelling the cation to a highly Na+-selective location sandwiched by the carboxylate groups of Asp and Glu at the constriction site. In contrast, the electrostatic repulsion is substantially weakened when Lys is mutated to Arg, because of two intrinsic properties of the Arg side chain: the planar geometric design and the sparse charge distribution of the guanidine group.

Lysine and the Na+/K+ Selectivity in Mammalian Voltage-Gated Sodium Channels.

Science.gov (United States)

Li, Yang; Liu, Huihui; Xia, Mengdie; Gong, Haipeng

2016-01-01

Voltage-gated sodium (Nav) channels are critical in the generation and transmission of neuronal signals in mammals. The crystal structures of several prokaryotic Nav channels determined in recent years inspire the mechanistic studies on their selection upon the permeable cations (especially between Na+ and K+ ions), a property that is proposed to be mainly determined by residues in the selectivity filter. However, the mechanism of cation selection in mammalian Nav channels lacks direct explanation at atomic level due to the difference in amino acid sequences between mammalian and prokaryotic Nav homologues, especially at the constriction site where the DEKA motif has been identified to determine the Na+/K+ selectivity in mammalian Nav channels but is completely absent in the prokaryotic counterparts. Among the DEKA residues, Lys is of the most importance since its mutation to Arg abolishes the Na+/K+ selectivity. In this work, we modeled the pore domain of mammalian Nav channels by mutating the four residues at the constriction site of a prokaryotic Nav channel (NavRh) to DEKA, and then mechanistically investigated the contribution of Lys in cation selection using molecular dynamics simulations. The DERA mutant was generated as a comparison to understand the loss of ion selectivity caused by the K-to-R mutation. Simulations and free energy calculations on the mutants indicate that Lys facilitates Na+/K+ selection by electrostatically repelling the cation to a highly Na+-selective location sandwiched by the carboxylate groups of Asp and Glu at the constriction site. In contrast, the electrostatic repulsion is substantially weakened when Lys is mutated to Arg, because of two intrinsic properties of the Arg side chain: the planar geometric design and the sparse charge distribution of the guanidine group.

Changes in cardiovascular function and vascular Na-K pump activity in streptozotocin (STZ)-diabetic rats

International Nuclear Information System (INIS)

Anon.

1986-01-01

Blood pressure, vascular reactivity and Na-K pump function were examined in male Sprague-Dawley rats and rats made diabetic with a single dose of STZ (50 mg/Kg, I.V.). In each group, body weight, systolic blood pressure and heart rate were determined weekly, and serum glucose was measured biweekly for 12 weeks. Contractile responses and Na-K pump activity of vascular smooth muscle were studied in caudal artery strips. At 12 weeks after treatment, STZ rats had elevated serum glucose but decreased body weight and heart rate in comparison to control rats. Systolic blood pressure of STZ rats was not significantly increased at any time during the treatment period. Contractile responses of caudal artery strips to norepinephrine and serotonin did not indicate altered sensitivity (ED50) of vascular smooth muscle in STZ rats. The responsiveness (g tension/g wet wt.), however, was significantly increased in artery strips from STZ rats. Analysis of ouabain-inhibitable 86 Rb-uptake of caudal artery by the double-reciprocal plot showed that neither the rate of 86 Rb-uptake nor the affinity for rubidium were altered by STZ treatment. The data indicate that nonspecific increases in the reactivity of caudal arteries to excitatory agents occur in diabetic rats which may precede the development of hypertension. The enhanced reactivity is not associated with alteration of the vascular Na-K pump activity

Is activation of the Na+K+ pump necessary for NGF-mediated neuronal survival

International Nuclear Information System (INIS)

Sendtner, M.; Gnahn, H.; Wakade, A.; Thoenen, H.

1988-01-01

The ability of nerve growth factor to cause rapid activation of the Na+K+ pump of its responsive cells was examined by measuring the uptake of 86 Rb+. A significant increase in 86 Rb+ uptake in E8 chick dorsal root ganglion sensory neurons after NGF treatment was seen only if the cells had been damaged during the preparation procedure. Such damaged cells could not survive in culture in the presence of NGF, and undamaged cells that did survive in response to NGF exhibited no increased 86 Rb+ uptake rate. Furthermore, cultured calf adrenal medullary cells did not show an increase in 86 Rb+ uptake after treatment with NGF, although these cells respond to NGF with an increased synthesis of catecholaminergic enzymes. These results are incompatible with the hypothesis that the mechanism of action of NGF that promotes neuronal survival and enzyme induction results from an initial stimulation of the Na+K+ pump

β3-Adrenoceptor activation relieves oxidative inhibition of the cardiac Na+-K+ pump in hyperglycemia induced by insulin receptor blockade.

Science.gov (United States)

Karimi Galougahi, Keyvan; Liu, Chia-Chi; Garcia, Alvaro; Fry, Natasha A; Hamilton, Elisha J; Figtree, Gemma A; Rasmussen, Helge H

2015-09-01

Dysregulated nitric oxide (NO)- and superoxide (O2 (·-))-dependent signaling contributes to the pathobiology of diabetes-induced cardiovascular complications. We examined if stimulation of β3-adrenergic receptors (β3-ARs), coupled to endothelial NO synthase (eNOS) activation, relieves oxidative inhibition of eNOS and the Na(+)-K(+) pump induced by hyperglycemia. Hyperglycemia was established in male New Zealand White rabbits by infusion of the insulin receptor antagonist S961 for 7 days. Hyperglycemia increased tissue and blood indexes of oxidative stress. It induced glutathionylation of the Na(+)-K(+) pump β1-subunit in cardiac myocytes, an oxidative modification causing pump inhibition, and reduced the electrogenic pump current in voltage-clamped myocytes. Hyperglycemia also increased glutathionylation of eNOS, which causes its uncoupling, and increased coimmunoprecipitation of cytosolic p47(phox) and membranous p22(phox) NADPH oxidase subunits, consistent with NADPH oxidase activation. Blocking translocation of p47(phox) to p22(phox) with the gp91ds-tat peptide in cardiac myocytes ex vivo abolished the hyperglycemia-induced increase in glutathionylation of the Na(+)-K(+) pump β1-subunit and decrease in pump current. In vivo treatment with the β3-AR agonist CL316243 for 3 days eliminated the increase in indexes of oxidative stress, decreased coimmunoprecipitation of p22(phox) with p47(phox), abolished the hyperglycemia-induced increase in glutathionylation of eNOS and the Na(+)-K(+) pump β1-subunit, and abolished the decrease in pump current. CL316243 also increased coimmunoprecipitation of glutaredoxin-1 with the Na(+)-K(+) pump β1-subunit, which may reflect facilitation of deglutathionylation. In vivo β3-AR activation relieves oxidative inhibition of key cardiac myocyte proteins in hyperglycemia and may be effective in targeting the deleterious cardiac effects of diabetes. Copyright © 2015 the American Physiological Society.

Lipopolysaccharide hyperpolarizes guinea pig airway epithelium by increasing the activities of the epithelial Na(+) channel and the Na(+)-K(+) pump.

Science.gov (United States)

Dodrill, Michael W; Fedan, Jeffrey S

2010-10-01

Earlier, we found that systemic administration of lipopolysaccharide (LPS; 4 mg/kg) hyperpolarized the transepithelial potential difference (V(t)) of tracheal epithelium in the isolated, perfused trachea (IPT) of the guinea pig 18 h after injection. As well, LPS increased the hyperpolarization component of the response to basolateral methacholine, and potentiated the epithelium-derived relaxing factor-mediated relaxation responses to hyperosmolar solutions applied to the apical membrane. We hypothesized that LPS stimulates the transepithelial movement of Na(+) via the epithelial sodium channel (ENaC)/Na(+)-K(+) pump axis, leading to hyperpolarization of V(t). LPS increased the V(t)-depolarizing response to amiloride (10 μM), i.e., offset the effect of LPS, indicating that Na(+) transport activity was increased. The functional activity of ENaC was measured in the IPT after short-circuiting the Na(+)-K(+) pump with basolateral amphotericin B (7.5 μM). LPS had no effect on the hyperpolarization response to apical trypsin (100 U/ml) in the Ussing chamber, indicating that channel-activating proteases are not involved in the LPS-induced activation of ENaC. To assess Na(+)-K(+) pump activity in the IPT, ENaC was short-circuited with apical amphotericin B. The greater V(t) in the presence of amphotericin B in tracheas from LPS-treated animals compared with controls revealed that LPS increased Na(+)-K(+) pump activity. This finding was confirmed in the Ussing chamber by inhibiting the Na(+)-K(+) pump via extracellular K(+) removal, loading the epithelium with Na(+), and observing a greater hyperpolarization response to K(+) restoration. Together, the findings of this study reveal that LPS hyperpolarizes the airway epithelium by increasing the activities of ENaC and the Na(+)-K(+) pump.

Contribution of the basolateral isoform of the Na-K-2Cl- cotransporter (NKCC1/BSC2) to renin secretion

DEFF Research Database (Denmark)

Castrop, Hayo; Lorenz, John N; Hansen, Pernille B

2005-01-01

Acute administration of loop diuretics like furosemide leads to a stimulation of renin secretion, an effect thought to result from inhibition of Na-K-2Cl cotransporter (NKCC2)-mediated salt transport at the luminal surface of the macula densa (MD). However, loop diuretics also inhibit NKCC1......, the second isoform of the Na-K-2Cl cotransporter, with similar potency. In the present study, we examined the influence of furosemide on renin secretion in NKCC1-deficient mice to distinguish between effects of the loop diuretic involving NKCC2 and, by implication, the MD pathway, and effects that might...

In-Situ Spatial Variability Of Thermal Conductivity And Volumetric ...

African Journals Online (AJOL)

Studies of spatial variability of thermal conductivity and volumetric water content of silty topsoil were conduct-ed on a 0.6 ha site at Abeokuta, South-Western Nigeria. The thermal conductivity (k) was measured at depths of up to 0.06 m along four parallel profiles of 200 m long and at an average temperature of 25 C, using ...

The relationship between the hypokalaemic response to adrenaline, beta-adrenoceptors, and Na(+)-K+ pumps in skeletal and cardiac muscle membranes in the rabbit

International Nuclear Information System (INIS)

Elfellah, M.S.; Reid, J.L.

1990-01-01

The hypokalaemic response to adrenaline and the involvement of beta-adrenoceptors and Na(+)-K+ pumps were investigated in control rabbits and animals chronically pretreated with adrenaline. The hypokalaemic response to acute intravenous infusion of adrenaline was significantly reduced when rabbits were chronically pretreated with adrenaline for 10 days. Chronic pretreatment of rabbits with adrenaline significantly reduced the densities for [125I]cyanopindolol and [3H]ouabain binding sites in skeletal muscle and heart. Furthermore, there was a strong positive correlation (r = 0.97, p less than 0.001) between the Bmax for ICYP and [3H]ouabain, in the rabbit heart. Ouabain-sensitive 86Rb uptake and the activity of 3-O-methylfluorescein phosphate phosphatase were used to assess the function of the Na(+)-K+ pump in skeletal and cardiac muscle. There was no significant difference in these functional indices of the Na(+)-K+ pump between the control and adrenaline-pretreated animals, in skeletal or cardiac muscle. Thus, downregulation of the [3H]ouabain binding sites did not appear to be accompanied by reduced function of the Na(+)-K+ pump. Additional investigations are required to confirm further the dissociation between the function of the pump and the ouabain binding sites

Susceptibility of β1 Na+-K+ pump subunit to glutathionylation and oxidative inhibition depends on conformational state of pump.

Science.gov (United States)

Liu, Chia-Chi; Garcia, Alvaro; Mahmmoud, Yasser A; Hamilton, Elisha J; Galougahi, Keyvan Karimi; Fry, Natasha A S; Figtree, Gemma A; Cornelius, Flemming; Clarke, Ronald J; Rasmussen, Helge H

2012-04-06

Glutathionylation of cysteine 46 of the β1 subunit of the Na(+)-K(+) pump causes pump inhibition. However, the crystal structure, known in a state analogous to an E2·2K(+)·P(i) configuration, indicates that the side chain of cysteine 46 is exposed to the lipid bulk phase of the membrane and not expected to be accessible to the cytosolic glutathione. We have examined whether glutathionylation depends on the conformational changes in the Na(+)-K(+) pump cycle as described by the Albers-Post scheme. We measured β1 subunit glutathionylation and function of Na(+)-K(+)-ATPase in membrane fragments and in ventricular myocytes. Signals for glutathionylation in Na(+)-K(+)-ATPase-enriched membrane fragments suspended in solutions that preferentially induce E1ATP and E1Na(3) conformations were much larger than signals in solutions that induce the E2 conformation. Ouabain further reduced glutathionylation in E2 and eliminated an increase seen with exposure to the oxidant peroxynitrite (ONOO(-)). Inhibition of Na(+)-K(+)-ATPase activity after exposure to ONOO(-) was greater when the enzyme had been in the E1Na(3) than the E2 conformation. We exposed myocytes to different extracellular K(+) concentrations to vary the membrane potential and hence voltage-dependent conformational poise. K(+) concentrations expected to shift the poise toward E2 species reduced glutathionylation, and ouabain eliminated a ONOO(-)-induced increase. Angiotensin II-induced NADPH oxidase-dependent Na(+)-K(+) pump inhibition was eliminated by conditions expected to shift the poise toward the E2 species. We conclude that susceptibility of the β1 subunit to glutathionylation depends on the conformational poise of the Na(+)-K(+) pump.

Susceptibility of β1 Na+-K+ Pump Subunit to Glutathionylation and Oxidative Inhibition Depends on Conformational State of Pump*

Science.gov (United States)

Liu, Chia-Chi; Garcia, Alvaro; Mahmmoud, Yasser A.; Hamilton, Elisha J.; Galougahi, Keyvan Karimi; Fry, Natasha A. S.; Figtree, Gemma A.; Cornelius, Flemming; Clarke, Ronald J.; Rasmussen, Helge H.

2012-01-01

Glutathionylation of cysteine 46 of the β1 subunit of the Na+-K+ pump causes pump inhibition. However, the crystal structure, known in a state analogous to an E2·2K+·Pi configuration, indicates that the side chain of cysteine 46 is exposed to the lipid bulk phase of the membrane and not expected to be accessible to the cytosolic glutathione. We have examined whether glutathionylation depends on the conformational changes in the Na+-K+ pump cycle as described by the Albers-Post scheme. We measured β1 subunit glutathionylation and function of Na+-K+-ATPase in membrane fragments and in ventricular myocytes. Signals for glutathionylation in Na+-K+-ATPase-enriched membrane fragments suspended in solutions that preferentially induce E1ATP and E1Na3 conformations were much larger than signals in solutions that induce the E2 conformation. Ouabain further reduced glutathionylation in E2 and eliminated an increase seen with exposure to the oxidant peroxynitrite (ONOO−). Inhibition of Na+-K+-ATPase activity after exposure to ONOO− was greater when the enzyme had been in the E1Na3 than the E2 conformation. We exposed myocytes to different extracellular K+ concentrations to vary the membrane potential and hence voltage-dependent conformational poise. K+ concentrations expected to shift the poise toward E2 species reduced glutathionylation, and ouabain eliminated a ONOO−-induced increase. Angiotensin II-induced NADPH oxidase-dependent Na+-K+ pump inhibition was eliminated by conditions expected to shift the poise toward the E2 species. We conclude that susceptibility of the β1 subunit to glutathionylation depends on the conformational poise of the Na+-K+ pump. PMID:22354969

Decontamination and decommissioning of the EBR-I complex. Topical report No. 3. NAK disposal pilot plant test

International Nuclear Information System (INIS)

Commander, J.C.; Lewis, L.; Hammer, R.

1975-06-01

Decontamination and decommissioning of the Experimental Breeder Reactor No. 1 (EBR-I) requires processing of the primary coolant, an eutectic solution of sodium and potassium (NaK), remaining in the EBR-I primary and secondary coolant systems. While developing design criteria for the NaK processing system, reasonable justification was provided for the development of a pilot test plant for field testing some of the process concepts and proposed hardware. The objective of this activity was to prove the process concept on a low-cost, small-scale test bed. The pilot test plant criteria provided a general description of the test including: the purpose, location, description of test equipment available, waste disposal requirements, and a flow diagram and conceptual equipment layout. The pilot plant test operations procedure provided a detailed step-by-step procedure for operation of the pilot plant to obtain the desired test data and operational experience. It also spelled out the safety precautions to be used by operating personnel, including the requirement for alkali metals training certification, use of protective clothing, availability of fire protection equipment, and caustic handling procedures. The pilot plant test was performed on May 16, 1974. During the test, 32.5 gallons or 240 lb of NaK was successfully converted to caustic by reaction with water in a caustic solution. (auth)

Stepwise evolution of resistance to toxic cardenolides via genetic substitutions in the Na+/K+ -ATPase of milkweed butterflies (lepidoptera: Danaini).

Science.gov (United States)

Petschenka, Georg; Fandrich, Steffi; Sander, Nils; Wagschal, Vera; Boppré, Michael; Dobler, Susanne

2013-09-01

Despite the monarch butterfly (Danaus plexippus) being famous for its adaptations to the defensive traits of its milkweed host plants, little is known about the macroevolution of these traits. Unlike most other animal species, monarchs are largely insensitive to cardenolides, because their target site, the sodium pump (Na(+)/K(+) -ATPase), has evolved amino acid substitutions that reduce cardenolide binding (so-called target site insensitivity, TSI). Because many, but not all, species of milkweed butterflies (Danaini) are associated with cardenolide-containing host plants, we analyzed 16 species, representing all phylogenetic lineages of milkweed butterflies, for the occurrence of TSI by sequence analyses of the Na(+)/K(+) -ATPase gene and by enzymatic assays with extracted Na(+)/K(+) -ATPase. Here we report that sensitivity to cardenolides was reduced in a stepwise manner during the macroevolution of milkweed butterflies. Strikingly, not all Danaini typically consuming cardenolides showed TSI, but rather TSI was more strongly associated with sequestration of toxic cardenolides. Thus, the interplay between bottom-up selection by plant compounds and top-down selection by natural enemies can explain the evolutionary sequence of adaptations to these toxins. © 2013 The Author(s). Evolution © 2013 The Society for the Study of Evolution.

Effect of atrioventricular conduction on heart rate variability

KAUST Repository

Ahmad, Talha Jamal; Ali, Hussnain; Majeed, S. M Imran; Khan, Shoab A.

2011-01-01

This paper discusses the effect of atrioventricular conduction time (AVCT) on the short-term Heart Rate Variability (HRV) by computing HRV parameters using intervals between the onsets of successive P waves (PP time series) for three groups: normal

Down-Regulation of Na+/K+ ATPase Activity by Human Parvovirus B19 Capsid Protein VP1

Directory of Open Access Journals (Sweden)

Ahmad Almilaji

2013-05-01

Full Text Available Background/Aims: Human parvovirus B19 (B19V may cause inflammatory cardiomyopathy (iCMP which is accompanied by endothelial dysfunction. The B19V capsid protein VP1 contains a lysophosphatidylcholine producing phospholipase A2 (PLA sequence. Lysophosphatidylcholine has in turn been shown to inhibit Na+/K+ ATPase. The present study explored whether VP1 modifies Na+/K+ ATPase activity. Methods: Xenopus oocytes were injected with cRNA encoding VP1 isolated from a patient suffering from fatal B19V-iCMP or cRNA encoding PLA2-negative VP1 mutant (H153A and K+ induced pump current (Ipump as well as ouabain-inhibited current (Iouabain both reflecting Na+/K+-ATPase activity were determined by dual electrode voltage clamp. Results: Injection of cRNA encoding VP1, but not of VP1(H153A or water, was followed by a significant decrease of both, Ipump and Iouabain in Xenopus oocytes. The effect was not modified by inhibition of transcription with actinomycin (10 µM for 36 hours but was abrogated in the presence of PLA2 specific blocker 4-bromophenacylbromide (50 µM and was mimicked by lysophosphatidylcholine (0.5 - 1 µg/ml. According to whole cell patch clamp, lysophosphatidylcholine (1 µg /ml similarly decreased Ipump in human microvascular endothelial cells (HMEC. Conclusion: The B19V capsid protein VP1 is a powerful inhibitor of host cell Na+/K+ ATPase, an effect at least partially due to phospholipase A2 (PLA2 dependent formation of lysophosphatidylcholine.

Two-week inhalation of budesonide increases muscle Na,K ATPase content but not endurance in response to terbutaline in men

DEFF Research Database (Denmark)

Hostrup, M.; Jessen, S.; Onslev, J.

2017-01-01

of plasma budesonide, cortisol, and K+. Subjects' performance during cycling to fatigue at 90% of incremental peak power output (iPPO) was measured in response to 4 mg inhaled terbutaline to maximally stimulate Na+,K+ ATPase activity. Plasma concentrations of budesonide rose to 5.0 ± 1.6 n......M with the intervention, whereas no changes were observed in plasma cortisol. Muscle Na+,K+ ATPase content increased (P ≤ 0.01) by 46 ± 34 pmol/(g wet wt) (17% increase) with the intervention. Cycling performance at 90% of iPPO did not change (P = 0.21) with the intervention (203 vs 214 s) in response to terbutaline...

Flow Components in a NaK Test Loop Designed to Simulate Conditions in a Nuclear Surface Power Reactor

Science.gov (United States)

Polzin, Kurt A.; Godfroy, Thomas J.

2008-01-01

A test loop using NaK as the working fluid is presently in use to study material compatibility effects on various components that comprise a possible nuclear reactor design for use on the lunar surface. A DC electromagnetic (EM) pump has been designed and implemented as a means of actively controlling the NaK flow rate through the system and an EM flow sensor is employed to monitor the developed flow rate. These components allow for the matching of the flow rate conditions in test loops with those that would be found in a full-scale surface-power reactor. The design and operating characteristics of the EM pump and flow sensor are presented. In the EM pump, current is applied to a set of electrodes to produce a Lorentz body force in the fluid. A measurement of the induced voltage (back-EMF) in the flow sensor provides the means of monitoring flow rate. Both components are compact, employing high magnetic field strength neodymium magnets thermally coupled to a water-cooled housing. A vacuum gap limits the heat transferred from the high temperature NaK tube to the magnets and a magnetically-permeable material completes the magnetic circuit. The pump is designed to produce a pressure rise of 5 psi, and the flow sensor's predicted output is roughly 20 mV at the loop's nominal flow rate of 0.5 GPM.

Summary of Test Results From a 1 kWe-Class Free-Piston Stirling Power Convertor Integrated With a Pumped NaK Loop

Science.gov (United States)

Briggs, Maxwell H.; Geng, Steven M.; Pearson, J. Boise; Godfroy, Thomas J.

2010-01-01

As a step towards development of Stirling power conversion for potential use in Fission Surface Power (FSP) systems, a pair of commercially available 1 kW class free-piston Stirling convertors was modified to operate with a NaK liquid metal pumped loop for thermal energy input. This was the first-ever attempt at powering a free-piston Stirling engine with a pumped liquid metal heat source and is a major FSP project milestone towards demonstrating technical feasibility. The tests included performance mapping the convertors over various hot and cold-end temperatures, piston amplitudes and NaK flow rates; and transient test conditions to simulate various start-up and fault scenarios. Performance maps of the convertors generated using the pumped NaK loop for thermal input show increases in power output over those measured during baseline testing using electric heating. Transient testing showed that the Stirling convertors can be successfully started in a variety of different scenarios and that the convertors can recover from a variety of fault scenarios.

Effect of atrioventricular conduction on heart rate variability

KAUST Repository

Ahmad, Talha Jamal

2011-08-01

This paper discusses the effect of atrioventricular conduction time (AVCT) on the short-term Heart Rate Variability (HRV) by computing HRV parameters using intervals between the onsets of successive P waves (PP time series) for three groups: normal, arrhythmia and sudden cardiac death (SCD) patients. A very precise wavelet transform based ECG delineator was developed to detect PP, PR and RR time series. Mean PR variation in arrhythmia and SCD group was found to be significantly high as compared to the normal group. It was observed that when PR variations in arrhythmia and SCD cases crossed a certain threshold, RR variability no longer provided a very accurate estimate of HRV. In such cases, PP variability was able to provide a better assessment of HRV. © 2011 IEEE.

Altered Na+ transport after an intracellular alpha-subunit deletion reveals strict external sequential release of Na+ from the Na/K pump.

Science.gov (United States)

Yaragatupalli, Siddhartha; Olivera, J Fernando; Gatto, Craig; Artigas, Pablo

2009-09-08

The Na/K pump actively exports 3 Na(+) in exchange for 2 K(+) across the plasmalemma of animal cells. As in other P-type ATPases, pump function is more effective when the relative affinity for transported ions is altered as the ion binding sites alternate between opposite sides of the membrane. Deletion of the five C-terminal residues from the alpha-subunit diminishes internal Na(+) (Na(i)(+)) affinity approximately 25-fold [Morth et al. (2007) Nature 450:1043-1049]. Because external Na(+) (Na(o)(+)) binding is voltage-dependent, we studied the reactions involving this process by using two-electrode and inside-out patch voltage clamp in normal and truncated (DeltaKESYY) Xenopus-alpha1 pumps expressed in oocytes. We observed that DeltaKESYY (i) decreased both Na(o)(+) and Na(i)(+) apparent affinities in the absence of K(o)(+), and (ii) did not affect apparent Na(o)(+) affinity at high K(o)(+). These results support a model of strict sequential external release of Na(+) ions, where the Na(+)-exclusive site releases Na(+) before the sites shared with K(+) and the DeltaKESYY deletion only reduces Na(o)(+) affinity at the shared sites. Moreover, at nonsaturating K(o)(+), DeltaKESYY induced an inward flow of Na(+) through Na/K pumps at negative potentials. Guanidinium(+) can also permeate truncated pumps, whereas N-methyl-D-glucamine cannot. Because guanidinium(o)(+) can also traverse normal Na/K pumps in the absence of both Na(o)(+) and K(o)(+) and can also inhibit Na/K pump currents in a Na(+)-like voltage-dependent manner, we conclude that the normal pathway transited by the first externally released Na(+) is large enough to accommodate guanidinium(+).

Effect of 2-wk intensified training and inactivity on muscle Na+/K+ pump expression, phospholemman (FXYD1) phosphorylation and performance in soccer players

DEFF Research Database (Denmark)

Thomassen, Martin; Christensen, Peter Møller; Gunnarsson, Thomas Gunnar Petursson

2010-01-01

The present study examined muscle adaptations and alterations in performance of highly trained soccer players with intensified training or training cessation. Eighteen elite soccer players were for a 2-wk period assigned to either a group which performed high intensity training with a reduction....... The present data suggest that short-term intensified training even for trained soccer players can increase muscle Na(+)/K(+) pump alpha2 isoform expression and that cessation of training for two weeks does not affect the expression of Na(+)/K(+) pump isoforms. Resting phosphorylation status of the Na...

Variability of microchip capillary electrophoresis with conductivity detection.

Science.gov (United States)

Tantra, Ratna; Robinson, Kenneth; Sikora, Aneta

2014-02-01

Microfluidic CE with conductivity detection platforms could have an impact on the future development of smaller, faster and portable devices. However, for the purpose of reliable identification and quantification, there is a need to understand the degree of irreproducibility associated with the analytical technique. In this study, a protocol was developed to remove baseline drift problems sometimes observed in such devices. The protocol, which consisted of pre-conditioning steps prior to analysis, was used to further assess measurement variability from 24 individual microchips fabricated from six separate batches of glass substrate. Results show acceptable RSD percentage for retention time measurements but large variability in their corresponding peak areas (with some microchips having variability of ∼50%). Sources of variability were not related to substrate batch but possibly to a number of factors such as applied voltage fluctuations or variations in microchannel quality, for example surface roughness that will subsequently affect microchannel dimensions. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Entropy generation by nanofluid with variable thermal conductivity ...

African Journals Online (AJOL)

The entropy generation by nanofluid with variable thermal conductivity and viscosity of assisted convective flow across a riser pipe of a horizontal flat plate solar collector is investigated numerically. The water based nanofluid with copper nanoparticles is used as the working fluid inside the fluid passing riser pipe.

Cotransport of water by the Na+-K+-2Cl(-) cotransporter NKCC1 in mammalian epithelial cells

DEFF Research Database (Denmark)

Hamann, Steffen; Herrera-Perez, José J; Zeuthen, Thomas

2010-01-01

Water transport by the Na+-K+-2Cl(-) cotransporter (NKCC1) was studied in confluent cultures of pigmented epithelial (PE) cells from the ciliary body of the fetal human eye. Interdependence among water, Na+ and Cl(-) fluxes mediated by NKCC1 was inferred from changes in cell water volume, monitored...

Test Results From a Pair of 1-kWe Dual-Opposed Free-Piston Stirling Power Convertors Integrated With a Pumped NaK Loop

Science.gov (United States)

Geng, Steven M.; Briggs, Maxwell H.; Penswick, L. Barry; Pearson, J. Boise; Godfroy, Thomas J.

2011-01-01

As a step towards development of Stirling power conversion for potential use in Fission Surface Power (FSP) systems, a pair of commercially available 1-kW-class free-piston Stirling convertors were modified to operate with a NaK (sodium (Na) and potassium (K)) liquid metal pumped loop for thermal energy input. This was the first-ever attempt at powering a free-piston Stirling engine with a pumped liquid metal heat source and is a major FSP project milestone towards demonstrating technical feasibility. The convertors were successfully tested at the Marshall Space Flight Center (MSFC) from June 6 through July 14, 2009. The convertors were operated for a total test time of 66 hr and 16 min. The tests included (a) performance mapping the convertors over various hot- and cold-end temperatures, piston amplitudes, and NaK flow rates and (b) transient test conditions to simulate various startup (i.e., low-, medium-, and high-temperature startups) and fault scenarios (i.e., loss of heat source, loss of NaK pump, convertor stall, etc.). This report documents the results of this testing

Differential effect of extracellular calcium on the Na(+)-K+ pump activity in intact polymorphonuclear leucocytes and erythrocytes

DEFF Research Database (Denmark)

Petersen, R H; Knudsen, T; Johansen, Torben

1991-01-01

The effect of extracellular calcium on the Na(+)-K+ pump activity in human polymorphonuclear leucocytes and erythrocytes was studied and compared with the activity in mixed peritoneal leucocytes from rats. While there was maximal decrease in the pump activity (25-30%) of leucocytes from both rat ...

β(3) adrenergic stimulation of the cardiac Na+-K+ pump by reversal of an inhibitory oxidative modification

DEFF Research Database (Denmark)

Bundgaard, Henning; Liu, Chia-Chi; Garcia, Alvaro

2010-01-01

inhibition of L-type Ca(2+) current contributes to negative inotropy of β(3) adrenergic receptor (β(3) AR) activation, but effects on other determinants of excitation-contraction coupling are not known. Of these, the Na(+)-K(+) pump is of particular interest because of adverse effects attributed ...

ß(3) adrenergic stimulation of the cardiac Na+-K+ pump by reversal of an inhibitory oxidative modification

DEFF Research Database (Denmark)

Bundgaard, Henning; Liu, Chia-Chi; Garcia, Alvaro

2010-01-01

inhibition of L-type Ca(2+) current contributes to negative inotropy of ß(3) adrenergic receptor (ß(3) AR) activation, but effects on other determinants of excitation-contraction coupling are not known. Of these, the Na(+)-K(+) pump is of particular interest because of adverse effects attributed ...

Protonation of key acidic residues is critical for the K⁺-selectivity of the Na/K pump.

Science.gov (United States)

Yu, Haibo; Ratheal, Ian M; Artigas, Pablo; Roux, Benoît

2011-09-11

The sodium-potassium (Na/K) pump is a P-type ATPase that generates Na(+) and K(+) concentration gradients across the cell membrane. For each hydrolyzed ATP molecule, the pump extrudes three Na(+) and imports two K(+) by alternating between outward- and inward-facing conformations that preferentially bind K(+) or Na(+), respectively. Remarkably, the selective K(+) and Na(+) binding sites share several residues, and how the pump is able to achieve the selectivity required for the functional cycle is unclear. Here, free energy-perturbation molecular dynamics (FEP/MD) simulations based on the crystal structures of the Na/K pump in a K(+)-loaded state (E2·P(i)) reveal that protonation of the high-field acidic side chains involved in the binding sites is crucial to achieving the proper K(+) selectivity. This prediction is tested with electrophysiological experiments showing that the selectivity of the E2P state for K(+) over Na(+) is affected by extracellular pH.

Nucleotide binding induces conformational changes apparent on the Na+/K+ -ATPase large cytoplasmic loop

Czech Academy of Sciences Publication Activity Database

Šimunová, Lenka; Kubala, M.; Lánský, Zdeněk; Teisinger, Jan; Amler, Evžen

Roč.13, č.1 (2006), s. 37-37 ISSN 1211-5894. [Discussions on Structural Molecular Biology /5./. 16.03.2006-18.03.2006, Nové Hrady] R&D Projects: GA MŠk(CZ) LC554; GA AV ČR 1ET400110403; GA ČR GD305/03/H148 Grant - others:Grantová agentura UK(CZ) 200053 Keywords : Na+/K+ - ATPase * ATP binding * TNP-ATP Subject RIV: BO - Biophysics

Summary of Test Results From a 1 kW(sub e)-Class Free-Piston Stirling Power Convertor Integrated With a Pumped NaK Loop

Science.gov (United States)

Briggs, Maxwell H.; Geng, Steven M.; Pearson, J. Boise; Godfroy, Thomas J.

2010-01-01

As a step towards development of Stirling power conversion for potential use in Fission Surface Power (FSP) systems, a pair of commercially available 1 kW class free-piston Stirling convertors was modified to operate with a NaK liquid metal pumped loop for thermal energy input. This was the first-ever attempt at powering a free-piston Stirling engine with a pumped liquid metal heat source and is a major FSP project milestone towards demonstrating technical feasibility. The tests included performance mapping the convertors over various hot and cold-end temperatures, piston amplitudes and NaK flow rates; and transient test conditions to simulate various start-up and fault scenarios. Performance maps of the convertors generated using the pumped NaK loop for thermal input show increases in power output over those measured during baseline testing using electric heating. Transient testing showed that the Stirling convertors can be successfully started in a variety of different scenarios and that the convertors can recover from a variety of fault scenarios.

Analytical Evalution of Heat Transfer Conductivity with Variable Properties

DEFF Research Database (Denmark)

Rahimi, Masoume; Hosseini, Mohammad Javad; Barari, Amin

2011-01-01

The homotopy analysis method (HAM) as a new technique which is powerful and easy-to-use, is applied to solve heat transfer problems. In this paper, we use HAM for heat transfer conductivity equation with variable properties which may contain highly nonlinear terms. The obtained results are also...

Spontaneous temporal changes and variability of peripheral nerve conduction analyzed using a random effects model

DEFF Research Database (Denmark)

Krøigård, Thomas; Gaist, David; Otto, Marit

2014-01-01

SUMMARY: The reproducibility of variables commonly included in studies of peripheral nerve conduction in healthy individuals has not previously been analyzed using a random effects regression model. We examined the temporal changes and variability of standard nerve conduction measures in the leg...... reexamined after 2 and 26 weeks. There was no change in the variables except for a minor decrease in sural nerve sensory action potential amplitude and a minor increase in tibial nerve minimal F-wave latency. Reproducibility was best for peroneal nerve distal motor latency and motor conduction velocity......, sural nerve sensory conduction velocity, and tibial nerve minimal F-wave latency. Between-subject variability was greater than within-subject variability. Sample sizes ranging from 21 to 128 would be required to show changes twice the magnitude of the spontaneous changes observed in this study. Nerve...

Involvement of Na+/K+ pump in fine modulation of bursting activity of the snail Br neuron by 10 mT static magnetic field.

Science.gov (United States)

Nikolić, Ljiljana; Todorović, Nataša; Zakrzewska, Joanna; Stanić, Marina; Rauš, Snežana; Kalauzi, Aleksandar; Janać, Branka

2012-07-01

The spontaneously active Br neuron from the brain-subesophageal ganglion complex of the garden snail Helix pomatia rhythmically generates regular bursts of action potentials with quiescent intervals accompanied by slow oscillations of membrane potential. We examined the involvement of the Na(+)/K(+) pump in modulating its bursting activity by applying a static magnetic field. Whole snail brains and Br neuron were exposed to the 10-mT static magnetic field for 15 min. Biochemical data showed that Na(+)/K(+)-ATPase activity increased almost twofold after exposure of snail brains to the static magnetic field. Similarly, (31)P NMR data revealed a trend of increasing ATP consumption and increase in intracellular pH mediated by the Na(+)/H(+) exchanger in snail brains exposed to the static magnetic field. Importantly, current clamp recordings from the Br neuron confirmed the increase in activity of the Na(+)/K(+) pump after exposure to the static magnetic field, as the magnitude of ouabain's effect measured on the membrane resting potential, action potential, and interspike interval duration was higher in neurons exposed to the magnetic field. Metabolic pathways through which the magnetic field influenced the Na(+)/K(+) pump could involve phosphorylation and dephosphorylation, as blocking these processes abolished the effect of the static magnetic field.

Development and Testing of a Variable Conductance Thermal Acquisition, Transport, and Switching System

Science.gov (United States)

Bugby, David C.; Farmer, Jeffery T.; Stouffer, Charles J.

2013-01-01

This paper describes the development and testing of a scalable thermal management architecture for instruments, subsystems, or systems that must operate in severe space environments with wide variations in sink temperature. The architecture involves a serial linkage of one or more hot-side variable conductance heat pipes (VCHPs) to one or more cold-side loop heat pipes (LHPs). The VCHPs provide wide area heat acquisition, limited distance thermal transport, modest against gravity pumping, concentrated LHP startup heating, and high switching ratio variable conductance operation. The LHPs provide localized heat acquisition, long distance thermal transport, significant against gravity pumping, and high switching ratio variable conductance operation. The single-VCHP, single-LHP system described herein was developed to maintain thermal control of a small robotic lunar lander throughout the lunar day-night thermal cycle. It is also applicable to other variable heat rejection space missions in severe environments. Operationally, despite a 60-70% gas blocked VCHP condenser during ON testing, the system was still able to provide 2-4 W/K ON conductance, 0.01 W/K OFF conductance, and an end-to-end switching ratio of 200-400. The paper provides a detailed analysis of VCHP condenser performance, which quantified the gas blockage situation. Future multi-VCHP/multi-LHP thermal management system concepts that provide power/transport length scalability are also discussed.

Investigating the potassium interactions with the palytoxin induced channels in Na+/K+ pump.

Science.gov (United States)

Rodrigues, Antônio M; Almeida, Antônio-Carlos G; Infantosi, Antonio F C; Teixeira, Hewerson Z; Duarte, Mário A

2009-02-01

K(+) has been appointed as the main physiological inhibitor of the palytoxin (PTX) effect on the Na(+)/K(+) pump. This toxin acts opening monovalent cationic channels through the Na(+)/K(+) pump. We investigate, by means of computational modeling, the kinetic mechanisms related with K(+) interacting with the complex PTX-Na(+)/K(+) pump. First, a reaction model, with structure similar to Albers-Post model, describing the functional cycle of the pump, was proposed for describing K(+) interference on the complex PTX-Na(+)/K(+) pump in the presence of intracellular ATP. A mathematic model was derived from the reaction model and it was possible to solve numerically the associated differential equations and to simulate experimental maneuvers about the PTX induced currents in the presence of K(+) in the intra- and extracellular space as well as ATP in the intracellular. After the model adjusting to the experimental data, a Monte Carlo method for sensitivity analysis was used to analyze how each reaction parameter acts during each experimental maneuver involving PTX. For ATP and K(+) concentrations conditions, the simulations suggest that the enzyme substate with ATP bound to its high-affinity sites is the main substate for the PTX binding. The activation rate of the induced current is limited by the K(+) deocclusion from the PTX-Na(+)/K(+) pump complex. The K(+) occlusion in the PTX induced channels in the enzymes with ATP bound to its low-affinity sites is the main mechanism responsible for the reduction of the enzyme affinity to PTX.

Intracellular mediators of Na+-K+ pump activity in guinea pig pancreatic acinar cells

International Nuclear Information System (INIS)

Hootman, S.R.; Ochs, D.L.; Williams, J.A.

1985-01-01

The involvement of Ca 2+ and cyclic nucleotides in neurohormonal regulation of Na + -K + -ATPase (Na + -K + pump) activity in guinea pig pancreatic acinar cells was investigated. Changes in Na+-K+ pump activity elicited by secretagogues were assessed by [3H]ouabain binding and by ouabain-sensitive 86 Rb + uptake. Carbachol (CCh) and cholecystokinin octapeptide (CCK-8) each stimulated both ouabain-sensitive 86Rb+ uptake and equilibrium binding of [ 3 H]ouabain by approximately 60%. Secretin increased both indicators of Na+-K+ pump activity by approximately 40% as did forskolin, 8-bromo- and dibutyryl cAMP, theophylline, and isobutylmethylxanthine. Incubation of acinar cells in Ca 2+ -free HEPES-buffered Ringer (HR) with 0.5 mM EGTA reduced the stimulatory effects of CCh and CCK-8 by up to 90% but caused only a small reduction in the effects of secretin, forskolin, and cAMP analogues. In addition, CCh, CCK-8, secretin, and forskolin each stimulated ouabain-insensitive 86Rb+ uptake by acinar cells. The increase elicited by CCh and CCK-8 was greatly reduced in the absence of extracellular Ca 2+ , while that caused by the latter two agents was not substantially altered. The effects of secretagogues on free Ca 2+ levels in pancreatic acinar cells also were investigated with quin-2, a fluorescent Ca 2+ chelator. Basal intracellular Ca 2+ concentration ([Ca 2+ ]i) was 161 nM in resting cells and increased to 713 and 803 nM within 15 s after addition of 100 microM CCh or 10 nM CCK-8, respectively

Population of computational rabbit-specific ventricular action potential models for investigating sources of variability in cellular repolarisation.

Directory of Open Access Journals (Sweden)

Philip Gemmell

Full Text Available Variability is observed at all levels of cardiac electrophysiology. Yet, the underlying causes and importance of this variability are generally unknown, and difficult to investigate with current experimental techniques. The aim of the present study was to generate populations of computational ventricular action potential models that reproduce experimentally observed intercellular variability of repolarisation (represented by action potential duration and to identify its potential causes. A systematic exploration of the effects of simultaneously varying the magnitude of six transmembrane current conductances (transient outward, rapid and slow delayed rectifier K(+, inward rectifying K(+, L-type Ca(2+, and Na(+/K(+ pump currents in two rabbit-specific ventricular action potential models (Shannon et al. and Mahajan et al. at multiple cycle lengths (400, 600, 1,000 ms was performed. This was accomplished with distributed computing software specialised for multi-dimensional parameter sweeps and grid execution. An initial population of 15,625 parameter sets was generated for both models at each cycle length. Action potential durations of these populations were compared to experimentally derived ranges for rabbit ventricular myocytes. 1,352 parameter sets for the Shannon model and 779 parameter sets for the Mahajan model yielded action potential duration within the experimental range, demonstrating that a wide array of ionic conductance values can be used to simulate a physiological rabbit ventricular action potential. Furthermore, by using clutter-based dimension reordering, a technique that allows visualisation of multi-dimensional spaces in two dimensions, the interaction of current conductances and their relative importance to the ventricular action potential at different cycle lengths were revealed. Overall, this work represents an important step towards a better understanding of the role that variability in current conductances may play in

Population of computational rabbit-specific ventricular action potential models for investigating sources of variability in cellular repolarisation.

Science.gov (United States)

Gemmell, Philip; Burrage, Kevin; Rodriguez, Blanca; Quinn, T Alexander

2014-01-01

Variability is observed at all levels of cardiac electrophysiology. Yet, the underlying causes and importance of this variability are generally unknown, and difficult to investigate with current experimental techniques. The aim of the present study was to generate populations of computational ventricular action potential models that reproduce experimentally observed intercellular variability of repolarisation (represented by action potential duration) and to identify its potential causes. A systematic exploration of the effects of simultaneously varying the magnitude of six transmembrane current conductances (transient outward, rapid and slow delayed rectifier K(+), inward rectifying K(+), L-type Ca(2+), and Na(+)/K(+) pump currents) in two rabbit-specific ventricular action potential models (Shannon et al. and Mahajan et al.) at multiple cycle lengths (400, 600, 1,000 ms) was performed. This was accomplished with distributed computing software specialised for multi-dimensional parameter sweeps and grid execution. An initial population of 15,625 parameter sets was generated for both models at each cycle length. Action potential durations of these populations were compared to experimentally derived ranges for rabbit ventricular myocytes. 1,352 parameter sets for the Shannon model and 779 parameter sets for the Mahajan model yielded action potential duration within the experimental range, demonstrating that a wide array of ionic conductance values can be used to simulate a physiological rabbit ventricular action potential. Furthermore, by using clutter-based dimension reordering, a technique that allows visualisation of multi-dimensional spaces in two dimensions, the interaction of current conductances and their relative importance to the ventricular action potential at different cycle lengths were revealed. Overall, this work represents an important step towards a better understanding of the role that variability in current conductances may play in experimentally

Caliper variable sonde for thermal conductivity measurements in situ

Energy Technology Data Exchange (ETDEWEB)

Oelsner, C; Leischner, H; Pischel, S

1968-01-01

For the measurement of the thermal conductivity of the formations surrounding a borehole, a sonde having variable diameter (consisting of an inflatable rubber cylinder with heating wires embedded in its wall) is described. The conditions for the usual sonde made of metal are no longer fulfilled, but the solution to the problem of determining the thermal conductivity from the temperature rise is given, based on an approach by Carslaw and Jaeger, which contains the Bessel functions of the second kind. It is shown that a simpler solution for large values of time can be obtained through the Laplace transformation, and the necessary series developments for computer application are also given. The sonde and the necessary measuring circuitry are described. Tests measurements have indicated that the thermal conductivity can be determined with this sonde with a precision of + 10%.

Zespół nakładania astmy i przewlekłej obturacyjnej choroby płuc

Directory of Open Access Journals (Sweden)

Jadwiga Kroczyńska-Bednarek

2011-07-01

Full Text Available Astma i przewlekła obturacyjna choroba płuc (POChP to zapalne choroby dróg oddechowych, które łączy obecność ograniczenia przepływu powierza przez drogi oddechowe podkreślane w ich definicji. Zapalenie, które leży u podłoża obu chorób, różni się jakościowo rodzajem przeważających komórek i głównych mediatorów zapalnych. Inna jest też na ogół odpowiedź na leki rozszerzające oskrzela w astmie i POChP. Pomimo tych różnic i znaczących odrębności naturalnego przebiegu, rokowania i patogenezy właściwe rozpoznanie obu chorób w praktyce jest trudne, a niekiedy nawet niemożliwe z powodu nakładania się cech astmy i POChP u tego samego pacjenta. Wraz z upływem lat u części chorych na astmę dochodzi do utrwalenia się obturacji, a wielu pacjentów z POChP wykazuje istotną reaktywność oskrzeli i częściową odwracalność obturacji. Nawet profil zapalenia w ciężkiej astmie może zmieniać się na podobny do obserwowanego w POChP, a zaostrzenie POChP przebiega niejednokrotnie z większym udziałem eozynofilów. Głównej przyczyny takiego współwystępowania obu schorzeń (zespołu nakładania upatruje się we wspólnych czynnikach ryzyka i fakcie, że sama astma może zwiększać prawdopodobieństwo wystąpienia POChP. Powszechność zjawiska zmusza do wypracowania skutecznych metod zapobiegania rozwojowi zespołu nakładania, lepszego różnicowania obu chorób, a w przypadku ich współistnienia – do poszukiwania optymalnych sposobów postępowania i leczenia.

Na/K pump inactivation, subsarcolemmal Na measurements, and cytoplasmic ion turnover kinetics contradict restricted Na spaces in murine cardiac myocytes

OpenAIRE

Lu, Fang-Min; Hilgemann, Donald W.

2017-01-01

The Na/K pump exports cytoplasmic Na ions while importing K ions, and its activity is thought to be affected by restricted intracellular Na diffusion in cardiac myocytes. Lu and Hilgemann find instead that the pump can enter an inactivated state and that inactivation can be relieved by cytoplasmic Na.

Reduced resting potentials in dystrophic (mdx) muscle fibers are secondary to NF-κB-dependent negative modulation of ouabain sensitive Na+-K+ pump activity.

Science.gov (United States)

Miles, M T; Cottey, E; Cottey, A; Stefanski, C; Carlson, C G

2011-04-15

To examine potential mechanisms for the reduced resting membrane potentials (RPs) of mature dystrophic (mdx) muscle fibers, the Na(+)-K(+) pump inhibitor ouabain was added to freshly isolated nondystrophic and mdx fibers. Ouabain produced a 71% smaller depolarization in mdx fibers than in nondystrophic fibers, increased the [Na(+)](i) in nondystrophic fibers by 40%, but had no significant effect on the [Na(+)](i) of mdx fibers, which was approximately double that observed in untreated nondystrophic fibers. Western blots indicated no difference in total and phosphorylated Na(+)-K(+) ATPase catalytic α1 subunit between nondystrophic and mdx muscle. Examination of the effects of the NF-κB inhibitor pyrrolidine dithiocarbamate (PDTC) indicated that direct application of the drug slowly hyperpolarized mdx fibers (7 mV in 90 min) but had no effect on nondystrophic fibers. Pretreatment with ouabain abolished this hyperpolarization, and pretreatment with PDTC restored ouabain-induced depolarization and reduced [Na(+)](i). Administration of an NF-κB inhibitor that utilizes a different mechanism for reducing nuclear NF-κB activation, ursodeoxycholic acid (UDCA), also hyperpolarized mdx fibers. These results suggest that in situ Na(+)-K(+) pump activity is depressed in mature dystrophic fibers by NF-κB dependent modulators, and that this reduced pump activity contributes to the weakness characteristic of dystrophic muscle. Copyright © 2011 Elsevier B.V. All rights reserved.

Reduced volume but increased training intensity elevates muscle Na+-K+ pump alpha1-subunit and NHE1 expression as well as short-term work capacity in humans

DEFF Research Database (Denmark)

Iaia, F. Marcello; Thomassen, Martin; Kolding, Helle

2008-01-01

by 30-s sprint runs three to four times a week, whereas CON continued the endurance training ( approximately 45 km/wk). After the 4-wk sprint period, the expression of the muscle Na(+)-K(+) pump alpha(1)-subunit and Na(+)/H(+)-exchanger isoform 1 was 29 and 30% higher (P ... pulmonary maximum oxygen uptake and 10-k time were unchanged. No changes in CON were observed. The present data suggest a role of the Na(+)-K(+) pump in the control of K(+) homeostasis and in the development of fatigue during repeated high-intensity exercise. Furthermore, performance during intense exercise....... Furthermore, plasma K(+) concentration was reduced (P

Altered erythrocyte Na-K pump in anorectic patients

Energy Technology Data Exchange (ETDEWEB)

Pasquali, R.; Strocchi, E.; Malini, P.; Casimirri, F.; Ambrosioni, E.; Melchionda, N.; Labo, G.

1985-07-01

The status of the erythrocyte sodium pump was evaluated in a group of patients suffering from anorexia nervosa and a group of healthy female control subjects. Anorectic patients showed significantly higher mean values of digoxin-binding sites/cell (ie, the number of Na-K-ATPase units) with respect to control subjects while no differences were found in the specific /sup 86/Rb uptake (which reflects the Na-K-ATPase activity) between the two groups. A significant correlation was found between relative weight and the number of Na-K-ATPase pump units (r = -0.66; P less than 0.0001). Anorectic patients showed lower serum T3 concentrations (71.3 +/- 53 ng/dL) with respect to control subjects (100.8 +/- 4.7 ng/dL; P less than 0.0005) and a significant negative correlation between T3 levels and the number of pump units (r = -0.52; P less than 0.003) was found. This study therefore shows that the erythrocyte Na-K pump may be altered in several anorectic patients. The authors suggest that this feature could be interrelated with the degree of underweight and/or malnutrition.

Altered erythrocyte Na-K pump in anorectic patients

International Nuclear Information System (INIS)

Pasquali, R.; Strocchi, E.; Malini, P.; Casimirri, F.; Ambrosioni, E.; Melchionda, N.; Labo, G.

1985-01-01

The status of the erythrocyte sodium pump was evaluated in a group of patients suffering from anorexia nervosa and a group of healthy female control subjects. Anorectic patients showed significantly higher mean values of digoxin-binding sites/cell (ie, the number of Na-K-ATPase units) with respect to control subjects while no differences were found in the specific 86 Rb uptake (which reflects the Na-K-ATPase activity) between the two groups. A significant correlation was found between relative weight and the number of Na-K-ATPase pump units (r = -0.66; P less than 0.0001). Anorectic patients showed lower serum T3 concentrations (71.3 +/- 53 ng/dL) with respect to control subjects (100.8 +/- 4.7 ng/dL; P less than 0.0005) and a significant negative correlation between T3 levels and the number of pump units (r = -0.52; P less than 0.003) was found. This study therefore shows that the erythrocyte Na-K pump may be altered in several anorectic patients. The authors suggest that this feature could be interrelated with the degree of underweight and/or malnutrition

MHD natural convection from a heated vertical wavy surface with variable viscosity and thermal conductivity

International Nuclear Information System (INIS)

Choudhury, M.; Hazarika, G.C.; Sibanda, P.

2013-01-01

We investigate the effects of temperature dependent viscosity and thermal conductivity on natural convection flow of a viscous incompressible electrically conducting fluid along a vertical wavy surface. The flow is permeated by uniform transverse magnetic field. The fluid viscosity and thermal conductivity are assumed to vary as inverse linear functions of temperature. The coupled non-linear systems of partial differential equations are solved using the finite difference method. The effects of variable viscosity parameter, variable thermal conductivity parameter and magnetic parameter on the flow field and the heat transfer characteristics are discussed and shown graphically. (author)

86Rb(K) influx and [3H]ouabain binding by human platelets: Evidence for beta-adrenergic stimulation of Na-K ATPase activity

International Nuclear Information System (INIS)

Turaihi, K.; Khokher, M.A.; Barradas, M.A.; Mikhailidis, D.P.; Dandona, P.

1989-01-01

Although active transport of potassium into human platelets has been demonstrated previously, there is hitherto no evidence that human platelets have an ouabain-inhibitable Na-K ATPase in their membrane. The present study demonstrates active rubidium (used as an index of potassium influx), 86 Rb(K), influx into platelets, inhibitable by ouabain, and also demonstrates the presence of specific [ 3 H]ouabain binding by the human platelet. This 86 Rb(K) influx was stimulated by adrenaline, isoprenaline, and salbutamol, but noradrenaline caused a mild inhibition. Active 86 Rb(K) influx by platelets was inhibited markedly by timolol, mildly by atenolol, but not by phentolamine. Therefore, active 86 Rb(K) influx in human platelets is enhanced by stimulation of beta adrenoceptors of the beta 2 subtype. The platelet may therefore replace the leukocyte in future studies of Na-K ATPase activity. This would be a considerable advantage in view of the ease and rapidity of preparation of platelets

Description of rainfall variability in Br hat -samhita of Varâha-mihira

OpenAIRE

Iyengar, RN

2004-01-01

Br hat -samhita of Varâha-mihira (5–6th century AD) provides valuable information on the approach in ancient India towards monsoon rainfall, including its measurement and forecasting. In this context, we come across a description of the expected amount of total seasonal rainfall depending on the first rains under the 27 naks atras of Indian astronomy. This provides a rough statistical picture of what might have been the rainfall and its variability in the region around Ujjain, where Varâha-mi...

An Experiment Study on Surface Roughness in High Speed Milling NAK80 Die Steel

Directory of Open Access Journals (Sweden)

Su Fa

2016-01-01

Full Text Available The paper introduces that the high speed milling experiments on NAK80 die steel was carried out on the DMU 60 mono BLOCK five axis linkage high speed CNC machining center tool by the TiAlN coated tools, in order to research the effect of milling parameters on surface roughness Ra. The results showed that the Ra value increased with the decrease of milling speed vc, increased with the axial depth of milling ap, and feed per tooth fz and radial depth of milling ae. On the basis of the single factor experiment results, the mathematics model for between surface roughness and milling parameters were established by linear regression analysis.

Ankyrin-B coordinates the Na/K ATPase, Na/Ca exchanger, and InsP3 receptor in a cardiac T-tubule/SR microdomain.

Directory of Open Access Journals (Sweden)

2005-12-01

Full Text Available We report identification of an ankyrin-B-based macromolecular complex of Na/K ATPase (alpha 1 and alpha 2 isoforms, Na/Ca exchanger 1, and InsP3 receptor that is localized in cardiomyocyte T-tubules in discrete microdomains distinct from classic dihydropyridine receptor/ryanodine receptor "dyads." E1425G mutation of ankyrin-B, which causes human cardiac arrhythmia, also blocks binding of ankyrin-B to all three components of the complex. The ankyrin-B complex is markedly reduced in adult ankyrin-B(+/- cardiomyocytes, which may explain elevated [Ca2+]i transients in these cells. Thus, loss of the ankyrin-B complex provides a molecular basis for cardiac arrhythmia in humans and mice. T-tubule-associated ankyrin-B, Na/Ca exchanger, and Na/K ATPase are not present in skeletal muscle, where ankyrin-B is expressed at 10-fold lower levels than in heart. Ankyrin-B also is not abundantly expressed in smooth muscle. We propose that the ankyrin-B-based complex is a specialized adaptation of cardiomyocytes with a role for cytosolic Ca2+ modulation.

Humoral Na+-K+ pump inhibitory activity in essential hypertension and in normotensive subjects after acute volume expansion

International Nuclear Information System (INIS)

Pamnani, M.B.; Burris, J.F.; Jemionek, J.F.; Huot, S.J.; Price, M.; Freis, E.D.; Haddy, F.J.

1989-01-01

Plasma from black male patients with essential hypertension was bioassayed for vascular Na+-K+ pump inhibitory activity. Halves of the same rat tail artery were incubated for two hours in boiled plasma supernates from a hypertensive patient and a paired age-, sex-, and race-matched normotensive subject and then ouabain-sensitive 86 Rb uptake was measured. Ouabain-sensitive 86 Rb uptake by their leukocytes was also measured. Eighteen pairs of subjects were studied. The uptakes were not significantly different in the hypertensive patients and control subjects. However, when we selected from the eighteen hypertensive patients, nine with low plasma renin activity on the day of the study, uptakes were reduced in the hypertensive patients relative to the paired control subjects. We also assayed plasma supernates from normotensive black and white male subjects before and after acute volume expansion (2.5 L saline IV + 1.5 L distilled water orally over a three-hour period) and from paired normotensive subjects before and after sham volume expansion and obtained a positive bioassay in the expanded subjects both on intraindividual and interindividual comparisons. These studies demonstrate increased vascular Na+-K+ pump inhibitory activity in the plasma of black male patients with low renin essential hypertension and in the plasma of normotensive subjects after acute volume expansion. The findings suggest that the inhibitory activity in the hypertensive subjects' plasma is related to volume expansion, relative or absolute

sup 86 Rb(K) influx and ( sup 3 H)ouabain binding by human platelets: Evidence for beta-adrenergic stimulation of Na-K ATPase activity

Energy Technology Data Exchange (ETDEWEB)

Turaihi, K.; Khokher, M.A.; Barradas, M.A.; Mikhailidis, D.P.; Dandona, P. (Royal Free Hospital and School of Medicine, London (England))

1989-08-01

Although active transport of potassium into human platelets has been demonstrated previously, there is hitherto no evidence that human platelets have an ouabain-inhibitable Na-K ATPase in their membrane. The present study demonstrates active rubidium (used as an index of potassium influx), {sup 86}Rb(K), influx into platelets, inhibitable by ouabain, and also demonstrates the presence of specific ({sup 3}H)ouabain binding by the human platelet. This {sup 86}Rb(K) influx was stimulated by adrenaline, isoprenaline, and salbutamol, but noradrenaline caused a mild inhibition. Active {sup 86}Rb(K) influx by platelets was inhibited markedly by timolol, mildly by atenolol, but not by phentolamine. Therefore, active {sup 86}Rb(K) influx in human platelets is enhanced by stimulation of beta adrenoceptors of the beta 2 subtype. The platelet may therefore replace the leukocyte in future studies of Na-K ATPase activity. This would be a considerable advantage in view of the ease and rapidity of preparation of platelets.

Assessment of sodium status in large ruminants by measuring the sodium-to-potassium ratio in muzzle secretions.

Science.gov (United States)

Singh, S P; Rani, D

1999-09-01

To develop a simple diagnostic test to assess sodium status in large ruminants on the basis of the sodium-to-potassium ratio (Na:K) and to determine its relevance. 7 buffalo heifers and 21 lactating, pregnant, and nonpregnant dairy cows and heifers. Buffalo heifers were subjected in 2 experiments to variable dietary sodium intake or sodium depletion and changes in sodium and potassium concentrations; Na:K was simultaneously monitored in various body fluids to study its value for indicating sodium status. Validity of the muzzle secretion test was assessed. Muzzle secretion and urinary Na:K and sodium concentration, but not serum electrolyte concentrations, reflected the sodium status of buffalo heifers in response to the widely variable intake of sodium (0.03 to 0.16% of dry matter [DM]). Progressive sodium depletion during an 11-day period, using saliva deprivation caused reciprocal changes in sodium and potassium concentrations in saliva and muzzle secretion, but not in urine. Decreasing urine sodium concentration was associated with decreasing urine potassium concentration. Saliva, urine, and muzzle secretion Na:K closely reflected the degree of sodium deficit. Buffaloes or dairy cows maintained on optimal sodium intake had muzzle secretion and urine Na:K > 0.30. Muzzle secretion or urine Na:K muzzle secretion Na:K, and to a large extent urine Na:K, may be used as a convenient diagnostic tool to assess sodium status in large ruminants. It has accuracy similar to that of saliva Na:K.

Experimental study on flow characteristics of a vertically falling film flow of liquid metal NaK in a transverse magnetic field

International Nuclear Information System (INIS)

Li Fengchen; Serizawa, Akimi

2004-01-01

Experimental study was carried out on the characteristics of a vertically falling film flow of liquid metal sodium-potassium alloy (NaK-78) in a vertical square duct in the presence of a transverse magnetic field. The magnitude of the applied magnetic field was up to 0.7 T. The Reynolds number, defined by the hydraulic diameter based on the wetted perimeter length and the liquid average velocity, ranged from 8.0x10 3 to 3.0x10 4 . The free surfaces of the falling film flows in both a stainless steel and an acrylic resin channels were visualized. The instantaneous film thickness of the falling film flow in the acrylic resin channel was then measured by means of the ultrasonic transmission technique. Magnetohydrodynamic (MHD) effects on the characteristics of the falling film flow were investigated by the visualization and the statistical analysis of the measured film thickness. It was found that the falling liquid NaK film was thickened and the flow was stabilized remarkably by a strong transverse magnetic field. A bifurcation of the film was recovered by the applied magnetic field. The turbulence of the flow was substantially suppressed

Regulation of the Na(+)-K+ pump activity and estimation of the reserve capacity in intact rat peritoneal mast cells

DEFF Research Database (Denmark)

Knudsen, Torben; Johansen, Torben

1990-01-01

Evidence is provided that regulation of the Na(+)-K+ pump activity in rat peritoneal mast cells occurs mainly through stimulation of the pump from inside the plasma membrane by sodium. It is demonstrated that there is a large reserve capacity for the exchange of intracellular sodium...... with extracellular potassium in these cells. The maximal pump activity was estimated to be 3230 pmol/10(6) cells per min and Km for extracellular potassium was 1.5 mM....

Small Scale Spatial Variability of Apparent Electrical Conductivity within a Paddy Field

International Nuclear Information System (INIS)

Aimrun, W.; Amin, M.S.M.; Ezrin, M.H.; Amin, M.S.M.

2010-01-01

Quick variability description is an important component for zone management practices. Precision farming requires topping up of only the nutrients that are lacking in the soil to attain the highest yield with the least input. The apparent soil electrical conductivity (ECa) sensor is a useful tool in mapping to identify areas of contrasting soil properties. In non saline soils, ECa is a substitute measurement for soil texture. It is directly related to both water holding capacity and Cation Exchange Capacity (CEC), which are key ingredients of productivity. This sensor measures the ECa across a field quickly and gives detailed soil features (one-second interval) with few operators. Hence, a dense sampling is possible and therefore a high-resolution ECa map can be produced. This study aims to characterize the variability of soil ECa within a Malaysian paddy field with respect to the spatial and seasonal variability. The study was conducted at Block C, Sawah Sempadan, Selangor, Malaysia, for three continuous seasons. Soil ECa was collected after harvesting period. The results showed that deep ECa visualized the pattern of the former river routes clearly as continuous lines (about 45 m width) at the northern and central regions of the study area. This exploration has shown different maps with higher contrast as compared to the existing soil series map for the study area. Seasonal variability test showed that the ECa that was acquired during rainy season (collected after harvest in December to January) has the highest value as compared to another season.

Partial characterization and response under hyperregulating conditions of Na+-K+ ATPase and levamisole-sensitive alkaline phosphatase activities in chela muscle of the euryhaline crab Cyrtograpsus angulatus

Directory of Open Access Journals (Sweden)

Silvina Andrea Pinoni

2008-03-01

Full Text Available The occurrence, characteristics and response to changes in environmental salinity of Na+-K+ ATPase and levamisole-sensitive alkaline phosphatase (AP activities were studied in chela muscle of the euryhaline crab Cyrtograpsus angulatus. Chela muscle exhibited an Na+-K+ ATPase activity which was strongly dependent on ATP concentration, pH and temperature of the reaction mixture. Maximal activity was found at 1 mM ATP, 30-37°C and pH 7.4. Levamisole-sensitive AP activity was characterised at physiological pH 7.4 and at pH 8.0. I50 for levamisole-sensitive AP activity was 8.8 mM and 8.0 mM at pH 7.4 and 8.0, respectively. At both pH levels, levamisole-sensitive AP activity exhibited Michaelis-Menten kinetics (Km=3.451 mM and 6.906 mM at pH 7.4 and 8.0, respectively. Levamisole-sensitive AP activities were strongly affected by temperature, exhibiting a peak at 37ºC. In crabs acclimated to low salinity (10; hyperegulating conditions, Na+-K+ ATPase activity and levamisole-sensitive AP activity at the physiological pH were higher than in 35 psu (osmoconforming conditions. The response to low salinity suggests that both activities could be components of muscle regulatory mechanisms at the biochemical level secondary to hyperegulation of C. angulatus. The study of these activities under hyperegulating conditions contributes to a better understanding of the complexity of biochemical mechanisms underlying the adaptive process of euryhaline crabs.

(/sup 3/H)ouabain localization of Na-K ATPase in the epithelium of rabbit ciliary body pars plicata

Energy Technology Data Exchange (ETDEWEB)

Usukura, J.; Fain, G.L.; Bok, D.

1988-04-01

The secretion of the aqueous humor has been proposed to occur as the result of active Na+ transport by a ouabain-sensitive Na-K ATPase. We have examined the localization of this enzyme in the epithelium of rabbit ciliary body pars plicata using (3H)ouabain autoradiography. Single ciliary processes were isolated and incubated in Ringer containing (3H)ouabain. Processes were then rapidly frozen, freezedried, sectioned and exposed for autoradiography. In the light microscope, silver grains were found predominantly over the nonpigmented epithelial cells. In the electron microscope, grains could be localized for the most part to the interdigitations of the nonpigmented cell basolateral membrane. Label could also be observed at a much lower density above other membranes and above the pigmented and nonpigmented cell cytoplasm. No label was found in sections of control tissue which had been incubated in (3H)ouabain with an excess of cold ouabain. To show that the (3H)ouabain had free access to all of the membrane surfaces within the epithelium, in parallel experiments we incubated isolated processes in horseradish peroxidase. Our experiments suggest that most of the active Na+ transport in ciliary body epithelium occurs across the basolateral membrane of nonpigmented cells into the posterior chamber. Furthermore, the placement of the Na-K ATPase within the narrow membrane infoldings of the interdigitations is consistent with a role for this enzyme in water transport and the production of the aqueous.

Dynamics of Na+,K+,2Cl- cotransporter and Na+,K+-ATPase expression in the branchial epithelium of brown trout (Salmo trutta) and Atlantic salmon (Salmo salar)

DEFF Research Database (Denmark)

Tipsmark, Christian Kølbæk; Madsen, Steffen; Seidelin, Michel

2002-01-01

The dynamics of branchial Na+,K+,2Cl- cotransporter (NKCC) and Na+,K+-ATPase (NKA) expression were investigated in brown trout and Atlantic salmon during salinity shifts and the parr-smolt transformation, respectively. In the brown trout, Western blotting revealed that NKCC and NKA abundance...

Prediction of spatially variable unsaturated hydraulic conductivity using scaled particle-size distribution functions

NARCIS (Netherlands)

Nasta, P.; Romano, N.; Assouline, S; Vrugt, J.A.; Hopmans, J.W.

2013-01-01

Simultaneous scaling of soil water retention and hydraulic conductivity functions provides an effective means to characterize the heterogeneity and spatial variability of soil hydraulic properties in a given study area. The statistical significance of this approach largely depends on the number of

Anion-coupled Na efflux mediated by the human red blood cell Na/K pump

International Nuclear Information System (INIS)

Dissing, S.; Hoffman, J.F.

1990-01-01

The red cell Na/K pump is known to continue to extrude Na when both Na and K are removed from the external medium. Because this ouabain-sensitive flux occurs in the absence of an exchangeable cation, it is referred to as uncoupled Na efflux. This flux is also known to be inhibited by 5 mM Nao but to a lesser extent than that inhibitable by ouabain. Uncoupled Na efflux via the Na/K pump therefore can be divided into a Nao-sensitive and Nao-insensitive component. We used DIDS-treated, SO4-equilibrated human red blood cells suspended in HEPES-buffered (pHo 7.4) MgSO4 or (Tris)2SO4, in which we measured 22Na efflux, 35SO4 efflux, and changes in the membrane potential with the fluorescent dye, diS-C3 (5). A principal finding is that uncoupled Na efflux occurs electroneurally, in contrast to the pump's normal electrogenic operation when exchanging Nai for Ko. This electroneutral uncoupled efflux of Na was found to be balanced by an efflux of cellular anions. (We were unable to detect any ouabain-sensitive uptake of protons, measured in an unbuffered medium at pH 7.4 with a Radiometer pH-STAT.) The Nao-sensitive efflux of Nai was found to be 1.95 +/- 0.10 times the Nao-sensitive efflux of (SO4)i, indicating that the stoichiometry of this cotransport is two Na+ per SO4=, accounting for 60-80% of the electroneutral Na efflux. The remainder portion, that is, the ouabain-sensitive Nao-insensitive component, has been identified as PO4-coupled Na transport and is the subject of a separate paper. That uncoupled Na efflux occurs as a cotransport with anions is supported by the result, obtained with resealed ghosts, that when internal and external SO4 was substituted by the impermeant anion, tartrate i,o, the efflux of Na was inhibited 60-80%. This inhibition could be relieved by the inclusion, before DIDS treatment, of 5 mM Cli,o

Transmural gradients in Na/K pump activity and [Na+]I in canine ventricle.

Science.gov (United States)

Gao, J; Wang, W; Cohen, I S; Mathias, R T

2005-09-01

There are well-documented differences in ion channel activity and action potential shape between epicardial (EPI), midmyocardial (MID), and endocardial (ENDO) ventricular myocytes. The purpose of this study was to determine if differences exist in Na/K pump activity. The whole cell patch-clamp was used to measure Na/K pump current (I(P)) and inward background Na(+)-current (I(inb)) in cells isolated from canine left ventricle. All currents were normalized to membrane capacitance. I(P) was measured as the current blocked by a saturating concentration of dihydro-ouabain. [Na(+)](i) was measured using SBFI-AM. I(P)(ENDO) (0.34 +/- 0.04 pA/pF, n = 17) was smaller than I(P)(EPI) (0.68 +/- 0.09 pA/pF, n = 38); the ratio was 0.50 with I(P)(MID) being intermediate (0.53 +/- 0.13 pA/pF, n = 19). The dependence of I(P) on [Na(+)](i) or voltage was essentially identical in EPI and ENDO (half-maximal activation at 9-10 mM [Na(+)](i) or approximately -90 mV). Increasing [K(+)](o) from 5.4 to 15 mM caused both I(P)(ENDO) and I(P)(EPI) to increase, but the ratio remained approximately 0.5. I(inb) in EPI and ENDO were nearly identical ( approximately 0.6 pA/pF). Physiological [Na(+)](i) was lower in EPI (7 +/- 2 mM, n = 31) than ENDO (12 +/- 3 mM, n = 29), with MID being intermediate (9 +/- 3 mM, n = 22). When cells were paced at 2 Hz, [Na(+)](i) increased but the differences persisted (ENDO 14 +/- 3 mM, n = 10; EPI 9 +/- 2 mM, n = 10; and MID intermediate, 11 +/- 2 mM, n = 9). Based on these results, the larger I(P) in EPI appears to reflect a higher maximum turnover rate, which implies either a larger number of active pumps or a higher turnover rate per pump protein. The transmural gradient in [Na(+)](i) means physiological I(P) is approximately uniform across the ventricular wall, whereas transporters that utilize the transmembrane electrochemical gradient for Na(+), such as Na/Ca exchange, have a larger driving force in EPI than ENDO.

Development and Initial Reliability Testing of NAK-50+: A Nutrition Attitude and Knowledge Questionnaire for Adults 50+ Years of Age.

Science.gov (United States)

Ducak, Kate; Keller, Heather

2016-03-01

Few questionnaires to test nutrition knowledge and attitudes of older adults living independently in the community have been developed and tested to assess self-management tools such as Nutri-eSCREEN and other education programs. This study is a first step in the development of a questionnaire designed to evaluate the nutrition knowledge and attitudes of independent older adults (NAK-50+). The steps involved in this study were: (i) drafting initial questions based on the content of the Nutri-eSCREEN education material, (ii) using cognitive interviewing to determine if these questions were understandable and relevant (n = 9 adults ≥50 years of age), and (iii) completing test-retest reliability in a convenient community sample (n = 60 adults ≥50 years of age). Intra-class coefficients (ICC) and kappa were used to determine reliability. A 33-item questionnaire resulted from this development and analysis. ICC for the total score was 0.68 indicating good agreement and thus initial reliability. NAK-50+ is a face valid and reliable questionnaire that assesses nutrition knowledge and attitudes in independent adults aged ≥50 years. Further work to determine construct validity and to refine the questionnaire is warranted. Availability of the questionnaire for this age group will support rigorous evaluation of education and self-management interventions for this segment of the population.

Synchronization modulation of Na/K pumps on Xenopus oocytes

Science.gov (United States)

Liang, Pengfei; Mast, Jason; Chen, Wei

We developed a new technique named synchronization modulation to electrically synchronize and modulate the Na/K pump molecules by a specially designed oscillating electric field. This technique is based on the theory of energy-trap in quantum physics as well as the concept of electronic synchrotron accelerator. As a result, the Na-transports are all entrapped into the positive half-cycle of the applied electric field and consequently, all of the K-transports are entrapped into the negative half cycle of the field. To demonstrate the process of the pump synchronization and modulation, we use Xenopus oocytes as a platform and introduce two-electrode whole-cell voltage clamp in measurement of pump current. Practically, we first synchronize the pump molecules running at the same pace (rate and phase) by a specially designed oscillation electric field. Then, we carefully maintain the pump synchronization status and gradually change the field frequency (decrease and increase) to modulate the pump molecules to newer pumping rate. The result shows a separation of the inward K current from the outward Na current, and about 10 time increase of the total (inward plus outward) pump current from the net outward current from the random paced pump molecules. Also, the ratio of the modulated total pump current with synchronized total pump current is consistent with the ratio of their field frequencies.

Caracterización parcial y respuesta bajo condiciones de hiperregulación de las actividades de Na+-K+ ATPasa y fosfatasa alcalina levamisol-sensible en músculo de la quela del cangrejo eurihalino Cyrtograpsus angulatus

OpenAIRE

Andrea Pinoni, Silvina; López Mañanes, Alejandra Antonia

2008-01-01

En el presente trabajo se estudió la presencia, características y respuesta a la salinidad ambiental de las actividades de Na+-K+ AT Pasa y fosfatasa alcalina (AP) levamisol-sensible en el músculo de la quela del cangrejo eurihalino Cyrtograpsus angulatus. El músculo de la quela exhibió una actividad de Na+-K+ AT Pasa marcadamente dependiente de la concentración de AT P, pH y temperatura del medio de reacción. La actividad fue máxima a 1 mM de AT P, 30-37ºC y a pH 7.4. La actividad de AP leva...

Apparent intermediate K conductance channel hyposmotic activation in human lens epithelial cells.

Science.gov (United States)

Lauf, Peter K; Misri, Sandeep; Chimote, Ameet A; Adragna, Norma C

2008-03-01

This study explores the nature of K fluxes in human lens epithelial cells (LECs) in hyposmotic solutions. Total ion fluxes, Na-K pump, Cl-dependent Na-K-2Cl (NKCC), K-Cl (KCC) cotransport, and K channels were determined by 85Rb uptake and cell K (Kc) by atomic absorption spectrophotometry, and cell water gravimetrically after exposure to ouabain +/- bumetanide (Na-K pump and NKCC inhibitors), and ion channel inhibitors in varying osmolalities with Na, K, or methyl-d-glucamine and Cl, sulfamate, or nitrate. Reverse transcriptase polymerase chain reaction (RT-PCR), Western blot analyses, and immunochemistry were also performed. In isosmotic (300 mosM) media approximately 90% of the total Rb influx occurred through the Na-K pump and NKCC and approximately 10% through KCC and a residual leak. Hyposmotic media (150 mosM) decreased K(c) by a 16-fold higher K permeability and cell water, but failed to inactivate NKCC and activate KCC. Sucrose replacement or extracellular K to >57 mM, but not Rb or Cs, in hyposmotic media prevented Kc and water loss. Rb influx equaled Kc loss, both blocked by clotrimazole (IC50 approximately 25 microM) and partially by 1-[(2-chlorophenyl) diphenylmethyl]-1H-pyrazole (TRAM-34) inhibitors of the IK channel KCa3.1 but not by other K channel or connexin hemichannel blockers. Of several anion channel blockers (dihydro-indenyl)oxy]alkanoic acid (DIOA), 4-2(butyl-6,7-dichloro-2-cyclopentylindan-1-on-5-yl)oxybutyric acid (DCPIB), and phloretin totally or partially inhibited Kc loss and Rb influx, respectively. RT-PCR and immunochemistry confirmed the presence of KCa3.1 channels, aside of the KCC1, KCC2, KCC3 and KCC4 isoforms. Apparently, IK channels, possibly in parallel with volume-sensitive outwardly rectifying Cl channels, effect regulatory volume decrease in LECs.

Contribution of competition for light to within-species variability in stomatal conductance

Science.gov (United States)

Loranty, Michael M.; Mackay, D. Scott; Ewers, Brent E.; Traver, Elizabeth; Kruger, Eric L.

2010-05-01

Sap flux (JS) measurements were collected across two stands dominated by either trembling aspen or sugar maple in northern Wisconsin. Observed canopy transpiration (EC-obs) values derived from JS were used to parameterize the Terrestrial Regional Ecosystem Exchange Simulator ecosystem model. Modeled values of stomatal conductance (GS) were used to determine reference stomatal conductance (GSref), a proxy for GS that removes the effects of temporal responses to vapor pressure deficit (D) on spatial patterns of GS. Values of GSref were compared to observations of soil moisture, several physiological variables, and a competition index (CI) derived from a stand inventory, to determine the underlying cause of observed variability. Considerable variability in GSref between individual trees was found, with values ranging from 20 to 200 mmol m-2 s-1 and 20 to 100 mmol m-2 s-1 at the aspen and maple stands, respectively. Model-derived values of GSref and a sensitivity to D parameter (m) showed good agreement with a known empirical relationship for both stands. At both sites, GSref did not vary with topographic position, as indicated by surface soil moisture. No relationships were observed between GSref and tree height (HT), and a weak correlation with sapwood area (AS) was only significant for aspen. Significant nonlinear inverse relationships between GSref and CI were observed at both stands. Simulations with uniform reductions in incident photosynthetically active radiation (Q0) resulted in better agreement between observed and simulated EC. Our results suggest a link between photosynthesis and plant hydraulics whereby individual trees subject to photosynthetic limitation as a result of competitive shading exhibit a dynamic stomatal response resulting in a more conservative strategy for managing hydrologic resources.

Selectivity of externally facing ion-binding sites in the Na/K pump to alkali metals and organic cations.

Science.gov (United States)

Ratheal, Ian M; Virgin, Gail K; Yu, Haibo; Roux, Benoît; Gatto, Craig; Artigas, Pablo

2010-10-26

The Na/K pump is a P-type ATPase that exchanges three intracellular Na(+) ions for two extracellular K(+) ions through the plasmalemma of nearly all animal cells. The mechanisms involved in cation selection by the pump's ion-binding sites (site I and site II bind either Na(+) or K(+); site III binds only Na(+)) are poorly understood. We studied cation selectivity by outward-facing sites (high K(+) affinity) of Na/K pumps expressed in Xenopus oocytes, under voltage clamp. Guanidinium(+), methylguanidinium(+), and aminoguanidinium(+) produced two phenomena possibly reflecting actions at site III: (i) voltage-dependent inhibition (VDI) of outwardly directed pump current at saturating K(+), and (ii) induction of pump-mediated, guanidinium-derivative-carried inward current at negative potentials without Na(+) and K(+). In contrast, formamidinium(+) and acetamidinium(+) induced K(+)-like outward currents. Measurement of ouabain-sensitive ATPase activity and radiolabeled cation uptake confirmed that these cations are external K(+) congeners. Molecular dynamics simulations indicate that bound organic cations induce minor distortion of the binding sites. Among tested metals, only Li(+) induced Na(+)-like VDI, whereas all metals tested except Na(+) induced K(+)-like outward currents. Pump-mediated K(+)-like organic cation transport challenges the concept of rigid structural models in which ion specificity at site I and site II arises from a precise and unique arrangement of coordinating ligands. Furthermore, actions by guanidinium(+) derivatives suggest that Na(+) binds to site III in a hydrated form and that the inward current observed without external Na(+) and K(+) represents cation transport when normal occlusion at sites I and II is impaired. These results provide insights on external ion selectivity at the three binding sites.

Characterisation, repackaging and incineration of NaK and Na used for heat transfer experiences on LMFBR at the JRC-Ispra site

Energy Technology Data Exchange (ETDEWEB)

Mazzuccato, M.; D' Alberti, F.; D' Amati, F. [European Commission, Joint Research Centre, Nuclear Decommissioning Unit, Via Fermi 210207 Ispra VA (Italy)

2010-07-01

The Joint Research Centre (JRC) is a service of the European Commission and its mission is to provide scientific and technical support to the EU policies. At the Italian JRC Ispra site is currently ongoing a nuclear decommissioning program aimed at dismantling and disposing facilities and materials no longer used for nuclear research purposes, e.g. alkali metals, whose radioactive content has to be checked prior the disposal as radioactive or conventional waste. This paper describes the project phases consisting in characterising, repackaging and disposing of {approx}607 kg of alkali metals, composed by {approx}397 kg of NaK liquid alloy and {approx}210 kg of Na metal. The material was used in the past for scientific experiences on heat transfer for liquid metal fast breeder reactors. The alkali metals are very reactive in presence of water leading to the formation of hydrogen; moreover the NaK had been stored for several years in a bunker inside drums unable to guarantee the needed confinement, with the consequent formation of oxygenated compounds in the outer layer of the alloy crust, as Na{sub 2}O{sub 2}, NaO{sub 2}, K{sub 2}O{sub 2} and KO{sub 2}, unstable if moved in presence of the liquid substrate. To perform the characterization and repackaging operations in a safe manner, avoiding any possible reaction between the liquid alloy and the solid surface of oxides, the alloy has been solidified reducing bunker temperature down to the alloy melting point (-15 deg. C). The sampling has been carried out by means of glove bag sealed on the top of each drum and filled in with inert gas to reduce the presence of humidity. Having characterization campaign proved that the alkali metals could not be classified as radioactive material, the NaK and Na containers were shipped to UK in a refrigerated truck. In order to allow a safe thermal destruction in a conventional incineration plant, additional repackaging has been performed in a UK plant to reduce the amount of alkali

Design of single-walled NaK capsules for fast breeder fuel pins irradiation (IVO-FR2-Vg7 program)

International Nuclear Information System (INIS)

Lopez Jimenez, J.; Hafner, H.E.

1979-01-01

In Frame of the Joint Irradiation Program IVO-FR2 between the Nuclear Research Centre of Karlsruhe (RFA) and the Junta de Energia Nuclear (Spain) is carried out in the FR2 reactor (Karlsruhe) the irradiation of 12 mixed-oxide fuel rods of 172 mm length. These test rods are first irradiated under various conditions in four modified FR2 capsule (Typ 7). Two versions of single-walled NaK (78% K) are used for this purpose. This report contains the design and description of these two capsule versions as well as the considerations required to oftain the operations licence, supplemented by the relevant figures. (author)

Photodissociation of NaK: Ab initio spin-orbit interaction of the Na (32S) and K (42Pj) manifold

International Nuclear Information System (INIS)

Manaa, M.R.

1999-01-01

The relevant interstate b 3 II, A 1 Σ + , c 3 Σ + , and B 1 II spin-orbit induced matrix elements, arising from the Ma (3 2 S) K (4 2 P j ) manifold are treated within the full microscopic Breit-Pauli approximation based on ab initio configuration interaction (CI) wave functions. The determination of these couplings as a function of the internuclear distance of NaK should permit a full treatment of the fine-structure branching ratio K*(4 2 P 1/2 (D 1 ))/Kasterisk(4 2 P 3/2 (D 2 )) in manifold-meditated photodissociation and in the treatment of interstate perturbations

Improved theory of time domain reflectometry with variable coaxial cable length for electrical conductivity measurements

Science.gov (United States)

Although empirical models have been developed previously, a mechanistic model is needed for estimating electrical conductivity (EC) using time domain reflectometry (TDR) with variable lengths of coaxial cable. The goals of this study are to: (1) derive a mechanistic model based on multisection tra...

Efficiency analysis of straight fin with variable heat transfer coefficient and thermal conductivity

International Nuclear Information System (INIS)

Sadri, Somayyeh; Raveshi, Mohammad Reza; Amiri, Shayan

2012-01-01

In this study, one type of applicable analytical method, differential transformation method (DTM), is used to evaluate the efficiency and behavior of a straight fin with variable thermal conductivity and heat transfer coefficient. Fins are widely used to enhance heat transfer between primary surface and the environment in many industrial applications. The performance of such a surface is significantly affected by variable thermal conductivity and heat transfer coefficient, particularly for large temperature differences. General heat transfer equation related to the fin is derived and dimensionalized. The concept of differential transformation is briefly introduced, and then this method is employed to derive solutions of nonlinear equations. Results are evaluated for several cases such as: laminar film boiling or condensation, forced convection, laminar natural convection, turbulent natural convection, nucleate boiling, and radiation. The obtained results from DTM are compared with the numerical solution to verify the accuracy of the proposed method. The effects of design parameters on temperature and efficiency are evaluated by some figures. The major aim of the present study, which is exclusive for this article, is to find the effect of the modes of heat transfer on fin efficiency. It has been shown that for radiation heat transfer, thermal efficiency reaches its maximum value

Heat pipes with variable thermal conductance property for space applications

Energy Technology Data Exchange (ETDEWEB)

Kravets, V.; Alekseik, Ye.; Alekseik, O.; Khairnasov, S. [National Technical University of Ukraine, Kyiv (Ukraine); Baturkin, V.; Ho, T. [Explorationssysteme RY-ES, Bremen (Germany); Celotti, L. [Active Space Technologies GmbH, Berlin (Germany)

2017-06-15

The activities presented in this paper demonstrate a new approach to provide passive thermal control using heat pipes, as demonstrated on the electronic unit of DLR’s MASCOT lander, which embarked on the NEA sample return mission Hayabusa 2 (JAXA). The focus is on the development and testing of heat pipes with variable thermal conductance in a predetermined temperature range. These heat pipes act as thermal switches. Unlike standard gasloaded heat pipes and thermal-diode heat pipes construction of presented heat pipes does not include any additional elements. Copper heat pipes with metal fibrous wicks were chosen as baseline design. We obtained positive results by choosing the heat carrier and structural parameters of the wick (i.e., pore diameter, porosity, and permeability). The increase in the thermal conductivity of the heat pipes from 0.04 W/K to 2.1 W/K was observed in the temperature range between −20 °C and +55 °C. Moreover, the heat pipes transferred the predetermined power of not less than 10 W within the same temperature range. The heat pipes have been in flight since December 2014, and the supporting telemetry data were obtained in September 2015. The data showed the nominal operation of the thermal control system.

Development, manufacturing and testing of a gas-loaded variable conductance methanol heat pipe

Science.gov (United States)

Vanbuggenum, R. I. J.; Daniels, D. H. W.

1987-02-01

The experimental technology required to measure the performance of moderate temperature heat pipes is presented. The heat pipe manufacturing process is described. The hydrodynamic characteristics of the porous structure inside the heat pipe envelope were examined using a specially developed test rig, based upon a steady-state evaporation test. A fully automated test facility was developed and validated by testing constant conductance and variable conductance heat pipes (VCHP). Theoretical performance predictions are illustrated in terms of pressure, depicted in 3D-plots, and compared with the test results of the heat pipe performance tests. The design of the VCHP was directed towards the verification of the VCHP mathematical model. The VCHP design is validated and ready for the final testing and model verification.

Magnetohydraulic flow through a packed bed of electrically conducting spheres

International Nuclear Information System (INIS)

Sanders, T.L.

1985-01-01

The flow of an electrically conducting fluid through a packed bed of electrically conducting spheres in the presence of a strong magnetic field constitutes a very complex flow situation due to the constant turning of the fluid in and out of magnetic field lines. The interaction of the orthogonal components of the velocity and magnetic field will induce electric fields that are orthogonal to both and the electric fields in turn can cause currents that interact with the magnetic field to generate forces against the direction of flow. The strengths of these generated forces depend primarily upon the closure paths taken by the induced currents which, in turn, depend upon the relative ratio of the electrical resistance of the solid spheres to that of the fluid. Both experimental and analytical analyses of the slow flow of a eutectic mixture of sodium and potassium (NaK) through packed cylinders containing stainless steel spheres in the presence of a strong transverse magnetic field were completed. A theory of magnetohydraulic flow is developed by analogy with the development of hydraulic radius theories of flow through porous media. An exact regional analysis is successfully applied to an infinite bed of electrically conducting spheres with a conducting or non-conducting constraining wall on one side. The equations derived are solved for many different combinations of flowrate, magnetic field strength, porosity, and electrical resistance ratio

Effect of anionic surfactant concentration on the variable range hopping conduction in polypyrrole nanoparticles

International Nuclear Information System (INIS)

Rawal, Ishpal; Kaur, Amarjeet

2014-01-01

The mechanism of charge transport in polypyrrole (PPy) nanoparticles prepared with different concentrations (5 to 30 mM) of anionic surfactant (sodium dodecyl sulfate) is reported. Transmission electron microscopy technique confirms the formation of PPy nanoparticles of sizes ∼52 to 28 nm under surfactant directed approach. The room temperature electrical conductivity of the prepared nanoparticles found to increase from 3 to 22 S/cm with surfactant concentration. The temperature dependent activation energy rules out the possibility of band conduction mechanism in the prepared PPy nanoparticles and thus the synthesized nanoparticles are analyzed under variable range hopping (VRH) model for conduction mechanism. The PPy nanoparticles, reduced with liquid ammonia, hold 3D VRH conduction mechanism for the charge transport. However, in the doped samples, some deviation from 3D VRH conduction behavior at higher temperatures (>150 K) has been observed. This may be attributed to the presence of anionic surfactant in these samples. The doping of anionic surfactant causes rise in conducting islands, which may lead to the change in the shape/distribution of density of states governed by Gaussian or exponential type near Fermi level

Effect of anionic surfactant concentration on the variable range hopping conduction in polypyrrole nanoparticles

Science.gov (United States)

Rawal, Ishpal; Kaur, Amarjeet

2014-01-01

The mechanism of charge transport in polypyrrole (PPy) nanoparticles prepared with different concentrations (5 to 30 mM) of anionic surfactant (sodium dodecyl sulfate) is reported. Transmission electron microscopy technique confirms the formation of PPy nanoparticles of sizes ˜52 to 28 nm under surfactant directed approach. The room temperature electrical conductivity of the prepared nanoparticles found to increase from 3 to 22 S/cm with surfactant concentration. The temperature dependent activation energy rules out the possibility of band conduction mechanism in the prepared PPy nanoparticles and thus the synthesized nanoparticles are analyzed under variable range hopping (VRH) model for conduction mechanism. The PPy nanoparticles, reduced with liquid ammonia, hold 3D VRH conduction mechanism for the charge transport. However, in the doped samples, some deviation from 3D VRH conduction behavior at higher temperatures (>150 K) has been observed. This may be attributed to the presence of anionic surfactant in these samples. The doping of anionic surfactant causes rise in conducting islands, which may lead to the change in the shape/distribution of density of states governed by Gaussian or exponential type near Fermi level.

Balance of unidirectional monovalent ion fluxes in cells undergoing apoptosis: why does Na+/K+ pump suppression not cause cell swelling?

Science.gov (United States)

Yurinskaya, Valentina E; Rubashkin, Andrey A; Vereninov, Alexey A

2011-05-01

Cells dying according to the apoptotic program, unlike cells dying via an unprogrammed mode, are able to avoid swelling and osmotic bursting with membrane disruption.There are indications that apoptosis is accompanied by suppression of the Na+/K+ pump and changes in the K+ and Cl− channels. It remains unclear how ion fluxes through individual ion pathways are integrated so as to induce loss of intracellular ions and concomitant apoptotic volume decrease. A decrease in activity of the sodium pump during apoptosis should cause cell swelling rather than shrinkage. We have made the first systemic analysis of the monovalent ion flux balance in apoptotic cells. Experimental data were obtained for human U937 cells treated with staurosporine for 4–5 h, which is known to induce apoptosis. The data include cellular Cl− content and fluxes, K+, Na+, water content and ouabain-sensitive and -resistant Rb+ fluxes.Unidirectional monovalent ion fluxeswere calculated using these data and a cell model comprising the double Donnan system with the Na+/K+ pump, Cl−, K+, Na+ channels, the Na+–K+–2Cl−cotransporter (NKCC), the Na+–Cl− cotransporter (NC), and the equivalent Cl−/Cl− exchange.Apoptotic cell shrinkage was found to be caused, depending on conditions, either by an increase in the integral channel permeability of membrane for K+ or by suppression of the pump coupledwith a decrease in the integral channel permeability of membrane for Na+. The decrease in the channel permeability of membrane for Na+ plays a crucial role in cell dehydration in apoptosis accompanied by suppression of the pump. Supplemental Table S1 is given for easy calculating flux balance under specified conditions.

Glutamate dehydrogenase and Na+-K+ ATPase expression and growth response of Litopenaeus vannamei to different salinities and dietary protein levels

Science.gov (United States)

Li, Erchao; Arena, Leticia; Lizama, Gabriel; Gaxiola, Gabriela; Cuzon, Gerard; Rosas, Carlos; Chen, Liqiao; van Wormhoudt, Alain

2011-03-01

Improvement in the osmoregulation capacity via nutritional supplies is vitally important in shrimp aquaculture. The effects of dietary protein levels on the osmoregulation capacity of the Pacific white shrimp ( L. vannamei) were investigated. This involved an examination of growth performance, glutamate dehydrogenase (GDH) and Na+-K+ ATPase mRNA expression,, and GDH activity in muscles and gills. Three experimental diets were formulated, containing 25%, 40%, and 50% dietary protein, and fed to the shrimp at a salinity of 25. After 20 days, no significant difference was observed in weight gain, though GDH and Na+-K+ ATPase gene expression and GDH activity increased with higher dietary protein levels. Subsequently, shrimp fed diets with 25% and 50% dietary protein were transferred into tanks with salinities of 38 and 5, respectively, and sampled at weeks 1 and 2. Shrimp fed with 40% protein at 25 in salinity (optimal conditions) were used as a control. Regardless of the salinities, shrimp fed with 50% dietary protein had significantly higher growth performance than other diets; no significant differences were found in comparison with the control. Shrimp fed with 25% dietary protein and maintained at salinities of 38 and 5 had significantly lower weight gain values after 2 weeks. Ambient salinity change also stimulated the hepatosomatic index, which increased in the first week and then recovered to a relatively normal level, as in the control, after 2 weeks. These findings indicate that in white shrimp, the specific protein nutrient and energy demands related to ambient salinity change are associated with protein metabolism. Increased dietary protein level could improve the osmoregulation capacity of L. vannamei with more energy resources allocated to GDH activity and expression.

The mode of inhibition of the Na+-K+ pump activity in mast cells by calcium

DEFF Research Database (Denmark)

Knudsen, T; Johansen, Torben

1989-01-01

, and hence the pump activity. This hypothesis is supported by the stimulation of pump activity produced by monensin, which is not inhibited by calcium. The enhancement of pump activity after exposure of calcium-deprived cells to EGTA might be the result of a further increase in the sodium permeability......1 The inhibition by calcium of the Na(+)-K+ pump in the plasma membrane of rat peritoneal mast cells was studied in pure populations of the cells by measuring the ouabain-sensitive uptake of the radioactive potassium analogue, 86rubidium (86Rb+). 2 Exposure of the cells to calcium induced a time......- and concentration-dependent decrease in the ouabain-sensitive K+(86Rb+)-uptake of the cells without influencing the ouabain-resistant uptake. The development of the inhibition required the presence of potassium in the medium in the millimolar range (1.5-8.0 mM), and it did not occur at a concentration of potassium...

The conversion of a room temperature NaK loop to a high temperature MHD facility for Li/V blanket testing

International Nuclear Information System (INIS)

Reed, C.B.; Haglund, R.C.; Miller, M.E.; Nasiatka, J.R.; Kirillov, I.R.; Ogorodnikov, A.P.; Preslitski, G.V.; Goloubovitch, G.P.; Xu, Zeng Yu

1996-01-01

The Vanadium/Lithium system has been the recent focus of ANL's Blanket Technology Pro-ram, and for the last several years, ANL's Liquid Metal Blanket activities have been carried out in direct support of the ITER (International Thermonuclear Experimental Reactor) breeding blanket task area. A key feasibility issue for the ITER Vanadium/Lithium breeding blanket is the Near the development of insulator coatings. Design calculations, Hua and Gohar, show that an electrically insulating layer is necessary to maintain an acceptably low magneto-hydrodynamic (MHD) pressure drop in the current ITER design. Consequently, the decision was made to convert Argonne's Liquid Metal EXperiment (ALEX) from a 200 degrees C NaK facility to a 350 degrees C lithium facility. The upgraded facility was designed to produce MHD pressure drop data, test section voltage distributions, and heat transfer data for mid-scale test sections and blanket mockups at Hartmann numbers (M) and interaction parameters (N) in the range of 10 3 to 10 5 in lithium at 350 degrees C. Following completion of the upgrade work, a short performance test was conducted, followed by two longer multiple-hour, MHD tests, all at 230 degrees C. The modified ALEX facility performed up to expectations in the testing. MHD pressure drop and test section voltage distributions were collected at Hartmann numbers of 1000

Effects of variable thermal conductivity on Stokes' flow of a thermoelectric fluid with fractional order of heat transfer

International Nuclear Information System (INIS)

Ezzat, M.A.; El-Bary, A.A.

2016-01-01

In this study, the constitutive relation for the heat flux vector is derived to be the Fourier's law of heat conduction with a variable thermal conductivity and time-fractional order. The Stokes' flow of unsteady incompressible thermoelectric fluid due to a moving plate in the presence of a transverse magnetic field is molded. Stokes' first problem is solved by applying Laplace transform with respect to time variable and evaluating the inverse transform integrals by using a numerical approach. Numerical results for the temperature and the velocity distributions are given and illustrated graphically for given problem. The results indicate that the thermal conductivity and time-fractional order play a major role in the temperature and velocity distributions. (authors)

Model and simulation of Na+/K+ pump phosphorylation in the presence of palytoxin.

Science.gov (United States)

Rodrigues, Antônio M; Almeida, Antônio-Carlos G; Infantosi, Antonio F C; Teixeira, Hewerson Z; Duarte, Mario A

2008-02-01

The ATP hydrolysis reactions responsible for the Na(+)/K(+)-ATPase phosphorylation, according to recent experimental evidences, also occur for the PTX-Na(+)/K(+) pump complex. Moreover, it has been demonstrated that PTX interferes with the enzymes phosphorylation status. However, the reactions involved in the PTX-Na(+)/K(+) pump complex phosphorylation are not very well established yet. This work aims at proposing a reaction model for PTX-Na(+)/K(+) pump complex, with similar structure to the Albers-Post model, to contribute to elucidate the PTX effect over Na(+)/K(+)-ATPase phosphorylation and dephosphorylation. Computational simulations with the proposed model support several hypotheses and also suggest: (i) phosphorylation promotes an increase of the open probability of induced channels; (ii) PTX reduces the Na(+)/K(+) pump phosphorylation rate; (iii) PTX may cause conformational changes to substates where the Na(+)/K(+)-ATPase may not be phosphorylated; (iv) PTX can bind to substates of the two principal states E1 and E2, with highest affinity to phosphorylated enzymes and with ATP bound to its low-affinity sites. The proposed model also allows previewing the behavior of the PTX-pump complex substates for different levels of intracellular ATP concentrations.

Thermal infrared imaging of the temporal variability in stomatal conductance for fruit trees

Science.gov (United States)

Struthers, Raymond; Ivanova, Anna; Tits, Laurent; Swennen, Rony; Coppin, Pol

2015-07-01

Repeated measurements using thermal infrared remote sensing were used to characterize the change in canopy temperature over time and factors that influenced this change on 'Conference' pear trees (Pyrus communis L.). Three different types of sensors were used, a leaf porometer to measure leaf stomatal conductance, a thermal infrared camera to measure the canopy temperature and a meteorological sensor to measure weather variables. Stomatal conductance of water stressed pear was significantly lower than in the control group 9 days after stress began. This decrease in stomatal conductance reduced transpiration, reducing evaporative cooling that increased canopy temperature. Using thermal infrared imaging with wavelengths between 7.5 and13 μm, the first significant difference was measured 18 days after stress began. A second order derivative described the average rate of change of the difference between the stress treatment and control group. The average rate of change for stomatal conductance was 0.06 (mmol m-2 s-1) and for canopy temperature was -0.04 (°C) with respect to days. Thermal infrared remote sensing and data analysis presented in this study demonstrated that the differences in canopy temperatures between the water stress and control treatment due to stomata regulation can be validated.

Variability of streambed hydraulic conductivity in an intermittent stream reach regulated by Vented Dams: A case study

Science.gov (United States)

Naganna, Sujay Raghavendra; Deka, Paresh Chandra

2018-07-01

The hydro-geological properties of streambed together with the hydraulic gradients determine the fluxes of water, energy and solutes between the stream and underlying aquifer system. Dam induced sedimentation affects hyporheic processes and alters substrate pore space geometries in the course of progressive stabilization of the sediment layers. Uncertainty in stream-aquifer interactions arises from the inherent complex-nested flow paths and spatio-temporal variability of streambed hydraulic properties. A detailed field investigation of streambed hydraulic conductivity (Ks) using Guelph Permeameter was carried out in an intermittent stream reach of the Pavanje river basin located in the mountainous, forested tract of western ghats of India. The present study reports the spatial and temporal variability of streambed hydraulic conductivity along the stream reach obstructed by two Vented Dams in sequence. Statistical tests such as Levene's and Welch's t-tests were employed to check for various variability measures. The strength of spatial dependence and the presence of spatial autocorrelation among the streambed Ks samples were tested by using Moran's I statistic. The measures of central tendency and dispersion pointed out reasonable spatial variability in Ks distribution throughout the study reach during two consecutive years 2016 and 2017. The streambed was heterogeneous with regard to hydraulic conductivity distribution with high-Ks zones near the backwater areas of the vented dam and low-Ks zones particularly at the tail water section of vented dams. Dam operational strategies were responsible for seasonal fluctuations in sedimentation and modifications to streambed substrate characteristics (such as porosity, grain size, packing etc.), resulting in heterogeneous streambed Ks profiles. The channel downstream of vented dams contained significantly more cohesive deposits of fine sediment due to the overflow of surplus suspended sediment-laden water at low velocity

Effect of Cattaneo-Christov heat flux on Jeffrey fluid flow with variable thermal conductivity

Science.gov (United States)

Hayat, Tasawar; Javed, Mehwish; Imtiaz, Maria; Alsaedi, Ahmed

2018-03-01

This paper presents the study of Jeffrey fluid flow by a rotating disk with variable thickness. Energy equation is constructed by using Cattaneo-Christov heat flux model with variable thermal conductivity. A system of equations governing the model is obtained by applying boundary layer approximation. Resulting nonlinear partial differential system is transformed to ordinary differential system. Homotopy concept leads to the convergent solutions development. Graphical analysis for velocities and temperature is made to examine the influence of different involved parameters. Thermal relaxation time parameter signifies that temperature for Fourier's heat law is more than Cattaneo-Christov heat flux. A constitutional analysis is made for skin friction coefficient and heat transfer rate. Effects of Prandtl number on temperature distribution and heat transfer rate are scrutinized. It is observed that larger Reynolds number gives illustrious temperature distribution.

The phosphatase activity of the isolated H4-H5 loop of Na(+)/K(+) ATPase resides outside its ATP binding site

Czech Academy of Sciences Publication Activity Database

Krumscheid, R.; Ettrich, Rüdiger; Sovová, Žofie; Sušánková, Klára; Lánský, Zdeněk; Hofbauerová, Kateřina; Linnertz, H.; Teisinger, Jan; Amler, Evžen; Schoner, W.

2004-01-01

Roč. 271, č. 19 (2004), s. 3923-3936 ISSN 0014-2956 R&D Projects: GA MŠk(CZ) LN00A141; GA ČR(CZ) GA204/01/0254; GA ČR(CZ) GA204/01/1001; GA ČR(CZ) GP206/03/D082; GA ČR(CZ) GA309/02/1479 Grant - others:Deutsche Forschungsgemeinschaft(DE) Bonn Scho 139/21-2+3; CZ-DE(CZ) TSR-088-97; CZ-DE(CZ) CZE 00/33 Institutional research plan: CEZ:AV0Z5011922 Keywords : Na(+)/K(+) ATPase * p-nitrophenylphosphate * H4-H5 loop Subject RIV: CE - Biochemistry Impact factor: 3.260, year: 2004

Evaluation of the Coreless Linear Conduction Pump for Thermoelectromagnetic Pumps,

Science.gov (United States)

1991-08-01

pitot -tube type) in the NaK Cart Loop had a range that was not compatible with the pressure head to be developed by the VCLCP. A remotely operated...B.Bleaney, Electricity and Magnetism. 3rd Ed., Oxford Univ. Press 1976. < = > Boeker, Henry G., An Approach to Science. McGraw-Hill, New York 1959

Conductance of partially disordered graphene: crossover from temperature-dependent to field-dependent variable-range hopping

International Nuclear Information System (INIS)

Cheah, C Y; Jaurigue, L C; Kaiser, A B; Gómez-Navarro, C

2013-01-01

We report an analysis of low-temperature measurements of the conductance of partially disordered reduced graphene oxide, finding that the data follow a simple crossover scenario. At room temperature, the conductance is dominated by two-dimensional (2D) electric field-assisted, thermally driven (Pollak–Riess) variable-range hopping (VRH) through highly disordered regions. However, at lower temperatures T, we find a smooth crossover to follow the exp(−E 0 /E) 1/3 field-driven (Shklovskii) 2D VRH conductance behaviour when the electric field E exceeds a specific crossover value E C (T) 2D =(E a E 0 1/3 /3) 3/4 determined by the scale factors E 0 and E a for the high-field and intermediate-field regimes respectively. Our crossover scenario also accounts well for experimental data reported by other authors for three-dimensional disordered carbon networks, suggesting wide applicability. (paper)

Spatial variability of hydraulic conductivity of an unconfined sandy aquifer determined by a mini slug test

DEFF Research Database (Denmark)

Bjerg, Poul Løgstrup; Hinsby, Klaus; Christensen, Thomas Højlund

1992-01-01

The spatial variability of the hydraulic conductivity in a sandy aquifer has been determined by a mini slug test method. The hydraulic conductivity (K) of the aquifer has a geometric mean of 5.05 × 10−4 m s−1, and an overall variance of 1n K equal to 0.37 which corresponds quite well to the results...... obtained by two large scale tracer experiments performed in the aquifer. A geological model of the aquifer based on 31 sediment cores, proposed three hydrogeological layers in the aquifer concurrent with the vertical variations observed with respect to hydraulic conductivity. The horizontal correlation......, to be in the range of 0.3–0.5 m compared with a value of 0.42 m obtained in one of the tracer tests performed....

Protein kinase-dependent oxidative regulation of the cardiac Na+-K+ pump: evidence from in vivo and in vitro modulation of cell signalling.

Science.gov (United States)

Galougahi, Keyvan Karimi; Liu, Chia-Chi; Garcia, Alvaro; Fry, Natasha A S; Hamilton, Elisha J; Rasmussen, Helge H; Figtree, Gemma A

2013-06-15

The widely reported stimulation of the cardiac Na(+)-K(+) pump by protein kinase A (PKA) should oppose other effects of PKA to increase contractility of the normal heart. It should also reduce harmful raised myocyte Na(+) levels in heart failure, yet blockade of the β1 adrenergic receptor (AR), coupled to PKA signalling, is beneficial. We treated rabbits with the β1 AR antagonist metoprolol to modulate PKA activity and studied cardiac myocytes ex vivo. Metoprolol increased electrogenic pump current (Ip) in voltage clamped myocytes and reduced glutathionylation of the β1 pump subunit, an oxidative modification causally related to pump inhibition. Activation of adenylyl cyclase with forskolin to enhance cAMP synthesis or inclusion of the catalytic subunit of PKA in patch pipette solutions abolished the increase in Ip in voltage clamped myocytes induced by treatment with metoprolol, supporting cAMP/PKA-mediated pump inhibition. Metoprolol reduced myocardial PKA and protein kinase C (PKC) activities, reduced coimmunoprecipitation of cytosolic p47(phox) and membranous p22(phox) NADPH oxidase subunits and reduced myocardial O2(•-)-sensitive dihydroethidium fluorescence. Treatment also enhanced coimmunoprecipitation of the β1 pump subunit with glutaredoxin 1 that catalyses de-glutathionylation. Since angiotensin II induces PKC-dependent activation of NADPH oxidase, we examined the effects of angiotensin-converting enzyme inhibition with captopril. This treatment had no effect on PKA activity but reduced the activity of PKC, reduced β1 subunit glutathionylation and increased Ip. The PKA-induced Na(+)-K(+) pump inhibition we report should act with other mechanisms that enhance contractility of the normal heart but accentuate the harmful effects of raised cytosolic Na(+) in the failing heart. This scheme is consistent with the efficacy of β1 AR blockade in the treatment of heart failure.

Heat Rejection from a Variable Conductance Heat Pipe Radiator Panel

Science.gov (United States)

Jaworske, D. A.; Gibson, M. A.; Hervol, D. S.

2012-01-01

A titanium-water heat pipe radiator having an innovative proprietary evaporator configuration was evaluated in a large vacuum chamber equipped with liquid nitrogen cooled cold walls. The radiator was manufactured by Advanced Cooling Technologies, Inc. (ACT), Lancaster, PA, and delivered as part of a Small Business Innovative Research effort. The radiator panel consisted of five titanium-water heat pipes operating as thermosyphons, sandwiched between two polymer matrix composite face sheets. The five variable conductance heat pipes were purposely charged with a small amount of non-condensable gas to control heat flow through the condenser. Heat rejection was evaluated over a wide range of inlet water temperature and flow conditions, and heat rejection was calculated in real-time utilizing a data acquisition system programmed with the Stefan-Boltzmann equation. Thermography through an infra-red transparent window identified heat flow across the panel. Under nominal operation, a maximum heat rejection value of over 2200 Watts was identified. The thermal vacuum evaluation of heat rejection provided critical information on understanding the radiator s performance, and in steady state and transient scenarios provided useful information for validating current thermal models in support of the Fission Power Systems Project.

Physiology and pathophysiology of Na+/H+ exchange and Na+-K+-2Cl- cotransport in the heart, brain, and blood

DEFF Research Database (Denmark)

Pedersen, S. F.; O´Donnell, M. E.; Anderson, S. E.

2006-01-01

Maintenance of a stable cell volume and intracellular pH is critical for normal cell function. Arguably, two of the most important ion transporters involved in these processes are the Na+/H+ exchanger isoform 1 (NHE1) and Na+-K+-2Cl- cotransporter isoform 1 (NKCC1). Both NHE1 and NKCC1....... The aim is to provide a comprehensive overview of the mechanisms and consequences of stress-induced stimulation of these transporters with focus on the heart, brain, and blood. The physiological stressors reviewed are metabolic/exercise stress, osmotic stress, and mechanical stress, conditions in which...... are stimulated by cell shrinkage and by numerous other stimuli, including a wide range of hormones and growth factors, and for NHE1, intracellular acidification. Both transporters can be important regulators of cell volume, yet their activity also, directly or indirectly, affects the intracellular concentrations...

Reduced volume and increased training intensity elevate muscle Na+/K+ pump {alpha}2-subunit expression as well as short- and long-term work capacity in humans

DEFF Research Database (Denmark)

Bangsbo, Jens; Gunnarsson, Thomas Petursson; Wendell, Jesper

2009-01-01

was unaltered, but the 3-K (3,000 m) time was reduced (Pexpression and performance remained unaltered in CON. The present data suggest that both short- and long-term......% reduction in the amount of training but including speed endurance training consisting of 6-12 30-s sprint runs 3-4 times a week (SET, n=12) or a control group (CON, n=5), which continued the endurance training (about 55 km(.)wk(-1)). For SET the expression of the muscle Na(+)/K(+) pump alpha2-subunit was 68...

Uncertainties in repository performance from spatial variability of hydraulic conductivities - statistical estimation and stochastic simulation using PROPER

International Nuclear Information System (INIS)

Lovius, L.; Norman, S.; Kjellbert, N.

1990-02-01

An assessment has been made of the impact of spatial variability on the performance of a KBS-3 type repository. The uncertainties in geohydrologically related performance measures have been investigated using conductivity data from one of the Swedish study sites. The analysis was carried out with the PROPER code and the FSCF10 submodel. (authors)

An unexpected oxidation: NaK5Cl2(S2O62 revisited

Directory of Open Access Journals (Sweden)

William T. A. Harrison

2017-02-01

Full Text Available The title compound, NaK5Cl2(S2O62 [systematic name: sodium pentapotassium dichloride bis(dithionate], arose as an unexpected product from an organic synthesis that used dithionite (S2O42− ions as a reducing agent to destroy excess permanganate ions. Compared to the previous study [Stanley (1953. Acta Cryst. 6, 187–196], the present tetragonal structure exhibits a root 2a × root 2a × c super-cell due to subtle changes in the orientations of the dithionate anions. The structure can be visualized as a three-dimensional framework of [001] columns of alternating trans-NaO4Cl2 and KO4Cl2 octahedra cross-linked by the dithionate ions with the interstices occupied by KO6Cl2 polyhedra to generate a densely packed three-dimensional framework. The asymmetric unit comprises two sodium ions (site symmetries 4 and -4, four potassium ions (site symmetries = -4, 4, 1 and 1, three chloride ions (site symmetries = 4, 4 and 2 and two half-dithionate ions (all atoms on general positions. Both dithionate ions are completed by crystallographic inversion symmetry. The crystal chosen for data collection was found to be rotationally twinned by 180° about the [100] axis in reciprocal space with a 0.6298 (13:0.3702 (13 domain ratio.

The effect of X-irradiation on Na-K ATPase and cation distribution in rabbit lens

International Nuclear Information System (INIS)

Matsuda, H.; Giblin, F.J.; Reddy, V.N.

1982-01-01

The Na-K ATPase activity of rabbit lens was measured at various times after exposure to a single dose of 2000 rads of X-ray and was compared with that in contralateral control eyes. A decrease in enzyme activity in both whole lens and in isolated capsule-epithelium was first observed 3 to 4 weeks after irradiation and became increasingly marked at 7.5 weeks after X-ray. These findings are consistent with our earlier observations that active transport of cations is reduced in these lenses and support the view that loss of membrane ATPase is responsible for the impairment of the cation pump in X-irradiated lenses. Despite a significant loss of the enzyme, X-irradiated lenses were able to maintain near normal levels of total cations (Na+ + K+), thus accounting for their normal hydration. The results of the changes in lens Na+ and K+ levels revealed that between 4 and 7.5 weeks after X-ray, the gain in Na+ was compensated by an equivalent loss of K+. A breakdown of this relationship of 1:1 exchange of Na+ for K+ is accompanied by a disproportionate increase in Na+ and water

The mesoscopic conductance of disordered rings, its random matrix theory and the generalized variable range hopping picture

International Nuclear Information System (INIS)

Stotland, Alexander; Peer, Tal; Cohen, Doron; Budoyo, Rangga; Kottos, Tsampikos

2008-01-01

The calculation of the conductance of disordered rings requires a theory that goes beyond the Kubo-Drude formulation. Assuming 'mesoscopic' circumstances the analysis of the electro-driven transitions shows similarities with a percolation problem in energy space. We argue that the texture and the sparsity of the perturbation matrix dictate the value of the conductance, and study its dependence on the disorder strength, ranging from the ballistic to the Anderson localization regime. An improved sparse random matrix model is introduced to capture the essential ingredients of the problem, and leads to a generalized variable range hopping picture. (fast track communication)

The effect of culture density and proliferation rate on the expression of ouabain-sensitive Na/K ATPase pumps in cultured human retinal pigment epithelium

International Nuclear Information System (INIS)

Burke, J.M.; Jaffe, G.J.; Brzeski, C.M.

1991-01-01

The number and activity of ouabain-sensitive Na/K ATPase pumps expressed by many cell types in vitro, including human retinal pigment epithelial cells (RPE), have been shown to decline with increasing culture density. Cell proliferation also declined as cultures became dense so it was unclear if pump number was modulated by cell proliferation or culture confluency. By exposing RPE cultures to various feeding regimens, using culture medium containing or lacking serum, it was possible to produce RPE cultures with a range of culture densities and growth rates. These were analyzed for proliferative activity by quantifying [ 3 H]thymidine incorporation and for Na/K ATPase pump number by measuring specific [ 3 H]ouabain binding. The results suggest that pump number is modulated by culture density and, further, that the density-dependent regulation of pump number requires serum. Although density-dependent modulation of culture growth is also serum requiring, cell proliferation and pump number did not appear to be related; cultures of similar density which differed significantly in growth rate had similar numbers of pumps. The view that elevated numbers of pumps were not necessarily found in proliferating cells was further supported by qualitative examination of radioautographs of cells dually labeled with [ 3 H]thymidine and [ 3 H]ouabain. Cycling cells which had [ 3 H]thymidine-labeled nuclei did not have notably higher labeling with [ 3 H]ouabain. However, [ 3 H]ouabain labeling, as an indicator of pump site number and distribution, did vary among cells in an RPE population and also within individual cells. This latter observation suggests that unpolarized RPE cells in sparse cultures may have regionally different requirements for ionic regulation

Sodium Variable Conductance Heat Pipe for Radioisotope Stirling Systems

Science.gov (United States)

Tarau, Calin; Anderson, William G.; Walker, Kara

2009-01-01

In a Stirling radioisotope system, heat must continually be removed from the General Purpose Heat Source (GPHS) modules to maintain the modules and surrounding insulation at acceptable temperatures. Normally, the Stirling convertor provides this cooling. If the converter stops in the current system, the insulation is designed to spoil, preventing damage to the GPHS, and also ending the mission. An alkali-metal Variable Conductance Heat Pipe (VCHP) has been designed to allow multiple stops and restarts of the Stirling convertor in an Advanced Stirling Radioisotope Generator (ASRG). When the Stirling convertor is turned off, the VCHP will activate when the temperatures rises 30 C above the setpoint temperature. A prototype VCHP with sodium as the working fluid was fabricated and tested in both gravity aided and against gravity conditions for a nominal heater head temperature of 790 C. The results show very good agreement with the predictions and validate the model. The gas front was located at the exit of the reservoir when heater head temperature was 790 C while cooling was ON, simulating an operating Advanced Stirling Converter (ASC). When cooling stopped, the temperature increased by 30 C, allowing the gas front to move past the radiator, which transferred the heat to the case. After resuming the cooling flow, the front returned at the initial location turning OFF the VCHP. The against gravity working conditions showed a colder reservoir and faster transients.

NAK WP-Cave project

International Nuclear Information System (INIS)

Svemar, C.

1985-11-01

WP-Cave is designed as an egg-shaped underground structure for intermediate storing and final disposal of high-level nuclear waste. Its height, when storing 1600 tonnes of spent fuel, is about 250 m and its diameter 110 m at mid-height. The waste storage has a compact layout and is surrounded by two engineered barriers. The innermost one is a 5 m-wide shield consisting of a mixture of bentonite clay and same which has a low hydraulic conductivity. This shield is surrounded by a so-called hydraulic cage, which initially drains the storage rock mass and, in the long-term diverts, the ground water flow past the storage. In this way an initial dry supervision period can be maintained. After sealing-off the storage and after water-filling, a stagnant chemical environment is established inside the bentonite-sand barrier preventing the disposed waste from being dissolved and from migrating to the geosphere. The programme, as outlined by the Project Board, has considered R and D questions with specific relation to the WP-Cave such as: properties of low-graded bentonite mixtures, function of the hydraulic cage, full-face boring of the storage, geomechanics of the storage and the bentonite-sand barrier, dry ventilation of the storage, temperature distributions and thermal stresses. An initial safety analysis has also been conducted. The hydraulic conductivity of low-grade bentonite mixtures has been measured in laboratory tests and found to be higher than expected. Tests of gas conductivity, for instance, confirm that only low gas pressures would build up inside the bentonite-sand barrier. The initial safety analysis indicates that a compact storage, such as that presented, would allow for the safe isolation of the spent nuclear fuel and would fulfull the radiation protection criterion of 0.1 mSv/year. With 27 refs. (Author)

Multidimensional Heat Conduction

DEFF Research Database (Denmark)

Rode, Carsten

1998-01-01

Analytical theory of multidimensional heat conduction. General heat conduction equation in three dimensions. Steay state, analytical solutions. The Laplace equation. Method of separation of variables. Principle of superposition. Shape factors. Transient, multidimensional heat conduction....

Early effects of aldosterone on Na-K pump in rat cortical collecting tubules

International Nuclear Information System (INIS)

Fujii, Y.; Takemoto, F.; Katz, A.I.

1990-01-01

Sustained exposure to aldosterone (Aldo) increases the abundance and activity of the Na-K pump in cortical collecting tubules (CCT). However, the onset and mechanism of the early interaction of Aldo with the CCT pump, especially in adrenal-intact animals, are unclear. We evaluated the short-term effects of the hormone on Na-K-adenosinetriphosphatase (ATPase) activity and on ouabain-sensitive 86Rb uptake, a measure of the transporting rate of the pump, in microdissected CCT from adrenal-intact rats. Incubation with Aldo (10(-8) M, 2 h) had no effect on Na-K-ATPase activity (Vmax), whereas it produced at least a twofold increase in 86Rb uptake. This effect was generated by physiological concentrations of the hormone (threshold 10(-10) M; apparent K1/2 approximately 10(-9) M), after a short lag of less than or equal to 30 min. Incubation with Aldo in the presence of amiloride or nystatin or in a Na-free medium (choline chloride) did not prevent the enhanced 86Rb uptake seen after Aldo alone; possible interpretations of these observations are discussed. We conclude that Aldo produces a rapid stimulation of pump function in CCT that precedes its induction of new pump synthesis; the physiological significance of this effect is suggested by its occurrence in tubules from adrenal-intact animals within the time frame and concentration range of the hormone's effects on electrolyte transport

Anelastic spherical dynamos with radially variable electrical conductivity

Science.gov (United States)

Dietrich, W.; Jones, C. A.

2018-05-01

A series of numerical simulations of the dynamo process operating inside gas giant planets has been performed. We use an anelastic, fully nonlinear, three-dimensional, benchmarked MHD code to evolve the flow, entropy and magnetic field. Our models take into account the varying electrical conductivity, high in the ionised metallic hydrogen region, low in the molecular outer region. Our suite of electrical conductivity profiles ranges from Jupiter-like, where the outer hydrodynamic region is quite thin, to Saturn-like, where there is a thick non-conducting shell. The rapid rotation leads to the formation of two distinct dynamical regimes which are separated by a magnetic tangent cylinder - mTC. Outside the mTC there are strong zonal flows, where Reynolds stress balances turbulent viscosity, but inside the mTC Lorentz force reduces the zonal flow. The dynamic interaction between both regions induces meridional circulation. We find a rich diversity of magnetic field morphologies. There are Jupiter-like steady dipolar fields, and a belt of quadrupolar dominated dynamos spanning the range of models between Jupiter-like and Saturn-like conductivity profiles. This diversity may be linked to the appearance of reversed sign helicity in the metallic regions of our dynamos. With Saturn-like conductivity profiles we find models with dipolar magnetic fields, whose axisymmetric components resemble those of Saturn, and which oscillate on a very long time-scale. However, the non-axisymmetric field components of our models are at least ten times larger than those of Saturn, possibly due to the absence of any stably stratified layer.

The effect of culture density and proliferation rate on the expression of ouabain-sensitive Na/K ATPase pumps in cultured human retinal pigment epithelium

Energy Technology Data Exchange (ETDEWEB)

Burke, J.M.; Jaffe, G.J.; Brzeski, C.M. (Medical College of Wisconsin, Milwaukee (USA))

1991-06-01

The number and activity of ouabain-sensitive Na/K ATPase pumps expressed by many cell types in vitro, including human retinal pigment epithelial cells (RPE), have been shown to decline with increasing culture density. Cell proliferation also declined as cultures became dense so it was unclear if pump number was modulated by cell proliferation or culture confluency. By exposing RPE cultures to various feeding regimens, using culture medium containing or lacking serum, it was possible to produce RPE cultures with a range of culture densities and growth rates. These were analyzed for proliferative activity by quantifying ({sup 3}H)thymidine incorporation and for Na/K ATPase pump number by measuring specific ({sup 3}H)ouabain binding. The results suggest that pump number is modulated by culture density and, further, that the density-dependent regulation of pump number requires serum. Although density-dependent modulation of culture growth is also serum requiring, cell proliferation and pump number did not appear to be related; cultures of similar density which differed significantly in growth rate had similar numbers of pumps. The view that elevated numbers of pumps were not necessarily found in proliferating cells was further supported by qualitative examination of radioautographs of cells dually labeled with ({sup 3}H)thymidine and ({sup 3}H)ouabain. Cycling cells which had ({sup 3}H)thymidine-labeled nuclei did not have notably higher labeling with ({sup 3}H)ouabain. However, ({sup 3}H)ouabain labeling, as an indicator of pump site number and distribution, did vary among cells in an RPE population and also within individual cells. This latter observation suggests that unpolarized RPE cells in sparse cultures may have regionally different requirements for ionic regulation.

Extracting Archaeological Feautres from GPR Surveys Conducted with Variable Soil Moisture Conditions

Science.gov (United States)

Morris, I. M.; Glisic, B.; Gonciar, A.

2017-12-01

As a common tool for subsurface archaeological prospection, ground penetrating radar (GPR) is a useful method for increasing the efficiency of archaeological excavations. Archaeological sites are often temporally and financially constrained, therefore having limited ability to reschedule surveys compromised by weather. Furthermore, electromagnetic GPR surveys are especially sensitive to variations in water content, soil type, and site-specific interference. In this work, GPR scans of a partially excavated Roman villa consisting of different construction materials and phases (limestone, andesite, brick) in central Romania are compared. Surveys were conducted with a 500 MHz GPR antenna in both dry (pre-rain event) and wet (post-rain event) conditions. Especially in time or depth slices, wet surveys present additional archaeological features that are not present or clear in the standard dry conditions, while simultaneously masking the clutter present in those scans. When dry, the limestone has a similar dielectric constant to the soil and does not provide enough contrast in electromagnetic properties for strong reflections despite the significant difference in their physical properties. Following precipitation, however, the electromagnetic properties of these two materials is dominated by their respective water content and the contrast is enhanced. For this reason, the wet surveys are particularly necessary for revealing reflections from the limestone features often invisible in dry surveys. GPR surveys conducted in variable environmental conditions provide unique archaeological information, with potential near-surface geophysical applications in nondestructive material characterization and identification.

Post-Irradiation Examination of Fuel Pin R54-F20A, Irradiated in a NaK Environment. RCN Report

International Nuclear Information System (INIS)

Kwast, H.

1972-12-01

Fuel pin R54-F20A has been irradiated in a NaK-environment. Temperature measurements in the NaK were carried out at average linear fission powers of 552 and 825 W/cm respectively. A maximum average canning temperature of 920°C was reached. The fuel pin was irradiated for about 50 minutes at the maximum irradiation conditions, while the total irradiation time was two hours. The irradiation had to be broken off before the end condition was reached because of malfunctioning of the fuelfailure detection system. No power peaking did occur at the upper and lower interfaces between the 50%-enriched UO 2 - and the natural UO 2 + 8 w/o UB 4 pellet. About 35% of the fuel has molten, but the fuel pin did not fail. The irradiation has been carried out in the Poolside Facility (PSF) of the High Flux Reactor (HFR) at Petten. (author)

Na(+)/K(+) pump interacts with the h-current to control bursting activity in central pattern generator neurons of leeches.

Science.gov (United States)

Kueh, Daniel; Barnett, William H; Cymbalyuk, Gennady S; Calabrese, Ronald L

2016-09-02

The dynamics of different ionic currents shape the bursting activity of neurons and networks that control motor output. Despite being ubiquitous in all animal cells, the contribution of the Na(+)/K(+) pump current to such bursting activity has not been well studied. We used monensin, a Na(+)/H(+) antiporter, to examine the role of the pump on the bursting activity of oscillator heart interneurons in leeches. When we stimulated the pump with monensin, the period of these neurons decreased significantly, an effect that was prevented or reversed when the h-current was blocked by Cs(+). The decreased period could also occur if the pump was inhibited with strophanthidin or K(+)-free saline. Our monensin results were reproduced in model, which explains the pump's contributions to bursting activity based on Na(+) dynamics. Our results indicate that a dynamically oscillating pump current that interacts with the h-current can regulate the bursting activity of neurons and networks.

Unsteady Flow of Reactive Viscous, Heat Generating/Absorbing Fluid with Soret and Variable Thermal Conductivity

Directory of Open Access Journals (Sweden)

I. J. Uwanta

2014-01-01

Full Text Available This study investigates the unsteady natural convection and mass transfer flow of viscous reactive, heat generating/absorbing fluid in a vertical channel formed by two infinite parallel porous plates having temperature dependent thermal conductivity. The motion of the fluid is induced due to natural convection caused by the reactive property as well as the heat generating/absorbing nature of the fluid. The solutions for unsteady state temperature, concentration, and velocity fields are obtained using semi-implicit finite difference schemes. Perturbation techniques are used to get steady state expressions of velocity, concentration, temperature, skin friction, Nusselt number, and Sherwood number. The effects of various flow parameters such as suction/injection (γ, heat source/sinks (S, Soret number (Sr, variable thermal conductivity δ, Frank-Kamenetskii parameter λ, Prandtl number (Pr, and nondimensional time t on the dynamics are analyzed. The skin friction, heat transfer coefficients, and Sherwood number are graphically presented for a range of values of the said parameters.

Spatial variability in streambed hydraulic conductivity of contrasting stream morphologies

DEFF Research Database (Denmark)

Sebök, Éva; Calvache, Carlos Duque; Engesgaard, Peter Knudegaard

2015-01-01

inner bend of the stream, whereas high Kv values were observed at the erosional outer bend and near the middle of the channel. Calculated Kv values were related to the thickness of the organic streambed sediment layer and also showed higher temporal variability than Kh because of sedimentation...... small-scale measurements were taken in December 2011 and August 2012, both in a straight stream channel with homogeneous elevation and downstream of a channel meander with heterogeneous elevation. All streambed attributes showed large spatial variability. Kh values were the highest at the depositional...... and scouring processes affecting the upper layers of the streambed. Test locations at the channel bend showed a more heterogeneous distribution of streambed properties than test locations in the straight channel, whereas within the channel bend, higher spatial variability in streambed attributes was observed...

Canonical Bcl-2 motifs of the Na+/K+ pump revealed by the BH3 mimetic chelerythrine: early signal transducers of apoptosis?

Science.gov (United States)

Lauf, Peter K; Heiny, Judith; Meller, Jarek; Lepera, Michael A; Koikov, Leonid; Alter, Gerald M; Brown, Thomas L; Adragna, Norma C

2013-01-01

Chelerythrine [CET], a protein kinase C [PKC] inhibitor, is a prop-apoptotic BH3-mimetic binding to BH1-like motifs of Bcl-2 proteins. CET action was examined on PKC phosphorylation-dependent membrane transporters (Na+/K+ pump/ATPase [NKP, NKA], Na+-K+-2Cl+ [NKCC] and K+-Cl- [KCC] cotransporters, and channel-supported K+ loss) in human lens epithelial cells [LECs]. K+ loss and K+ uptake, using Rb+ as congener, were measured by atomic absorption/emission spectrophotometry with NKP and NKCC inhibitors, and Cl- replacement by NO3ˉ to determine KCC. 3H-Ouabain binding was performed on a pig renal NKA in the presence and absence of CET. Bcl-2 protein and NKA sequences were aligned and motifs identified and mapped using PROSITE in conjunction with BLAST alignments and analysis of conservation and structural similarity based on prediction of secondary and crystal structures. CET inhibited NKP and NKCC by >90% (IC50 values ~35 and ~15 μM, respectively) without significant KCC activity change, and stimulated K+ loss by ~35% at 10-30 μM. Neither ATP levels nor phosphorylation of the NKA α1 subunit changed. 3H-ouabain was displaced from pig renal NKA only at 100 fold higher CET concentrations than the ligand. Sequence alignments of NKA with BH1- and BH3-like motifs containing pro-survival Bcl-2 and BclXl proteins showed more than one BH1-like motif within NKA for interaction with CET or with BH3 motifs. One NKA BH1-like motif (ARAAEILARDGPN) was also found in all P-type ATPases. Also, NKA possessed a second motif similar to that near the BH3 region of Bcl-2. Findings support the hypothesis that CET inhibits NKP by binding to BH1-like motifs and disrupting the α1 subunit catalytic activity through conformational changes. By interacting with Bcl-2 proteins through their complementary BH1- or BH3-like-motifs, NKP proteins may be sensors of normal and pathological cell functions, becoming important yet unrecognized signal transducers in the initial phases of apoptosis. CET

effective hydraulic conductivity for a soil of variable pore size

African Journals Online (AJOL)

eobe

Keywords: hydraulic conductivity, soil, infiltration, permeability, water. 1. INTRODUCTION. INTRODUCTION. INTRODUCTION. Accurate determination of hydraulic conductivity is very crucial for infiltration and runoff estimation. Factors which affect water infiltration in the soil include hydraulic conductivity, wetting front and soil.

Na+/K+ pump interacts with the h-current to control bursting activity in central pattern generator neurons of leeches

Science.gov (United States)

Kueh, Daniel; Barnett, William H; Cymbalyuk, Gennady S; Calabrese, Ronald L

2016-01-01

The dynamics of different ionic currents shape the bursting activity of neurons and networks that control motor output. Despite being ubiquitous in all animal cells, the contribution of the Na+/K+ pump current to such bursting activity has not been well studied. We used monensin, a Na+/H+ antiporter, to examine the role of the pump on the bursting activity of oscillator heart interneurons in leeches. When we stimulated the pump with monensin, the period of these neurons decreased significantly, an effect that was prevented or reversed when the h-current was blocked by Cs+. The decreased period could also occur if the pump was inhibited with strophanthidin or K+-free saline. Our monensin results were reproduced in model, which explains the pump’s contributions to bursting activity based on Na+ dynamics. Our results indicate that a dynamically oscillating pump current that interacts with the h-current can regulate the bursting activity of neurons and networks. DOI: http://dx.doi.org/10.7554/eLife.19322.001 PMID:27588351

Variability in mesophyll conductance between barley genotypes, and effects on transpiration efficiency and carbon isotope discrimination.

Science.gov (United States)

Barbour, Margaret M; Warren, Charles R; Farquhar, Graham D; Forrester, Guy; Brown, Hamish

2010-07-01

Leaf internal, or mesophyll, conductance to CO(2) (g(m)) is a significant and variable limitation of photosynthesis that also affects leaf transpiration efficiency (TE). Genotypic variation in g(m) and the effect of g(m) on TE were assessed in six barley genotypes (four Hordeum vulgare and two H. bulbosum). Significant variation in g(m) was found between genotypes, and was correlated with photosynthetic rate. The genotype with the highest g(m) also had the highest TE and the lowest carbon isotope discrimination as recorded in leaf tissue (Delta(p)). These results suggest g(m) has unexplored potential to provide TE improvement within crop breeding programmes.

A method for estimating spatially variable seepage and hydrualic conductivity in channels with very mild slopes

Science.gov (United States)

Shanafield, Margaret; Niswonger, Richard G.; Prudic, David E.; Pohll, Greg; Susfalk, Richard; Panday, Sorab

2014-01-01

Infiltration along ephemeral channels plays an important role in groundwater recharge in arid regions. A model is presented for estimating spatial variability of seepage due to streambed heterogeneity along channels based on measurements of streamflow-front velocities in initially dry channels. The diffusion-wave approximation to the Saint-Venant equations, coupled with Philip's equation for infiltration, is connected to the groundwater model MODFLOW and is calibrated by adjusting the saturated hydraulic conductivity of the channel bed. The model is applied to portions of two large water delivery canals, which serve as proxies for natural ephemeral streams. Estimated seepage rates compare well with previously published values. Possible sources of error stem from uncertainty in Manning's roughness coefficients, soil hydraulic properties and channel geometry. Model performance would be most improved through more frequent longitudinal estimates of channel geometry and thalweg elevation, and with measurements of stream stage over time to constrain wave timing and shape. This model is a potentially valuable tool for estimating spatial variability in longitudinal seepage along intermittent and ephemeral channels over a wide range of bed slopes and the influence of seepage rates on groundwater levels.

Canonical Bcl-2 Motifs of the Na+/K+ Pump Revealed by the BH3 Mimetic Chelerythrine: Early Signal Transducers of Apoptosis?

Directory of Open Access Journals (Sweden)

Peter K. Lauf

2013-02-01

Full Text Available Background/Aims: Chelerythrine [CET], a protein kinase C [PKC] inhibitor, is a prop-apoptotic BH3-mimetic binding to BH1-like motifs of Bcl-2 proteins. CET action was examined on PKC phosphorylation-dependent membrane transporters (Na+/K+ pump/ATPase [NKP, NKA], Na+-K+-2Cl+ [NKCC] and K+-Cl- [KCC] cotransporters, and channel-supported K+ loss in human lens epithelial cells [LECs]. Methods: K+ loss and K+ uptake, using Rb+ as congener, were measured by atomic absorption/emission spectrophotometry with NKP and NKCC inhibitors, and Cl- replacement by NO3ˉ to determine KCC. 3H-Ouabain binding was performed on a pig renal NKA in the presence and absence of CET. Bcl-2 protein and NKA sequences were aligned and motifs identified and mapped using PROSITE in conjunction with BLAST alignments and analysis of conservation and structural similarity based on prediction of secondary and crystal structures. Results: CET inhibited NKP and NKCC by >90% (IC50 values ∼35 and ∼15 µM, respectively without significant KCC activity change, and stimulated K+ loss by ∼35% at 10-30 µM. Neither ATP levels nor phosphorylation of the NKA α1 subunit changed. 3H-ouabain was displaced from pig renal NKA only at 100 fold higher CET concentrations than the ligand. Sequence alignments of NKA with BH1- and BH3-like motifs containing pro-survival Bcl-2 and BclXl proteins showed more than one BH1-like motif within NKA for interaction with CET or with BH3 motifs. One NKA BH1-like motif (ARAAEILARDGPN was also found in all P-type ATPases. Also, NKA possessed a second motif similar to that near the BH3 region of Bcl-2. Conclusion: Findings support the hypothesis that CET inhibits NKP by binding to BH1-like motifs and disrupting the α1 subunit catalytic activity through conformational changes. By interacting with Bcl-2 proteins through their complementary BH1- or BH3-like-motifs, NKP proteins may be sensors of normal and pathological cell functions, becoming important yet

The Role of Na:K:2Cl Cotransporter 1 (NKCC1/SLC12A2) in Dental Epithelium during Enamel Formation in Mice

Science.gov (United States)

Jalali, Rozita; Lodder, Johannes C.; Zandieh-Doulabi, Behrouz; Micha, Dimitra; Melvin, James E.; Catalan, Marcelo A.; Mansvelder, Huibert D.; DenBesten, Pamela; Bronckers, Antonius

2017-01-01

Na+:K+:2Cl− cotransporters (NKCCs) belong to the SLC12A family of cation-coupled Cl− transporters. We investigated whether enamel-producing mouse ameloblasts express NKCCs. Transcripts for Nkcc1 were identified in the mouse dental epithelium by RT-qPCR and NKCC1 protein was immunolocalized in outer enamel epithelium and in the papillary layer but not the ameloblast layer. In incisors of Nkcc1-null mice late maturation ameloblasts were disorganized, shorter and the mineral density of the enamel was reduced by 10% compared to wild-type controls. Protein levels of gap junction protein connexin 43, Na+-dependent bicarbonate cotransporter e1 (NBCe1), and the Cl−-dependent bicarbonate exchangers SLC26A3 and SLC26A6 were upregulated in Nkcc1-null enamel organs while the level of NCKX4/SLC24A4, the major K+, Na+ dependent Ca2+ transporter in maturation ameloblasts, was slightly downregulated. Whole-cell voltage clamp studies on rat ameloblast-like HAT-7 cells indicated that bumetanide increased ion-channel activity conducting outward currents. Bumetanide also reduced cell volume of HAT-7 cells. We concluded that non-ameloblast dental epithelium expresses NKCC1 to regulate cell volume in enamel organ and provide ameloblasts with Na+, K+ and Cl− ions required for the transport of mineral- and bicarbonate-ions into enamel. Absence of functional Nkcc1 likely is compensated by other types of ion channels and ion transporters. The increased amount of Cx43 in enamel organ cells in Nkcc1-null mice suggests that these cells display a higher number of gap junctions to increase intercellular communication. PMID:29209227

Low temperature resistivity studies of SmB6: Observation of two-dimensional variable-range hopping conductivity

Science.gov (United States)

Batkova, Marianna; Batko, Ivan; Gabáni, Slavomír; Gažo, Emil; Konovalova, Elena; Filippov, Vladimir

2018-05-01

We studied electrical resistance of a single-crystalline SmB6 sample with a focus on the region of the "low-temperature resistivity plateau". Our observations did not show any true saturation of the electrical resistance at temperatures below 3 K down to 70 mK. According to our findings, temperature dependence of the electrical conduction in a certain temperature interval above 70 mK can be decomposed into a temperature-independent term and a temperature-activated term that can be described by variable-range hopping formula for two-dimensional systems, exp [ -(T0 / T) 1 / 3 ]. Thus, our results indicate importance of hopping type of electrical transport in the near-surface region of SmB6.

Electrical conductivity study on polythiophenes films

International Nuclear Information System (INIS)

Youm, I.; Cadene, M.

1994-10-01

The electrical conduction mechanism of two classes of polythiophenes: polythiophene (PT) and poly(3-methylthiophene) (PMT) films containing various levels of doping counter-ions was investigated. The temperature dependence of electrical conductivity obeys the Mott equation based on variable range hopping. The dimension of the variable range hopping is correlated with the structure of the conducting polymer. It seems for these polymers that carrier transport via mobile conjugational defects does not play a detectable role. (author). 17 refs, 3 figs, 1 tab

Muscle conduction velocity, surface electromyography variables, and echo intensity during concentric and eccentric fatigue.

Science.gov (United States)

Gonzalez-Izal, Miriam; Lusa Cadore, Eduardo; Izquierdo, Mikel

2014-03-01

Concentric (CON) and eccentric (ECC) contractions may involve different mechanisms related to changes in sarcolemma status and the consequent alteration of action potential transmission along muscle fibers. Muscle conduction velocity (CV), surface electromyography signal (sEMG), muscle quality, and blood lactate concentrations were analyzed during CON and ECC actions. Compared with ECC, the CON protocol resulted in greater muscle force losses, blood lactate concentrations, and changes in sEMG parameters. Similar reductions in CV were detected in both protocols. Higher echo intensity values were observed 2 days after ECC due to greater muscle damage. The effects of the muscle damage produced by ECC exercise on the transmission of action potentials along muscle fibers (measured as the CV) may be comparable with the effects of hydrogen accumulation produced by CON exercise (related to greater lactate concentrations), which causes greater force loss and change in other sEMG variables during CON than during ECC actions.

Characterization of meter-scale spatial variability of riverbed hydraulic conductivity in a lowland river (Aa River, Belgium)

Science.gov (United States)

Ghysels, Gert; Benoit, Sien; Awol, Henock; Jensen, Evan Patrick; Debele Tolche, Abebe; Anibas, Christian; Huysmans, Marijke

2018-04-01

An improved general understanding of riverbed heterogeneity is of importance for all groundwater modeling studies that include river-aquifer interaction processes. Riverbed hydraulic conductivity (K) is one of the main factors controlling river-aquifer exchange fluxes. However, the meter-scale spatial variability of riverbed K has not been adequately mapped as of yet. This study aims to fill this void by combining an extensive field measurement campaign focusing on both horizontal and vertical riverbed K with a detailed geostatistical analysis of the meter-scale spatial variability of riverbed K . In total, 220 slug tests and 45 standpipe tests were performed at two test sites along the Belgian Aa River. Omnidirectional and directional variograms (along and across the river) were calculated. Both horizontal and vertical riverbed K vary over several orders of magnitude and show significant meter-scale spatial variation. Horizontal K shows a bimodal distribution. Elongated zones of high horizontal K along the river course are observed at both sections, indicating a link between riverbed structures, depositional environment and flow regime. Vertical K is lognormally distributed and its spatial variability is mainly governed by the presence and thickness of a low permeable organic layer at the top of the riverbed. The absence of this layer in the center of the river leads to high vertical K and is related to scouring of the riverbed by high discharge events. Variograms of both horizontal and vertical K show a clear directional anisotropy with ranges along the river being twice as large as those across the river.

Optimization of Process Variables for Insulation Coating of Conductive Particles by Response Surface Methodology

International Nuclear Information System (INIS)

Sim, Chol-Ho

2016-01-01

The powder core, conventionally fabricated from iron particles coated with insulator, showed large eddy current loss under high frequency, because of small specific resistance. To overcome the eddy current loss, the increase in the specific resistance of powder cores was needed. In this study, copper oxide coating onto electrically conductive iron particles was performed using a planetary ball mill to increase the specific resistance. Coating factors were optimized by the Response surface methodology. The independent variables were the CuO mass fraction, mill revolution number, coating time, ball size, ball mass and sample mass. The response variable was the specific resistance. The optimization of six factors by the fractional factorial design indicated that CuO mass fraction, mill revolution number, and coating time were the key factors. The levels of these three factors were selected by the three-factors full factorial design and steepest ascent method. The steepest ascent method was used to approach the optimum range for maximum specific resistance. The Box-Behnken design was finally used to analyze the response surfaces of the screened factors for further optimization. The results of the Box-Behnken design showed that the CuO mass fraction and mill revolution number were the main factors affecting the efficiency of coating process. As the CuO mass fraction increased, the specific resistance increased. In contrast, the specific resistance increased with decreasing mill revolution number. The process optimization results revealed a high agreement between the experimental and the predicted data (Adj-R2=0.944). The optimized CuO mass fraction, mill revolution number, and coating time were 0.4, 200 rpm, and 15 min, respectively. The measured value of the specific resistance of the coated pellet under the optimized conditions of the maximum specific resistance was 530 kΩ·cm

Optimization of Process Variables for Insulation Coating of Conductive Particles by Response Surface Methodology

Energy Technology Data Exchange (ETDEWEB)

Sim, Chol-Ho [Sangji University, Wonju (Korea, Republic of)

2016-02-15

The powder core, conventionally fabricated from iron particles coated with insulator, showed large eddy current loss under high frequency, because of small specific resistance. To overcome the eddy current loss, the increase in the specific resistance of powder cores was needed. In this study, copper oxide coating onto electrically conductive iron particles was performed using a planetary ball mill to increase the specific resistance. Coating factors were optimized by the Response surface methodology. The independent variables were the CuO mass fraction, mill revolution number, coating time, ball size, ball mass and sample mass. The response variable was the specific resistance. The optimization of six factors by the fractional factorial design indicated that CuO mass fraction, mill revolution number, and coating time were the key factors. The levels of these three factors were selected by the three-factors full factorial design and steepest ascent method. The steepest ascent method was used to approach the optimum range for maximum specific resistance. The Box-Behnken design was finally used to analyze the response surfaces of the screened factors for further optimization. The results of the Box-Behnken design showed that the CuO mass fraction and mill revolution number were the main factors affecting the efficiency of coating process. As the CuO mass fraction increased, the specific resistance increased. In contrast, the specific resistance increased with decreasing mill revolution number. The process optimization results revealed a high agreement between the experimental and the predicted data (Adj-R2=0.944). The optimized CuO mass fraction, mill revolution number, and coating time were 0.4, 200 rpm, and 15 min, respectively. The measured value of the specific resistance of the coated pellet under the optimized conditions of the maximum specific resistance was 530 kΩ·cm.

Species-dependent adaptation of the cardiac Na+/K+ pump kinetics to the intracellular Na+ concentration.

Science.gov (United States)

Lewalle, Alexandre; Niederer, Steven A; Smith, Nicolas P

2014-12-15

The Na(+)/K(+) ATPase (NKA) plays a critical role in maintaining ionic homeostasis and dynamic function in cardiac myocytes, within both the in vivo cell and in silico models. Physiological conditions differ significantly between mammalian species. However, most existing formulations of NKA used to simulate cardiac function in computational models are derived from a broad range of experimental sources spanning many animal species. The resultant inability of these models to discern species-specific features is a significant obstacle to achieving a detailed quantitative and comparative understanding of physiological behaviour in different biological contexts. Here we present a framework for characterising the steady-state NKA current using a biophysical mechanistic model specifically designed to provide a mechanistic explanation of the NKA flux supported by self-consistent species-specific data. We thus compared NKA kinetics specific to guinea- pig and rat ventricular myocytes. We observe that the apparent binding affinity for sodium in the rat is significantly lower, whereas the overall pump cycle rate is doubled, in comparison to the guinea pig. This sensitivity of NKA to its regulatory substrates compensates for the differences in Na(+) concentrations between the cell types. NKA is thereby maintained within its dynamic range over a wide range of pacing frequencies in these two species, despite significant disparities in sodium concentration. Hence, by replacing a conventional generic NKA model with our rat-specific NKA formula into a whole-cell simulation, we have, for the first time, been able to accurately reproduce the action potential duration and the steady-state sodium concentration as functions of pacing frequency. © 2014 The Authors. The Journal of Physiology © 2014 The Physiological Society.

Variability in emotional/behavioral problems in boys with oppositional defiant disorder or conduct disorder: the role of arousal.

Science.gov (United States)

Schoorl, Jantiene; Van Rijn, Sophie; De Wied, Minet; Van Goozen, Stephanie H M; Swaab, Hanna

2016-08-01

It is often reported that children with oppositional defiant disorder (ODD) or conduct disorder (CD) are under-aroused. However, the evidence is mixed, with some children with ODD/CD displaying high arousal. This has led to the hypothesis that different profiles of arousal dysfunction may exist within children with ODD/CD. This knowledge could explain variability within children with ODD/CD, both in terms of specific types of aggression as well as comorbid symptoms (e.g., other emotional/behavioral problems). We measured heart rate variability (HRV), heart rate (HR) and skin conductance level (SCL) during rest and stress, and obtained parent and teacher reports of aggression, anxiety, attention problems and autism traits in a sample of 66 ODD/CD and 36 non-clinical boys (aged 8-12 years). The ODD/CD group scored significantly higher on aggression, anxiety, attention problems and autism traits than the controls; boys with ODD/CD also had higher resting HRs than controls, but HR stress, HRV and SCL did not differ. Hierarchical regressions showed different physiological profiles in subgroups of boys with ODD/CD based on their type of aggression; a pattern of high baseline HR and SCL, but low stress HRV was related to reactive aggression, whereas the opposite physiological pattern (low HR, low stress SCL, high stress HRV) was related to proactive aggression. Furthermore, high stress SCL was related to anxiety symptoms, whereas low stress SCL was related to attention problems. These findings are important because they indicate heterogeneity within boys with ODD/CD and highlight the importance of using physiology to differentiate boys with different ODD/CD subtypes.

Variable-spot ion beam figuring

International Nuclear Information System (INIS)

Wu, Lixiang; Qiu, Keqiang; Fu, Shaojun

2016-01-01

This paper introduces a new scheme of ion beam figuring (IBF), or rather variable-spot IBF, which is conducted at a constant scanning velocity with variable-spot ion beam collimated by a variable diaphragm. It aims at improving the reachability and adaptation of the figuring process within the limits of machine dynamics by varying the ion beam spot size instead of the scanning velocity. In contrast to the dwell time algorithm in the conventional IBF, the variable-spot IBF adopts a new algorithm, which consists of the scan path programming and the trajectory optimization using pattern search. In this algorithm, instead of the dwell time, a new concept, integral etching time, is proposed to interpret the process of variable-spot IBF. We conducted simulations to verify its feasibility and practicality. The simulation results indicate the variable-spot IBF is a promising alternative to the conventional approach.

Boiling on fins with wire screen of variable effective conductivity

Directory of Open Access Journals (Sweden)

Orzechowski Tadeusz

2017-01-01

Full Text Available The high scale of integration of modern equipment used for medical, military and other purposes puts heavy demands as regards the removal of great heat fluxes. This can be achieved only in exchangers that apply the phase change phenomena. Among many methods to improve boiling heat transfer, the wire mesh covering demonstrates some advantages due to the possibilities of designing the desired microstructure parameters, availability on the market, and low cost. The wire mesh microstucture with specified geometrical parameters produces anisotropy in conductivity. The different arrangement of the mesh layers relative to the direction of the heat flux is a cause of the change of temperature distribution within the layer. The consequence is a respective change in the discharge conditions of the gas phase and liquid feed. The experiments were conducted on fins covered with a single layer of copper mesh with lumen of 38 % and boiling FC-72 at ambient pressure. Compared with the smooth surface, the wire mesh structures yield an increase in the heat transfer rate at boiling. It is also shown that nucleate boiling is initiated at lower wall superheat. Formulas for longitudinal and perpendicular thermal conductivity are given for different mesh structure arrangements.

Alzheimer's Toxic Amyloid Beta Oligomers: Unwelcome Visitors to the Na/K ATPase alpha3 Docking Station.

Science.gov (United States)

DiChiara, Thomas; DiNunno, Nadia; Clark, Jeffrey; Bu, Riana Lo; Cline, Erika N; Rollins, Madeline G; Gong, Yuesong; Brody, David L; Sligar, Stephen G; Velasco, Pauline T; Viola, Kirsten L; Klein, William L

2017-03-01

Toxic amyloid beta oligomers (AβOs) are known to accumulate in Alzheimer's disease (AD) and in animal models of AD. Their structure is heterogeneous, and they are found in both intracellular and extracellular milieu. When given to CNS cultures or injected ICV into non-human primates and other non-transgenic animals, AβOs have been found to cause impaired synaptic plasticity, loss of memory function, tau hyperphosphorylation and tangle formation, synapse elimination, oxidative and ER stress, inflammatory microglial activation, and selective nerve cell death. Memory loss and pathology in transgenic models are prevented by AβO antibodies, while Aducanumab, an antibody that targets AβOs as well as fibrillar Aβ, has provided cognitive benefit to humans in early clinical trials. AβOs have now been investigated in more than 3000 studies and are widely thought to be the major toxic form of Aβ. Although much has been learned about the downstream mechanisms of AβO action, a major gap concerns the earliest steps: How do AβOs initially interact with surface membranes to generate neuron-damaging transmembrane events? Findings from Ohnishi et al (PNAS 2005) combined with new results presented here are consistent with the hypothesis that AβOs act as neurotoxins because they attach to particular membrane protein docks containing Na/K ATPase-α3, where they inhibit ATPase activity and pathologically restructure dock composition and topology in a manner leading to excessive Ca++ build-up. Better understanding of the mechanism that makes attachment of AβOs to vulnerable neurons a neurotoxic phenomenon should open the door to therapeutics and diagnostics targeting the first step of a complex pathway that leads to neural damage and dementia.

Dietary sodium and potassium intake were associated with hypertension, kidney damage and adverse perinatal outcome in pregnant women with preeclampsia.

Science.gov (United States)

Yılmaz, Zehra Vural; Akkaş, Elif; Türkmen, Gülenay Gençosmanoğlu; Kara, Özgür; Yücel, Aykan; Uygur, Dilek

2017-02-01

In this study, we hypothesized that dietary salt and potassium intake may be related with blood pressure, kidney damage and perinatal outcome in pregnants with preeclampsia (PE). In total, 200 women (50 control women with healthy pregnancy, 150 women with PE) were recruited for the study. Daily salt and potassium intake was estimated based on calculation of 24-hour urinary sodium U[Na+] and potassium U[K+] excretion. U[Na+]/[K+] was calculated by dividing U[Na+] by U[K+]. At the end of the measurements, the pregnant women with PE (n=150) were divided into tertiles according to U[Na+]/[K+]: low Na/K group (n=50, mean U[Na+]/[K+]: 1,04±0,32), medium Na/K group (n=50, mean U[Na+]/[K+]: 2,49± 0,54), high Na/K group (n=50, mean U[Na+]/[K+]: 6,62±3,41). The mean SBP and DBP levels were significantly lower in low Na/K group compared with medium or high Na/K groups (p=0.024, p=0.0002; respectively). Serum creatinine was significantly lower in low Na/K group than high Na/K group (p=0.025). Frequency of severe preeclampsia is lower in low Na/K group than medium or high Na/K groups (p=0.002, p=0.0001; respectively). Birth weight and gestational age at birth were higher in low Na/K group compared with high Na/K group (p=0.045, p=0.0002; respectively). After adjusting for covariates, SBP and DBP and creatinine levels were independently associated with 24 hours urinary [Na+]/[K+] Conclusion: These findings suggest that pregnant with PE with high dietary salt and low potassium intake may have greater maternal and neonatal morbidity risk than pregnant with PE under low dietary salt and high potassium intake.

Changes in antioxidant status, protein concentration, acetylcholinesterase, (Na+,K+)-, and Mg2+ -ATPase activities in the brain of hyper- and hypothyroid adult rats.

Science.gov (United States)

Carageorgiou, Haris; Pantos, Constantinos; Zarros, Apostolos; Mourouzis, Iordanis; Varonos, Dennis; Cokkinos, Dennis; Tsakiris, Stylianos

2005-06-01

It is a common knowledge that metabolic reactions increase in hyperthyroidism and decrease in hypothyroidism. The aim of this work was to investigate how the metabolic reactions could affect the total antioxidant status (TAS), protein concentration (PC) and the activities of acetylcholinesterase (AChE), (Na+,K+)-ATPase and Mg2+ -ATPase in the brain of hyper- and hypothyroid adult male rats. Hyperthyroidism was induced in rats by subcutaneous administration of thyroxine (25 microg/l00 g body weight) once daily for 14 days, while hypothyroidism was induced by oral administration of propylthiouracil (0.05%) for 21 days. TAS, PC, and enzyme activities were evaluated spectrophotometrically in the homogenated brain of each animal. TAS, PC, and Mg2+ -ATPase activity were found unaffected in hyperthyroidism, while AChE and Na+,K+ -ATPase activities were reduced by 25% (p activities were found to be increased (approx. 23-30%, p activity and PC were shown to be inhibited (approx. 23-30%, p activities may reflect the different metabolic effects of hyper- and hypothyroidism. Such changes of the enzyme activities may differentially modulate the brain intracellular Mg2+, neural excitability, as well as the uptake and release of biogenic amines.

Psychosocial profiles of Irish children with conduct disorders, mixed disorders of conduct and emotion and emotional disorders

OpenAIRE

Byrne, Jacqueline; Carr, Alan

1995-01-01

This paper reports on a retrospective archival study. Forty-one conduct disorder cases, 20 cases with mixed disorders of conduct and emotions and 23 emotional disorder cases were compared on demographic, behavioural and contextual variables. The pattern of treatment received by each group and their therapeutic outcomes were also compared. The three groups had similar demographic characteristics but distinctive psychosocial profiles. Conduct disordered cases showed a predominance of covert beh...

Molecular beam study of the a 3Σ+ state of NaK up to the dissociation limit

Science.gov (United States)

Temelkov, I.; Knöckel, H.; Pashov, A.; Tiemann, E.

2015-03-01

We provide spectroscopic data for the a 3Σ+ state of the 23Na39K molecule. The experiment is done in an ultrasonic beam apparatus, starting from the ground state X 1Σ+and driving the population to the a 3Σ+ state, using a Λ scheme with fixed pump and scanning dump laser. The signals are observed as dips of the total fluorescence. The intermediate level is chosen to be strongly perturbed by the B 1Π/c 3Σ+ states mixing to overcome the singlet-triplet transfer prohibition. We observed highly resolved hyperfine spectra of various rovibrational levels of the a 3Σ+state from va=2 up to the highest vibrational levels for rotational quantum numbers Na=4 ,6 ,8 . By the typical experimental linewidth of 17 MHz, the vibrational dependence of the hyperfine splitting is clearly revealed for NaK. The absolute frequency measurements of the vibrational levels are used for improvement of the a 3Σ+ potential curve and of the derived scattering length of all natural isotope combinations. Applying the Λ scheme in the reverse direction can provide a pathway for efficient transfer of ultracold 23Na39K molecules from the Na(3 s )+K(4 s ) asymptote to the lowest levels of the ground state. We show spectra that couple the absolute ground state vX=0 ,J =0 with an appropriate intermediate state for direct realization of the reverse path. The refined theoretical model of the coupled excited states of the Na(3 s )+K(4 p ) asymptote allows predictions of efficient paths for 23Na40K ; one example is calculated.

Performance analysis and optimization of radiating fins with a step change in thickness and variable thermal conductivity by homotopy perturbation method

Science.gov (United States)

Arslanturk, Cihat

2011-02-01

Although tapered fins transfer more rate of heat per unit volume, they are not found in every practical application because of the difficulty in manufacturing and fabrications. Therefore, there is a scope to modify the geometry of a constant thickness fin in view of the less difficulty in manufacturing and fabrication as well as betterment of heat transfer rate per unit volume of the fin material. For the better utilization of fin material, it is proposed a modified geometry of new fin with a step change in thickness (SF) in the literature. In the present paper, the homotopy perturbation method has been used to evaluate the temperature distribution within the straight radiating fins with a step change in thickness and variable thermal conductivity. The temperature profile has an abrupt change in the temperature gradient where the step change in thickness occurs and thermal conductivity parameter describing the variation of thermal conductivity has an important role on the temperature profile and the heat transfer rate. The optimum geometry which maximizes the heat transfer rate for a given fin volume has been found. The derived condition of optimality gives an open choice to the designer.

Year long variability of ground electrical conductivity in the sandy ...

African Journals Online (AJOL)

Ground electrical conductivity was measured continuously on a soil type in Nigeria for one year using the Model R-50 Soil Test Resistivity Meter Equipment. The Wenner arrangement of electrodes, which is one of the probe methods of ground resistivity measurement, was employed for the measurement. About 67% of all ...

Numerical study of different conduction models for Al_2O_3-water nanofluid with variable properties inside a trapezoidal enclosure

International Nuclear Information System (INIS)

Arani, Ali Akbar Abbasian; Azemati, Ali Akbar; Rezaee, Mohammad; Hadavand, Behzad Shirkavand

2017-01-01

Natural convection in enclosures containing nanofluids is important in physical and environmental applications. Different models for conduction have been developed because of the importance of this phenomenon in natural convection in enclosures. In this study, effects of conduction models of Chon, Corcione, Khanafer, and Koo and Kleinstreuer on the natural convection inside a trapezoidal enclosure with hot and cold walls are evaluated numerically. The enclosure contains Al_2O_3-water nanofluid with variable properties. Effects of the conduction models on fluid flow, natural convection, variations in volume fraction, and diameter of nanoparticles in the models, as well as the variations in the Rayleigh number, are examined. Results show that at Rayleigh numbers of 105 and 106, the maximum and minimum values of the average Nusselt number are obtained using the models of Khanafer and Chon, respectively. In all models, the average Nusselt number presents upward and downward trends when the volume fraction of nanoparticles increases but decreases when the di- ameter of the nanoparticles increases. At Ra = 105 in all models, as the volume fraction of nanoparticles increases, the nanofluid provides a higher average Nusselt number compared with the base fluid. By contrast, at Ra = 106, at volume fractions larger than 0.01 and using the model of Chon, the average Nusselt number of the nanofluid is lower compared with that of the base fluid.

Iron oxide nanoparticles to an Indian major carp, Labeo rohita: Impacts on hematology, iono regulation and gill Na+/K+ ATPase activity

Directory of Open Access Journals (Sweden)

Anand Sadanandan Remya

2015-04-01

Full Text Available In this study, the chronic toxicity effects of iron oxide (Fe2O3 nanoparticles (NPs (500 mg l−l on certain hematological, ionoregulatory and gill Na+/K+ ATPase activity of an Indian major carp, Labeo rohita were estimated for a period of 25 days under static bioassay. A significant increase in hemoglobin (Hb content, red blood cell (RBC count and hematocrit (Ht value was noticed throughout the study period when compared to control groups. In contrast, mean cellular volume (MCV, mean cellular hemoglobin (MCH (except on 5th day and mean cellular hemoglobin concentration (MCHC levels and white blood cell (WBC counts were found to be decreased during the above study period. Fe2O3 NPs also caused alterations in iono regulation resulting in hyponatremia (Na+, hypochloremia (Cl− (except on 5th day and hypokalemia (K+ (except up to 15th day. A biphasic trend in gill Na+/K+-ATPase activity was noticed during the above treatment period. Our results demonstrate that high Fe2O3 NP concentrations in the aquatic environment may have adverse physiological effects on fish. These data may be useful to assess the environmental risk posed by NPs. However the toxicity of various sizes of the nanoparticle could be evaluated using different aquatic organisms.

The Information Content of Financial and Economic Variables: Empirical Tests of Information Variables in Japan

OpenAIRE

Kengo Kato

1991-01-01

The main topic of this paper is "information variables" (or "indicators") of monetary policy, which work as criteria for setting the direction of monetary policy. After briefly surveying the notion and candidates of information variables, according to the studies mainly in the United States, empirical tests using Japan's data are conducted. It can be said that some information variables seem to be useful, but the results are mixed in general.

Functional classification of mitochondrion-rich cells in euryhaline Mozambique tilapia (Oreochromis mossambicus) embryos, by means of triple immunofluorescence staining for Na+/K+-ATPase, Na +/K+/2Cl- cotransporter and CFTR anion channel

Science.gov (United States)

Hiroi, J.; McCormick, S.D.; Ohtani-Kaneko, R.; Kaneko, T.

2005-01-01

Mozambique tilapia Oreochromis mossambicus embryos were transferred from freshwater to seawater and vice versa, and short-term changes in the localization of three major ion transport proteins, Na+/K +-ATPase, Na+/K+/2Cl- cotransporter (NKCC) and cystic fibrosis transmembrane conductance regulator (CFTR) were examined within mitochondrion-rich cells (MRCs) in the embryonic yolk-sac membrane. Triple-color immunofluorescence staining allowed us to classify MRCs into four types: type I, showing only basolateral Na+/K +-ATPase staining; type II, basolateral Na+/K +-ATPase and apical NKCC; type III, basolateral Na+/K +-ATPase and basolateral NKCC; type IV, basolateral Na +/K+-ATPase, basolateral NKCC and apical CFTR. In freshwater, type-I, type-II and type-III cells were observed. Following transfer from freshwater to seawater, type-IV cells appeared at 12 h and showed a remarkable increase in number between 24 h and 48 h, whereas type-III cells disappeared. When transferred from seawater back to freshwater, type-IV cells decreased and disappeared at 48 h, type-III cells increased, and type-II cells, which were not found in seawater, appeared at 12 h and increased in number thereafter. Type-I cells existed consistently irrespective of salinity changes. These results suggest that type I is an immature MRC, type II is a freshwater-type ion absorptive cell, type III is a dormant type-IV cell and/or an ion absorptive cell (with a different mechanism from type II), and type IV is a seawater-type ion secretory cell. The intracellular localization of the three ion transport proteins in type-IV cells is completely consistent with a widely accepted model for ion secretion by MRCs. A new model for ion absorption is proposed based on type-II cells possessing apical NKCC.

Differential expression of gill Na⁺,K⁺-ATPase alpha- and beta-subunits, Na⁺,K⁺,2Cl^- cotransporter and CFTR anion channel in juvenile anadromous and landlocked Atlantic salmon Salmo salar

DEFF Research Database (Denmark)

Nilsen, Tom O.; Ebbesson, Lars O. E.; Madsen, Steffen S.

2007-01-01

This study examines changes in gill Na(+),K(+)-ATPase (NKA) alpha- and beta-subunit isoforms, Na(+),K(+),2Cl(-) cotransporter (NKCC) and cystic fibrosis transmembrane conductance regulator (CFTR I and II) in anadromous and landlocked strains of Atlantic salmon during parr-smolt transformation, an...

State and location dependence of action potential metabolic cost in cortical pyramidal neurons

NARCIS (Netherlands)

Hallermann, Stefan; de Kock, Christiaan P. J.; Stuart, Greg J.; Kole, Maarten H. P.

2012-01-01

Action potential generation and conduction requires large quantities of energy to restore Na+ and K+ ion gradients. We investigated the subcellular location and voltage dependence of this metabolic cost in rat neocortical pyramidal neurons. Using Na+/K+ charge overlap as a measure of action

Sodium-NaK engineering handbook. Volume III. Sodium systems, safety, handling, and instrumentation. [LMFBR

Energy Technology Data Exchange (ETDEWEB)

Foust, O J [ed.

1978-01-01

The handbook is intended for use by present and future designers in the Liquid Metals Fast Breeder Reactor (LMFBR) Program and by the engineering and scientific community performing other type investigation and exprimentation requiring high-temperature sodium and NaK technology. The arrangement of subject matter progresses from a technological discussion of sodium and sodium--potassium alloy (NaK) to discussions of varius categories and uses of hardware in sodium and NaK systems. Emphasis is placed on sodium and NaK as heat-transport media. Sufficient detail is included for basic understanding of sodium and NaK technology and of technical aspects of sodium and NaK components and instrument systems. Information presented is considered adequate for use in feasibility studies and conceptual design, sizing components and systems, developing preliminary component and system descriptions, identifying technological limitations and problem areas, and defining basic constraints and parameters.

Estimating 24-h urinary sodium/potassium ratio from casual ('spot') urinary sodium/potassium ratio: the INTERSALT Study.

Science.gov (United States)

Iwahori, Toshiyuki; Miura, Katsuyuki; Ueshima, Hirotsugu; Chan, Queenie; Dyer, Alan R; Elliott, Paul; Stamler, Jeremiah

2017-10-01

Association between casual and 24-h urinary sodium-to-potassium (Na/K) ratio is well recognized, although it has not been validated in diverse demographic groups. Our aim was to assess utility across and within populations of casual urine to estimate 24-h urinary Na/K ratio using data from the INTERSALT Study. The INTERSALT Study collected cross-sectional standardized data on casual urinary sodium and potassium and also on timed 24-h urinary sodium and potassium for 10 065 individuals from 52 population samples in 32 countries (1985-87). Pearson correlation coefficients and agreement were computed for Na/K ratio of casual urine against 24-h urinary Na/K ratio both at population and individual levels. Pearson correlation coefficients relating means of 24-h urine and casual urine Na/K ratio were r = 0.96 and r = 0.69 in analyses across populations and individuals, respectively. Correlations of casual urine Na/creatinine and K/creatinine ratios with 24-h urinary Na and K excretion, respectively, were lower than correlation of casual and 24-h urinary Na/K ratio in analyses across populations and individuals. The bias estimate with the Bland-Altman method, defined as the difference between Na/K ratio of 24-h urine and casual urine, was approximately 0.4 across both populations and individuals. Spread around, the mean bias was higher for individuals than populations. With appropriate bias correction, casual urine Na/K ratio may be a useful, low-burden alternative method to 24-h urine for estimation of population urinary Na/K ratio. It may also be applicable for assessment of the urinary Na/K ratio of individuals, with use of repeated measurements to reduce measurement error and increase precision. © The Author 2016. Published by Oxford University Press on behalf of the International Epidemiological Association

Comparative study of Eyring and Carreau fluids in a suspension of dust and nickel nanoparticles with variable conductivity

Science.gov (United States)

Mamatha Upadhya, S.; Mahesha; Raju, C. S. K.

2018-04-01

A theoretical analysis is carried out to investigate the magnetohydrodynamic unsteady flow of Eyring-Powell and Carreau non-Newtonian fluids in a suspension of dust and nickel nanoparticles by considering variable thermal conductivity and thermal radiation. Dispersion of nickel nanoparticles in dusty fluids finds applications in heat exchanger systems, rechargeable batteries, chemical catalysts, metallurgy, conducting paints, magnetic recording media, drug delivery, nanofibers, textiles, etc. The initially arising set of physical governing partial differential equations is transformed to ordinary differential equations (ODEs) with the aid of similarity transformations. Consequentially, the nonlinear ODEs are solved numerically through the Runge-Kutta Fehlberg scheme (RKFS). The computational results for non-dimensional temperature and velocity profiles are presented through graphs. Furthermore, the numerical values of friction factor and heat transfer rate are tabulated numerically for the unsteady and steady cases of the Eyring and Carreau fluid cases and of the dusty non-Newtonian (φ=0) and the dusty non-Newtonian nanofluid (φ≠ 0) cases of the unsteady flow. We also validated the present results with previous published studies and found them to be highly satisfactory. The formulated model reveals that the rate of heat transfer is higher in the mixture of the nickel + Eyring-Powell case compared to the nickel + Carreau case. From this we can highlight that, depending on the industrial appliances, we can use heating or cooling processes for Eyring and Carreau fluids, respectively.

Molecular characterization of the α-subunit of Na⁺/K⁺ ATPase from the euryhaline barnacle Balanus improvisus reveals multiple genes and differential expression of alternative splice variants.

Directory of Open Access Journals (Sweden)

Ulrika Lind

Full Text Available The euryhaline bay barnacle Balanus improvisus has one of the broadest salinity tolerances of any barnacle species. It is able to complete its life cycle in salinities close to freshwater (3 PSU up to fully marine conditions (35 PSU and is regarded as one of few truly brackish-water species. Na⁺/K⁺ ATPase (NAK has been shown to be important for osmoregulation when marine organisms are challenged by changing salinities, and we therefore cloned and examined the expression of different NAKs from B. improvisus. We found two main gene variants, NAK1 and NAK2, which were approximately 70% identical at the protein level. The NAK1 mRNA existed in a long and short variant with the encoded proteins differing only by 27 N-terminal amino acids. This N-terminal stretch was coded for by a separate exon, and the two variants of NAK1 mRNAs appeared to be created by alternative splicing. We furthermore showed that the two NAK1 isoforms were differentially expressed in different life stages and in various tissues of adult barnacle, i.e the long isoform was predominant in cyprids and in adult cirri. In barnacle cyprid larvae that were exposed to a combination of different salinities and pCO2 levels, the expression of the long NAK1 mRNA increased relative to the short in low salinities. We suggest that the alternatively spliced long variant of the Nak1 protein might be of importance for osmoregulation in B. improvisus in low salinity conditions.

Scaling behavior and variable hopping conductivity in the quantum Hall plateau transition

International Nuclear Information System (INIS)

Tu, Tao; Zhao, Yong-Jie; Guo, Guo-Ping; Hao, Xiao-Jie; Guo, Guang-Can

2007-01-01

We have measured the temperature dependence of the longitudinal resistivity ρ xx of a two-dimensional electron system in the regime of the quantum Hall plateau transition. We extracted the quantitative form of scaling function for ρ xx and compared it with the results of ordinary scaling theory and variable range hopping based theory. We find that the two alternative theoretically proposed scaling functions are valid in different regions

Progress with variable cycle engines

Science.gov (United States)

Westmoreland, J. S.

1980-01-01

The evaluation of components of an advanced propulsion system for a future supersonic cruise vehicle is discussed. These components, a high performance duct burner for thrust augmentation and a low jet noise coannular exhaust nozzle, are part of the variable stream control engine. An experimental test program involving both isolated component and complete engine tests was conducted for the high performance, low emissions duct burner with excellent results. Nozzle model tests were completed which substantiate the inherent jet noise benefit associated with the unique velocity profile possible of a coannular exhaust nozzle system on a variable stream control engine. Additional nozzle model performance tests have established high thrust efficiency levels at takeoff and supersonic cruise for this nozzle system. Large scale testing of these two critical components is conducted using an F100 engine as the testbed for simulating the variable stream control engine.

A Variable Thermal Conductivity Flow of A Micropolar Fluid Over A ...

African Journals Online (AJOL)

We revisited the paper of Mahmoud et al, on the hydromagnetic boundary layer micropolar fluid flow over a stretching surface embedded in a non-Darcian porous medium with radiation.We show that even when the thermal conductivity depends linearly or quadratically on temperature the problem still has a unique solution.

Pratt & Whitney aircraft nuclear J-8 turbojet engine performance variation with radiator diameter

International Nuclear Information System (INIS)

Larson, John W.

1960-01-01

The variation of engine performance with liquid metal radiator diameter and flight altitude has been estimated for both the 1600F NaK and 1800F NaK radiators at Mach 0.6 and hot day atmospheric conditions. The net thrust, air flow and reactor power is presented in 3 figures for the Pratt & Whitney Aircraft J-58 engine with the 1600F NaK radiator. The net thrust, air flow and reactor power for the 1800F NaK radiator are also presented in figures.

Evaluation of peripheral metabolic status by determination of Na-K ATPase pump activity in circulating erythrocytes in patients with thyroid diseases and nonthyroidal illnesses.

Science.gov (United States)

Ogasawara, H; Nishikawa, M

1993-02-01

The number of Na-K ATPase units in erythrocytes (RBC) was determined by the maximal ouabain binding assay in 25 normal subjects and patients with hyperthyroidism (n = 29), hypothyroidism (8), chronic renal failure (CRF, 19) and with neoplastic disorders (NP, 12). The activity of the pump units was also assessed by measuring ouabain-sensitive 86Rb uptake in some of these subjects. In addition, it was determined in mononuclear cells in normal controls and patients with hyper- and hypothyroidism and CRF. Significant diminution of the number of the RBC pump units was found in hyperthyroidism, while it was increased in hypothyroidism. The binding (O) of old RBC was significantly lower than that (Y) of young RBC and a striking correlation was observed between the % reduction rate ((Y-O)/Y) of the binding and the serum T4 level in hyperthyroidism (r = 0.85, P hyperthyroidism. The ratio of RBC 86Rb uptake to the number of the pump units in the same cell (U/B) bore a significant relation to serum T3 (r = 0.48, P metabolic status. In CRF patients with low T3 levels, bindings were increased but those in NP with low T3 was almost normal.(ABSTRACT TRUNCATED AT 250 WORDS)

Inhibiting Na+/K+ ATPase can impair mitochondrial energetics and induce abnormal Ca2+ cycling and automaticity in guinea pig cardiomyocytes.

Directory of Open Access Journals (Sweden)

Qince Li

Full Text Available Cardiac glycosides have been used for the treatment of heart failure because of their capabilities of inhibiting Na+/K+ ATPase (NKA, which raises [Na+]i and attenuates Ca2+ extrusion via the Na+/Ca2+ exchanger (NCX, causing [Ca2+]i elevation. The resulting [Ca2+]i accumulation further enhances Ca2+-induced Ca2+ release, generating the positive inotropic effect. However, cardiac glycosides have some toxic and side effects such as arrhythmogenesis, confining their extensive clinical applications. The mechanisms underlying the proarrhythmic effect of glycosides are not fully understood. Here we investigated the mechanisms by which glycosides could cause cardiac arrhythmias via impairing mitochondrial energetics using an integrative computational cardiomyocyte model. In the simulations, the effect of glycosides was mimicked by blocking NKA activity. Results showed that inhibiting NKA not only impaired mitochondrial Ca2+ retention (thus suppressed reactive oxygen species (ROS scavenging but also enhanced oxidative phosphorylation (thus increased ROS production during the transition of increasing workload, causing oxidative stress. Moreover, concurrent blocking of mitochondrial Na+/Ca2+ exchanger, but not enhancing of Ca2+ uniporter, alleviated the adverse effects of NKA inhibition. Intriguingly, NKA inhibition elicited Ca2+ transient and action potential alternans under more stressed conditions such as severe ATP depletion, augmenting its proarrhythmic effect. This computational study provides new insights into the mechanisms underlying cardiac glycoside-induced arrhythmogenesis. The findings suggest that targeting both ion handling and mitochondria could be a very promising strategy to develop new glycoside-based therapies in the treatment of heart failure.

Inhibiting Na+/K+ ATPase can impair mitochondrial energetics and induce abnormal Ca2+ cycling and automaticity in guinea pig cardiomyocytes.

Science.gov (United States)

Li, Qince; Pogwizd, Steven M; Prabhu, Sumanth D; Zhou, Lufang

2014-01-01

Cardiac glycosides have been used for the treatment of heart failure because of their capabilities of inhibiting Na+/K+ ATPase (NKA), which raises [Na+]i and attenuates Ca2+ extrusion via the Na+/Ca2+ exchanger (NCX), causing [Ca2+]i elevation. The resulting [Ca2+]i accumulation further enhances Ca2+-induced Ca2+ release, generating the positive inotropic effect. However, cardiac glycosides have some toxic and side effects such as arrhythmogenesis, confining their extensive clinical applications. The mechanisms underlying the proarrhythmic effect of glycosides are not fully understood. Here we investigated the mechanisms by which glycosides could cause cardiac arrhythmias via impairing mitochondrial energetics using an integrative computational cardiomyocyte model. In the simulations, the effect of glycosides was mimicked by blocking NKA activity. Results showed that inhibiting NKA not only impaired mitochondrial Ca2+ retention (thus suppressed reactive oxygen species (ROS) scavenging) but also enhanced oxidative phosphorylation (thus increased ROS production) during the transition of increasing workload, causing oxidative stress. Moreover, concurrent blocking of mitochondrial Na+/Ca2+ exchanger, but not enhancing of Ca2+ uniporter, alleviated the adverse effects of NKA inhibition. Intriguingly, NKA inhibition elicited Ca2+ transient and action potential alternans under more stressed conditions such as severe ATP depletion, augmenting its proarrhythmic effect. This computational study provides new insights into the mechanisms underlying cardiac glycoside-induced arrhythmogenesis. The findings suggest that targeting both ion handling and mitochondria could be a very promising strategy to develop new glycoside-based therapies in the treatment of heart failure.

Self-similar variables and the problem of nonlocal electron heat conductivity

International Nuclear Information System (INIS)

Krasheninnikov, S.I.; Bakunin, O.G.

1993-10-01

Self-similar solutions of the collisional electron kinetic equation are obtained for the plasmas with one (1D) and three (3D) dimensional plasma parameter inhomogeneities and arbitrary Z eff . For the plasma parameter profiles characterized by the ratio of the mean free path of thermal electrons with respect to electron-electron collisions, γ T , to the scale length of electron temperature variation, L, one obtains a criterion for determining the effect that tail particles with motion of the non-diffusive type have on the electron heat conductivity. For these conditions it is shown that the use of a open-quotes symmetrizedclose quotes kinetic equation for the investigation of the strong nonlocal effect of suprathermal electrons on the electron heat conductivity is only possible at sufficiently high Z eff (Z eff ≥ (L/γ T ) 1/2 ). In the case of 3D inhomogeneous plasma (spherical symmetry), the effect of the tail electrons on the heat transport is less pronounced since they are spread across the radius r

Variable orifice using an iris shutter

International Nuclear Information System (INIS)

Beeman, R.; Brajkovich, S.J.

1978-01-01

A variable orifice forming mechanism is described that utilizes shutter arrangement adapted to control gas flow, conductance in vacuum systems, as a heat shield for furnace windows, as a beam shutter in sputtering operations, and in any other application requiring periodic or continuously-variable control of material, gas, or fluid flow

Design of a conductivity meter for highly insulating liquids

Energy Technology Data Exchange (ETDEWEB)

Medrano, M; Perez, A T; Soria-Hoyo, C [Dep. Electronica y Electromagnetismo, Facultad de Fisica, Universidad de Sevilla, Avda. Reina Mercedes s/n, 41012 Sevilla (Spain)

2007-03-07

The accurate measurement of the electrical conductivity of low conducting liquids is an important issue in many industrial applications. The lack of repeatability is a common problem to the available procedures and commercial techniques. In this paper, we present a device to measure the electrical conductivity of low conducting liquids. The variable inter-electrode gap allows us to assure the existence of an ohmic regime, since only under ohmic regime conditions is the value of the conductivity meaningful.

Design of a conductivity meter for highly insulating liquids

International Nuclear Information System (INIS)

Medrano, M; Perez, A T; Soria-Hoyo, C

2007-01-01

The accurate measurement of the electrical conductivity of low conducting liquids is an important issue in many industrial applications. The lack of repeatability is a common problem to the available procedures and commercial techniques. In this paper, we present a device to measure the electrical conductivity of low conducting liquids. The variable inter-electrode gap allows us to assure the existence of an ohmic regime, since only under ohmic regime conditions is the value of the conductivity meaningful

Variable Conductance Heat Pipe Cooling of Stirling Convertor and General Purpose Heat Source

Science.gov (United States)

Tarau, Calin; Schwendeman, Carl; Anderson, William G.; Cornell, Peggy A.; Schifer, Nicholas A.

2013-01-01

In a Stirling Radioisotope Power System (RPS), heat must be continuously removed from the General Purpose Heat Source (GPHS) modules to maintain the modules and surrounding insulation at acceptable temperatures. The Stirling convertor normally provides this cooling. If the Stirling convertor stops in the current system, the insulation is designed to spoil, preventing damage to the GPHS at the cost of an early termination of the mission. An alkali-metal Variable Conductance Heat Pipe (VCHP) can be used to passively allow multiple stops and restarts of the Stirling convertor. In a previous NASA SBIR Program, Advanced Cooling Technologies, Inc. (ACT) developed a series of sodium VCHPs as backup cooling systems for Stirling RPS. The operation of these VCHPs was demonstrated using Stirling heater head simulators and GPHS simulators. In the most recent effort, a sodium VCHP with a stainless steel envelope was designed, fabricated and tested at NASA Glenn Research Center (GRC) with a Stirling convertor for two concepts; one for the Advanced Stirling Radioisotope Generator (ASRG) back up cooling system and one for the Long-lived Venus Lander thermal management system. The VCHP is designed to activate and remove heat from the stopped convertor at a 19 degC temperature increase from the nominal vapor temperature. The 19 degC temperature increase from nominal is low enough to avoid risking standard ASRG operation and spoiling of the Multi-Layer Insulation (MLI). In addition, the same backup cooling system can be applied to the Stirling convertor used for the refrigeration system of the Long-lived Venus Lander. The VCHP will allow the refrigeration system to: 1) rest during transit at a lower temperature than nominal; 2) pre-cool the modules to an even lower temperature before the entry in Venus atmosphere; 3) work at nominal temperature on Venus surface; 4) briefly stop multiple times on the Venus surface to allow scientific measurements. This paper presents the experimental

Adalékok a gazdaságelméleti amortizáció tartalmának tisztázásához. Egy alternatív közelítés

OpenAIRE

Bélyácz, Iván

2002-01-01

A cikk a gazdaságelméleti amortizáció (economic depreciation) teoretikus gyökereit kutatja. A szerző - Tom Lee jövedelem- és értékméréssel foglalkozó munkáját alapul véve - Hicks széles körben ismert jövedelemkoncepcióit számszerű példák segítségével teszi szemléletessé. Lee munkája a jövedelem gazdaságelméleti modelljeinek bemutatásával szinte csak mellékesen foglalkozik az amortizáció kérdésével, modelljei azonban maradéktalanul alkalmasak a gazdaságelméleti amortizáció időbeli alakulásának...

Numerical study of different conduction models for Al{sub 2}O{sub 3}-water nanofluid with variable properties inside a trapezoidal enclosure

Energy Technology Data Exchange (ETDEWEB)

Arani, Ali Akbar Abbasian; Azemati, Ali Akbar; Rezaee, Mohammad [University of Kashan, Kashan (Iran, Islamic Republic of); Hadavand, Behzad Shirkavand [Islamic Azad University, Abadan (Iran, Islamic Republic of)

2017-05-15

Natural convection in enclosures containing nanofluids is important in physical and environmental applications. Different models for conduction have been developed because of the importance of this phenomenon in natural convection in enclosures. In this study, effects of conduction models of Chon, Corcione, Khanafer, and Koo and Kleinstreuer on the natural convection inside a trapezoidal enclosure with hot and cold walls are evaluated numerically. The enclosure contains Al{sub 2}O{sub 3}-water nanofluid with variable properties. Effects of the conduction models on fluid flow, natural convection, variations in volume fraction, and diameter of nanoparticles in the models, as well as the variations in the Rayleigh number, are examined. Results show that at Rayleigh numbers of 105 and 106, the maximum and minimum values of the average Nusselt number are obtained using the models of Khanafer and Chon, respectively. In all models, the average Nusselt number presents upward and downward trends when the volume fraction of nanoparticles increases but decreases when the di- ameter of the nanoparticles increases. At Ra = 105 in all models, as the volume fraction of nanoparticles increases, the nanofluid provides a higher average Nusselt number compared with the base fluid. By contrast, at Ra = 106, at volume fractions larger than 0.01 and using the model of Chon, the average Nusselt number of the nanofluid is lower compared with that of the base fluid.

Four to seven random casual urine specimens are sufficient to estimate 24-h urinary sodium/potassium ratio in individuals with high blood pressure.

Science.gov (United States)

Iwahori, T; Ueshima, H; Torii, S; Saito, Y; Fujiyoshi, A; Ohkubo, T; Miura, K

2016-05-01

This study was done to clarify the optimal number and type of casual urine specimens required to estimate urinary sodium/potassium (Na/K) ratio in individuals with high blood pressure. A total of 74 individuals with high blood pressure, 43 treated and 31 untreated, were recruited from the Japanese general population. Urinary sodium, potassium and Na/K ratio were measured in both casual urine samples and 7-day 24-h urine samples and then analyzed by correlation and Bland-Altman analyses. Mean Na/K ratio from random casual urine samples on four or more days strongly correlated with the Na/K ratio of 7-day 24-h urine (r=0.80-0.87), which was similar to the correlation between 1 and 2-day 24-h urine and 7-day 24-h urine (r=0.75-0.89). The agreement quality for Na/K ratio of seven random casual urine for estimating the Na/K ratio of 7-day 24-h urine was good (bias: -0.26, limits of agreements: -1.53-1.01), and it was similar to that of 2-day 24-h urine for estimating 7-day 24-h values (bias: 0.07, limits of agreement: -1.03 to 1.18). Stratified analyses comparing individuals using antihypertensive medication and individuals not using antihypertensive medication showed similar results. Correlations of the means of casual urine sodium or potassium concentrations with 7-day 24-h sodium or potassium excretions were relatively weaker than those for Na/K ratio. The mean Na/K ratio of 4-7 random casual urine specimens on different days provides a good substitute for 1-2-day 24-h urinary Na/K ratio for individuals with high blood pressure.

Universal conductance fluctuations in disordered metals

International Nuclear Information System (INIS)

Lee, P.A.

1987-01-01

The author argues that observed and theoretical fluctuations in the electrical conductance of disordered metals, induced by variations in the magnetic field or the chemical potential, are not time-dependent noise but that the conductance is a deterministic albeit fluctuating function for a given realization of the impurity configuration. A method is constructed for representing the sensitivity of the conductance of a given metal to a small change in the impurity configuration as a function of such variables as sample size, impurities per unit volume, and mean free path. The sensitivity helps explain the size of 1/f noise due to defect motion in disordered metals

A study of variable thrust, variable specific impulse trajectories for solar system exploration

Science.gov (United States)

Sakai, Tadashi

A study has been performed to determine the advantages and disadvantages of variable thrust and variable Isp (specific impulse) trajectories for solar system exploration. There have been several numerical research efforts for variable thrust, variable Isp, power-limited trajectory optimization problems. All of these results conclude that variable thrust, variable Isp (variable specific impulse, or VSI) engines are superior to constant thrust, constant Isp (constant specific impulse; or CSI) engines. However, most of these research efforts assume a mission from Earth to Mars, and some of them further assume that these planets are circular and coplanar. Hence they still lack the generality. This research has been conducted to answer the following questions: (1) Is a VSI engine always better than a CSI engine or a high thrust engine for any mission to any planet with any time of flight considering lower propellant mass as the sole criterion? (2) If a planetary swing-by is used for a VSI trajectory, is the fuel savings of a VSI swing-by trajectory better than that of a CSI swing-by or high thrust swing-by trajectory? To support this research, an unique, new computer-based interplanetary trajectory calculation program has been created. This program utilizes a calculus of variations algorithm to perform overall optimization of thrust, Isp, and thrust vector direction along a trajectory that minimizes fuel consumption for interplanetary travel. It is assumed that the propulsion system is power-limited, and thus the compromise between thrust and Isp is a variable to be optimized along the flight path. This program is capable of optimizing not only variable thrust trajectories but also constant thrust trajectories in 3-D space using a planetary ephemeris database. It is also capable of conducting planetary swing-bys. Using this program, various Earth-originating trajectories have been investigated and the optimized results have been compared to traditional CSI and high

Antenatal Bartter syndrome presenting as hyperparathyroidism with hypercalcemia and hypercalciuria: a case report and review.

Science.gov (United States)

Gross, Itai; Siedner-Weintraub, Yael; Simckes, Ari; Gillis, David

2015-07-01

Antenatal type I Bartter syndrome (ABS) is usually identified by the presence of polyhydramnios, premature delivery, hypokalemia, metabolic alkalosis, hypercalciuria, and nephrocalcinosis caused by mutations in the Na-K-2Cl cotransporter (NKCC2)-encoding SLC12A1 gene. In this report, we describe a novel presentation of this syndrome with hypercalcemic hypercalciuric hyperparathyroidism, and review the literature of the variable atypical presentations of ABS.

Expression of three isoforms of Na-K-2Cl cotransporter (NKCC2) in the kidney and regulation by dehydration.

Science.gov (United States)

Itoh, Kazuko; Izumi, Yuichiro; Inoue, Takeaki; Inoue, Hideki; Nakayama, Yushi; Uematsu, Takayuki; Fukuyama, Takashi; Yamazaki, Taiga; Yasuoka, Yukiko; Makino, Takeshi; Nagaba, Yasushi; Tomita, Kimio; Kobayashi, Noritada; Kawahara, Katsumasa; Mukoyama, Masashi; Nonoguchi, Hiroshi

2014-10-24

Sodium reabsorption via Na-K-2Cl cotransporter 2 (NKCC2) in the thick ascending limbs has a major role for medullary osmotic gradient and subsequent water reabsorption in the collecting ducts. We investigated intrarenal localization of three isoforms of NKCC2 mRNA expressions and the effects of dehydration on them in rats. To further examine the mechanisms of dehydration, the effects of hyperosmolality on NKCC2 mRNA expression in microdissected renal tubules was studied. RT-PCR and RT-competitive PCR were employed. The expressions of NKCC2a and b mRNA were observed in the cortical thick ascending limbs (CAL) and the distal convoluted tubules (DCT) but not in the medullary thick ascending limbs (MAL), whereas NKCC2f mRNA expression was seen in MAL and CAL. Two-day dehydration did not affect these mRNA expressions. In contrast, hyperosmolality increased NKCC2 mRNA expression in MAL in vitro. Bradykinin dose-dependently decreased NKCC2 mRNA expression in MAL. However, dehydration did not change NKCC2 protein expression in membrane fraction from cortex and outer medulla and in microdissected MAL. These data show that NKCC2a/b and f types are mainly present in CAL and MAL, respectively. Although NKCC2 mRNA expression was stimulated by hyperosmolality in vitro, NKCC2 mRNA and protein expressions were not stimulated by dehydration in vivo. These data suggest the presence of the inhibitory factors for NKCC2 expression in dehydration. Considering the role of NKCC2 for the countercurrent multiplier system, NKCC2f expressed in MAL might be more important than NKCC2a/b. Copyright © 2014 Elsevier Inc. All rights reserved.

Anisotropy of heat conduction in Mo/Si multilayers

International Nuclear Information System (INIS)

Medvedev, V. V.; Yakshin, A. E.; Kruijs, R. W. E. van de; Bijkerk, F.; Yang, J.; Schmidt, A. J.; Zoethout, E.

2015-01-01

This paper reports on the studies of anisotropic heat conduction phenomena in Mo/Si multilayers with individual layer thicknesses selected to be smaller than the mean free path of heat carriers. We applied the frequency-domain thermoreflectance technique to characterize the thermal conductivity tensor. While the mechanisms of the cross-plane heat conduction were studied in detail previously, here we focus on the in-plane heat conduction. To analyze the relative contribution of electron transport to the in-plane heat conduction, we applied sheet-resistance measurements. Results of Mo/Si multilayers with variable thickness of the Mo layers indicate that the net in-plane thermal conductivity depends on the microstructure of the Mo layers

Variable contact gap single-molecule conductance determination for a series of conjugated molecular bridges

DEFF Research Database (Denmark)

Haiss, W.; Wang, Christian; Jitchati, R.

2008-01-01

It is now becoming clear that the characteristics of the whole junction are important in determining the conductance of single molecules bound between two metal contacts. This paper shows through measurements on a series of seven conjugated molecular bridges that contact separation is an importan...... that conductance increases rather dramatically at higher tilt angle away from the normal for conformationally rigid molecular wires and that this increase in conductance arises from increased electronic coupling between the molecular bridge and the gold contacts.......It is now becoming clear that the characteristics of the whole junction are important in determining the conductance of single molecules bound between two metal contacts. This paper shows through measurements on a series of seven conjugated molecular bridges that contact separation is an important......-distance curves and knowledge of the terminal to terminal length of the molecular wire. The contact gap separation dependence is interpreted as arising from tilting of these molecules in the junction and this model is underpinned by ab initio transport computations. In this respect we make the general observation...

Detection of endogenous lithium in neuropsychiatric disorders--a model for biological transmutation.

Science.gov (United States)

Kurup, Ravi Kumar; Kurup, Parameswara Achutha

2002-01-01

The human hypothalamus produces an endogenous membrane Na(+)-K(+) ATPase inhibitor, digoxin. A digoxin induced model of cellular/neuronal quantal state and perception has been described by the authors. Biological transmutation has been described in microbial systems in the quantal state. The study focuses on the plasma levels of digoxin, RBC membrane Na(+)-K(+) ATPase activity, plasma levels of magnesium and lithium in neuropsychiatric and systemic disorders. Inhibition of RBC membrane Na(+)-K(+) ATPase activity was observed in most cases along with an increase in the levels of serum digoxin and lithium and a decrease in the level of serum Mg(++). The generation of endogenous lithium would obviously occur due to biological transmutation from magnesium. Digoxin and lithium together can produce added membrane Na(+)-K(+) ATPase inhibition. The role of membrane Na(+)-K(+) ATPase inhibition in the pathogenesis of neuropsychiatric and systemic disorders is discussed. The inhibition of membrane Na(+)-K(+) ATPase can contribute to an increase in intracellular calcium and a decrease in magnesium, which can result in a defective neurotransmitter transport mechanism, mitochondrial dysfunction and apoptosis, defective golgi body function and protein processing dysfunction, immune dysfunction and oncogenesis. Copyright 2002 John Wiley & Sons, Ltd.

Biopsie et mesure de l'activité Na+/K+ ATPasique branchiale : validité et impact sur le développement du smolt de saumon Atlantique (Salmo salar L.

Directory of Open Access Journals (Sweden)

SIEGLER L.

1996-01-01

Full Text Available Une biopsie de fragment de tissu branchial a été effectuée, durant toute la période de smoltification, sur des juvéniles de saumons Atlantique (Salmo salar élevés en pisciculture. Le microdosage de l'activité de la Na+/K+ ATPase branchiale, effectué sur ce fragment de tissu, a été comparé au macrodosage obtenu à partir des branchies entières. Aucune mortalité n'a été observée chez les saumons biopsies dont le taux de croissance (linéaire et pondérale est resté identique à celui des poissons témoins. La bonne correspondance des cinétiques de l'activité enzymatique obtenues par les deux méthodes valide la technique de microdosage et confirme l'absence d'influence sur le développement physiologique ultérieur du smolt biopsie. Nos résultats montrent les modifications envisageables pour améliorer la sensibilité de la méthode. Cette technique est très prometteuse pour l'analyse des populations naturelles

Influence of Variable Thermal Conductivity on MHD Boundary Layer Slip Flow of Ethylene-Glycol Based Cu Nanofluids over a Stretching Sheet with Convective Boundary Condition

Directory of Open Access Journals (Sweden)

N. Bhaskar Reddy

2014-01-01

Full Text Available An analysis is carried out to investigate the influence of variable thermal conductivity and partial velocity slip on hydromagnetic two-dimensional boundary layer flow of a nanofluid with Cu nanoparticles over a stretching sheet with convective boundary condition. Using similarity transformation, the governing boundary layer equations along with the appropriate boundary conditions are transformed to a set of ordinary differential equations. Employing Runge-kutta fourth-order method along with shooting technique, the resultant system of equations is solved. The influence of various pertinent parameters such as nanofluid volume fraction parameter, the magnetic parameter, radiation parameter, thermal conductivity parameter, velocity slip parameter, Biot number, and suction or injection parameter on the velocity of the flow field and heat transfer characteristics is computed numerically and illustrated graphically. The present results are compared with the existing results for the case of regular fluid and found an excellent agreement.

Dependence of conductivity on thickness within the variable-range hopping regime for Coulomb glasses

Directory of Open Access Journals (Sweden)

M. Caravaca

Full Text Available In this paper, we provide some computational evidence concerning the dependence of conductivity on the system thickness for Coulomb glasses. We also verify the Efros–Shklovskii law and deal with the calculation of its characteristic parameter as a function of the thickness. Our results strengthen the link between theoretical and experimental fields. Keywords: Coulomb glass, Conductivity, Density of states, Efros–Shklovskii law

Structural, nanomechanical and variable range hopping conduction behavior of nanocrystalline carbon thin films deposited by the ambient environment assisted filtered cathodic jet carbon arc technique

Energy Technology Data Exchange (ETDEWEB)

Panwar, O.S., E-mail: ospanwar@mail.nplindia.ernet.in [Polymorphic Carbon Thin Films Group, Physics of Energy Harvesting Division, CSIR-National Physical Laboratory, Dr. K. S. Krishnan Road, New Delhi - 110 012 (India); Rawal, Ishpal; Tripathi, R.K. [Polymorphic Carbon Thin Films Group, Physics of Energy Harvesting Division, CSIR-National Physical Laboratory, Dr. K. S. Krishnan Road, New Delhi - 110 012 (India); Srivastava, A.K. [Electron and Ion Microscopy, Sophisticated and Analytical Instruments, CSIR-National Physical Laboratory, Dr. K. S. Krishnan Road, New Delhi - 110 012 (India); Kumar, Mahesh [Ultrafast Opto-Electronics and Tetrahertz Photonics Group, CSIR-National Physical Laboratory, Dr. K. S. Krishnan Road, New Delhi - 110 012 (India)

2015-04-15

Highlights: • Nanocrystalline carbon thin films are grown by filtered cathodic jet carbon arc process. • Effect of gaseous environment on the properties of carbon films has been studied. • The structural and nanomechanical properties of carbon thin films have been studied. • The VRH conduction behavior in nanocrystalline carbon thin films has been studied. - Abstract: This paper reports the deposition and characterization of nanocrystalline carbon thin films by filtered cathodic jet carbon arc technique assisted with three different gaseous environments of helium, nitrogen and hydrogen. All the films are nanocrystalline in nature as observed from the high resolution transmission electron microscopic (HRTEM) measurements, which suggests that the nanocrystallites of size ∼10–50 nm are embedded though out the amorphous matrix. X-ray photoelectron spectroscopic studies suggest that the film deposited under the nitrogen gaseous environment has the highest sp{sup 3}/sp{sup 2} ratio accompanied with the highest hardness of ∼18.34 GPa observed from the nanoindentation technique. The film deposited under the helium gaseous environment has the highest ratio of the area under the Raman D peak to G peak (A{sub D}/A{sub G}) and the highest conductivity (∼2.23 S/cm) at room temperature, whereas, the film deposited under the hydrogen environment has the lowest conductivity value (2.27 × 10{sup −7} S/cm). The temperature dependent dc conduction behavior of all the nanocrystalline carbon thin films has been analyzed in the light of Mott’s variable range hopping (VRH) conduction mechanism and observed that all the films obey three dimension VRH conduction mechanism for the charge transport.

A variable thickness window: Thermal and structural analyses

International Nuclear Information System (INIS)

Wang, Zhibi; Kuzay, T.M.

1994-01-01

In this paper, the finite difference formulations for variable thickness thermal analysis and variable thickness plane stress analysis are presented. In heat transfer analysis, radiation effects and temperature-dependent thermal conductivity are taken into account. While in thermal stress analysis, the thermal expansion coefficient is considered as temperature dependent. An application of the variable thickness window to an Advanced Photon Source beamline is presented

Assessment of variable application rates of biological amendment ...

African Journals Online (AJOL)

Assessment of variable application rates of biological amendment substances on establishment and growth characteristics of maize plants. ... Hence, a greenhouse experiment was conducted in 2008 to assess the effects of variable rates (50, 75 and 100% of the recommended rates) of industrial manufactured biological ...

A sea urchin Na(+)K(+)2Cl(-) cotransporter is involved in the maintenance of calcification-relevant cytoplasmic cords in Strongylocentrotus droebachiensis larvae.

Science.gov (United States)

Basse, Wiebke C; Gutowska, Magdalena A; Findeisen, Ulrike; Stumpp, Meike; Dupont, Sam; Jackson, Daniel J; Himmerkus, Nina; Melzner, Frank; Bleich, Markus

2015-09-01

The cellular mechanisms of calcification in sea urchin larvae are still not well understood. Primary mesenchyme cells within the larval body cavity form a syncytium to secrete CaCO3 spicules from intracellular amorphous CaCO3 (ACC) stores. We studied the role of Na(+)K(+)2Cl(-) cotransporter (NKCC) in intracellular ACC accumulation and larval spicule formation of Strongylocentrotus droebachiensis. First, we incubated growing larvae with three different loop diuretics (azosemide, bumetanide, and furosemide) and established concentration-response curves. All loop diuretics were able to inhibit calcification already at concentrations that specifically inhibit NKCC. Calcification was most effectively inhibited by azosemide (IC50=6.5 μM), while larval mortality and swimming ability were not negatively impacted by the treatment. The inhibition by bumetanide (IC50=26.4 μM) and furosemide (IC50=315.4 μM) resembled the pharmacological fingerprint of the mammalian NKCC1 isoform. We further examined the effect of azosemide on the maintenance of cytoplasmic cords and on the occurrence of calcification vesicles using fluorescent dyes (calcein, FM1-43). Fifty micromolars of azosemide inhibited the maintenance of cytoplasmic cords and resulted in increased calcein fluorescence within calcification vesicles. The expression of NKCC in S. droebachiensis was verified by PCR and Western blot with a specific NKCC antibody. In summary, the pharmacological profile of loop diuretics and their specific effects on calcification in sea urchin larvae suggest that they act by inhibition of NKCC via repression of cytoplasmic cord formation and maintenance. Copyright © 2015 Elsevier Inc. All rights reserved.

Ethical Considerations in Conducting Pragmatic Trials in Oncology.

Science.gov (United States)

Hammer, Marilyn J

2017-09-01

Pragmatic trials evaluate interventions in real-life scenarios, which differ from explanatory trials that control for numerous factors and variables to best determine causal associations. Each approach has advantages and disadvantages. Conducting pragmatic research trials while maintaining the tenets of the ethical conduct of research can sometimes be challenging, particularly regarding informed consent. In this column, distinctions between pragmatic and explanatory trials are discussed from an ethical view.

Electrogenic properties of the Na⁺/K⁺ ATPase control transitions between normal and pathological brain states.

Science.gov (United States)

Krishnan, Giri P; Filatov, Gregory; Shilnikov, Andrey; Bazhenov, Maxim

2015-05-01

Ionic concentrations fluctuate significantly during epileptic seizures. In this study, using a combination of in vitro electrophysiology, computer modeling, and dynamical systems analysis, we demonstrate that changes in the potassium and sodium intra- and extracellular ion concentrations ([K(+)] and [Na(+)], respectively) during seizure affect the neuron dynamics by modulating the outward Na(+)/K(+) pump current. First, we show that an increase of the outward Na(+)/K(+) pump current mediates termination of seizures when there is a progressive increase in the intracellular [Na(+)]. Second, we show that the Na(+)/K(+) pump current is crucial in maintaining the stability of the physiological network state; a reduction of this current leads to the onset of seizures via a positive-feedback loop. We then present a novel dynamical mechanism for bursting in neurons with a reduced Na(+)/K(+) pump. Overall, our study demonstrates the profound role of the current mediated by Na(+)/K(+) ATPase on the stability of neuronal dynamics that was previously unknown. Copyright © 2015 the American Physiological Society.

High-resolution array CGH profiling identifies Na/K transporting ATPase interacting 2 (NKAIN2) as a predisposing candidate gene in neuroblastoma.

Science.gov (United States)

Romania, Paolo; Castellano, Aurora; Surace, Cecilia; Citti, Arianna; De Ioris, Maria Antonietta; Sirleto, Pietro; De Mariano, Marilena; Longo, Luca; Boldrini, Renata; Angioni, Adriano; Locatelli, Franco; Fruci, Doriana

2013-01-01

Neuroblastoma (NB), the most common solid cancer in early childhood, usually occurs sporadically but also its familial occurance is known in 1-2% of NB patients. Germline mutations in the ALK and PHOX2B genes have been found in a subset of familial NBs. However, because some individuals harbouring mutations in these genes do not develop this tumor, additional genetic alterations appear to be required for NB pathogenesis. Herein, we studied an Italian family with three NB patients, two siblings and a first cousin, carrying an ALK germline-activating mutation R1192P, that was inherited from their unaffected mothers and with no mutations in the PHOX2B gene. A comparison between somatic and germline DNA copy number changes in the two affected siblings by a high resolution array-based Comparative Genomic Hybridization (CGH) analysis revealed a germline gain at NKAIN2 (Na/K transporting ATPase interacting 2) locus in one of the sibling, that was inherited from the parent who does not carry the ALK mutation. Surprisingly, NKAIN2 was expressed at high levels also in the affected sibling that lacks the genomic gain at this locus, clearly suggesting the existance of other regulatory mechanisms. High levels of NKAIN2 were detected in the MYCN-amplified NB cell lines and in the most aggressive NB lesions as well as in the peripheral blood of a large cohort of NB patients. Consistent with a role of NKAIN2 in NB development, NKAIN2 was down-regulated during all-trans retinoic acid differentiation in two NB cell lines. Taken together, these data indicate a potential role of NKAIN2 gene in NB growth and differentiation.

High-resolution array CGH profiling identifies Na/K transporting ATPase interacting 2 (NKAIN2 as a predisposing candidate gene in neuroblastoma.

Directory of Open Access Journals (Sweden)

Paolo Romania

Full Text Available Neuroblastoma (NB, the most common solid cancer in early childhood, usually occurs sporadically but also its familial occurance is known in 1-2% of NB patients. Germline mutations in the ALK and PHOX2B genes have been found in a subset of familial NBs. However, because some individuals harbouring mutations in these genes do not develop this tumor, additional genetic alterations appear to be required for NB pathogenesis. Herein, we studied an Italian family with three NB patients, two siblings and a first cousin, carrying an ALK germline-activating mutation R1192P, that was inherited from their unaffected mothers and with no mutations in the PHOX2B gene. A comparison between somatic and germline DNA copy number changes in the two affected siblings by a high resolution array-based Comparative Genomic Hybridization (CGH analysis revealed a germline gain at NKAIN2 (Na/K transporting ATPase interacting 2 locus in one of the sibling, that was inherited from the parent who does not carry the ALK mutation. Surprisingly, NKAIN2 was expressed at high levels also in the affected sibling that lacks the genomic gain at this locus, clearly suggesting the existance of other regulatory mechanisms. High levels of NKAIN2 were detected in the MYCN-amplified NB cell lines and in the most aggressive NB lesions as well as in the peripheral blood of a large cohort of NB patients. Consistent with a role of NKAIN2 in NB development, NKAIN2 was down-regulated during all-trans retinoic acid differentiation in two NB cell lines. Taken together, these data indicate a potential role of NKAIN2 gene in NB growth and differentiation.

Regulation of the Na(+)-K(+)-2Cl(-) cotransporter by cGMP/cGMP-dependent protein kinase I after furosemide administration.

Science.gov (United States)

Limmer, Franziska; Schinner, Elisabeth; Castrop, Hayo; Vitzthum, Helga; Hofmann, Franz; Schlossmann, Jens

2015-10-01

Sodium chloride reabsorption in the thick ascending limb of the loop of Henle is mediated by the Na(+)-K(+)-2Cl(-) cotransporter (NKCC2). The loop diuretic furosemide is a potent inhibitor of NKCC2. However, less is known about the mechanism regulating the electrolyte transporter. Considering the well-established effects of nitric oxide on NKCC2 activity, cGMP is likely involved in this regulation. cGMP-dependent protein kinase I (cGKI; PKGI) is a cGMP target protein that phosphorylates different substrates after activation through cGMP. We investigated the potential correlation between the cGMP/cGKI pathway and NKCC2 regulation. We treated wild-type (wt) and cGKIα-rescue mice with furosemide. cGKIα-rescue mice expressed cGKIα only under the control of the smooth muscle-specific transgelin (SM22) promoter in a cGKI deficient background. Furosemide treatment increased the urine excretion of sodium and chloride in cGKIα-rescue mice compared to that in wt mice. We analyzed the phosphorylation of NKCC2 by western blotting and immunostaining using the phosphospecific antibody R5. The administration of furosemide significantly increased the phosphorylated NKCC2 signal in wt but not in cGKIα-rescue mice. NKCC2 activation led to its phosphorylation and membrane translocation. To examine whether cGKI was involved in this process, we analyzed vasodilator-stimulated phosphoprotein, which is phosphorylated by cGKI. Furosemide injection resulted in increased vasodilator-stimulated phosphoprotein phosphorylation in wt mice. We hypothesize that furosemide administration activated cGKI, leading to NKCC2 phosphorylation and membrane translocation. This cGKI-mediated pathway could be a mechanism to compensate for the inhibitory effect of furosemide on NKCC2. © 2015 FEBS.

Regulation of the sodium-potassium pump in cultured rat skeletal myotubes by intracellular sodium ions

International Nuclear Information System (INIS)

Brodie, C.; Sampson, S.R.

1989-01-01

The properties of the Na-K pump and some of the factors controlling its amount and function were studied in rat myotubes in culture. The number of Na-K pump sites was quantified by measuring the amount of [ 3 H]ouabain bound to whole-cell preparations. Activity of the pump was determined by measurement of ouabain-sensitive 86 Rb-uptake and component of membrane potential. Chronic treatment of myotubes with tetrodotoxin (TTX), which lowers [Na]i, decreased the number of Na-K pumps, the ouabain-sensitive 86Rb uptake, and the size of the electrogenic pump component of Em. In contrast, chronic treatment with either ouabain or veratridine, which increases [Na+]i, resulted in an elevated level of Na-K pump sites. This effect was blocked by inhibitors of protein synthesis. Neither rates of degradation nor affinity of pump sites in cells treated with TTX, veratridine, or ouabain differred from those in control cells. The number and activity of Na-K pump sites were unaffected by chronic elevation in [Ca]i or chronic depolarization. We conclude that alterations in the level in intracellular Na ions play the major role in regulation of Na-K pump synthesis in cultured mammalian skeletal muscle

Mathematical model for thermal solar collectors by using magnetohydrodynamic Maxwell nanofluid with slip conditions, thermal radiation and variable thermal conductivity

Directory of Open Access Journals (Sweden)

Asif Mahmood

Full Text Available Solar energy is the cleanest, renewable and most abundant source of energy available on earth. The main use of solar energy is to heat and cool buildings, heat water and to generate electricity. There are two types of solar energy collection system, the photovoltaic systems and the solar thermal collectors. The efficiency of any solar thermal system depend on the thermophysical properties of the operating fluids and the geometry/length of the system in which fluid is flowing. In the present research a simplified mathematical model for the solar thermal collectors is considered in the form of non-uniform unsteady stretching surface. The flow is induced by a non-uniform stretching of the porous sheet and the uniform magnetic field is applied in the transverse direction to the flow. The non-Newtonian Maxwell fluid model is utilized for the working fluid along with slip boundary conditions. Moreover the high temperature effect of thermal radiation and temperature dependent thermal conductivity are also included in the present model. The mathematical formulation is carried out through a boundary layer approach and the numerical computations are carried out for cu-water and TiO2-water nanofluids. Results are presented for the velocity and temperature profiles as well as the skin friction coefficient and Nusselt number and the discussion is concluded on the effect of various governing parameters on the motion, temperature variation, velocity gradient and the rate of heat transfer at the boundary. Keywords: Solar energy, Thermal collectors, Maxwell-nanofluid, Thermal radiation, Partial slip, Variable thermal conductivity

Classification and prediction of port variables

Energy Technology Data Exchange (ETDEWEB)

Molina Serrano, B.

2016-07-01

Many variables are included in planning and management of port terminals. They can beeconomic, social, environmental and institutional. Agent needs to know relationshipbetween these variables to modify planning conditions. Use of Bayesian Networks allowsfor classifying, predicting and diagnosing these variables. Bayesian Networks allow forestimating subsequent probability of unknown variables, basing on know variables.In planning level, it means that it is not necessary to know all variables because theirrelationships are known. Agent can know interesting information about how port variablesare connected. It can be interpreted as cause-effect relationship. Bayesian Networks can beused to make optimal decisions by introduction of possible actions and utility of theirresults.In proposed methodology, a data base has been generated with more than 40 port variables.They have been classified in economic, social, environmental and institutional variables, inthe same way that smart port studies in Spanish Port System make. From this data base, anetwork has been generated using a non-cyclic conducted grafo which allows for knowingport variable relationships - parents-children relationships-. Obtained network exhibits thateconomic variables are – in cause-effect terms- cause of rest of variable typologies.Economic variables represent parent role in the most of cases. Moreover, whenenvironmental variables are known, obtained network allows for estimating subsequentprobability of social variables.It has been concluded that Bayesian Networks allow for modeling uncertainty in aprobabilistic way, even when number of variables is high as occurs in planning andmanagement of port terminals. (Author)

Analytical Plans Supporting The Sludge Batch 8 Glass Variability Study Being Conducted By Energysolutions And CUA's Vitreous State Laboratory

International Nuclear Information System (INIS)

Edwards, T. B.; Peeler, D. K.

2012-01-01

EnergySolutions (ES) and its partner, the Vitreous State Laboratory (VSL) of The Catholic University of America (CUA), are to provide engineering and technical services support to Savannah River Remediation, LLC (SRR) for ongoing operation of the Defense Waste Processing Facility (DWPF) flowsheet as well as for modifications to improve overall plant performance. SRR has requested via a statement of work that ES/VSL conduct a glass variability study (VS) for Sludge Batch 8. SRR issued a technical task request (TTR) asking that the Savannah River National Laboratory (SRNL) provide planning and data reduction support for the ES/VSL effort. This document provides two analytical plans for use by ES/VSL: one plan is to guide the measurement of the chemical composition of the study glasses while the second is to guide the measurement of the durability of the study glasses. The measurements generated by ES/VSL are to be provided to SRNL for data reduction and evaluation. SRNL is to review the results of its evaluation with ES/VSL and SRR. The results will subsequently be incorporated into a joint report with ES/VSL as a deliverable to SRR to support the processing of SB8 at DWPF

Anisotropy of hopping conductivity in TIGaSe2, crystal

International Nuclear Information System (INIS)

Nadjafov, A.I.; Sardarli, R.M.; Samedov, O. A.; Abdullayev, A.P.; Zeynalova, E.A.; Jabbarov, J.H.

2005-01-01

Full Text: The temperature dependences of electrical conductivity of a chained semiconductor crystal TIGaTe 2 in a direction of chains and perpendicularly have been investigated. It was established that in a constant electrical field in both crystallographic directions took place hopping conductivity with variable length of a jump on located near Fermi level. The energy activation of conductivity has been determined. It was appreciated density of a condition in a vicinity of a Fermi level, their disorder, radius of localization, average distance of jumps of carriers

Relationship between cotton yield and soil electrical conductivity, topography, and landsat imagery

Science.gov (United States)

Understanding spatial and temporal variability in crop yield is a prerequisite to implementing site-specific management of crop inputs. Apparent soil electrical conductivity (ECa), soil brightness, and topography are easily obtained data that can explain yield variability. The objectives of this stu...

High pressure studies of ionic conductivity in solids

International Nuclear Information System (INIS)

Samara, G.A.

1979-01-01

The pressure dependence of the ionic conductivity provides information about the volume relaxation associated with the formation of lattice defects as well as with the diffusive motion of these defects, and thereby helps elucidate the conduction process. Pressure results on a variety of crystals will be discussed with emphasis on recent results on crystals with large lattice polarizabilities and soft phonon modes. Pressure is shown to be an important--sometimes essential, variable in the study of ionic transport processes

The variable stars of NGC 1866

International Nuclear Information System (INIS)

Welch, D.L.; Cote, P.; Fischer, P.; Mateo, M.; Madore, B.F.

1991-01-01

A search has been conducted for new variables in the LMC cluster NGC 1866 using new multiepoch CCD photometry. Eight previously unknown Cepheid variables, most near the cluster core, are found. Of the new variables reported by Storm et al. (188), only six of 10 appear to be Cepheids and one of these is not a member. Periods and mean magnitudes and colors for sufficiently uncrowded variables are reported, as is one red giant variable of long period and one Cepheid which is a single-lined spectroscopic binary with a velocity semiamplitude greater than or equal to 10.5 km/s. The variation of light-curve amplitude with position in the instability strip is reported along with an apparently nonvariable star, which is a radial velocity member, in the strip. A true distance modulus of 18.57 + or - 0.01 mag is obtained for the cluster. 36 refs

Tuning Nanocrystal Surface Depletion by Controlling Dopant Distribution as a Route Toward Enhanced Film Conductivity

Science.gov (United States)

Staller, Corey M.; Robinson, Zachary L.; Agrawal, Ankit; Gibbs, Stephen L.; Greenberg, Benjamin L.; Lounis, Sebastien D.; Kortshagen, Uwe R.; Milliron, Delia J.

2018-05-01

Electron conduction through bare metal oxide nanocrystal (NC) films is hindered by surface depletion regions resulting from the presence of surface states. We control the radial dopant distribution in tin-doped indium oxide (ITO) NCs as a means to manipulate the NC depletion width. We find in films of ITO NCs of equal overall dopant concentration that those with dopant-enriched surfaces show decreased depletion width and increased conductivity. Variable temperature conductivity data shows electron localization length increases and associated depletion width decreases monotonically with increased density of dopants near the NC surface. We calculate band profiles for NCs of differing radial dopant distributions and, in agreement with variable temperature conductivity fits, find NCs with dopant-enriched surfaces have narrower depletion widths and longer localization lengths than those with dopant-enriched cores. Following amelioration of NC surface depletion by atomic layer deposition of alumina, all films of equal overall dopant concentration have similar conductivity. Variable temperature conductivity measurements on alumina-capped films indicate all films behave as granular metals. Herein, we conclude that dopant-enriched surfaces decrease the near-surface depletion region, which directly increases the electron localization length and conductivity of NC films.

A Statistical Analysis of Cointegration for I(2) Variables

DEFF Research Database (Denmark)

Johansen, Søren

1995-01-01

be conducted using the ¿ sup2/sup distribution. It is shown to what extent inference on the cointegration ranks can be conducted using the tables already prepared for the analysis of cointegration of I(1) variables. New tables are needed for the test statistics to control the size of the tests. This paper...... contains a multivariate test for the existence of I(2) variables. This test is illustrated using a data set consisting of U.K. and foreign prices and interest rates as well as the exchange rate....

Effects of cortisol and salinity acclimation on Na+/K+/2Cl–- cotransporter gene expression and Na+, K+-ATPase activity in the gill of Persian sturgeon, Acipenser persicus, fry

Directory of Open Access Journals (Sweden)

Saber Khodabandeh

2009-10-01

Full Text Available Na+, K+-ATPase activity and Na+/K+/2Cl–- cotransporter (NKCC gene expression in the gills of Persian sturgeon, Acipenser persicus, fry (2-3 g, 3.30-8.12 cm total body length in freshwater (control group, diluted Caspian Sea water (5 ppt and after treatment with cortisol in freshwater were studied. Na+, K+-ATPase activity was lower in the 5 ppt-acclimated fish (1.07±0.05 _mol Pi/mg protein/h than in the control fish (1.19±0.05 μmol Pi/mg protein/h but this difference was not significant. nKCC gene expression in the 5 ppt-acclimated fish (1.6±0.07 was significantly higher than in the control fish (0.8±0.00. In the cortisol treated fish, Na+, K+-ATPase activity (1.91±0.05 μmol Pi/mg protein/h and NKCC gene expression (3.2±0.1 were significantly higher than in the control group. our results show that Persian sturgeon fry (2-3 g can tolerate 5 ppt salinity by changing their enzymatic content and activity, and that exogenous cortisol application can increase the osmoregulatory capacity of fry before release into brackish water and can reduce their mortality.

Variabilidade sazonal da condutância estomática em um ecossistema de manguezal amazônico e suas relações com variáveis meteorológicas Seasonal variability of the stomatal conductance in Amazonian mangrove ecosystem and their relationships with meteorological variables

Directory of Open Access Journals (Sweden)

Hernani José Brazão Rodrigues

2011-06-01

Full Text Available No presente trabalho foram estudadas as variações da condutância estomática (g s para o período chuvoso (março e seco (agosto do ano de 2003, e suas relações de dependência com algumas variáveis meteorológicas medidas em um ecossistema de manguezal amazônico. As informações utilizadas foram do projeto ECOBIOMA, parte integrante do Experimento de Grande Escala da Biosfera-Atmosfera da Amazônia (LBA. A g s acompanha a tendência de variação do balanço de radiação, atingindo valores máximos durante o dia e mínimos durante a noite. A condutância apresentou maiores flutuações no período chuvoso, com valor médio de g s = 0,015 m s-¹, porém com magnitudes inferiores as do período seco. Durante a época seca apresentou um valor médio de g s = 0,027 m s-¹, com menor amplitude, variando de 0,010 This work investigated the variations of stomatal conductance (g s in the rainy and dry seasons and its dependence relations with meteorological variables measured in an Amazonian mangrove ecosystem. Data were originated from the ECOBIOMA project, part of the Large Scale Biosphere-Atmosphere Experiment in Amazon (LBA. Stomatal conductance followed the tendency of the radiation balance variation, reaching maximum values during the day and minimum values at night. The conductance showed greater fluctuations in the rainy season, with mean value of g s = 0.015 m s-¹, however smaller in magnitude than in the dry season. During the dry season, the mean value was g s = 0.027 m s-¹, with lower range, varying between 0.010 and 0.042 m s-¹. The meteorological variables used for establishing the dependence relations with the daily variability of stomatal conductance were the following; specific moisture deficit (δq, vapor pressure deficit (PVD, net radiation (Rn and wind velocity (Vv. The PVD showed the best correlation with g s, with R² = 0.99 for both periods. In spite of the importance of Vv in the gaseous changes between the

Phosphorylation and transport in the Na-K-2Cl cotransporters, NKCC1 and NKCC2A, compared in HEK-293 cells.

Directory of Open Access Journals (Sweden)

Anke Hannemann

2011-03-01

Full Text Available Na-K-2Cl cotransporters help determine cell composition and volume. NKCC1 is widely distributed whilst NKCC2 is only found in the kidney where it plays a vital role reabsorbing 20% of filtered NaCl. NKCC2 regulation is poorly understood because of its restricted distribution and difficulties with its expression in mammalian cell cultures. Here we compare phosphorylation of the N-termini of the cotransporters, measured with phospho-specific antibodies, with bumetanide-sensitive transport of K(+ ((86Rb(+ (activity in HEK-293 cells stably expressing fNKCC1 or fNKCC2A which were cloned from ferret kidney. Activities of transfected transporters were distinguished from those of endogenous ones by working at 37 °C. fNKCC1 and fNKCC2A activities were highest after pre-incubation of cells in hypotonic low-[Cl(-] media to reduce cell [Cl(-] and volume during flux measurement. Phosphorylation of both transporters more than doubled. Pre-incubation with ouabain also strongly stimulated fNKCC1 and fNKCC2A and substantially increased phosphorylation, whereas pre-incubation in Na(+-free media maximally stimulated fNKCC1 and doubled its phosphorylation, but inhibited fNKCC2A, with a small increase in its phosphorylation. Kinase inhibitors halved phosphorylation and activity of both transporters whereas inhibition of phosphatases with calyculin A strongly increased phosphorylation of both transporters but only slightly stimulated fNKCC1 and inhibited fNCCC2A. Thus kinase inhibition reduced phosphorylation and transport, and transport stimulation was only seen when phosphorylation increased, but transport did not always increase with phosphorylation. This suggests phosphorylation of the N-termini determines the transporters' potential capacity to move ions, but final activity also depends on other factors. Transport cannot be reliably inferred solely using phospho-specific antibodies on whole-cell lysates.

Phosphorylation and transport in the Na-K-2Cl cotransporters, NKCC1 and NKCC2A, compared in HEK-293 cells.

Science.gov (United States)

Hannemann, Anke; Flatman, Peter W

2011-03-25

Na-K-2Cl cotransporters help determine cell composition and volume. NKCC1 is widely distributed whilst NKCC2 is only found in the kidney where it plays a vital role reabsorbing 20% of filtered NaCl. NKCC2 regulation is poorly understood because of its restricted distribution and difficulties with its expression in mammalian cell cultures. Here we compare phosphorylation of the N-termini of the cotransporters, measured with phospho-specific antibodies, with bumetanide-sensitive transport of K(+) ((86)Rb(+)) (activity) in HEK-293 cells stably expressing fNKCC1 or fNKCC2A which were cloned from ferret kidney. Activities of transfected transporters were distinguished from those of endogenous ones by working at 37 °C. fNKCC1 and fNKCC2A activities were highest after pre-incubation of cells in hypotonic low-[Cl(-)] media to reduce cell [Cl(-)] and volume during flux measurement. Phosphorylation of both transporters more than doubled. Pre-incubation with ouabain also strongly stimulated fNKCC1 and fNKCC2A and substantially increased phosphorylation, whereas pre-incubation in Na(+)-free media maximally stimulated fNKCC1 and doubled its phosphorylation, but inhibited fNKCC2A, with a small increase in its phosphorylation. Kinase inhibitors halved phosphorylation and activity of both transporters whereas inhibition of phosphatases with calyculin A strongly increased phosphorylation of both transporters but only slightly stimulated fNKCC1 and inhibited fNCCC2A. Thus kinase inhibition reduced phosphorylation and transport, and transport stimulation was only seen when phosphorylation increased, but transport did not always increase with phosphorylation. This suggests phosphorylation of the N-termini determines the transporters' potential capacity to move ions, but final activity also depends on other factors. Transport cannot be reliably inferred solely using phospho-specific antibodies on whole-cell lysates.

Observations of leaf stomatal conductance at the canopy scale: an atmospheric modeling perspective

International Nuclear Information System (INIS)

Avissar, R.

1993-01-01

Plant stomata play a key role in the redistribution of energy received on vegetated land into sensible and latent heat. As a result, they have a considerable impact on the atmospheric planetary boundary layer, the hydrologic cycle, the climate, and the weather. Current parameterizations of the stomatal mechanism in state-of-the-art atmospheric models are based on empirical relations that are established at the leaf scale between stomatal conductance and environmental conditions. In order to evaluate these parameterizations, an experiment was carried out on a potato field in New Jersey during the summer of 1989. Stomatal conductances were measured within a small homogeneous area in the middle of the potato field and under a relatively broad range of atmospheric conditions. A large variability of stomatal conductances was observed. This variability, which was associated with the variability of micro-environmental and physiological conditions that is found even in a homogeneous canopy, cannot be simulated explicitly on the scale of a single agricultural field and,a fortiori, on the scale of atmospheric models. Furthermore, this variability could not be related to the environmental conditions measured at a height of 2 m above the plant canopy simultaneously with the conductances, reinforcing the concept of scale decoupling suggested by Jarvis and McNaughton (1986) and McNaughton and Jarvis (1991). Thus, for atmospheric modeling purposes, a parameterization of stomatal conductance at the canopy scale using external environmental forcing conditions seems more appropriate than a parameterization based on leaf-scale stomatal conductance, as currently adopted in state-of-the-art atmospheric models. The measured variability was characterized by a lognormal probability density function (pdf) that remained relatively stable during the entire measuring period. These observations support conclusions by McNaughton and Jarvis (1991) that, unlike current parameterizations, a

Observations of leaf stomatal conductance at the canopy scale: an atmospheric modeling perspective

International Nuclear Information System (INIS)

Avissar, R.

1993-01-01

Plant stomata play a key role in the redistribution of energy received on vegetated land into sensible and latent heat. As a result, they have a considerable impact on the atmospheric planetary boundary layer, the hydrologic cycle, the climate, and the weather. Current parameterizations of the stomatal mechanism in state-of-the-art atmospheric models are based on empirical relations that are established at the leaf scale between stomatal conductance and environmental conditions. In order to evaluate these parameterizations, an experiment was carried out on a potato field in New Jersey during the summer of 1989. Stomatal conductances were measured within a small homogeneous area in the middle of the potato field and under a relatively broad range of atmospheric conditions. A large variability of stomatal conductances was observed. This variability, which was associated with the variability of micro-environmental and physiological conditions that is found even in a homogeneous canopy, cannot be simulated explicitly on the scale of a single agricultural field and, a fortiori, on the scale of atmospheric models. Furthermore, this variability could not be related to the environmental conditions measured at a height of 2 m above the plant canopy simultaneously with the conductances, reinforcing the concept of scale decoupling suggested by Jarvis and McNaughton (1986) and McNaughton and Jarvis (1991). Thus, for atmospheric modeling purposes, a parameterization of stomatal conductance at the canopy scale using external environmental forcing conditions seems more appropriate than a parameterization based on leaf-scale stomatal conductance, as currently adopted in state-of-the-art atmospheric models. The measured variability was characterized by a lognormal probability density function (pdf) that remained relatively stable during the entire measuring period. These observations support conclusions by McNaughton and Jarvis (1991) that, unlike current parameterizations, a

TEMPERAMENT CHARACTERISTICS OF CHILDREN WITH CONDUCT AND CONVERSION DISORDERS

OpenAIRE

Malhotra, Savita

1989-01-01

SUMMARY In a comparative study of temperament profiles of groups of 30 children each diagnosed as conduct disorders, conversion disorder, emotional disorders (according to DSM-III) and normal control, it was found that the children diagnosed as conduct disorders showed high activity and intensity of emotional response as well as negative mood, those diagnosed as conversion disorder exhibited low distractibility. The significance of various temperament variables in differing clinical outcomes ...

Numerical investigation of CO{sub 2} emission and thermal stability of a convective and radiative stockpile of reactive material in a cylindrical pipe of variable thermal conductivity

Energy Technology Data Exchange (ETDEWEB)

Lebelo, Ramoshweu Solomon, E-mail: sollyl@vut.ac.za [Department of Mathematics, Vaal University of Technology, Private Bag X021, Vanderbijlpark, 1911 (South Africa)

2014-10-24

In this paper the CO{sub 2} emission and thermal stability in a long cylindrical pipe of combustible reactive material with variable thermal conductivity are investigated. It is assumed that the cylindrical pipe loses heat by both convection and radiation at the surface. The nonlinear differential equations governing the problem are tackled numerically using Runge-Kutta-Fehlberg method coupled with shooting technique method. The effects of various thermophysical parameters on the temperature and carbon dioxide fields, together with critical conditions for thermal ignition are illustrated and discussed quantitatively.

Some problems in steady-state thermal conductivity with variable heat transfer rate

International Nuclear Information System (INIS)

Malov, Yu.I.; Martinson, L.K.; Pavlov, K.B.

1975-01-01

Some boundary-value problems of steady heat conductivity with an alternating heat exchange coefficient have been solved for a cylindrical region. The solutions have been performed as expansion in series with respect to eigenfunctions with the coefficients consistent with infinite systems of linear algebraic equations. A reduction method has been substantiated for those systems. The paper presents results of calculation of the temperature distribution inside the infinite cylinder with concrete tasks of heat exchange coefficient variations on the cylinder surface

Influence of heat shock on germination Na/sup +/ and K/sup +/ leakage and electrical conductivity of imbibed calligonum seeds

International Nuclear Information System (INIS)

Ren, J.; Tao, L.

2016-01-01

Relationships between mineral leakage and germination characteristics of five Calligonum seed in teat shock treatments were analyzed. The results suggested that heat shock stress for imbibing seeds significantly inhabited the germination and K+ leakage, and induced more seed transform death. The greater EC induced decreasing of germination of five Calligonum species, and seeds with more leakage of K+ performed greater germinability. Increasing of EC and Na+ leakage induced more seed dead. Na+ leakage and EC of germination medium always increased with temperature. K+ in seeds inhabited germination, Na+ in seeds determined the vigor of Calligonum seeds. Na+/K+ and EC both could be considered to be used for indications of seed vigor of Calligonum seeds. (author)

Sound Localization in Patients With Congenital Unilateral Conductive Hearing Loss With a Transcutaneous Bone Conduction Implant.

Science.gov (United States)

Vyskocil, Erich; Liepins, Rudolfs; Kaider, Alexandra; Blineder, Michaela; Hamzavi, Sasan

2017-03-01

There is no consensus regarding the benefit of implantable hearing aids in congenital unilateral conductive hearing loss (UCHL). This study aimed to measure sound source localization performance in patients with congenital UCHL and contralateral normal hearing who received a new bone conduction implant. Evaluation of within-subject performance differences for sound source localization in a horizontal plane. Tertiary referral center. Five patients with atresia of the external auditory canal and contralateral normal hearing implanted with transcutaneous bone conduction implant at the Medical University of Vienna were tested. Activated/deactivated implant. Sound source localization test; localization performance quantified using the root mean square (RMS) error. Sound source localization ability was highly variable among individual subjects, with RMS errors ranging from 21 to 40 degrees. Horizontal plane localization performance in aided conditions showed statistically significant improvement compared with the unaided conditions, with RMS errors ranging from 17 to 27 degrees. The mean RMS error decreased by a factor of 0.71 (p conduction implant. Some patients with congenital UCHL might be capable of developing improved horizontal plane localization abilities with the binaural cues provided by this device.

Progress on Variable Cycle Engines

Science.gov (United States)

Westmoreland, J. S.; Howlett, R. A.; Lohmann, R. P.

1979-01-01

Progress in the development and future requirements of the Variable Stream Control Engine (VSCE) are presented. The two most critical components of this advanced system for future supersonic transports, the high performance duct burner for thrust augmentation, and the low jet coannular nozzle were studied. Nozzle model tests substantiated the jet noise benefit associated with the unique velocity profile possible with a coannular nozzle system on a VSCE. Additional nozzle model performance tests have established high thrust efficiency levels only at takeoff and supersonic cruise for this nozzle system. An experimental program involving both isolated component and complete engine tests has been conducted for the high performance, low emissions duct burner with good results and large scale testing of these two components is being conducted using a F100 engine as the testbed for simulating the VSCE. Future work includes application of computer programs for supersonic flow fields to coannular nozzle geometries, further experimental testing with the duct burner segment rig, and the use of the Variable Cycle Engine (VCE) Testbed Program for evaluating the VSCE duct burner and coannular nozzle technologies.

Hermite- Padé projection to thermal radiative and variable ...

African Journals Online (AJOL)

The combined effect of variable thermal conductivity and radiative heat transfer on steady flow of a conducting optically thin viscous fluid through a channel with sliding wall and non-uniform wall temperatures under the influence of an externally applied homogeneous magnetic field are analyzed in the present study.

A Latent-Variable Causal Model of Faculty Reputational Ratings.

Science.gov (United States)

King, Suzanne; Wolfle, Lee M.

A reanalysis was conducted of Saunier's research (1985) on sources of variation in the National Research Council (NRC) reputational ratings of university faculty. Saunier conducted a stepwise regression analysis using 12 predictor variables. Due to problems with multicollinearity and because of the atheoretical nature of stepwise regression,…

Ionizing radiation action of transport systems of Na+ and K+ of neutronal membranes. Potassium ions reaccumulation with brain slices

International Nuclear Information System (INIS)

Dvoretsky, A.I.; Shainskaya, A.M.; Ananyeva, T.V.; Kulikova, I.A.

1990-01-01

The biological effect of ionizing radiation (IR) on the Na,K pump of the surviving brain cortex slices was investigated. It was shown that IR leads to marked disturbances in the Na,K pump activity and causes essential phasic changes in potassium ion reaccumulation by brain slices in different time after exposure. The possibility of modelling the radiation effect with the help of phospholipase A2 and decylenic acid was shown. The mechanisms of the functional disturbance of Na-K pump of nerve cells after irradiation are under discussion. (author)

Numerical analysis of unsteady 3D flow of Carreau nanofluid with variable thermal conductivity and heat source/sink

Science.gov (United States)

Irfan, M.; Khan, M.; Khan, W. A.

Inspired by modern deeds of nanotechnology and nanoscience and their abundant applications in the field of science and engineering, we establish a mathematical relation for unsteady 3D forced convective flow of Carreau nanofluid over a bidirectional stretched surface. Heat transfer phenomena of Carreau nanofluid is inspected through the variable thermal conductivity and heat generation/absorption impact. Furthermore, this research paper presents a more convincing approach for heat and mass transfer phenomenon of nanoliquid by utilizing new mass flux condition. Practically, zero mass flux condition is more adequate because in this approach we assume nanoparticle amends itself accordingly on the boundaries. Now the features of Buongiorno's relation for Carreau nanofluid can be applied in a more efficient way. An appropriate transformation is vacant to alter the PDEs into ODEs and then tackled numerically by employing bvp4c scheme. The numerous consequence of scheming parameters on the Carreau nanoliquid velocity components, temperature and concentration fields are portrayed graphically and deliberated in detail. The numerical outcomes for local skin friction and the wall temperature gradient for nanoliquid are intended and vacant through tables. The outcomes conveyed here manifest that impact of Brownian motion parameter Nb on the rate of heat transfer for nanoliquids becomes negligible for the recently recommended revised relation. Addationally, for authentication of the present relation, the achieved results are distinguished with earlier research works in specific cases and marvelous agreement has been noted.

Low temperature hopping conduction in amorphous Gesub(x)Sesub(1-x)

International Nuclear Information System (INIS)

Mehra, R.M.; Kumar, H.; Agarwal, S.C.; Sikka, P.; Mathur, P.C.

1985-08-01

Bulk amorphous samples of Gesub(x)Sesub(1-x) (0.5<=x<=0.7) were prepared by quenching. Dc conductivity measurements were carried out in the temperature range 77-300 K. In the low temperature region, the conduction occurs due to variable range hopping in the localized states near the Fermi level. The results are explained by Mott, Pollak and Butcher's models. Butcher's model which is based on the equivalent of conduction network is compatible with the results. (author)

Critical analysis of soil hydraulic conductivity determination using monoenergetic gamma radiation attenuation

International Nuclear Information System (INIS)

Portezan Filho, Otavio

1997-01-01

Three soil samples of different textures: LVA (red yellow latosol), LVE (dark red latosol) and LRd (dystrophic dark red latosol) were utilized for unsaturated hydraulic conductivity K(θ) measurements. Soil bulk densities and water contents during internal water drainage were measured by monoenergetic gamma radiation attenuation, using homogeneous soil columns assembled in the laboratory. The measurements were made with a collimated gamma beam of 0.003 m in diameter using a Nal(Tl) (3'' x 3 '') detector and a 137 Cs gamma source of 74 X 10 8 Bq and 661.6 KeV. Soil columns were scanned with the gamma beam from 0.01 to 0.20 m depth, in 0.01m steps, for several soil water redistribution times. The results show a great variability of the unsaturated hydraulic conductivity relation K(θ), even though homogeneous soils were used. The variability among methods is significantly smaller in relation to variability in space. The assumption of unit hydraulic gradient during redistribution of soil water utilized in the methods of Hillel, Libardi and Sisson leads to hydraulic conductivity values that increase in depth. The exponential character of the K(θ) relationship, is responsible for the difficulty of estimating soil hydraulic conductivity, which is a consequence of small variations in the porous arrangement, even in samples supposed to be homogeneous. (author)

Assessment of alkali metal coolants for the ITER blanket

International Nuclear Information System (INIS)

Natesan, K.; Reed, C.B.; Mattas, R.F.

1994-01-01

The blanket system is one of the most important components of a fusion reactor because it has a major impact on both the economics and safety of fusion energy. The primary functions of the blanket in a deuterium/tritium-fueled fusion reactor are to convert the fusion energy into sensible heat and to breed tritium for the fuel cycle. The Blanket Comparison and Selection Study, conducted earlier, described the overall comparative performance of different blanket concepts, including liquid metal, molten salt, water, and helium. This paper will discuss the ITER requirements for a self-cooled blanket concept with liquid lithium and for indirectly cooled concepts that use other alkali metals such as NaK. The paper will address the thermodynamics of interactions between the liquid metals (i.e., lithium and NaK) and structural materials (e.g., V-base alloys), together with associated corrosion/compatibility issues. Available experimental data will be used to assess the long-term performance of the first wall in a liquid metal environment

Estimating biozone hydraulic conductivity in wastewater soil-infiltration systems using inverse numerical modeling.

Science.gov (United States)

Bumgarner, Johnathan R; McCray, John E

2007-06-01

During operation of an onsite wastewater treatment system, a low-permeability biozone develops at the infiltrative surface (IS) during application of wastewater to soil. Inverse numerical-model simulations were used to estimate the biozone saturated hydraulic conductivity (K(biozone)) under variably saturated conditions for 29 wastewater infiltration test cells installed in a sandy loam field soil. Test cells employed two loading rates (4 and 8cm/day) and 3 IS designs: open chamber, gravel, and synthetic bundles. The ratio of K(biozone) to the saturated hydraulic conductivity of the natural soil (K(s)) was used to quantify the reductions in the IS hydraulic conductivity. A smaller value of K(biozone)/K(s,) reflects a greater reduction in hydraulic conductivity. The IS hydraulic conductivity was reduced by 1-3 orders of magnitude. The reduction in IS hydraulic conductivity was primarily influenced by wastewater loading rate and IS type and not by the K(s) of the native soil. The higher loading rate yielded greater reductions in IS hydraulic conductivity than the lower loading rate for bundle and gravel cells, but the difference was not statistically significant for chamber cells. Bundle and gravel cells exhibited a greater reduction in IS hydraulic conductivity than chamber cells at the higher loading rates, while the difference between gravel and bundle systems was not statistically significant. At the lower rate, bundle cells exhibited generally lower K(biozone)/K(s) values, but not at a statistically significant level, while gravel and chamber cells were statistically similar. Gravel cells exhibited the greatest variability in measured values, which may complicate design efforts based on K(biozone) evaluations for these systems. These results suggest that chamber systems may provide for a more robust design, particularly for high or variable wastewater infiltration rates.

Characterization of starter-free Queso Fresco made with sodium-potassium salt blends over 12 weeks of 4°C storage.

Science.gov (United States)

Van Hekken, D L; Tunick, M H; Renye, J A; Tomasula, P M

2017-07-01

Development of reduced-sodium cheese to meet the demands of consumers concerned about sodium levels in their diet is challenging when a high-moisture, higher pH, fresh cheese, such as Queso Fresco (QF), depends on its NaCl salt content to obtain its signature flavor and quality traits. This study evaluated the effects of different Na-K salt blends on the compositional, sensorial, microbial, functional, and rheological properties of QF stored for up to 12 wk at 4°C. Queso Fresco curd from each vat was divided into 6 portions and salted with different blends of NaCl-KCl (Na-K, %): 0.75-0.75, 1.0-0.5, 1.0-1.0, 1.0-1.3, 1.0-1.5, and 2.0-0 (control). Within this narrow salt range (1.5 to 2.5% total salt), the moisture, protein, fat, and lactose levels; water activity; pH; and the textural and rheological properties were not affected by salt treatment or aging. The total salt, sodium, potassium, and ash contents reflected the different Na-K ratios added to the QF. Total aerobic microbial count, overall proteolysis, the release of casein phosphopeptides, and the level of volatile compounds were affected by aging but not by the salt treatment. Only the 1.0-1.3 and 1.0-1.5 Na-K cheeses had sensory saltiness scores similar to that of the 2.0-0 Na-K control QF. Loss of free serum from the cheese matrix increased steadily over the 12 wk, with higher losses found in QF containing 1.5% total salt compared with the higher Na-K blends. In conclusion, KCl substitution is a viable means for reduction of sodium in QF resulting in only minor differences in the quality traits, and levels of 1.0-1.3 and 1.0-1.5 Na-K are recommended to match the saltiness intensity of the 2.0-0 Na-K control. The findings from this study will aid cheese producers in creating reduced-sodium QF for health-conscious consumers. Copyright © 2017 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

A Thermodynamical Theory with Internal Variables Describing Thermal Effects in Viscous Fluids

Science.gov (United States)

Ciancio, Vincenzo; Palumbo, Annunziata

2018-04-01

In this paper the heat conduction in viscous fluids is described by using the theory of classical irreversible thermodynamics with internal variables. In this theory, the deviation from the local equilibrium is characterized by vectorial internal variables and a generalized entropy current density expressed in terms of so-called current multipliers. Cross effects between heat conduction and viscosity are also considered and some phenomenological generalizations of Fourier's and Newton's laws are obtained.

Mutation of the Na(+)-K(+)-2Cl(-) cotransporter NKCC2 in mice is associated with severe polyuria and a urea-selective concentrating defect without hyperreninemia.

Science.gov (United States)

Kemter, Elisabeth; Rathkolb, Birgit; Bankir, Lise; Schrewe, Anja; Hans, Wolfgang; Landbrecht, Christina; Klaften, Matthias; Ivandic, Boris; Fuchs, Helmut; Gailus-Durner, Valérie; Hrabé de Angelis, Martin; Wolf, Eckhard; Wanke, Ruediger; Aigner, Bernhard

2010-06-01

The bumetanide-sensitive Na(+)-K(+)-2Cl(-) cotransporter NKCC2, located in the thick ascending limb of Henle's loop, plays a critical role in the kidney's ability to concentrate urine. In humans, loss-of-function mutations of the solute carrier family 12 member 1 gene (SLC12A1), coding for NKCC2, cause type I Bartter syndrome, which is characterized by prenatal onset of a severe polyuria, salt-wasting tubulopathy, and hyperreninemia. In this study, we describe a novel chemically induced, recessive mutant mouse line termed Slc12a1(I299F) exhibiting late-onset manifestation of type I Bartter syndrome. Homozygous mutant mice are viable and exhibit severe polyuria, metabolic alkalosis, marked increase in plasma urea but close to normal creatininemia, hypermagnesemia, hyperprostaglandinuria, hypotension,, and osteopenia. Fractional excretion of urea is markedly decreased. In addition, calcium and magnesium excretions are more than doubled compared with wild-type mice, while uric acid excretion is twofold lower. In contrast to hyperreninemia present in human disease, plasma renin concentration in homozygotes is not increased. The polyuria observed in homozygotes may be due to the combination of two additive factors, a decrease in activity of mutant NKCC2 and an increase in medullary blood flow, due to prostaglandin-induced vasodilation, that impairs countercurrent exchange of urea in the medulla. In conclusion, this novel viable mouse line with a missense Slc12a1 mutation exhibits most of the features of type I Bartter syndrome and may represent a new model for the study of this human disease.

Adhesive bonding using variable frequency microwave energy

Science.gov (United States)

Lauf, Robert J.; McMillan, April D.; Paulauskas, Felix L.; Fathi, Zakaryae; Wei, Jianghua

1998-01-01

Methods of facilitating the adhesive bonding of various components with variable frequency microwave energy are disclosed. The time required to cure a polymeric adhesive is decreased by placing components to be bonded via the adhesive in a microwave heating apparatus having a multimode cavity and irradiated with microwaves of varying frequencies. Methods of uniformly heating various articles having conductive fibers disposed therein are provided. Microwave energy may be selectively oriented to enter an edge portion of an article having conductive fibers therein. An edge portion of an article having conductive fibers therein may be selectively shielded from microwave energy.

Decontamination and decommissioning of the EBR-I Complex. Final report

International Nuclear Information System (INIS)

Kendall, E.W.; Wang, D.K.

1975-07-01

This final report covers the Decontamination and Decommissioning (D and D) of the Experimental Breeder Reactor No. 1 (EBR-I) Complex funded under Contract No. AT(10-1)-1375. The major effort consisted of removal and processing of 5500 gallons of sodium/potassium (NaK) coolant from the EBR-I reactor system. Tests were performed to assess the explosive hazards of NaK and KO 2 in various environments and in contact with various contaminants likely to be encountered in the removal and processing operations. A NaK process plant was designed and constructed and the operation was successfully completed. Lesser effort was required for D and D of the Zero Power Reactor (ZPR-III) Facility, the Argonne Fast Source Reactor (AFSR) Shielding, and removal of contaminated NaK from the storage pit. The D and D effort was completed by 13 June 1975, ahead of schedule. (auth)

A Comparison of Coolant Options for Brayton Power Conversion Heat Rejection Systems

International Nuclear Information System (INIS)

Siamidis, John; Mason, Lee

2006-01-01

This paper describes potential heat rejection design concepts for Brayton power conversion systems. Brayton conversion systems are currently under study by NASA for Nuclear Electric Propulsion (NEP) and surface power applications. The Brayton Heat Rejection Subsystem (HRS) must dissipate waste heat generated by the power conversion system due to inefficiencies in the thermal-to-electric conversion process. Sodium potassium (NaK) and H2O are two coolant working fluids that have been investigated in the design of a pumped loop and heat pipe space HRS. In general NaK systems are high temperature (300 to 1000 K) low pressure systems, and H2O systems are low temperature (300 to 600 K) high pressure systems. NaK is an alkali metal with health and safety hazards that require special handling procedures. On the other hand, H2O is a common fluid, with no health hazards and no special handling procedures. This paper compares NaK and H2O for the HRS pumped loop coolant working fluid. A detailed excel analytical model, HRS O pt, was developed to evaluate the various HRS design parameters. It is capable of analyzing NaK or H2O coolant, parallel or series flow configurations, and numerous combinations of other key parameters (heat pipe spacing, diameter and radial flux, radiator facesheet thickness, fluid duct system pressure drop, system rejected power, etc.) of the HRS. This paper compares NaK against water for the HRS coolant working fluid with respect to the relative mass, performance, design and implementation issues between the two fluids

Solutions for the conductivity of multi-coated spheres and spherically symmetric inclusion problems

Science.gov (United States)

Pham, Duc Chinh

2018-02-01

Variational results on the macroscopic conductivity (thermal, electrical, etc.) of the multi-coated sphere assemblage have been used to derive the explicit expression of the respective field (thermal, electrical, etc.) within the spheres in d dimensions (d=2,3). A differential substitution approach has been developed to construct various explicit expressions or determining equations for the effective spherically symmetric inclusion problems, which include those with radially variable conductivity, different radially variable transverse and normal conductivities, and those involving imperfect interfaces, in d dimensions. When the volume proportion of the outermost spherical shell increases toward 1, one obtains the respective exact results for the most important specific cases: the dilute solutions for the compound inhomogeneities suspended in a major matrix phase. Those dilute solution results are also needed for other effective medium approximation schemes.

Predicting Bond Betas using Macro-Finance Variables

DEFF Research Database (Denmark)

Aslanidis, Nektarios; Christiansen, Charlotte; Cipollini, Andrea

We conduct in-sample and out-of-sample forecasting using the new approach of combining explanatory variables through complete subset regressions (CSR). We predict bond CAPM betas and bond returns conditioning on various macro-fi…nance variables. We explore differences across long-term government ...... bonds, investment grade corporate bonds, and high-yield corporate bonds. The CSR method performs well in predicting bond betas, especially in-sample, and, mainly high-yield bond betas when the focus is out-of-sample. Bond returns are less predictable than bond betas....

Universal Quantum Computing with Arbitrary Continuous-Variable Encoding

OpenAIRE

Lau, Hoi-Kwan; Plenio, Martin B.

2016-01-01

Implementing a qubit quantum computer in continuous-variable systems conventionally requires the engineering of specific interactions according to the encoding basis states. In this work, we present a unified formalism to conduct universal quantum computation with a fixed set of operations but arbitrary encoding. By storing a qubit in the parity of two or four qumodes, all computing processes can be implemented by basis state preparations, continuous-variable exponential-swap operations, and ...

In-situ measurements of soil-water conductivity

International Nuclear Information System (INIS)

Murphy, C.E.

1978-01-01

Radionuclides and other environmentally important materials often move in association with water. In terrestrial ecosystems, the storage and movement of water in the soil is of prime importance to the hydrologic cycle of the ecosystem. The soil-water conductivity (the rate at which water moves through the soil) is a necessary input to models of soil-water movement. In situ techniques for measurement of soil-water conductivity have the advantage of averaging soil-water properties over larger areas than most laboratory methods. The in situ techniques also cause minimum disturbance of the soil under investigation. Results of measurements using a period of soil-water drainage after initial wetting indicate that soil-water conductivity and its variation with soil-water content can be determined with reasonable accuracy for the plot where the measurements were made. Further investigations are being carried out to look at variability between plots within a soil type

Maximizing Energy Capture of Fixed-Pitch Variable-Speed Wind Turbines

Energy Technology Data Exchange (ETDEWEB)

Pierce, K.; Migliore, P.

2000-08-01

Field tests of a variable-speed, stall-regulated wind turbine were conducted at a US Department of Energy Laboratory. A variable-speed generating system, comprising a doubly-fed generator and series-resonant power converter, was installed on a 275-kW, downwind, two-blade wind turbine. Gearbox, generator, and converter efficiency were measured in the laboratory so that rotor aerodynamic efficiency could be determined from field measurement of generator power. The turbine was operated at several discrete rotational speeds to develop power curves for use in formulating variable-speed control strategies. Test results for fixed-speed and variable-speed operation are presented along with discussion and comparison of the variable-speed control methodologies. Where possible, comparisons between fixed-speed and variable-speed operation are shown.

iHeartLift: a closed loop system with bio-feedback that uses music tempo variability to improve heart rate variability.

Science.gov (United States)

Ho, Thomas C T; Chen, Xiang

2011-01-01

"Musica delenit bestiam feram" translates into "Music soothes the savage beast". There is a hidden truth in this ancient quip passed down from generations. Besides soothing the heart, it also incites the heart to a healthier level of heart rate variability (HRV). In this paper, an approach to use and test music and biofeedback to increase the heart rate variability for people facing daily stress is discussed. By determining the music tempo variability (MTV) of a piece of music and current heart rate variability, iHeartLift is able to compare the 2 trends and locate a musical piece that is suited to increase the user's heart rate variability to a healthier level. With biofeedback, the 2 trends are continuously compared in real-time and the musical piece is changed in accordance with the current comparisons. A study was conducted and it was generally found that HRV can be uplifted by music regardless of language and meaning of musical lyrics but with limitations to musical genre.

A global data set of soil hydraulic properties and sub-grid variability of soil water retention and hydraulic conductivity curves

Science.gov (United States)

Montzka, Carsten; Herbst, Michael; Weihermüller, Lutz; Verhoef, Anne; Vereecken, Harry

2017-07-01

Agroecosystem models, regional and global climate models, and numerical weather prediction models require adequate parameterization of soil hydraulic properties. These properties are fundamental for describing and predicting water and energy exchange processes at the transition zone between solid earth and atmosphere, and regulate evapotranspiration, infiltration and runoff generation. Hydraulic parameters describing the soil water retention (WRC) and hydraulic conductivity (HCC) curves are typically derived from soil texture via pedotransfer functions (PTFs). Resampling of those parameters for specific model grids is typically performed by different aggregation approaches such a spatial averaging and the use of dominant textural properties or soil classes. These aggregation approaches introduce uncertainty, bias and parameter inconsistencies throughout spatial scales due to nonlinear relationships between hydraulic parameters and soil texture. Therefore, we present a method to scale hydraulic parameters to individual model grids and provide a global data set that overcomes the mentioned problems. The approach is based on Miller-Miller scaling in the relaxed form by Warrick, that fits the parameters of the WRC through all sub-grid WRCs to provide an effective parameterization for the grid cell at model resolution; at the same time it preserves the information of sub-grid variability of the water retention curve by deriving local scaling parameters. Based on the Mualem-van Genuchten approach we also derive the unsaturated hydraulic conductivity from the water retention functions, thereby assuming that the local parameters are also valid for this function. In addition, via the Warrick scaling parameter λ, information on global sub-grid scaling variance is given that enables modellers to improve dynamical downscaling of (regional) climate models or to perturb hydraulic parameters for model ensemble output generation. The present analysis is based on the ROSETTA PTF

Functional expression of the Na-K-2Cl cotransporter NKCC2 in mammalian cells fails to confirm the dominant-negative effect of the AF splice variant.

Science.gov (United States)

Hannemann, Anke; Christie, Jenny K; Flatman, Peter W

2009-12-18

The renal bumetanide-sensitive Na-K-2Cl cotransporter (NKCC2) is the major salt transport pathway in the apical membrane of the mammalian thick ascending limb. It is differentially spliced and the three major variants (A, B, and F) differ in their localization and transport characteristics. Most knowledge about its regulation comes from experiments in Xenopus oocytes as NKCC2 proved difficult to functionally express in a mammalian system. Here we report the cloning and functional expression of untagged and unmodified versions of the major splice variants from ferret kidney (fNKCC2A, -B, and -F) in human embryonic kidney (HEK) 293 cells. Many NKCC2 antibodies used in this study detected high molecular weight forms of the transfected proteins, probably NKCC2 dimers, but not the monomers. Interestingly, monomers were strongly detected by phosphospecific antibodies directed against phosphopeptides in the regulatory N terminus. Bumetanide-sensitive (86)Rb uptake was significantly higher in transfected HEK-293 cells and could be stimulated by incubating cells in a medium containing a low chloride concentration prior the uptake measurements. fNKCC2 was less sensitive to the reduction in chloride concentration than NKCC1. Using HEK-293 cells stably expressing fNKCC2A we also show that co-expression of variant NKCC2AF does not have the dominant-negative effect on NKCC2A activity that was seen in Xenopus oocytes, nor is it trafficked to the cell surface. In addition, fNKCC2AF is neither complex glycosylated nor phosphorylated in its N terminus regulatory region like other variants.

Mathematical model for thermal and entropy analysis of thermal solar collectors by using Maxwell nanofluids with slip conditions, thermal radiation and variable thermal conductivity

Science.gov (United States)

Aziz, Asim; Jamshed, Wasim; Aziz, Taha

2018-04-01

In the present research a simplified mathematical model for the solar thermal collectors is considered in the form of non-uniform unsteady stretching surface. The non-Newtonian Maxwell nanofluid model is utilized for the working fluid along with slip and convective boundary conditions and comprehensive analysis of entropy generation in the system is also observed. The effect of thermal radiation and variable thermal conductivity are also included in the present model. The mathematical formulation is carried out through a boundary layer approach and the numerical computations are carried out for Cu-water and TiO2-water nanofluids. Results are presented for the velocity, temperature and entropy generation profiles, skin friction coefficient and Nusselt number. The discussion is concluded on the effect of various governing parameters on the motion, temperature variation, entropy generation, velocity gradient and the rate of heat transfer at the boundary.

Influence of soil particle shape on saturated hydraulic conductivity

Directory of Open Access Journals (Sweden)

Zięba Zofia

2017-03-01

Full Text Available The aim of this paper is to define the correlation between the geometry of grains and saturated hydraulic conductivity of soils. The particle shape characteristics were described by the ζ0C index (Parylak, 2000, which expresses the variability of several shape properties, such as sphericity, angularity and roughness.

System and method of modulating electrical signals using photoconductive wide bandgap semiconductors as variable resistors

Science.gov (United States)

Harris, John Richardson; Caporaso, George J; Sampayan, Stephen E

2013-10-22

A system and method for producing modulated electrical signals. The system uses a variable resistor having a photoconductive wide bandgap semiconductor material construction whose conduction response to changes in amplitude of incident radiation is substantially linear throughout a non-saturation region to enable operation in non-avalanche mode. The system also includes a modulated radiation source, such as a modulated laser, for producing amplitude-modulated radiation with which to direct upon the variable resistor and modulate its conduction response. A voltage source and an output port, are both operably connected to the variable resistor so that an electrical signal may be produced at the output port by way of the variable resistor, either generated by activation of the variable resistor or propagating through the variable resistor. In this manner, the electrical signal is modulated by the variable resistor so as to have a waveform substantially similar to the amplitude-modulated radiation.

Radio variability in the Phoenix Deep Survey at 1.4 GHz

Science.gov (United States)

Hancock, P. J.; Drury, J. A.; Bell, M. E.; Murphy, T.; Gaensler, B. M.

2016-09-01

We use archival data from the Phoenix Deep Survey to investigate the variable radio source population above 1 mJy beam-1 at 1.4 GHz. Given the similarity of this survey to other such surveys we take the opportunity to investigate the conflicting results which have appeared in the literature. Two previous surveys for variability conducted with the Very Large Array (VLA) achieved a sensitivity of 1 mJy beam-1. However, one survey found an areal density of radio variables on time-scales of decades that is a factor of ˜4 times greater than a second survey which was conducted on time-scales of less than a few years. In the Phoenix deep field we measure the density of variable radio sources to be ρ = 0.98 deg-2 on time-scales of 6 months to 8 yr. We make use of Wide-field Infrared Survey Explorer infrared cross-ids, and identify all variable sources as an active galactic nucleus of some description. We suggest that the discrepancy between previous VLA results is due to the different time-scales probed by each of the surveys, and that radio variability at 1.4 GHz is greatest on time-scales of 2-5 yr.

Relationships and variability of agronomic and physiological ...

African Journals Online (AJOL)

This study was conducted to determine the variability, heritability and correlations among agronomic and physiological characters of mungbean (Vigna radiata (L.) Wilczek) and to identify their direct and indirect effects on seed yield. Fifty six mungbean accessions were evaluated at Suranaree University of Technology Farm ...

Ocean carbon and heat variability in an Earth System Model

Science.gov (United States)

Thomas, J. L.; Waugh, D.; Gnanadesikan, A.

2016-12-01

Ocean carbon and heat content are very important for regulating global climate. Furthermore, due to lack of observations and dependence on parameterizations, there has been little consensus in the modeling community on the magnitude of realistic ocean carbon and heat content variability, particularly in the Southern Ocean. We assess the differences between global oceanic heat and carbon content variability in GFDL ESM2Mc using a 500-year, pre-industrial control simulation. The global carbon and heat content are directly out of phase with each other; however, in the Southern Ocean the heat and carbon content are in phase. The global heat mutli-decadal variability is primarily explained by variability in the tropics and mid-latitudes, while the variability in global carbon content is primarily explained by Southern Ocean variability. In order to test the robustness of this relationship, we use three additional pre-industrial control simulations using different mesoscale mixing parameterizations. Three pre-industrial control simulations are conducted with the along-isopycnal diffusion coefficient (Aredi) set to constant values of 400, 800 (control) and 2400 m2 s-1. These values for Aredi are within the range of parameter settings commonly used in modeling groups. Finally, one pre-industrial control simulation is conducted where the minimum in the Gent-McWilliams parameterization closure scheme (AGM) increased to 600 m2 s-1. We find that the different simulations have very different multi-decadal variability, especially in the Weddell Sea where the characteristics of deep convection are drastically changed. While the temporal frequency and amplitude global heat and carbon content changes significantly, the overall spatial pattern of variability remains unchanged between the simulations.

AcEST: DK953656 [AcEST

Lifescience Database Archive (English)

Full Text Available . 34 0.61 sp|O75011|NAK1_SCHPO Serine/threonine-protein kinase nak1 OS=Sch... 34 0.61 sp|P40798|STC_DROME Protein shuttle craft...D D ++ G S D+ E Sbjct: 352 TVTGTVIPKSSTVHEPPSSNDSHPLLQLFKDSKISDDDSPSN--AEGASTEDSKGE 405 >sp|P40798|STC_DROME Protein shuttle craft

Preparation and Application of Conductive Textile Coatings Filled with Honeycomb Structured Carbon Nanotubes

Directory of Open Access Journals (Sweden)

Filip Govaert

2014-01-01

Full Text Available Electrical conductive textile coatings with variable amounts of carbon nanotubes (CNTs are presented. Formulations of textile coatings were prepared with up to 15 wt % of CNT, based on the solid weight of the binder. The binders are water based polyacrylate dispersions. The CNTs were mixed into the binder dispersion starting from a commercially available aqueous CNT dispersion that is compatible with the binder dispersion. Coating formulations with variable CNT concentrations were applied on polyester and cotton woven and knitted fabrics by different textile coating techniques: direct coating, transfer coating, and screen printing. The coatings showed increasing electrical conductivity with increasing CNT concentration. The coatings can be regarded to be electrically conductive (sheet resistivity<103 Ohm/sq starting at 3 wt% CNT. The degree of dispersion of the carbon nanotubes particles inside the coating was visualized by scanning electron microscopy. The CNT particles form honeycomb structured networks in the coatings, proving a high degree of dispersion. This honeycomb structure of CNT particles is forming a conductive network in the coating leading to low resistivity values.

Variables associated with Grade R English Additional Language ...

African Journals Online (AJOL)

reviewer 1

Since Grade R is the foundation for formal Grade 1 learning, research conducted ... There appears to be a paucity of research on variables relating to EAL acquisition in South Africa. In a ...... teacher can code switch and explain the meaning of.

Some Physiological Adaptations to Drought in Xerohalophytic Plants Inhabiting Two Oases in Western Desert of Egypt

International Nuclear Information System (INIS)

Rayan, A M; Farghali, K A

2007-01-01

Under natural drought, some physiological parameters were measured in some wild species inhabiting the western desert of Egypt. Seasonal changes of nitrogen metabolites and Na/K ratio were detected in the investigated species. Effect of seasons, species, and their interaction played an important role on total free amino acids, soluble proteins and Na/K ratio at two oases (Dakhla and Kharga). Species diversity showed more effective variable in regulating such metabolites at Kharga oasis. Plants responded to their environment in two ways, either by increasing their water binding molecules or by preventing the formation of amino acids into proteins. Some of the halophytic and xerophytic species may adjust osmotically to stress by the contribution of nitrogen metabolites. On the other hand, Zygophyllum coccineum, the succulent plant, may adapt to environmental conditions through the accumulation of free amino acids. Correlation analysis between Na+/K+ ratio with free amino acids, soluble proteins and water content in Tamarix aphylla, Salsola imbricata, Balanites aegyptiaca, Trichodesma africanum, and Z. coccineum (Kharga) indicated changes in ionic fraction or accumulating soluble organic compounds which were osmotically active and contribute to osmotic adjustment. Correlations were found between chlorophyll content, ionic and nitrogen metabolites. In Acacia nilotica, Suaeda monoica and Z. coccineum at Dakhla oasis, changes in soluble proteins or ionic ratio could be caused by chlorophyll response to stress, while S. imbricata and T. aphylla may control cellular protein contents. On the other hand, the sharing of both free amino acids and ionic fraction may play an important role of osmoregulation in S. imbricata, Citrullus colocynthis and Z. coccineum at Kharga oasis. (author)

Prenatal programming of adult mineral metabolism: relevance to blood pressure, dietary prevention strategies, and cardiovascular disease.

Science.gov (United States)

Schulter, Günter; Goessler, Walter; Papousek, Ilona

2012-01-01

Mounting evidence indicates that adult health outcomes such as the development of cardiovascular disease or diabetes can trace some of their roots back to prenatal development. This study investigated the epigenetic impact of a particular prenatal hormonal condition on specific health-related consequences, i.e., on concentrations of minerals and mineral metabolism in adults. In 70 university students, the second-to-fourth digit length (2D:4D) was measured as a proxy of prenatal sex steroid action, and the concentrations of sodium (Na), potassium (K), magnesium (Mg), and calcium (Ca) were determined in hair samples by inductively coupled plasma-mass spectrometry. Mineral concentrations and the mineral ratios Na/K, Na/Mg, and Na/Ca were analyzed in multivariate analyses of variance, with digit ratios and sex of participants as grouping variables. The results were validated in a replication cohort from the general population, and with a wider age-range. In addition, the correlation of mineral concentrations and mineral ratios with blood pressure was examined. Men with relatively lower (i.e., more masculine) and women with relatively higher (i.e., more feminine) digit ratios had higher Na/K, Na/Mg, and Na/Ca ratios than their counterparts. Virtually identical results were obtained in the replication study. Moreover, Na concentrations and Na/K ratios were significantly correlated with systolic blood pressure. The findings suggest that the individual variation in mineral metabolism can be predicted by 2D:4D, indicating that prenatal sex steroid action may be involved in the epigenetic programming of specific metabolic conditions which are highly relevant to adult health and disease. 2011 Wiley Periodicals, Inc.

Time course and predictors of median nerve conduction after carpal tunnel release.

Science.gov (United States)

Rotman, Mitchell B; Enkvetchakul, Bobby V; Megerian, J Thomas; Gozani, Shai N

2004-05-01

To identify predictors of outcome and of electrophysiologic recovery in patients with carpal tunnel syndrome (CTS) treated by endoscopic carpal tunnel release using a nerve conduction testing system (NC-Stat; NEUROMetrix, Inc, Waltham, MA). Validity of the automated nerve conduction testing system was shown by comparing presurgical distal motor latencies (DMLs) against a reference obtained by referral to an electromyography laboratory. The DML was evaluated in 48 patients with CTS. Measurements were obtained within 1 hour of surgery and at 2 weeks, 6 weeks, 3 months, and 6 months after carpal tunnel release. Presurgical and postsurgical DMLs were then compared and correlated with variables and possible predictors of outcome including age, body mass index, gender, and presurgical DMLs. The automated nerve conduction testing system DMLs matched those of reference electromyography/nerve conduction study values with high correlation. Sensitivity of the automated nerve conduction testing system when compared with a standardized CTS case definition was 89%, with a specificity of 95%. A significant correlation was found between the DML before release and the DML 1 hour after release. Moreover, maximal postsurgical DML improvement was highly dependent on the presurgical DML, with no improvement shown for the 6-ms group. Among the clinical variables of age, gender, and body mass index only age was mildly predictive of postrelease DML changes at 6 months. No other correlations between clinical variables and postsurgical DMLs were significant. In addition the predictive value of age was lost when combined with the presurgical DML in a multivariate analysis. Postsurgical changes in the median nerve DML were highly dependent on the prerelease latency. The sensitivity and specificity of a nerve conduction monitoring system in detecting and aiding in the diagnosis of CTS is useful in the long-term management of patients with CTS and can aid in determining the level of improvement

Design study and performance analysis of a high-speed multistage variable-geometry fan for a variable cycle engine

Science.gov (United States)

Sullivan, T. J.; Parker, D. E.

1979-01-01

A design technology study was performed to identify a high speed, multistage, variable geometry fan configuration capable of achieving wide flow modulation with near optimum efficiency at the important operating condition. A parametric screening study of the front and rear block fans was conducted in which the influence of major fan design features on weight and efficiency was determined. Key design parameters were varied systematically to determine the fan configuration most suited for a double bypass, variable cycle engine. Two and three stage fans were considered for the front block. A single stage, core driven fan was studied for the rear block. Variable geometry concepts were evaluated to provide near optimum off design performance. A detailed aerodynamic design and a preliminary mechanical design were carried out for the selected fan configuration. Performance predictions were made for the front and rear block fans.

Swelling variability of reference steels in HVEM studies

International Nuclear Information System (INIS)

Garner, F.A.; Mastel, B.

1975-09-01

A series of low-fluence electron irradiation experiments (0-15 dpa) were conducted on 316 stainless steels to explore the effects of the following variables: heat variations, FTR duct vs tubes, fabrication, annealing, Si content. Conclusions: the swelling rate became constant (max 1.3 percent/dpa) in all irradiations after an incubation period, which is variable. There is no difference in the steady-state swelling rate between various FTR heats, for annealing temperature variations, or for variation of Si content from 0.4 to 2 percent

Statistical and trend analysis of water quality and quantity data for the Strymon River in Greece

Directory of Open Access Journals (Sweden)

V. Z. Antonopoulos

2001-01-01

Full Text Available Strymon is a transboundary river of Greece, Bulgaria and Former Yugoslav Republic of Macedonia (FYROM in southeastern Europe. Water quality parameters and the discharge have been monitored each month just 10 km downstream of the river’s entry into Greece. The data of nine water quality variables (T, ECw, DO, SO42-, Na++K+, Mg2+ , Ca2+, NO3‾, TP and the discharge for the period 1980-1997 were selected for this analysis. In this paper a the time series of monthly values of water quality parameters and the discharge were analysed using statistical methods, b the existence of trends and the evaluation of the best fitted models were performed and c the relationships between concentration and loads of constituents both with the discharge were also examined. Boxplots for summarising the distribution of a data set were used. The ◈-test and the Kolmogorov-Smirnov test were used to select the theoretical distribution which best fitted the data. Simple regression was used to examine the concentration-discharge and the load-discharge relationships. According to the correlation coefficient (r values the relation between concentrations and discharge is weak (r 0.902. Trends were detected using the nonparametric Spearman’s criterion upon the data for the variables: Q, ECw, DO, SO42-, Na++K+ and NO3‾ on which temporal trend analysis was performed. Keywords: Strymon river, water quality, discharge, concentration, load, statistics, trends

Age dependant somatometric and cephalometric variables among ...

African Journals Online (AJOL)

Background: The process of growth passes through stages of developmental processes. This stage is the age. Age is known to affect many parameters in the body and this includes somatometric and cephalometric variables. Methods: The study was conducted with a total number of 409 students of university of Jos, ...

Genetics Home Reference: rapid-onset dystonia parkinsonism

Science.gov (United States)

... making one part of a larger protein called Na+/K+ ATPase, also known as the sodium pump. This protein is critical for the normal function of nerve cells (neurons) in the brain. It transports charged atoms (ions) into ... the activity of the Na+/K+ ATPase or make the protein unstable. Studies suggest ...

Variabilidade espaço-temporal da condutividade elétrica da água subterrânea na região semiárida de Pernambuco Spatial temporal variability of electrical conductivity of groundwater in the semiarid region of Pernambuco, Brazil

Directory of Open Access Journals (Sweden)

Tafnes S. Andrade

2012-05-01

Full Text Available RESUMO Quando mal-conduzida, a irrigação pode causar degradação dos solos e da água subterrânea, por potencializar o risco de salinização. Este problema é mais evidente em regiões semiáridas, nas quais as características físico-climáticas contribuem para seu agravamento. Uma das variáveis mais utilizadas para avaliar a concentração de sais solúveis na água de irrigação e no solo, é a condutividade elétrica. Neste trabalho, buscou-se avaliar a variabilidade espacial e temporal da condutividade elétrica da água subterrânea utilizada para irrigação em um assentamento rural, no semiárido pernambucano. Técnicas estatísticas descritivas e geoestatísticas foram aplicadas para identificação dos padrões de variabilidade e dependência espacial da condutividade elétrica, visando ao mapeamento da salinidade da água subterrânea. Verificou-se que a condutividade elétrica possui variabilidade média a alta, com dependência espacial moderada, em que a textura do solo e o regime pluviométrico influenciam na variação espacial e temporal da condutividade elétrica, que vem aumentando ao longo dos anos, na área estudada.ABSTRACT Irrigation, when poorly managed, can cause soil and groundwater degradation by increasing the salinization risk. This problem is evident in semiarid regions, where the physico-climatic characteristics contribute to enhance the problem. One of the main variables used to measure the soluble salts concentration in irrigation water and soil is the electrical conductivity. This work aimed to evaluate the spatial and temporal variability of electrical conductivity of groundwater for irrigation in a semiarid rural settlement in the State of Pernambuco. Descriptive statistics and geostatistical techniques have been applied to identify patterns of variability and spatial dependence of electrical conductivity aiming to map the groundwater salinity. It was found that the electrical conductivity has medium

About the free electron model in electric conduction of metals

International Nuclear Information System (INIS)

Hoffmann, C.

1991-01-01

In the model proposed by Drude to describe, among others, the electric conduction in metals, it is supposed that electrons move freely in the material with a time interval between encounters T and a probability distribution g(t). The name, 'electron pause time', will be assigned to the time T with that probability distribution. The calculations made by Drude turned out to be erroneous. The error can be corrected observing that the random variable 'pause time' appearing in this intuitive idea is not the previously defined random variable T, 'electron pause time', but another random variable S, which will be called 'observed pause time' whose probability density is Csg(s), where C is a normalization constant. With this distribution, the characteristics of the distribution, q(u), of the wait time can be obtained. (Author) [es

Long-Period Variability in o Ceti

Science.gov (United States)

Templeton, Matthew R.; Karovska, Margarita

2009-02-01

We carried out a new and sensitive search for long-period variability in the prototype of the Mira class of long-period pulsating variables, o Ceti (Mira A), the closest and brightest Mira variable. We conducted this search using an unbroken light curve from 1902 to the present, assembled from the visual data archives of five major variable star observing organizations from around the world. We applied several time-series analysis techniques to search for two specific kinds of variability: long secondary periods (LSPs) longer than the dominant pulsation period of ~333 days, and long-term period variation in the dominant pulsation period itself. The data quality is sufficient to detect coherent periodic variations with photometric amplitudes of 0.05 mag or less. We do not find evidence for coherent LSPs in o Ceti to a limit of 0.1 mag, where the amplitude limit is set by intrinsic, stochastic, low-frequency variability of approximately 0.1 mag. We marginally detect a slight modulation of the pulsation period similar in timescale to that observed in the Miras with meandering periods, but with a much lower period amplitude of ±2 days. However, we do find clear evidence of a low-frequency power-law component in the Fourier spectrum of o Ceti's long-term light curve. The amplitude of this stochastic variability is approximately 0.1 mag at a period of 1000 days, and it exhibits a turnover for periods longer than this. This spectrum is similar to the red noise spectra observed in red supergiants.

Evaluation of the Atmospheric Boundary-Layer Electrical Variability

Science.gov (United States)

Anisimov, Sergey V.; Galichenko, Sergey V.; Aphinogenov, Konstantin V.; Prokhorchuk, Aleksandr A.

2017-12-01

Due to the chaotic motion of charged particles carried by turbulent eddies, electrical quantities in the atmospheric boundary layer (ABL) have short-term variability superimposed on long-term variability caused by sources from regional to global scales. In this study the influence of radon exhalation rate, aerosol distribution and turbulent transport efficiency on the variability of fair-weather atmospheric electricity is investigated via Lagrangian stochastic modelling. For the mid-latitude lower atmosphere undisturbed by precipitation, electrified clouds, or thunderstorms, the model is capable of reproducing the diurnal variation in atmospheric electrical parameters detected by ground-based measurements. Based on the analysis of field observations and numerical simulation it is found that the development of the convective boundary layer, accompanied by an increase in turbulent kinetic energy, forms the vertical distribution of radon and its decaying short-lived daughters to be approximately coincident with the barometric law for several eddy turnover times. In the daytime ABL the vertical distribution of atmospheric electrical conductivity tends to be uniform except within the surface layer, due to convective mixing of radon and its radioactive decay products. At the same time, a decrease in the conductivity near the ground is usually observed. This effect leads to an enhanced ground-level atmospheric electric field compared to that normally observed in the nocturnal stably-stratified boundary layer. The simulation showed that the variability of atmospheric electric field in the ABL associated with internal origins is significant in comparison to the variability related to changes in global parameters. It is suggested that vertical profiles of electrical quantities can serve as informative parameters on ABL turbulent dynamics and can even more broadly characterize the state of the environment.

Regional simulation of interannual variability over South America

Science.gov (United States)

Misra, V.; Dirmeyer, P. A.; Kirtman, B. P.; Juang, H.-M. Henry; Kanamitsu, M.

2002-08-01

Three regional climate simulations covering the austral summer season during three contrasting phases of the El Niño-Southern Oscillation cycle were conducted with the Regional Spectral Model (RSM) developed at the National Centers for Environmental Prediction (NCEP). The simulated interannual variability of precipitation over the Amazon River Basin, the Intertropical Convergence Zone, the Pacific and Atlantic Ocean basins, and extratropical South America compare reasonably well with observations. The RSM optimally filters the peturbations about a time-varying base field, thereby enhancing the information content of the global NCEP reanalysis. The model is better than the reanalysis in reproducing the observed interannual variability of outgoing longwave radiation at both high frequencies (3-30 days) and intraseasonal (30-60 days) scales. The low-level jet shows a peak in its speed in 1998 and a minimum in the 1999 simulations. The lag correlation of the jet index with convection over various areas in continental South America indicates that the jet induces precipitation over the Pampas region downstream. A detailed moisture budget was conducted over various subregions. This budget reveals that moisture flux convergence determines most of the interannual variability of precipitation over the Amazon Basin, the Atlantic Intertropical Convergence Zone, and the Nordeste region of Brazil. However, both surface evaporation and surface moisture flux convergence were found to be critical in determining the interannual variability of precipitation over the southern Pampas, Gran Chaco area, and the South Atlantic Convergence Zone.

Dietary Intake and Sources of Potassium and the Relationship to Dietary Sodium in a Sample of Australian Pre-School Children

Directory of Open Access Journals (Sweden)

Siobhan A. O’Halloran

2016-08-01

Full Text Available The aim of this study was to determine the intake and food sources of potassium and the molar sodium:potassium (Na:K ratio in a sample of Australian pre-school children. Mothers provided dietary recalls of their 3.5 years old children (previous participants of Melbourne Infant Feeding Activity and Nutrition Trial. The average daily potassium intake, the contribution of food groups to daily potassium intake, the Na:K ratio, and daily serves of fruit, dairy, and vegetables, were assessed via three unscheduled 24 h dietary recalls. The sample included 251 Australian children (125 male, mean age 3.5 (0.19 (SD years. Mean potassium intake was 1618 (267 mg/day, the Na:K ratio was 1.47 (0.5 and 54% of children did not meet the Australian recommended adequate intake (AI of 2000 mg/day for potassium. Main food sources of potassium were milk (27%, fruit (19%, and vegetable (14% products/dishes. Food groups with the highest Na:K ratio were processed meats (7.8, white bread/rolls (6.0, and savoury sauces and condiments (5.4. Children had a mean intake of 1.4 (0.75 serves of fruit, 1.4 (0.72 dairy, and 0.52 (0.32 serves of vegetables per day. The majority of children had potassium intakes below the recommended AI. The Na:K ratio exceeded the recommended level of 1 and the average intake of vegetables was 2 serves/day below the recommended 2.5 serves/day and only 20% of recommended intake. An increase in vegetable consumption in pre-school children is recommended to increase dietary potassium and has the potential to decrease the Na:K ratio which is likely to have long-term health benefits.

Socioeconomic Status Associated With Urinary Sodium and Potassium Excretion in Japan: NIPPON DATA2010

Directory of Open Access Journals (Sweden)

Naoko Miyagawa

2018-03-01

Full Text Available Background: Although socioeconomic status (SES may affect food and nutrient intakes, few studies have reported on sodium (Na and potassium (K intakes among individuals with various SESs in Japan. We investigated associations of SES with Na and K intake levels using urinary specimens in a representative Japanese population. Methods: This was a cross-sectional study of 2,560 men and women (the NIPPON DATA2010 cohort who participated in the National Health and Nutrition Survey Japan in 2010. Casual urine was used to calculate estimated excretion in 24-hour urinary Na (E24hr-Na and K (E24hr-K. The urinary sodium-to-potassium (Na/K ratio was calculated from casual urinary electrolyte values. An analysis of covariance was performed to investigate associations of aspects of SES, including equivalent household expenditure (EHE, educational attainment, and job category, with E24hr-Na, E24hr-K, and the Na/K ratio for men and women separately. A stratified analysis was performed on educational attainment and the job category for younger (<65 years and older (≥65 years participants. Results: In men and women, average E24hr-Na was 176.2 mmol/day and 172.3, average E24hr-K was 42.5 and 41.3, and the average Na/K ratio was 3.61 and 3.68, respectively. Lower EHE was associated with a higher Na/K ratio in women and lower E24hr-K in men and women. A shorter education was associated with a higher Na/K ratio in women and younger men, and lower E24hr-K in older men and women. Conclusion: Lower EHE and a shorter education were associated with a lower K intake and higher Na/K ratio estimated from casual urine specimens in Japanese men and women.

The effect of sediment thermal conductivity on vertical groundwater flux estimates

Science.gov (United States)

Sebok, Eva; Müller, Sascha; Engesgaard, Peter; Duque, Carlos

2015-04-01

The interaction between groundwater and surface water is of great importance both from ecological and water management perspective. The exchange fluxes are often estimated based on vertical temperature profiles taken from shallow sediments assuming a homogeneous standard value of sediment thermal conductivity. Here we report on a field investigation in a stream and in a fjord, where vertical profiles of sediment thermal conductivity and temperatures were measured in order to, (i) define the vertical variability in sediment thermal conductivity, (ii) quantify the effect of heterogeneity in sediment thermal conductivity on the estimated vertical groundwater fluxes. The study was carried out at field sites located in Ringkøbing fjord and Holtum stream in Western Denmark. Both locations have soft, sandy sediments with an upper organic layer at the fjord site. First 9 and 12 vertical sediment temperature profiles up to 0.5 m depth below the sediment bed were collected in the fjord and in the stream, respectively. Later sediment cores of 0.05 m diameter were removed at the location of the temperature profiles. Sediment thermal conductivity was measured in the sediment cores at 0.1 m intervals with a Decagon KD2 Pro device. A 1D flow and heat transport model (HydroGeoSphere) was set up and vertical groundwater fluxes were estimated based on the measured vertical sediment temperature profiles by coupling the model with PEST. To determine the effect of heterogeneity in sediment thermal conductivity on estimated vertical groundwater fluxes, the model was run by assigning (i) a homogeneous thermal conductivity for all sediment layers, calculated as the average sediment thermal conductivity of the profile, (ii) measured sediment thermal conductivities to the different model layers. The field survey showed that sediment thermal conductivity over a 0.5 m profile below the sediment bed is not uniform, having the largest variability in the fjord where organic sediments were also

CHAPTER 1

African Journals Online (AJOL)

Dr Olaleye

nocturnal changes in urinary Na+/K+ ratio, and to test if aldosterone plays a key role. Methods: We investigated the Na+/K+ ratios ... This nocturnal dipping in blood pressure may be as a result of the circadian rhythm, which .... animals have shown that in the absence of endogenous aldosterone, the circadian excretion of K+ ...

Identifying Variations in Hydraulic Conductivity on the East River at Crested Butte, CO

Science.gov (United States)

Ulmer, K. N.; Malenda, H. F.; Singha, K.

2016-12-01

Slug tests are a widely used method to measure saturated hydraulic conductivity, or how easily water flows through an aquifer, by perturbing the piezometric surface and measuring the time the local groundwater table takes to re-equilibrate. Saturated hydraulic conductivity is crucial to calculating the speed and direction of groundwater movement. Therefore, it is important to document data variance from in situ slug tests. This study addresses two potential sources of data variability: different users and different types of slug used. To test for user variability, two individuals slugged the same six wells with water multiple times at a stream meander on the East River near Crested Butte, CO. To test for variations in type of slug test, multiple water and metal slug tests were performed at a single well in the same meander. The distributions of hydraulic conductivities of each test were then tested for variance using both the Kruskal-Wallis test and the Brown-Forsythe test. When comparing the hydraulic conductivity distributions gathered by the two individuals, we found that they were statistically similar. However, we found that the two types of slug tests produced hydraulic conductivity distributions for the same well that are statistically dissimilar. In conclusion, multiple people should be able to conduct slug tests without creating any considerable variations in the resulting hydraulic conductivity values, but only a single type of slug should be used for those tests.

Design, Fabrication and Integration of a NaK-Cooled Circuit

International Nuclear Information System (INIS)

Garber, Anne; Godfroy, Thomas

2006-01-01

The Early Flight Fission Test Facilities (EFF-TF) team has been tasked by the NASA Marshall Space Flight Center Nuclear Systems Office to design, fabricate, and test an actively pumped alkali metal flow circuit. The system, which was originally designed for use with a eutectic mixture of sodium potassium (NaK), was redesigned for use with lithium. Due to a shift in focus, it is once again being prepared for use with NaK. Changes made to the actively pumped, high temperature circuit include the replacement of the expansion reservoir, addition of remotely operated valves, and modification of the support table. Basic circuit components include: reactor segment, NaK to gas heat exchanger, electromagnetic (EM) liquid metal pump, load/drain reservoir, expansion reservoir, instrumentation, and a spill reservoir. A 37-pin partial-array core (pin and flow path dimensions are the same as those in a full design) was selected for fabrication and test. This paper summarizes the integration and preparations for the fill of the pumped NaK circuit. (authors)

Variability of Travel Times on New Jersey Highways

Science.gov (United States)

2011-06-01

This report presents the results of a link and path travel time study conducted on selected New Jersey (NJ) highways to produce estimates of the corresponding variability of travel time (VTT) by departure time of the day and days of the week. The tra...

Variability of Massive Young Stellar Objects in Cygnus-X

Science.gov (United States)

Thomas, Nancy H.; Hora, J. L.; Smith, H. A.

2013-01-01

Young stellar objects (YSOs) are stars in the process of formation. Several recent investigations have shown a high rate of photometric variability in YSOs at near- and mid-infrared wavelengths. Theoretical models for the formation of massive stars (1-10 solar masses) remain highly idealized, and little is known about the mechanisms that produce the variability. An ongoing Spitzer Space Telescope program is studying massive star formation in the Cygnus-X region. In conjunction with the Spitzer observations, we have conducted a ground-based near-infrared observing program of the Cygnus-X DR21 field using PAIRITEL, the automated infrared telescope at Whipple Observatory. Using the Stetson index for variability, we identified variable objects and a number of variable YSOs in our time-series PAIRITEL data of DR21. We have searched for periodicity among our variable objects using the Lomb-Scargle algorithm, and identified periodic variable objects with an average period of 8.07 days. Characterization of these variable and periodic objects will help constrain models of star formation present. This work is supported in part by the NSF REU and DOD ASSURE programs under NSF grant no. 0754568 and by the Smithsonian Institution.

Low conductive support for thermal insulation of a sample holder of a variable temperature scanning tunneling microscope.

Science.gov (United States)

Hanzelka, Pavel; Vonka, Jakub; Musilova, Vera

2013-08-01

We have designed a supporting system to fix a sample holder of a scanning tunneling microscope in an UHV chamber at room temperature. The microscope will operate down to a temperature of 20 K. Low thermal conductance, high mechanical stiffness, and small dimensions are the main features of the supporting system. Three sets of four glass balls placed in vertices of a tetrahedron are used for thermal insulation based on small contact areas between the glass balls. We have analyzed the thermal conductivity of the contacts between the balls mutually and between a ball and a metallic plate while the results have been applied to the entire support. The calculation based on a simple model of the setup has been verified with some experimental measurements. In comparison with other feasible supporting structures, the designed support has the lowest thermal conductance.

Evolving spiking networks with variable resistive memories.

Science.gov (United States)

Howard, Gerard; Bull, Larry; de Lacy Costello, Ben; Gale, Ella; Adamatzky, Andrew

2014-01-01

Neuromorphic computing is a brainlike information processing paradigm that requires adaptive learning mechanisms. A spiking neuro-evolutionary system is used for this purpose; plastic resistive memories are implemented as synapses in spiking neural networks. The evolutionary design process exploits parameter self-adaptation and allows the topology and synaptic weights to be evolved for each network in an autonomous manner. Variable resistive memories are the focus of this research; each synapse has its own conductance profile which modifies the plastic behaviour of the device and may be altered during evolution. These variable resistive networks are evaluated on a noisy robotic dynamic-reward scenario against two static resistive memories and a system containing standard connections only. The results indicate that the extra behavioural degrees of freedom available to the networks incorporating variable resistive memories enable them to outperform the comparative synapse types.

Acetazolamide lowers intracranial pressure and modulates the cerebrospinal fluid secretion pathway in healthy rats

DEFF Research Database (Denmark)

Uldall, Maria; Botfield, Hannah; Jansen-Olesen, Inger

2017-01-01

a maximum reduction at 55min 66±4% (P... in the amount of AQP1 (p=0.0152) and Na/K ATPase (p=0.0411) protein in the membrane fraction of the CP, but not AQP4 (p=0.0649). A single dose of acetazolamide lowers ICP and modulates the CSF secretion pathway in healthy rats - Firstly, by inhibiting the Na/K ATPase to slow the CSF production, secondly...... was collected for qPCR and western blot analysis. The effect of acetazolamide on the Na/K ATPase activity was evaluated in an in vitro assay of primary CP epithelial cells isolated from rats. Acetazolamide significantly lowered ICP within 10min of injection compared to the vehicle group (P

Temperature-specific inhibition of human red cell (Na/sup +//K/sup +/) ATPase by 2450-MHz microwave radiation

Energy Technology Data Exchange (ETDEWEB)

Allis, J.W.; Sinha-Robinson, B.L.

1987-01-01

The ATPase activity in human red blood cell membranes was investigated in vitro as a function of temperature and exposure to 2450-MHz (CW) microwave radiation. Assays were conducted spectrophotometrically during microwave exposure with a custom-made spectrophotometer-waveguide apparatus. Temperature profiles of total ATPase and Ca+2 ATPase (ouabain-inhibited) activity between 17 and 31 C were graphed as an Arrhenius plot. Each data set was fitted to two straight lines which intersected between 23 and 24 C. The difference between the total and Ca+2 ATPase activities, which represented the Na+/K+ ATPase activity, was also plotted and treated similarly to yield an intersection near 25 C. Exposure of membrane suspensions to a 6 W/kg dose rate at 1 C intervals between 23 and 27 C, resulted in an activity change only for the Na+/K+ ATPase at 25 C. The activity decreased by approximately 35% compared to sham-irradiated samples. An hypothesis based on the interaction of microwave radiation with enzyme structure during a conformational rearrangement is proposed as an explanation for the effect.

Dishonest Academic Conduct: From the Perspective of the Utility Function.

Science.gov (United States)

Sun, Ying; Tian, Rui

Dishonest academic conduct has aroused extensive attention in academic circles. To explore how scholars make decisions according to the principle of maximal utility, the author has constructed the general utility function based on the expected utility theory. The concrete utility functions of different types of scholars were deduced. They are as follows: risk neutral, risk averse, and risk preference. Following this, the assignment method was adopted to analyze and compare the scholars' utilities of academic conduct. It was concluded that changing the values of risk costs, internal condemnation costs, academic benefits, and the subjective estimation of penalties following dishonest academic conduct can lead to changes in the utility of academic dishonesty. The results of the current study suggest that within scientific research, measures to prevent and govern dishonest academic conduct should be formulated according to the various effects of the above four variables.

Spatial variability of soil electrical conductivity under the mole rats (Spalax microphthalmus digging activity at the different scales

Directory of Open Access Journals (Sweden)

A. V. Zhukov

2012-07-01

Full Text Available The soil mounds emerged owing to the mole rats’ digging activity have been shown to be characterised by less electrical conductivity than surrounded soil. This effect is due to the changes of the mounds bulk’s density and moisture. The effect of the mole rats’ digging activity on the soil electrical conductivity has been found not to be restricted by the geometrical border of the mounds. The mounds are surrounded by 1–1.5 m halo of increased soil electrical conductivity. The halo size is increased with the aging of the mound and with the compacting of their aggregation.

[Computation of the K+, Na+ and Cl- fluxes through plasma membrane of animal cell with Na+/K+ pump, NKCC, NC cotransporters, and ionic channels with and without non-Goldman rectification in K+ channels. Norma and apoptosis].

Science.gov (United States)

Rubashkin, A A; Iurinskaia, V E; Vereninov, A A

2010-01-01

The balance of K+, Na+ and Cl- fluxes through cell membrane with the Na+/K+ pump, ion channels and NKCC and NC cotransporters is considered. It is shown that all unidirectional K+, Na+ and Cl- fluxes through cell membrane, permeability coefficients of ion channels and membrane potential can be computed for balanced ion distribution between cell and the medium if K+, Na+ and Cl- concentration in cell water and three fluxes are known: total Cl- flux, total K+ influx and ouabain-inhibitable "pump" component of the K+ influx. Changes in the mortovalent ion balance in lymphoid cells U937 induced to apoptosis by 1 microM staurosporine are analyzed as an example. It is found that the apoptotic shift in ion and water balance in studied cells is caused by a decrease in the pump activity which is accompanied by a decrease in the integral permeability of Na+ channels without significant increase in K+ and Cl- channel permeabilities. Computation shows that only a small part of the total fluxes of K+, Na+ and Cl- accounts for the fluxes via NKCC and NC cotransporters. Therefore, cotransport fluxes can not be studied using inhibitors.

Modeling Short-Range Soil Variability and its Potential Use in Variable-Rate Treatment of Experimental Plots

Directory of Open Access Journals (Sweden)

A Moameni

2011-02-01

Full Text Available Abstract In Iran, the experimental plots under fertilizer trials are managed in such a way that the whole plot area uniformly receives agricultural inputs. This could lead to biased research results and hence to suppressing of the efforts made by the researchers. This research was conducted in a selected site belonging to the Gonbad Agricultural Research Station, located in the semiarid region, northeastern Iran. The aim was to characterize the short-range spatial variability of the inherent and management-depended soil properties and to determine if this variation is large and can be managed at practical scales. The soils were sampled using a grid 55 m apart. In total, 100 composite soil samples were collected from topsoil (0-30 cm and were analyzed for calcium carbonate equivalent, organic carbon, clay, available phosphorus, available potassium, iron, copper, zinc and manganese. Descriptive statistics were applied to check data trends. Geostatistical analysis was applied to variography, model fitting and contour mapping. Sampling at 55 m made it possible to split the area of the selected experimental plot into relatively uniform areas that allow application of agricultural inputs with variable rates. Keywords: Short-range soil variability, Within-field soil variability, Interpolation, Precision agriculture, Geostatistics

Surface-Enhanced Raman Spectroscopy (SERS Tracking of Chelerythrine, a Na+/K+ Pump Inhibitor, into Cytosol and Plasma Membrane Fractions of Human Lens Epithelial Cell Cultures

Directory of Open Access Journals (Sweden)

Kevin M. Dorney

2013-12-01

Full Text Available Background/Aims: The quaternary benzo-phenanthridine alkaloid (QBA chelerythrine (CET is a pro-apoptotic drug and Na+/K+ pump (NKP inhibitor in human lens epithelial cells (HLECs. In order to obtain further insight into the mechanism of NKP inhibition by CET, its sub-cellular distribution was quantified in cytosolic and membrane fractions of HLEC cultures by surface-enhanced Raman spectroscopy (SERS. Methods: Silver nanoparticles (AgNPs prepared by the Creighton method were concentrated, and size-selected using a one-step tangential flow filtration approach. HLECs cultures were exposed to 50 μM CET in 300 mOsM phosphate-buffered NaCl for 30 min. A variety of cytosolic extracts, crude and purified membranes, prepared in lysing solutions in the presence and absence of a non-ionic detergent, were incubated with AgNPs and subjected to SERS analysis. Determinations of CET were based on a linear calibration plot of the integrated CET SERS intensity at its 659 cm-1 marker band as a function of CET concentration. Results: SERS detected chemically unaltered CET in both cytosol and plasma membrane fractions. Normalized for protein, the CET content was some 100 fold higher in the crude and purified plasma membrane fraction than in the soluble cytosolic extract. The total free CET concentration in the cytosol, free of membranes or containing detergent-solubilized membrane material, approached that of the incubation medium of HLECs. Conclusion: Given a negative membrane potential of HLECs the data suggest, but do not prove, that CET may traverse the plasma membrane as a positively charged monomer (CET+ accumulating near or above passive equilibrium distribution. These findings may contribute to a recently proposed hypothesis that CET binds to and inhibits the NKP through its cytosolic aspect.

Surface-enhanced Raman spectroscopy (SERS) tracking of chelerythrine, a Na(+)/K(+) pump inhibitor, into cytosol and plasma membrane fractions of human lens epithelial cell cultures.

Science.gov (United States)

Dorney, Kevin M; Sizemore, Ioana E P; Alqahtani, Tariq; Adragna, Norma C; Lauf, Peter K

2013-01-01

The quaternary benzo-phenanthridine alkaloid (QBA) chelerythrine (CET) is a pro-apoptotic drug and Na(+)/K(+) pump (NKP) inhibitor in human lens epithelial cells (HLECs). In order to obtain further insight into the mechanism of NKP inhibition by CET, its sub-cellular distribution was quantified in cytosolic and membrane fractions of HLEC cultures by surface-enhanced Raman spectroscopy (SERS). Silver nanoparticles (AgNPs) prepared by the Creighton method were concentrated, and size-selected using a one-step tangential flow filtration approach. HLECs cultures were exposed to 50 μM CET in 300 mOsM phosphate-buffered NaCl for 30 min. A variety of cytosolic extracts, crude and purified membranes, prepared in lysing solutions in the presence and absence of a non-ionic detergent, were incubated with AgNPs and subjected to SERS analysis. Determinations of CET were based on a linear calibration plot of the integrated CET SERS intensity at its 659 cm(-1) marker band as a function of CET concentration. SERS detected chemically unaltered CET in both cytosol and plasma membrane fractions. Normalized for protein, the CET content was some 100 fold higher in the crude and purified plasma membrane fraction than in the soluble cytosolic extract. The total free CET concentration in the cytosol, free of membranes or containing detergent-solubilized membrane material, approached that of the incubation medium of HLECs. Given a negative membrane potential of HLECs the data suggest, but do not prove, that CET may traverse the plasma membrane as a positively charged monomer (CET(+)) accumulating near or above passive equilibrium distribution. These findings may contribute to a recently proposed hypothesis that CET binds to and inhibits the NKP through its cytosolic aspect. © 2014 S. Karger AG, Basel.

Dietary Sodium to Potassium Ratio and Risk of Stroke in a Multiethnic Urban Population: The Northern Manhattan Study.

Science.gov (United States)

Willey, Joshua; Gardener, Hannah; Cespedes, Sandino; Cheung, Ying K; Sacco, Ralph L; Elkind, Mitchell S V

2017-11-01

There is growing evidence that increased dietary sodium (Na) intake increases the risk of vascular diseases, including stroke, at least in part via an increase in blood pressure. Higher dietary potassium (K), seen with increased intake of fruits and vegetables, is associated with lower blood pressure. The goal of this study was to determine the association of a dietary Na:K with risk of stroke in a multiethnic urban population. Stroke-free participants from the Northern Manhattan Study, a population-based cohort study of stroke incidence, were followed-up for incident stroke. Baseline food frequency questionnaires were analyzed for Na and K intake. We estimated the hazard ratios and 95% confidence intervals for the association of Na:K with incident total stroke using multivariable Cox proportional hazards models. Among 2570 participants with dietary data (mean age, 69±10 years; 64% women; 21% white; 55% Hispanic; 24% black), the mean Na:K ratio was 1.22±0.43. Over a mean follow-up of 12 years, there were 274 strokes. In adjusted models, a higher Na:K ratio was associated with increased risk for stroke (hazard ratio, 1.6; 95% confidence interval, 1.2-2.1) and specifically ischemic stroke (hazard ratio, 1.6; 95% confidence interval, 1.2-2.1). Na:K intake is an independent predictor of stroke risk. Further studies are required to understand the joint effect of Na and K intake on risk of cardiovascular disease. © 2017 American Heart Association, Inc.

Purposeful selection of variables in logistic regression

Directory of Open Access Journals (Sweden)

Williams David Keith

2008-12-01

Full Text Available Abstract Background The main problem in many model-building situations is to choose from a large set of covariates those that should be included in the "best" model. A decision to keep a variable in the model might be based on the clinical or statistical significance. There are several variable selection algorithms in existence. Those methods are mechanical and as such carry some limitations. Hosmer and Lemeshow describe a purposeful selection of covariates within which an analyst makes a variable selection decision at each step of the modeling process. Methods In this paper we introduce an algorithm which automates that process. We conduct a simulation study to compare the performance of this algorithm with three well documented variable selection procedures in SAS PROC LOGISTIC: FORWARD, BACKWARD, and STEPWISE. Results We show that the advantage of this approach is when the analyst is interested in risk factor modeling and not just prediction. In addition to significant covariates, this variable selection procedure has the capability of retaining important confounding variables, resulting potentially in a slightly richer model. Application of the macro is further illustrated with the Hosmer and Lemeshow Worchester Heart Attack Study (WHAS data. Conclusion If an analyst is in need of an algorithm that will help guide the retention of significant covariates as well as confounding ones they should consider this macro as an alternative tool.

On the Variability of Wilson Currents by Storm Type and Phase

Science.gov (United States)

Deierling, Wiebke; Kalb, Christina; Mach, Douglas; Liu, Chuntao; Peterson, Michael; Blakeslee, Richard

2014-01-01

Storm total conduction currents from electrified clouds are thought to play a major role in maintaining the potential difference between the earth's surface and the upper atmosphere within the Global Electric Circuit (GEC). However, it is not entirely known how the contributions of these currents vary by cloud type and phase of the clouds life cycle. Estimates of storm total conduction currents were obtained from data collected over two decades during multiple field campaigns involving the NASA ER-2 aircraft. In this study the variability of these currents by cloud type and lifecycle is investigated. We also compared radar derived microphysical storm properties with total storm currents to investigate whether these storm properties can be used to describe the current variability of different electrified clouds. The ultimate goal is to help improve modeling of the GEC via quantification and improved parameterization of the conduction current contribution of different cloud types.

Children's Prosocial Conduct in Structured Situations and as Viewed by Others: Consistency, Convergence, and Relationships with Person Variables.

Science.gov (United States)

Payne, Frank D.

1980-01-01

A sample of 41 fourth- through sixth-grade children participated in structured situations and were rated by themselves and their teachers on the same four facets of prosocial conduct (donating, helping, sharing, and cooperating). Among the results, the relationship between need for approval and prosocial conduct varied inversely with the…

Intelligent Variable Emittance Panels Using New, ""True"" Solid Electrolyte, Phase II

Data.gov (United States)

National Aeronautics and Space Administration — This work further developed a highly promising Variable Emittance technology for spacecraft thermal control based on Conducting Polymer (CP) electrochromics...

A self-similar model for conduction in the plasma erosion opening switch

International Nuclear Information System (INIS)

Mosher, D.; Grossmann, J.M.; Ottinger, P.F.; Colombant, D.G.

1987-01-01

The conduction phase of the plasma erosion opening switch (PEOS) is characterized by combining a 1-D fluid model for plasma hydrodynamics, Maxwell's equations, and a 2-D electron-orbit analysis. A self-similar approximation for the plasma and field variables permits analytic expressions for their space and time variations to be derived. It is shown that a combination of axial MHD compression and magnetic insulation of high-energy electrons emitted from the switch cathode can control the character of switch conduction. The analysis highlights the need to include additional phenomena for accurate fluid modeling of PEOS conduction

Guidelines for the Investigation of Mediating Variables in Business Research

OpenAIRE

MacKinnon, David P.; Coxe, Stefany; Baraldi, Amanda N.

2011-01-01

Business theories often specify the mediating mechanisms by which a predictor variable affects an outcome variable. In the last 30 years, investigations of mediating processes have become more widespread with corresponding developments in statistical methods to conduct these tests. The purpose of this article is to provide guidelines for mediation studies by focusing on decisions made prior to the research study that affect the clarity of conclusions from a mediation study, the statistical mo...

The Effects of Elevated Specific Conductivity on the Chronic Toxicity of Mining Influenced Streams Using Ceriodaphnia dubia.

Science.gov (United States)

Armstead, Mindy Yeager; Bitzer-Creathers, Leah; Wilson, Mandee

2016-01-01

Salinization of freshwater ecosystems as a result of human activities has markedly increased in recent years. Much attention is currently directed at evaluating the effects of increased salinity on freshwater biota. In the Central Appalachian region of the eastern United States, specific conductance from alkaline discharges associated with mountain top mining practices has been implicated in macroinvertebrate community declines in streams receiving coal mining discharges. Whole effluent toxicity testing of receiving stream water was used to test the hypothesis that mine discharges are toxic to laboratory test organisms and further, that toxicity is related to ionic concentrations as indicated by conductivity. Chronic toxicity testing using Ceriodaphnia dubia was conducted by contract laboratories at 72 sites with a total of 129 tests over a 3.5 year period. The database was evaluated to determine the ionic composition of mine effluent dominated streams and whether discharge constituents were related to toxicity in C. dubia. As expected, sulfate was found to be the dominant anion in streams receiving mining discharges with bicarbonate variable and sometimes a substantial component of the dissolved solids. Overall, the temporal variability in conductance was low at each site which would indicate fairly stable water quality conditions. Results of the toxicity tests show no relationship between conductance and survival of C. dubia in the mining influenced streams with the traditional toxicity test endpoints. However, consideration of the entire dataset revealed a significant inverse relationship between conductivity and neonate production. While conductivity explained very little of the high variability in the offspring production (r2 = 0.1304), the average numbers of offspring were consistently less than 20 neonates at the highest conductivities.

The Effects of Elevated Specific Conductivity on the Chronic Toxicity of Mining Influenced Streams Using Ceriodaphnia dubia.

Directory of Open Access Journals (Sweden)

Mindy Yeager Armstead

Full Text Available Salinization of freshwater ecosystems as a result of human activities has markedly increased in recent years. Much attention is currently directed at evaluating the effects of increased salinity on freshwater biota. In the Central Appalachian region of the eastern United States, specific conductance from alkaline discharges associated with mountain top mining practices has been implicated in macroinvertebrate community declines in streams receiving coal mining discharges. Whole effluent toxicity testing of receiving stream water was used to test the hypothesis that mine discharges are toxic to laboratory test organisms and further, that toxicity is related to ionic concentrations as indicated by conductivity. Chronic toxicity testing using Ceriodaphnia dubia was conducted by contract laboratories at 72 sites with a total of 129 tests over a 3.5 year period. The database was evaluated to determine the ionic composition of mine effluent dominated streams and whether discharge constituents were related to toxicity in C. dubia. As expected, sulfate was found to be the dominant anion in streams receiving mining discharges with bicarbonate variable and sometimes a substantial component of the dissolved solids. Overall, the temporal variability in conductance was low at each site which would indicate fairly stable water quality conditions. Results of the toxicity tests show no relationship between conductance and survival of C. dubia in the mining influenced streams with the traditional toxicity test endpoints. However, consideration of the entire dataset revealed a significant inverse relationship between conductivity and neonate production. While conductivity explained very little of the high variability in the offspring production (r2 = 0.1304, the average numbers of offspring were consistently less than 20 neonates at the highest conductivities.

Development of Flexible Software Process Lines with Variability Operations

DEFF Research Database (Denmark)

Schramm, Joachim; Dohrmann, Patrick; Kuhrmann, Marco

2015-01-01

families of processes and, as part of this, variability operations provide means to modify and reuse pre-defined process assets. Objective: Our goal is to evaluate the feasibility of variability operations to support the development of flexible software process lines. Method: We conducted a longitudinal......Context: Software processes evolve over time and several approaches were proposed to support the required flexibility. Yet, little is known whether these approaches sufficiently support the development of large software processes. A software process line helps to systematically develop and manage...

Thermal Conductivity of the Potential Repository Horizon Model Report

International Nuclear Information System (INIS)

Ramsey, J.

2002-01-01

The purpose of this report is to assess the spatial variability and uncertainty of thermal conductivity in the host horizon for the proposed repository at Yucca Mountain. More specifically, the lithostratigraphic units studied are located within the Topopah Spring Tuff (Tpt) and consist of the upper lithophysal zone (Tptpul), the middle nonlithophysal zone (Tptpmn), the lower lithophysal zone (Tptpll), and the lower nonlithophysal zone (Tptpln). The Tptpul is the layer directly above the repository host layers, which consist of the Tptpmn, Tptpll, and the Tptpln. Current design plans indicate that the largest portion of the repository will be excavated in the Tptpll (Board et al. 2002 [157756]). The main distinguishing characteristic among the lithophysal and nonlithophysal units is the percentage of large scale (cm-m) voids within the rock. The Tptpul and Tptpll, as their names suggest, have a higher percentage of lithophysae than the Tptpmn and the Tptpln. Understanding the influence of the lithophysae is of great importance to understanding bulk thermal conductivity and perhaps repository system performance as well. To assess the spatial variability and uncertainty of thermal conductivity, a model is proposed that is functionally dependent on the volume fraction of lithophysae and the thermal conductivity of the matrix portion of the rock. In this model, void space characterized as lithophysae is assumed to be air-saturated under all conditions, while void space characterized as matrix may be either water- or air-saturated. Lithophysae are assumed to be air-saturated under all conditions since the units being studied are all located above the water table in the region of interest, and the relatively strong capillary forces of the matrix will, under most conditions, preferentially retain any moisture present in the rock

Seasonal variability of the parameters of the Ball-Berry model of stomatal conductance in maize (Zea mays L.) and sunflower (Helianthus annuus L.) under well-watered and water-stressed conditions.

Science.gov (United States)

Miner, Grace L; Bauerle, William L

2017-09-01

The Ball-Berry (BB) model of stomatal conductance (g s ) is frequently coupled with a model of assimilation to estimate water and carbon exchanges in plant canopies. The empirical slope (m) and 'residual' g s (g 0 ) parameters of the BB model influence transpiration estimates, but the time-intensive nature of measurement limits species-specific data on seasonal and stress responses. We measured m and g 0 seasonally and under different water availability for maize and sunflower. The statistical method used to estimate parameters impacted values nominally when inter-plant variability was low, but had substantial impact with larger inter-plant variability. Values for maize (m = 4.53 ± 0.65; g 0  = 0.017 ± 0.016 mol m -2 s -1 ) were 40% higher than other published values. In maize, we found no seasonal changes in m or g 0 , supporting the use of constant seasonal values, but water stress reduced both parameters. In sunflower, inter-plant variability of m and g 0 was large (m = 8.84 ± 3.77; g 0  = 0.354 ± 0.226 mol m -2 s -1 ), presenting a challenge to clear interpretation of seasonal and water stress responses - m values were stable seasonally, even as g 0 values trended downward, and m values trended downward with water stress while g 0 values declined substantially. © 2017 John Wiley & Sons Ltd.

Biomimetic electrochemistry from conducting polymers. A review

International Nuclear Information System (INIS)

Otero, T.F.; Martinez, J.G.; Arias-Pardilla, J.

2012-01-01

Highlights: ► Composition and properties of conducting polymers change during reactions. ► These properties are being exploited to develop biomimetic reactive and soft devices. ► The state of the art for artificial muscles sensing working conditions was reviewed. ► Smart membranes, drug delivery devices and nervous interfaces were also reviewed. - Abstract: Films of conducting polymers in the presence of electrolytes can be oxidized or reduced by the flow of anodic or cathodic currents. Ions and solvent are exchanged during a reaction for charge and osmotic pressure balance. A reactive conducting polymer contains ions and solvent. Such variation of composition during a reaction is reminiscent of the biological processes in cells. Along changes to the composition of the material during a reaction, there are also changes to other properties, including: volume (electrochemomechanical), colour (electrochromic), stored charge (electrical storage), porosity or permselectivity (electroporosity), stored chemicals, wettability and so on. Most of those properties mimic similar property changes in organs during their functioning. These properties are being exploited to develop biomimetic reactive and soft devices: artificial muscles and polymeric actuators; supercapacitors and all organic batteries; smart membranes; electron-ion transducers; nervous interfaces and artificial synapses, or drug delivery devices. In this review we focus on the state of the art for artificial muscles, smart membranes and electron-ion transducers. The reactive nature of those devices provide them with a unique advantage related to the present days technologies: any changes in the surrounding physical or chemical variable acting on the electrochemical reaction rate will be sensed by the device while working. Working under constant current (driving signal), the evolution of the device potential or the evolution of the consumed electrical energy (sensing signals) senses and quantifies the

Thermal conductance and basal metabolic rate are part of a coordinated system for heat transfer regulation

Science.gov (United States)

Naya, Daniel E.; Spangenberg, Lucía; Naya, Hugo; Bozinovic, Francisco

2013-01-01

Thermal conductance measures the ease with which heat leaves or enters  an organism's body. Although the analysis of this physiological variable in relation to climatic and ecological factors can be traced to studies by Scholander and colleagues, only small advances have occurred ever since. Here, we analyse the relationship between minimal thermal conductance estimated during summer (Cmin) and several ecological, climatic and geographical factors for 127 rodent species, in order to identify the exogenous factors that have potentially affected the evolution of thermal conductance. In addition, we evaluate whether there is compensation between Cmin and basal metabolic rate (BMR)—in such a way that a scale-invariant ratio between both variables is equal to one—as could be expected from the Scholander–Irving model of heat transfer. Our major findings are (i) annual mean temperature is the best single predictor of mass-independent Cmin. (ii) After controlling for the effect of body mass, there is a strong positive correlation between log10 (Cmin) and log10 (BMR). Further, the slope of this correlation is close to one, indicating an almost perfect compensation between both physiological variables. (iii) Structural equation modelling indicated that Cmin values are adjusted to BMR values and not the other way around. Thus, our results strongly suggest that BMR and thermal conductance integrate a coordinated system for heat regulation in endothermic animals and that summer conductance values are adjusted (in an evolutionary sense) to track changes in BMRs. PMID:23902915

Thermal conductance and basal metabolic rate are part of a coordinated system for heat transfer regulation.

Science.gov (United States)

Naya, Daniel E; Spangenberg, Lucía; Naya, Hugo; Bozinovic, Francisco

2013-09-22

Thermal conductance measures the ease with which heat leaves or enters an organism's body. Although the analysis of this physiological variable in relation to climatic and ecological factors can be traced to studies by Scholander and colleagues, only small advances have occurred ever since. Here, we analyse the relationship between minimal thermal conductance estimated during summer (Cmin) and several ecological, climatic and geographical factors for 127 rodent species, in order to identify the exogenous factors that have potentially affected the evolution of thermal conductance. In addition, we evaluate whether there is compensation between Cmin and basal metabolic rate (BMR)-in such a way that a scale-invariant ratio between both variables is equal to one-as could be expected from the Scholander-Irving model of heat transfer. Our major findings are (i) annual mean temperature is the best single predictor of mass-independent Cmin. (ii) After controlling for the effect of body mass, there is a strong positive correlation between log10 (Cmin) and log10 (BMR). Further, the slope of this correlation is close to one, indicating an almost perfect compensation between both physiological variables. (iii) Structural equation modelling indicated that Cmin values are adjusted to BMR values and not the other way around. Thus, our results strongly suggest that BMR and thermal conductance integrate a coordinated system for heat regulation in endothermic animals and that summer conductance values are adjusted (in an evolutionary sense) to track changes in BMRs.

Socioeconomic Status, a Forgotten Variable in Lateralization Development

Science.gov (United States)

Boles, David B.

2011-01-01

Socioeconomic status (SES), a variable combining income, education, and occupation, is correlated with a variety of social health outcomes including school dropout rates, early parenthood, delinquency, and mental illness. Several studies conducted in the 1970s and 1980s largely failed to report a relationship between SES and hemispheric asymmetry…

Reasoning about Shape as a Pattern in Variability

Science.gov (United States)

Bakker, Arthur

2004-01-01

This paper examines ways in which coherent reasoning about key concepts such as variability, sampling, data, and distribution can be developed as part of statistics education. Instructional activities that could support such reasoning were developed through design research conducted with students in grades 7 and 8. Results are reported from a…

The Sodium-Potassium Pump Controls the Intrinsic Firing of the Cerebellar Purkinje Neuron

Science.gov (United States)

Forrest, Michael D.; Wall, Mark J.; Press, Daniel A.; Feng, Jianfeng

2012-01-01

In vitro, cerebellar Purkinje cells can intrinsically fire action potentials in a repeating trimodal or bimodal pattern. The trimodal pattern consists of tonic spiking, bursting, and quiescence. The bimodal pattern consists of tonic spiking and quiescence. It is unclear how these firing patterns are generated and what determines which firing pattern is selected. We have constructed a realistic biophysical Purkinje cell model that can replicate these patterns. In this model, Na+/K+ pump activity sets the Purkinje cell's operating mode. From rat cerebellar slices we present Purkinje whole cell recordings in the presence of ouabain, which irreversibly blocks the Na+/K+ pump. The model can replicate these recordings. We propose that Na+/K+ pump activity controls the intrinsic firing mode of cerbellar Purkinje cells. PMID:23284664

Regulation of potassium transport in human lens epithelial cells.

Science.gov (United States)

Lauf, Peter K; Warwar, Ronald; Brown, Thomas L; Adragna, Norma C

2006-01-01

The major K influx pathways and their response to thiol modification by N-ethylmaleimide (NEM) and protein kinase and phosphatase inhibitors were characterized in human lens epithelial B3 (HLE-B3) cells with Rb as K congener. Ouabain (0.1 mM) and bumetanide (5 microM) discriminated between the Na/K pump ( approximately 35% of total Rb influx) and Na-K-2Cl cotransport (NKCC) ( approximately 50%). Cl-replacement with nitrate or sulfamate revealed 100 microM, activated the Na/K pump and abolished NKCC but did not affect KCC. The data suggest at least partial inverse regulation of KCC and NKCC in HLE-B3 cells by signaling cascades involving serine, threonine and tyrosine phosphorylation/dephosphorylation equilibria.

DETERMINATION OF TEMPERATURE DISTRIBUTION FOR ANNULAR FINS WITH TEMPERATURE DEPENDENT THERMAL CONDUCTIVITY BY HPM

Directory of Open Access Journals (Sweden)

Davood Domairry Ganji

2011-01-01

Full Text Available In this paper, homotopy perturbation method has been used to evaluate the temperature distribution of annular fin with temperature-dependent thermal conductivity and to determine the temperature distribution within the fin. This method is useful and practical for solving the nonlinear heat transfer equation, which is associated with variable thermal conductivity condition. The homotopy perturbation method provides an approximate analytical solution in the form of an infinite power series. The annular fin heat transfer rate with temperature-dependent thermal conductivity has been obtained as a function of thermo-geometric fin parameter and the thermal conductivity parameter describing the variation of the thermal conductivity.

Impact analysis of flow variability in sizing kanbans

Directory of Open Access Journals (Sweden)

Isaac Pergher

2014-02-01

Full Text Available The aim of this paper is to analyze the effects of variability flow, advocated by Factory Physics, in sizing Kanban production systems. The variability of flow presupposes that the variability of activities performed by a process is dissipated throughout the productive flow system, causing variations in the lead time, the work-in-process levels and the equipment availability, among others. To conduct the research, we created a didactic model of discrete event computer simulation. The proposed model aims to present the possible impacts caused by the variability flow in a production system regarding the sizing of the number of Kanbans cards, by using the results supplied by two different investigated scenarios. The main results of the research allow concluding that, by comparing the two scenarios developed in the model, the presence of variability in the production system caused an average increase of 32% in the number of Kanban cards (p=0,000. This implies that, in real productive systems, the study of Kanban sizing should consider the variability of individual operations, a fact often relegated as an assumption in the formulation from classical literature on the definition of the number of Kanbans, thus providing opportunities for the development of future research.

A recommendation for the thermal conductivity of oxide fuels

International Nuclear Information System (INIS)

Kang, K. H.; Ryu, H. J.; Song, K. C.; Yang, M. S.; Na, S. H.; Lee, Y. W.; Moon, H. S.; Kim, H. S.

2004-01-01

The thermal conductivity of nuclear fuel is one of the most important properties because it affects the fuel operating temperature. Therefore, it influences almost all the important processes occurred in nuclear fuel during irradiation, such as gas release, swelling and grain growth. The model of the thermal conductivity of nuclear fuel should be used in the codes to evaluate the performance of it analytically and be required in the nuclear fuel research and development. The thermal conductivity, k, of UO 2 depends on the deviation from stoichiometry, x, the burnup, b, and the fractional porosity, p, as well as the temperature, T: k = k(x, b, p, T), (1) Changes in thermal conductivity occur during irradiation because of fission-gas bubble formation, pores, cracks, fission product build-up and possible changes in the oxygen to uranium ratio (O/U). The dependence on temperature and porosity has been well studied and incorporated in computer codes used for the in-pile fuel behavior analysis. There are several studies on the effect of impurity on the thermal conductivity of UO 2 . In this paper, the variables affected on the thermal conductivity were studied. The available data of the thermal conductivity of UO 2 , UO 2+x , (U, Pu)O 2 , (U, Pu)O 2 and simulated fuel for irradiation fuel were reviewed and analyzed. The best models were recommended

Sensitivity of Variables with Time for Degraded RC Shear Wall with Low Steel Ratio under Seismic Load

International Nuclear Information System (INIS)

Park, Jun Hee; Choun, Young Sun; Choi, In Kil

2011-01-01

Various factors lead to the degradation of reinforced concrete (RC) shear wall over time. The steel section loss, concrete spalling and strength of material have been considered for the structural analysis of degraded shear wall. When all variables with respect to degradation are considered for probabilistic evaluation of degraded shear wall, many of time and effort were demanded. Therefore, it is required to define important variables related to structural behavior for effectively conducting probabilistic seismic analysis of structures with age-related degradation. In this study, variables were defined by applying the function of time to consider degradation with time. Importance of variables with time on the seismic response was investigated by conducting sensitivity analysis

Penalized variable selection in competing risks regression.

Science.gov (United States)

Fu, Zhixuan; Parikh, Chirag R; Zhou, Bingqing

2017-07-01

Penalized variable selection methods have been extensively studied for standard time-to-event data. Such methods cannot be directly applied when subjects are at risk of multiple mutually exclusive events, known as competing risks. The proportional subdistribution hazard (PSH) model proposed by Fine and Gray (J Am Stat Assoc 94:496-509, 1999) has become a popular semi-parametric model for time-to-event data with competing risks. It allows for direct assessment of covariate effects on the cumulative incidence function. In this paper, we propose a general penalized variable selection strategy that simultaneously handles variable selection and parameter estimation in the PSH model. We rigorously establish the asymptotic properties of the proposed penalized estimators and modify the coordinate descent algorithm for implementation. Simulation studies are conducted to demonstrate the good performance of the proposed method. Data from deceased donor kidney transplants from the United Network of Organ Sharing illustrate the utility of the proposed method.

Conductive heat flow at the TAG Active Hydrothermal Mound: Results from 1993-1995 submersible surveys

Science.gov (United States)

Becker, K.; Von Herzen, R.; Kirklin, J.; Evans, R.; Kadko, D.; Kinoshita, M.; Matsubayashi, O.; Mills, R.; Schultz, A.; Rona, P.

We report 70 measurements of conductive heat flow at the 50-m-high, 200-m-diameter TAG active hydrothermal mound, made during submersible surveys with Alvin in 1993 and 1995 and Shinkai 6500 in 1994. The stations were all measured with 5-thermistor, 0.6- or 1-m-long Alvin heat flow probes, which are capable of determining both gradient and thermal conductivity, and were transponder-navigated to an estimated accuracy of ±5-10 m relative to the 10-m-diameter central complex of black smokers. Within 20 m of this complex, conductive heat flow values are extremely variable (0.1- > 100 W/m²), which can only be due to local spatial and possible temporal variability in the immediate vicinity of the vigorous discharge sites. A similar local variability is suggested in the “Kremlin” area of white smokers to the southeast of the black smoker complex. On the south and southeast side of the mound, there is very high heat flow (3.7- > 25 W/m²) on the sedimented terraces that slope down from the Kremlin area. Heat flow is also high (0.3-3 W/m²) in the pelagic carbonate sediments on the surrounding seafloor within a few tens of meters of the southwest, northwest, and northeast sides of the mound. On the west side of the sulfide rubble plateau that surrounds the central black smoker peak, there is a coherent belt of very low heat flow (smokers, suggestive of local, shallow recharge of bottom water. The three submersible surveys spanned nearly two years, but showed no indication of any temporal variability in conductive heat flow over this time scale, whether natural or induced by ODP drilling in 1994.

[Effects of situational and individual variables on critical thinking expression].

Science.gov (United States)

Tanaka, Yuko; Kusumi, Takashi

2016-04-01

The present study examined when people decide to choose an expression that is based on critical thinking, and how situational and individual variables affect such a decision process. Given a conversation scenario including overgeneralization with two friends, participants decided whether to follow the conversation by a critical-thinking expression or not. The authors controlled purpose and topic as situational variables, and measured critical-thinking ability, critical-thinking disposition, and self-monitoring as individual variables. We conducted an experiment in which the situational variables were counterbalanced in a within-subject design with 60 university students. The results of logistic regression analysis showed differences within individuals in the decision process whether to choose a critical-thinking expression, and that some situational factors and some subscales of the individual measurements were related to the differences.

MHD pressure drop of imperfect insulation of liquid metal flow

International Nuclear Information System (INIS)

Horiike, H.; Nishiura, R.; Inoue, S.; Miyazaki, K.

2000-01-01

An experiment was performed to study magnetohydrodynamic (MHD) pressure gradient in the case of an imperfect electric insulation coating when using NaK loop. Test channels with uniform defects in their coating were made by painting inner surface with acrylic lacquer insulation. It was found that the exponent to B -- which is 1 for insulated walls, and 2 for conducting ones, was very sensitive to crack fractions lower than 25%. The pressure gradient was found to increase almost linearly with the fraction

Within-Day Variability in the Quality of Classroom Interactions during Third and Fifth Grade: Implications for Children's Experiences and Conducting Classroom Observations

Science.gov (United States)

Curby, Timothy W.; Stuhlman, Megan; Grimm, Kevin; Mashburn, Andrew; Chomat-Mooney, Lia; Downer, Jason; Hamre, Bridget; Pianta, Robert C.

2011-01-01

The quality of classroom interactions has typically been studied using aggregates of ratings over time. However, within-day ratings may contain important variability. This study investigated within-day variability using the NICHD Study of Early Childcare and Youth Development's observational data during grades 3 and 5. The first question examined…

Role of radiotherapy in local control of non-AIDS associated Kaposi's sarcoma patients in Korea: a single institution experience

International Nuclear Information System (INIS)

Chang, Ji Hyun; Kim, Il Han

2012-01-01

There has been no definite consensus on standard treatment, either local or systemic, for the Kaposi's sarcoma (KS). Radiotherapy (RT) can be a good local therapeutic choice especially in non-AIDS associated KS (NAKS) for its indolent behavior. Medical records of 17 KS patients treated with RT at the Seoul National University Hospital from February 1998 to January 2012 were retrospectively reviewed. One human immunodeficiency virus (HIV)+ patient with 3 lesions was excluded. The total number of the lesion was 23 among the 16 patients. The median follow-up period was 27.9 months. Correlation between response and variables was analyzed using the logistic regression model. Median age of the patients was 75 years. All the 23 lesions were located at the extremities. Fourteen (61%) of those had pain or local swelling as the initial presentation. Ten patients had possible causes of immunodeficiency and were regarded as iatrogenic, and other 6 were classic KS. Median dose of RT was 36 Gy. No KS-related death was observed. Excluding 2 with short-term follow-up only, complete response and partial response were obtained in 2 (9%) and 19 (73%) lesions, respectively. Of those, 3 lesions underwent local progression. Six had out-of-field recurrence after RT. Symptom improvement was achieved in 13 (93%) of 14 patients. Grade 2 skin toxicities were found in 9 lesions but all got improvement after treatment. When divided into responsive and progressive group, free from progression was not related to any of the possible variables. RT is effective in local control of NAKS resulting great response rate.

High-conductance states in a mean-field cortical network model

CERN Document Server

Lerchner, A; Hertz, J

2004-01-01

Measured responses from visual cortical neurons show that spike times tend to be correlated rather than exactly Poisson distributed. Fano factors vary and are usually greater than 1 due to the tendency of spikes being clustered into bursts. We show that this behavior emerges naturally in a balanced cortical network model with random connectivity and conductance-based synapses. We employ mean field theory with correctly colored noise to describe temporal correlations in the neuronal activity. Our results illuminate the connection between two independent experimental findings: high conductance states of cortical neurons in their natural environment, and variable non-Poissonian spike statistics with Fano factors greater than 1.

A new thermal conductivity model for nanofluids

Energy Technology Data Exchange (ETDEWEB)

Koo, Junemoo; Kleinstreuer, Clement [Department of Mechanical and Aerospace Engineering (United States)], E-mail: ck@eos.ncsu.edu

2004-12-15

In a quiescent suspension, nanoparticles move randomly and thereby carry relatively large volumes of surrounding liquid with them. This micro-scale interaction may occur between hot and cold regions, resulting in a lower local temperature gradient for a given heat flux compared with the pure liquid case. Thus, as a result of Brownian motion, the effective thermal conductivity, k{sub eff}, which is composed of the particles' conventional static part and the Brownian motion part, increases to result in a lower temperature gradient for a given heat flux. To capture these transport phenomena, a new thermal conductivity model for nanofluids has been developed, which takes the effects of particle size, particle volume fraction and temperature dependence as well as properties of base liquid and particle phase into consideration by considering surrounding liquid traveling with randomly moving nanoparticles.The strong dependence of the effective thermal conductivity on temperature and material properties of both particle and carrier fluid was attributed to the long impact range of the interparticle potential, which influences the particle motion. In the new model, the impact of Brownian motion is more effective at higher temperatures, as also observed experimentally. Specifically, the new model was tested with simple thermal conduction cases, and demonstrated that for a given heat flux, the temperature gradient changes significantly due to a variable thermal conductivity which mainly depends on particle volume fraction, particle size, particle material and temperature. To improve the accuracy and versatility of the k{sub eff}model, more experimental data sets are needed.

Development of Flexible Software Process Lines with Variability Operations

DEFF Research Database (Denmark)

Dohrmann, Patrick; Schramm, Joachim; Kuhrmann, Marco

2016-01-01

the development of flexible software process lines. Method: We conducted a longitudinal study in which we studied 5 variants of the V-Modell XT process line for 2 years. Results: Our results show the variability operation instrument feasible in practice. We analyzed 616 operation exemplars addressing various...

A Study of Locale-Wise Differences in Certain Cognitive and Non-Cognitive Variables

Science.gov (United States)

Puar, Surjit Singh

2012-01-01

The present study has been designed to investigate the locale-wise differences among high school students on the basis of certain cognitive variables like general mental ability and academic achievement and non-cognitive variables such as anxiety, emotional maturity and social maturity. The study was conducted over a sample of 400 (200 boys and…

Glutathionylation-Dependence of Na+-K+-Pump Currents Can Mimic Reduced Subsarcolemmal Na+ Diffusion

Science.gov (United States)

Garcia, Alvaro; Liu, Chia-Chi; Cornelius, Flemming; Clarke, Ronald J.; Rasmussen, Helge H.

2016-01-01

The existence of a subsarcolemmal space with restricted diffusion for Na+ in cardiac myocytes has been inferred from a transient peak electrogenic Na+-K+ pump current beyond steady state on reexposure of myocytes to K+ after a period of exposure to K+-free extracellular solution. The transient peak current is attributed to enhanced electrogenic pumping of Na+ that accumulated in the diffusion-restricted space during pump inhibition in K+-free extracellular solution. However, there are no known physical barriers that account for such restricted Na+ diffusion, and we examined if changes of activity of the Na+-K+ pump itself cause the transient peak current. Reexposure to K+ reproduced a transient current beyond steady state in voltage-clamped ventricular myocytes as reported by others. Persistence of it when the Na+ concentration in patch pipette solutions perfusing the intracellular compartment was high and elimination of it with K+-free pipette solution could not be reconciled with restricted subsarcolemmal Na+ diffusion. The pattern of the transient current early after pump activation was dependent on transmembrane Na+- and K+ concentration gradients suggesting the currents were related to the conformational poise imposed on the pump. We examined if the currents might be accounted for by changes in glutathionylation of the β1 Na+-K+ pump subunit, a reversible oxidative modification that inhibits the pump. Susceptibility of the β1 subunit to glutathionylation depends on the conformational poise of the Na+-K+ pump, and glutathionylation with the pump stabilized in conformations equivalent to those expected to be imposed on voltage-clamped myocytes supported this hypothesis. So did elimination of the transient K+-induced peak Na+-K+ pump current when we included glutaredoxin 1 in patch pipette solutions to reverse glutathionylation. We conclude that transient K+-induced peak Na+-K+ pump current reflects the effect of conformation-dependent β1 pump subunit

Glutathionylation-Dependence of Na(+)-K(+)-Pump Currents Can Mimic Reduced Subsarcolemmal Na(+) Diffusion.

Science.gov (United States)

Garcia, Alvaro; Liu, Chia-Chi; Cornelius, Flemming; Clarke, Ronald J; Rasmussen, Helge H

2016-03-08

The existence of a subsarcolemmal space with restricted diffusion for Na(+) in cardiac myocytes has been inferred from a transient peak electrogenic Na(+)-K(+) pump current beyond steady state on reexposure of myocytes to K(+) after a period of exposure to K(+)-free extracellular solution. The transient peak current is attributed to enhanced electrogenic pumping of Na(+) that accumulated in the diffusion-restricted space during pump inhibition in K(+)-free extracellular solution. However, there are no known physical barriers that account for such restricted Na(+) diffusion, and we examined if changes of activity of the Na(+)-K(+) pump itself cause the transient peak current. Reexposure to K(+) reproduced a transient current beyond steady state in voltage-clamped ventricular myocytes as reported by others. Persistence of it when the Na(+) concentration in patch pipette solutions perfusing the intracellular compartment was high and elimination of it with K(+)-free pipette solution could not be reconciled with restricted subsarcolemmal Na(+) diffusion. The pattern of the transient current early after pump activation was dependent on transmembrane Na(+)- and K(+) concentration gradients suggesting the currents were related to the conformational poise imposed on the pump. We examined if the currents might be accounted for by changes in glutathionylation of the β1 Na(+)-K(+) pump subunit, a reversible oxidative modification that inhibits the pump. Susceptibility of the β1 subunit to glutathionylation depends on the conformational poise of the Na(+)-K(+) pump, and glutathionylation with the pump stabilized in conformations equivalent to those expected to be imposed on voltage-clamped myocytes supported this hypothesis. So did elimination of the transient K(+)-induced peak Na(+)-K(+) pump current when we included glutaredoxin 1 in patch pipette solutions to reverse glutathionylation. We conclude that transient K(+)-induced peak Na(+)-K(+) pump current reflects the effect

Perceiving blocks of emotional pictures and sounds:Effects on physiological variables

Directory of Open Access Journals (Sweden)

Anne-Marie eBrouwer

2013-06-01

Full Text Available Most studies on physiological effects of emotion inducing images and sounds examine stimulus locked variables reflecting a state of at most a few seconds. We here aimed to induce longer lasting emotional states using blocks of repetitive visual, auditory and bimodal stimuli corresponding to specific valence and arousal levels. The duration of these blocks enabled us to reliably measure heart rate variability as a possible indicator of arousal. In addition, heart rate and skin conductance were determined without taking stimulus timing into account. Heart rate was higher for pleasant and low arousal stimuli compared to unpleasant and high arousal stimuli. Heart rate variability and skin conductance increased with arousal. Effects of valence and arousal on cardiovascular measures habituated or remained the same over 2-minute intervals whereas the arousal effect on skin conductance increased. We did not find any effect of stimulus modality. Our results indicate that blocks of images and sounds of specific valence and arousal levels consistently influence different physiological parameters. These parameters need not be stimulus locked. We found no evidence for differences in emotion induction between visual and auditory stimuli, nor did we find bimodal stimuli to be more potent than unimodal stimuli. The latter could be (partly due to the fact that our bimodal stimuli were not optimally congruent.

Transverse magnetic scattering by parallel conducting elliptic cylinders

Science.gov (United States)

Sebak, A.

1991-10-01

A boundary value solution to the problem of transverse magnetic multiple scattering by M parallel perfectly conducting elliptic cylinders is presented. The solution is an exact one and based on the separation-of-variables technique and the addition theorem for Mathieu functions. It is expressed in terms of a system of simultaneous linear equations of infinite order, which is then truncated for numerical computations. Representative numerical results for the scattered field by two cylinders are then generated, for some selected sizes and orientations parameters, and presented.

Safety analysis report. Decontamination and decommissioning of the EBR-I Complex

International Nuclear Information System (INIS)

Commander, J.C.; Macbeth, P.J.; Michels, D.E.

1975-06-01

The safety aspects of the planned EBR-I Complex decontamination and decommissioning operations are assessed. The major operations are: (1) removal of NaK from the EBR-I primary and secondary coolant systems, (2) processing of the NaK to produce solid caustic for disposal, (3) decontamination of contaminated areas of EBR-I and ZPR-III, (4) removal of items that cannot be decontaminated economically to acceptably safe levels, (5) isolation of contaminated areas, (6) demolition of the AFSR Shielding, and (7) removal of contaminated vessels from the NaK storage pit. It may be concluded that although potential hazards do exist from explosion, chemical burns and low-level radioactive exposure from the D and D operation, these hazards represent acceptable risks provided that the established procedures and precautions are followed. (U.S.)

ROTSE All-Sky Surveys for Variable Stars. I. Test Fields

International Nuclear Information System (INIS)

Akerlof, C.; Amrose, S.; Balsano, R.; Bloch, J.; Casperson, D.; Fletcher, S.; Gisler, G.; Hills, J.; Kehoe, R.; Lee, B.

2000-01-01

The Robotic Optical Transient Search Experiment I (ROTSE-I) experiment has generated CCD photometry for the entire northern sky in two epochs nightly since 1998 March. These sky patrol data are a powerful resource for studies of astrophysical transients. As a demonstration project, we present first results of a search for periodic variable stars derived from ROTSE-I observations. Variable identification, period determination, and type classification are conducted via automatic algorithms. In a set of nine ROTSE-I sky patrol fields covering roughly 2000 deg2, we identify 1781 periodic variable stars with mean magnitudes between m v = 10.0 and m v = 15.5. About 90% of these objects are newly identified as variable. Examples of many familiar types are presented. All classifications for this study have been manually confirmed. The selection criteria for this analysis have been conservatively defined and are known to be biased against some variable classes. This preliminary study includes only 5.6% of the total ROTSE-I sky coverage, suggesting that the full ROTSE-I variable catalog will include more than 32,000 periodic variable stars. (c) (c) 2000. The American Astronomical Society

The value of using seasonality and meteorological variables to model intra-urban PM2.5 variation

Science.gov (United States)

Olvera Alvarez, Hector A.; Myers, Orrin B.; Weigel, Margaret; Armijos, Rodrigo X.

2018-06-01

A yearlong air monitoring campaign was conducted to assess the impact of local temperature, relative humidity, and wind speed on the temporal and spatial variability of PM2.5 in El Paso, Texas. Monitoring was conducted at four sites purposely selected to capture the local traffic variability. Effects of meteorological events on seasonal PM2.5 variability were identified. For instance, in winter low-wind and low-temperature conditions were associated with high PM2.5 events that contributed to elevated seasonal PM2.5 levels. Similarly, in spring, high PM2.5 events were associated with high-wind and low-relative humidity conditions. Correlation coefficients between meteorological variables and PM2.5 fluctuated drastically across seasons. Specifically, it was observed that for most sites correlations between PM2.5 and meteorological variables either changed from positive to negative or dissolved depending on the season. Overall, the results suggest that mixed effects analysis with season and site as fixed factors and meteorological variables as covariates could increase the explanatory value of LUR models for PM2.5.

Variability in urban soils influences the health and growth of native tree seedlings

Science.gov (United States)

Clara C. Pregitzer; Nancy F. Sonti; Richard A. Hallett

2016-01-01

Reforesting degraded urban landscapes is important due to the many benefits urban forests provide. Urban soils are highly variable, yet little is known about how this variability in urban soils influences tree seedling performance and survival. We conducted a greenhouse study to assess health, growth, and survival of four native tree species growing in native glacial...

Water Sources for Cyanobacteria Below Desert Rocks in the Negev Desert Determined by Conductivity

Science.gov (United States)

McKay, Christopher P.

2016-01-01

We present year round meteorological and conductivity measurements of colonized hypolithic rocks in the Arava Valley, Negev Desert, Israel. The data indicate that while dew is common in the Negev it is not an important source of moisture for hypolithic organisms at this site. The dominance of cyanobacteria in the hypolithic community are consistent with predictions that cyanobacteria are confined to habitats supplied by rain. To monitor the presence of liquid water under the small Negev rocks we developed and tested a simple field conductivity system based on two wires placed about 0.5 cm apart. Based on 21 replicates recorded for one year in the Negev we conclude that in natural rains (0.25 mm to 6 mm) the variability between sensor readings is between 20 and 60% decreasing with increasing rain amount. We conclude that the simple small electrical conductivity system described here can be used effectively to monitor liquid water levels in lithic habitats. However, the natural variability of these sensors indicates that several replicates should be deployed. The results and method presented have use in arid desert reclamation programs.

Variability Bugs:

DEFF Research Database (Denmark)

Melo, Jean

. Although many researchers suggest that preprocessor-based variability amplifies maintenance problems, there is little to no hard evidence on how actually variability affects programs and programmers. Specifically, how does variability affect programmers during maintenance tasks (bug finding in particular......)? How much harder is it to debug a program as variability increases? How do developers debug programs with variability? In what ways does variability affect bugs? In this Ph.D. thesis, I set off to address such issues through different perspectives using empirical research (based on controlled...... experiments) in order to understand quantitatively and qualitatively the impact of variability on programmers at bug finding and on buggy programs. From the program (and bug) perspective, the results show that variability is ubiquitous. There appears to be no specific nature of variability bugs that could...

Towards an improved and more flexible representation of water stress in coupled photosynthesis-stomatal conductance models; implications for simulated land surface fluxes and variables at various spatiotemporal scales

Science.gov (United States)

Egea, G.; Verhoef, A.; Vidale, P. L.; Black, E.; Van den Hoof, C.

2012-04-01

effect that the revised parameterization will have on GCM simulations of climate variability and change. Best, M. J. et al. (2011). The Joint UK Land Environment Simulator (JULES), model description - Part 1: Energy and water fluxes. Geosci. Model Dev., 4, 677-699. Egea, G., Verhoef, A., Vidale, P.L. (2011) Towards an improved and more flexible representation of water stress in coupled photosynthesis-stomatal conductance models. Agricultural and Forest Meteorology, 151 (10), 1370-1384.

Controlling thermal chaos in the mantle by positive feedback from radiative thermal conductivity

Directory of Open Access Journals (Sweden)

F. Dubuffet

2002-01-01

Full Text Available The thermal conductivity of mantle materials has two components, the lattice component klat from phonons and the radiative component krad due to photons. These two contributions of variable thermal conductivity have a nonlinear dependence in the temperature, thus endowing the temperature equation in mantle convection with a strongly nonlinear character. The temperature derivatives of these two mechanisms have different signs, with ∂klat /∂T negative and dkrad /dT positive. This offers the possibility for the radiative conductivity to control the chaotic boundary layer instabilities developed in the deep mantle. We have parameterized the weight factor between krad and klat with a dimensionless parameter f , where f = 1 corresponds to the reference conductivity model. We have carried out two-dimensional, time-dependent calculations for variable thermal conductivity but constant viscosity in an aspect-ratio 6 box for surface Rayleigh numbers between 106 and 5 × 106. The averaged Péclet numbers of these flows lie between 200 and 2000. Along the boundary in f separating the chaotic and steady-state solutions, the number decreases and the Nusselt number increases with internal heating, illustrating the feedback between internal heating and radiative thermal conductivity. For purely basal heating situation, the time-dependent chaotic flows become stabilized for values of f of between 1.5 and 2. The bottom thermal boundary layer thickens and the surface heat flow increases with larger amounts of radiative conductivity. For magnitudes of internal heating characteristic of a chondritic mantle, much larger values of f , exceeding 10, are required to quench the bottom boundary layer instabilities. By isolating the individual conductive mechanisms, we have ascertained that the lattice conductivity is partly responsible for inducing boundary layer instabilities, while the radiative conductivity and purely depth-dependent conductivity exert a stabilizing

A similarity solution of time dependent MHD liquid film flow over stretching sheet with variable physical properties

Directory of Open Access Journals (Sweden)

M. Idrees

2018-03-01

Full Text Available An analysis is performed for the fluid dynamics incorporating the variation of viscosity and thermal conductivity on an unsteady two-dimensional free surface flow of a viscous incompressible conducting fluid taking into account the effect of a magnetic field. Surface tension quadratically vary with temperature while fluid viscosity and thermal conductivity are assumed to vary as a linear function of temperature. The boundary layer partial differential equations in cartesian coordinates are transformed into a system of nonlinear ordinary differential equations (ODEs by similarity transformation. The developed nonlinear equations are solved analytically by Homotopy Analysis Method (HAM while numerically by using the shooting method. The Effects of natural parameters such as the variable viscosity parameter A, variable thermal conductivity parameter N, Hartmann number Ma, film Thickness, unsteadiness parameter S, Thermocapillary number M and Prandtl number Pr on the velocity and temperature profiles are investigated. The results for the surface skin friction coefficient f″(0, Nusselt number (heat flux -θ′(0 and free surface temperature θ(1 are presented graphically and in tabular form. Keywords: Variable viscosity and thermal conductivity, Thermocapillary number, Magnetic field, Thin film, Unsteady stretching surface

Variable Selection for Regression Models of Percentile Flows

Science.gov (United States)

Fouad, G.

2017-12-01

Percentile flows describe the flow magnitude equaled or exceeded for a given percent of time, and are widely used in water resource management. However, these statistics are normally unavailable since most basins are ungauged. Percentile flows of ungauged basins are often predicted using regression models based on readily observable basin characteristics, such as mean elevation. The number of these independent variables is too large to evaluate all possible models. A subset of models is typically evaluated using automatic procedures, like stepwise regression. This ignores a large variety of methods from the field of feature (variable) selection and physical understanding of percentile flows. A study of 918 basins in the United States was conducted to compare an automatic regression procedure to the following variable selection methods: (1) principal component analysis, (2) correlation analysis, (3) random forests, (4) genetic programming, (5) Bayesian networks, and (6) physical understanding. The automatic regression procedure only performed better than principal component analysis. Poor performance of the regression procedure was due to a commonly used filter for multicollinearity, which rejected the strongest models because they had cross-correlated independent variables. Multicollinearity did not decrease model performance in validation because of a representative set of calibration basins. Variable selection methods based strictly on predictive power (numbers 2-5 from above) performed similarly, likely indicating a limit to the predictive power of the variables. Similar performance was also reached using variables selected based on physical understanding, a finding that substantiates recent calls to emphasize physical understanding in modeling for predictions in ungauged basins. The strongest variables highlighted the importance of geology and land cover, whereas widely used topographic variables were the weakest predictors. Variables suffered from a high

Conduction mechanism in bismuth silicate glasses containing titanium

International Nuclear Information System (INIS)

Dult, Meenakshi; Kundu, R.S.; Murugavel, S.; Punia, R.; Kishore, N.

2014-01-01

Bismuth silicate glasses mixed with different concentrations of titanium dioxide having compositions xTiO 2 –(60−x)Bi 2 O 3 –40SiO 2 with x=0, 5, 10, 15 and 20 were prepared by the normal melt quench technique. The frequency dependence of the ac electrical conductivity of different compositions of titanium bismuth silicate glasses has been studied in the frequency range 10 −1 Hz to 10 MHz and in the temperature range 623–703 K. The temperature and frequency dependent conductivity is found to obey Jonscher's universal power law for all the compositions of titanium bismuth silicate glass system. The dc conductivity (σ dc ), so called crossover frequency (ω H ), and frequency exponent (s) have been estimated from the fitting of experimental data of ac conductivity with Jonscher's universal power law. Enthalpy to dissociate the cation from its original site next to a charge compensating center (H f ) and enthalpy of migration (H m ) have also been estimated. The conductivity data have been analyzed in terms of different theoretical models to determine the possible conduction mechanism. Analysis of the conductivity data and the frequency exponent shows that the correlated barrier hopping of electrons between Ti 3+ and Ti 4+ ions in the glasses is the most favorable mechanism for ac conduction. The temperature dependent dc conductivity has been analyzed in the framework of theoretical variable range hopping model (VRH) proposed by Mott which describe the hopping conduction in disordered semiconducting systems. The various polaron hopping parameters have also been deduced. Mott's VRH model is found to be in good agreement with experimental data and the values of inverse localization length of s-like wave function (α) obtained by this model with modifications suggested by Punia et al. are close to the ones reported for a number of oxide glasses

Overall conductance and heat transfer area minimization of refrigerators and heat pumps with finite heat reservoirs

International Nuclear Information System (INIS)

Sarkar, J.; Bhattacharyya, Souvik

2007-01-01

In the present study, the overall conductance and the overall heat transfer area per unit capacity of refrigeration and heat pump systems have been minimized analytically considering both internal and external irreversibilities with variable temperature (finite capacity) heat reservoirs. Hot and cold side refrigerant temperatures, conductance and heat transfer area ratios have been optimized to attain this goal. The results have been verified with the more elaborate numerical optimization results obtained for ammonia based vapour compression refrigeration and heat pump systems working with variable temperature reservoirs. It is observed that the analytical results for optimum refrigerant temperatures, minimum overall conductance and heat transfer area deviate marginally from the numerically optimized results (within 1%), if one assumes a constant heat rejection temperature. The deviation of minimum overall conductance and heat transfer area is more (about 20%), if one considers both the desuperheating and condensation regions separately. However, in the absence of complex and elaborate numerical models, the simple analytical results obtained here can be used as reasonably accurate preliminary guidelines for optimization of refrigeration and heat pump systems

Strain and thermal conductivity in ultrathin suspended silicon nanowires

Science.gov (United States)

Fan, Daniel; Sigg, Hans; Spolenak, Ralph; Ekinci, Yasin

2017-09-01

We report on the uniaxial strain and thermal conductivity of well-ordered, suspended silicon nanowire arrays between 10 to 20 nm width and 22 nm half-pitch, fabricated by extreme-ultraviolet (UV) interference lithography. Laser-power-dependent Raman spectroscopy showed that nanowires connected monolithically to the bulk had a consistent strain of ˜0.1 % , whereas nanowires clamped by metal exhibited variability and high strain of up to 2.3%, having implications in strain engineering of nanowires. The thermal conductivity at room temperature was measured to be ˜1 W /m K for smooth nanowires and ˜0.1 W /m K for rougher ones, similar to results by other investigators. We found no modification of the bulk properties in terms of intrinsic scattering, and therefore, the decrease in thermal conductivity is mainly due to boundary scattering. Different types of surface roughness, such as constrictions and line-edge roughness, may play roles in the scattering of phonons of different wavelengths. Such low thermal conductivities would allow for very efficient thermal energy harvesting, approaching and passing values achieved by state-of-the-art thermoelectric materials.

Impacts of variable thermal conductivity on stagnation point boundary layer flow past a Riga plate with variable thickness using generalized Fourier's law

Science.gov (United States)

Shah, S.; Hussain, S.; Sagheer, M.

2018-06-01

This article explores the problem of two-dimensional, laminar, steady and boundary layer stagnation point slip flow over a Riga plate. The incompressible upper-convected Maxwell fluid has been considered as a rheological fluid model. The heat transfer characteristics are investigated with generalized Fourier's law. The fluid thermal conductivity is assumed to be temperature dependent in this study. A system of partial differential equations governing the flow of an upper-convected Maxwell fluid, heat and mass transfer using generalized Fourier's law is developed. The main objective of the article is to inspect the impacts of pertinent physical parameters such as the stretching ratio parameter (0 ⩽ A ⩽ 0.3) , Deborah number (0 ⩽ β ⩽ 0.6) , thermal relaxation parameter (0 ⩽ γ ⩽ 0.5) , wall thickness parameter (0.1 ⩽ α ⩽ 3.5) , slip parameter (0 ⩽ R ⩽ 1.5) , thermal conductivity parameter (0.1 ⩽ δ ⩽ 1.0) and modified Hartmann number (0 ⩽ Q ⩽ 3) on the velocity and temperature profiles. Suitable local similarity transformations have been used to get a system of non-linear ODEs from the governing PDEs. The numerical solutions for the dimensionless velocity and temperature distributions have been achieved by employing an effective numerical method called the shooting method. It is seen that the velocity profile shows the reduction in the velocity for the higher values of viscoelastic parameter and the thermal relaxation parameter. In addition, to enhance the reliability at the maximum level of the obtained numerical results by shooting method, a MATLAB built-in solver bvp4c has also been utilized.

Cataclysmic variables as probes of x-ray properties of interstellar grains

International Nuclear Information System (INIS)

Bode, M.F.; Evans, A.; Norwell, G.A.

1983-01-01

Interstellar-grain properties have previously been probed at wavelengths ranging from the infrared to the ultraviolet. Recent work by other authors has shown that we may also observe the effects of scattering by such grains at x-ray wavelengths. In this paper we suggest that investigations of the x-ray properties of interstellar grains may profitably be conducted in sight lines to variable sources. Particular emphasis is given in this context to cataclysmic variables and related objects

Conductance oscillations of core-shell nanowires in transversal magnetic fields

Science.gov (United States)

Manolescu, Andrei; Nemnes, George Alexandru; Sitek, Anna; Rosdahl, Tomas Orn; Erlingsson, Sigurdur Ingi; Gudmundsson, Vidar

2016-05-01

We analyze theoretically electronic transport through a core-shell nanowire in the presence of a transversal magnetic field. We calculate the conductance for a variable coupling between the nanowire and the attached leads and show how the snaking states, which are low-energy states localized along the lines of the vanishing radial component of the magnetic field, manifest their existence. In the strong-coupling regime they induce flux periodic, Aharonov-Bohm-like, conductance oscillations, which, by decreasing the coupling to the leads, evolve into well-resolved peaks. The flux periodic oscillations arise due to interference of the snaking states, which is a consequence of backscattering at either the contacts with leads or magnetic or potential barriers in the wire.

High-conductance states in a mean-field cortical network model

DEFF Research Database (Denmark)

Lerchner, Alexander; Ahmadi, Mandana; Hertz, John

2004-01-01

cortical network model with random connectivity and conductance-based synapses. We employ mean-field theory with correctly colored noise to describe temporal correlations in the neuronal activity. Our results illuminate the connection between two independent experimental findings: high-conductance states......Measured responses from visual cortical neurons show that spike times tend to be correlated rather than exactly Poisson distributed. Fano factors vary and are usually greater than 1, indicating a tendency toward spikes being clustered. We show that this behavior emerges naturally in a balanced...... of cortical neurons in their natural environment, and variable non-Poissonian spike statistics with Fano factors greater than 1. (C) 2004 Elsevier B.V. All rights reserved....

Tsunami inundation variability from stochastic rupture scenarios: Application to multiple inversions of the 2011 Tohoku, Japan earthquake

KAUST Repository

Mori, Nobuhito; Mai, Paul Martin; Goda, Katsuichiro; Yasuda, Tomohiro

2017-01-01

earthquake in the Tohoku region to conduct thorough sensitivity analyses and to quantify the inundation variability. The numerical results indicate a strong influence of the reference source models on inundation variability, and demonstrate significant

Measuring the surgical 'learning curve': methods, variables and competency.

Science.gov (United States)

Khan, Nuzhath; Abboudi, Hamid; Khan, Mohammed Shamim; Dasgupta, Prokar; Ahmed, Kamran

2014-03-01

To describe how learning curves are measured and what procedural variables are used to establish a 'learning curve' (LC). To assess whether LCs are a valuable measure of competency. A review of the surgical literature pertaining to LCs was conducted using the Medline and OVID databases. Variables should be fully defined and when possible, patient-specific variables should be used. Trainee's prior experience and level of supervision should be quantified; the case mix and complexity should ideally be constant. Logistic regression may be used to control for confounding variables. Ideally, a learning plateau should reach a predefined/expert-derived competency level, which should be fully defined. When the group splitting method is used, smaller cohorts should be used in order to narrow the range of the LC. Simulation technology and competence-based objective assessments may be used in training and assessment in LC studies. Measuring the surgical LC has potential benefits for patient safety and surgical education. However, standardisation in the methods and variables used to measure LCs is required. Confounding variables, such as participant's prior experience, case mix, difficulty of procedures and level of supervision, should be controlled. Competency and expert performance should be fully defined. © 2013 The Authors. BJU International © 2013 BJU International.

Confirming theoretical pay constructs of a variable pay scheme

Directory of Open Access Journals (Sweden)

Sibangilizwe Ncube

2013-05-01

Full Text Available Orientation: Return on the investment in variable pay programmes remains controversial because their cost versus contribution cannot be empirically justified. Research purpose: This study validates the findings of the model developed by De Swardt on the factors related to successful variable pay programmes. Motivation for the study: Many organisations blindly implement variable pay programmes without any means to assess the impact these programmes have on the company’s performance. This study was necessary to validate the findings of an existing instrument that validates the contribution of variable pay schemes. Research design, approach and method: The study was conducted using quantitative research. A total of 300 completed questionnaires from a non-purposive sample of 3000 participants in schemes across all South African industries were returned and analysed. Main findings: Using exploratory and confirmatory factor analysis, it was found that the validation instrument developed by De Swardt is still largely valid in evaluating variable pay schemes. The differences between the study and the model were reported. Practical/managerial implications: The study confirmed the robustness of an existing model that enables practitioners to empirically validate the use of variable pay plans. This model assists in the design and implementation of variable pay programmes that meet critical success factors. Contribution/value-add: The study contributed to the development of a measurement instrument that will assess whether a variable pay plan contributes to an organisation’s success.

Variability of LD50 Values from Rat Oral Acute Toxicity Studies: Implications for Alternative Model Development

Science.gov (United States)

Alternative models developed for estimating acute systemic toxicity are generally evaluated using in vivo LD50 values. However, in vivo acute systemic toxicity studies can produce variable results, even when conducted according to accepted test guidelines. This variability can ma...

Using Variable Speed Control on Pump Application

Directory of Open Access Journals (Sweden)

Dr.Sc. Aida Spahiu

2012-06-01

Full Text Available Pumps are one of the most common variable speed drive (VSD system applications and special interest has focused on improving their energy efficiency by using variable speed control instead of throttling or other less efficient flow control methods. Pumps are the single largest user of electricity in industry in the European Union, consuming 160 TWh per annum of electricity and accounting for 79 million tonnes of carbon dioxide (CO2 emissions [1]. Centrifugal pumps are the most likely pump style to provide a favorable return based on energy savings when applied with a variable speed drive. To help illustrate this, are conducted benchmark testing to document various head and flow scenarios and their corresponding effect on energy savings. Paper shows the relationship of static and friction head in the energy efficiency equation and the effect of motor, pump and VSD efficiencies. The received results are good reference points for engineers and managers of water sector in Albania to select the best prospects for maximizing efficiency and energy savings.

The Validity of Graduate Management Admission Test Scores: A Summary of Studies Conducted from 1997 to 2004

Science.gov (United States)

Talento-Miller, Eileen; Rudner, Lawrence M.

2008-01-01

The validity of Graduate Management Admission Test (GMAT) scores is examined by summarizing 273 studies conducted between 1997 and 2004. Each of the studies was conducted through the Validity Study Service of the test sponsor and contained identical variables and statistical methods. Validity coefficients from each of the studies were corrected…

Measured spatial variability of beach erosion due to aeolian processes.

NARCIS (Netherlands)

de Vries, S.; Verheijen, A.H.; Hoonhout, B.M.; Vos, S.E.; Cohn, Nicholas; Ruggiero, P; Aagaard, T.; Deigaard, R.; Fuhrman, D.

2017-01-01

This paper shows the first results of measured spatial variability of beach erosion due to aeolian processes during the recently conducted SEDEX2 field experiment at Long Beach, Washington, U.S.A.. Beach erosion and sedimentation were derived using series of detailed terrestrial LIDAR measurements

Omitted Variable Sensitivity Analysis with the Annotated Love Plot

Science.gov (United States)

Hansen, Ben B.; Fredrickson, Mark M.

2014-01-01

The goal of this research is to make sensitivity analysis accessible not only to empirical researchers but also to the various stakeholders for whom educational evaluations are conducted. To do this it derives anchors for the omitted variable (OV)-program participation association intrinsically, using the Love plot to present a wide range of…

Time-specific and population-level differences in physiological responses of fathead minnows (Pimephales promelas) and golden shiners (Notemigonus crysoleucas) exposed to copper.

Science.gov (United States)

Peles, John D; Pistole, David H; Moffe, Mickey C

2012-03-01

The influence of exposure time on gill Na+/K+ ATPase activity and metabolic rate in populations of fathead minnows (Pimephales promelas) and golden shiners (Notemigonus crysoleucas) hatcheries in Ohio (OH) and Pennsylvania (PA) when exposed to sublethal concentrations of copper (Cu) was examined. The pattern of change in gill Na+/K+ ATPase activity was similar in all species/populations and results support expectations based on the concept of acclimation. In all populations, Na+/K+ ATPase activity declined significantly compared to reference values within 24 h, recovered by 48 h, and then continued to increase before exceeding reference values by 192 h. With the exception of PA fathead minnows, Na+/K+ ATPase activities returned to reference levels by 384 h. Although metabolic rates of individual fish were not strongly correlated with Na+/K+ ATPase activities, the pattern of change in mean values of these physiological parameters was very similar. However, OH populations of both fathead minnows and golden shiners demonstrated much more dramatic changes in metabolic rate compared to PA fish. At 24 h, metabolic rate of PA fathead minnows had decreased by 16% compared to the reference value whereas the OH population had decreased by 31%; metabolic rate of PA golden shiners declined by 23% compared to 59% in OH shiners at 24 h. Similar differences were observed in the maximum metabolic rates achieved at 192 h. While the increased sensitivity of OH fish to Cu is not readily explainable by genetic or environmental factors, results suggest the need for considering population level differences when evaluating the physiological effects of toxicants. Copyright © 2011 Elsevier B.V. All rights reserved.

Universal Quantum Computing with Arbitrary Continuous-Variable Encoding.

Science.gov (United States)

Lau, Hoi-Kwan; Plenio, Martin B

2016-09-02

Implementing a qubit quantum computer in continuous-variable systems conventionally requires the engineering of specific interactions according to the encoding basis states. In this work, we present a unified formalism to conduct universal quantum computation with a fixed set of operations but arbitrary encoding. By storing a qubit in the parity of two or four qumodes, all computing processes can be implemented by basis state preparations, continuous-variable exponential-swap operations, and swap tests. Our formalism inherits the advantages that the quantum information is decoupled from collective noise, and logical qubits with different encodings can be brought to interact without decoding. We also propose a possible implementation of the required operations by using interactions that are available in a variety of continuous-variable systems. Our work separates the "hardware" problem of engineering quantum-computing-universal interactions, from the "software" problem of designing encodings for specific purposes. The development of quantum computer architecture could hence be simplified.

Electron heat conduction and suprathermal particles

International Nuclear Information System (INIS)

Bakunin, O.G.; Krasheninnikov, S.I.

1991-01-01

As recognized at present, the applicability of Spitzer-Harm's theory on electron heat conduction along the magnetic field is limited by comparatively small values of the thermal electron mean free path ratio, λ to the characteristic length of changes in plasma parameters, L: γ=λ/L≤10 -2 . The stationary kinetic equation for the electron distribution function inhomogeneous along the x-axis f e (v,x) allows one to have solutions in the self-similar variables. The objective of a given study is to generalize the solutions for the case of arbitrary Z eff , that will allow one to compare approximate solutions to the kinetic equation with the precise ones in a wide range of parameters. (author) 8 refs., 2 figs

A Model to Couple Flow, Thermal and Reactive Chemical Transport, and Geo-mechanics in Variably Saturated Media

Science.gov (United States)

Yeh, G. T.; Tsai, C. H.

2015-12-01

This paper presents the development of a THMC (thermal-hydrology-mechanics-chemistry) process model in variably saturated media. The governing equations for variably saturated flow and reactive chemical transport are obtained based on the mass conservation principle of species transport supplemented with Darcy's law, constraint of species concentration, equation of states, and constitutive law of K-S-P (Conductivity-Degree of Saturation-Capillary Pressure). The thermal transport equation is obtained based on the conservation of energy. The geo-mechanic displacement is obtained based on the assumption of equilibrium. Conventionally, these equations have been implicitly coupled via the calculations of secondary variables based on primary variables. The mechanisms of coupling have not been obvious. In this paper, governing equations are explicitly coupled for all primary variables. The coupling is accomplished via the storage coefficients, transporting velocities, and conduction-dispersion-diffusion coefficient tensor; one set each for every primary variable. With this new system of equations, the coupling mechanisms become clear. Physical interpretations of every term in the coupled equations will be discussed. Examples will be employed to demonstrate the intuition and superiority of these explicit coupling approaches. Keywords: Variably Saturated Flow, Thermal Transport, Geo-mechanics, Reactive Transport.

Variable Emissivity Electrochromics using Ionic Electrolytes and Low Solar Absorptance Coatings, Phase II

Data.gov (United States)

National Aeronautics and Space Administration — This work further developed a highly promising variable emissivity technology for spacecraft thermal control, based on unique conducting polymer (CP) electrochromics...

Prediction of the saturated hydraulic conductivity from Brooks and Corey’s water retention parameters

NARCIS (Netherlands)

Nasta, P.; Vrugt, J.A.; Romano, N.

2013-01-01

Prediction of flow through variably saturated porous media requires accurate knowledge of the soil hydraulic properties, namely the water retention function (WRF) and the hydraulic conductivity function (HCF). Unfortunately, direct measurement of the HCF is time consuming and expensive. In this

Standardization of soil apparent electrical conductivity using multi-temporal surveys across multiple production fields

Science.gov (United States)

Apparent soil electrical conductivity (ECa) is an efficient technique for understanding within-field variability of physical and chemical soil characteristics. Commercial devices are readily available for collecting ECa on whole fields and used broadly for crop management in precision agriculture; h...

Do Demographic Variables Moderate the Relationship Between Job Burnout and its Consequences?

Directory of Open Access Journals (Sweden)

Hasan Zarei Matin

2012-01-01

Full Text Available Many studies have already been conducted to understand the various dimensions of the burnout. The purpose of the present research is to investigate the moderating effect of demographic variables on the relationship between job burnout and its consequences among the staff of an Iranian public sector company. In this research, job burnout is considered as independent variable; organizational commitment, intention to leave and the employees‟ job satisfaction are dependent variables; and the age, gender, marital status and educational level are moderating variables. The results of this study show that firstly, the job burnout of employees in organizations leads to the decrease of organizational commitment and job satisfaction, and the increase of intention to leave; secondly, the demographic variables in this research don't affect on the relationship of job burnout with its consequences.

Polyol concentrations in Aspergillus repens grown under salt stress.

Science.gov (United States)

Kelavkar, U P; Chhatpar, H S

1993-09-01

Na(+), K(+) and the ratio of Na(+)/K(+) were higher in cells of the halotolerant Aspergillus repens grown with 2 M NaCl than without NaCl. The osmolytes, proline, glycerol, betaine and glutamate, did not affect the Na(+)/K(+) ratio, nor the polyol content of cells under any conditions. The concentrations of polyols, consisting of glycerol, arabitol, erythritol and mannitol, changed markedly during growth, indicating that they have a crucial role in osmotic adaptation.

Individual Movement Variability Magnitudes Are Explained by Cortical Neural Variability.

Science.gov (United States)

Haar, Shlomi; Donchin, Opher; Dinstein, Ilan

2017-09-13

Humans exhibit considerable motor variability even across trivial reaching movements. This variability can be separated into specific kinematic components such as extent and direction that are thought to be governed by distinct neural processes. Here, we report that individual subjects (males and females) exhibit different magnitudes of kinematic variability, which are consistent (within individual) across movements to different targets and regardless of which arm (right or left) was used to perform the movements. Simultaneous fMRI recordings revealed that the same subjects also exhibited different magnitudes of fMRI variability across movements in a variety of motor system areas. These fMRI variability magnitudes were also consistent across movements to different targets when performed with either arm. Cortical fMRI variability in the posterior-parietal cortex of individual subjects explained their movement-extent variability. This relationship was apparent only in posterior-parietal cortex and not in other motor system areas, thereby suggesting that individuals with more variable movement preparation exhibit larger kinematic variability. We therefore propose that neural and kinematic variability are reliable and interrelated individual characteristics that may predispose individual subjects to exhibit distinct motor capabilities. SIGNIFICANCE STATEMENT Neural activity and movement kinematics are remarkably variable. Although intertrial variability is rarely studied, here, we demonstrate that individual human subjects exhibit distinct magnitudes of neural and kinematic variability that are reproducible across movements to different targets and when performing these movements with either arm. Furthermore, when examining the relationship between cortical variability and movement variability, we find that cortical fMRI variability in parietal cortex of individual subjects explained their movement extent variability. This enabled us to explain why some subjects

Variable Emissivity Electrochromics Using Ionic Electrolytes and Low Solar Absorptance Coatings, Phase I

Data.gov (United States)

National Aeronautics and Space Administration — In recent work, this firm developed a highly promising, patented variable emittance technology based on electrochromic Conducting Polymers, with: (1) Thin ( 105...

Stimulus variability and the phonetic relevance hypothesis: effects of variability in speaking style, fundamental frequency, and speaking rate on spoken word identification.

Science.gov (United States)

Sommers, Mitchell S; Barcroft, Joe

2006-04-01

Three experiments were conducted to examine the effects of trial-to-trial variations in speaking style, fundamental frequency, and speaking rate on identification of spoken words. In addition, the experiments investigated whether any effects of stimulus variability would be modulated by phonetic confusability (i.e., lexical difficulty). In Experiment 1, trial-to-trial variations in speaking style reduced the overall identification performance compared with conditions containing no speaking-style variability. In addition, the effects of variability were greater for phonetically confusable words than for phonetically distinct words. In Experiment 2, variations in fundamental frequency were found to have no significant effects on spoken word identification and did not interact with lexical difficulty. In Experiment 3, two different methods for varying speaking rate were found to have equivalent negative effects on spoken word recognition and similar interactions with lexical difficulty. Overall, the findings are consistent with a phonetic-relevance hypothesis, in which accommodating sources of acoustic-phonetic variability that affect phonetically relevant properties of speech signals can impair spoken word identification. In contrast, variability in parameters of the speech signal that do not affect phonetically relevant properties are not expected to affect overall identification performance. Implications of these findings for the nature and development of lexical representations are discussed.

Assessing geotechnical centrifuge modelling in addressing variably saturated flow in soil and fractured rock.

Science.gov (United States)

Jones, Brendon R; Brouwers, Luke B; Van Tonder, Warren D; Dippenaar, Matthys A

2017-05-01

The vadose zone typically comprises soil underlain by fractured rock. Often, surface water and groundwater parameters are readily available, but variably saturated flow through soil and rock are oversimplified or estimated as input for hydrological models. In this paper, a series of geotechnical centrifuge experiments are conducted to contribute to the knowledge gaps in: (i) variably saturated flow and dispersion in soil and (ii) variably saturated flow in discrete vertical and horizontal fractures. Findings from the research show that the hydraulic gradient, and not the hydraulic conductivity, is scaled for seepage flow in the geotechnical centrifuge. Furthermore, geotechnical centrifuge modelling has been proven as a viable experimental tool for the modelling of hydrodynamic dispersion as well as the replication of similar flow mechanisms for unsaturated fracture flow, as previously observed in literature. Despite the imminent challenges of modelling variable saturation in the vadose zone, the geotechnical centrifuge offers a powerful experimental tool to physically model and observe variably saturated flow. This can be used to give valuable insight into mechanisms associated with solid-fluid interaction problems under these conditions. Findings from future research can be used to validate current numerical modelling techniques and address the subsequent influence on aquifer recharge and vulnerability, contaminant transport, waste disposal, dam construction, slope stability and seepage into subsurface excavations.

Aging and motor variability: a test of the neural noise hypothesis.

Science.gov (United States)

Sosnoff, Jacob J; Newell, Karl M

2011-07-01

Experimental tests of the neural noise hypothesis of aging, which holds that aging-related increments in motor variability are due to increases in white noise in the perceptual-motor system, were conducted. Young (20-29 years old) and old (60-69 and 70-79 years old) adults performed several perceptual-motor tasks. Older adults were progressively more variable in their performance outcome, but there was no age-related difference in white noise in the motor output. Older adults had a greater frequency-dependent structure in their motor variability that was associated with performance decrements. The findings challenge the main tenet of the neural noise hypothesis of aging in that the increased variability of older adults was due to a decreased ability to adapt to the constraints of the task rather than an increment of neural noise per se.

Spatial variability in airborne pollen concentrations.

Science.gov (United States)

Raynor, G S; Ogden, E C; Hayes, J V

1975-03-01

Tests were conducted to determine the relationship between airborne pollen concentrations and distance. Simultaneous samples were taken in 171 tests with sets of eight rotoslide samplers spaced from one to 486 M. apart in straight lines. Use of all possible pairs gave 28 separation distances. Tests were conducted over a 2-year period in urban and rural locations distant from major pollen sources during both tree and ragweed pollen seasons. Samples were taken at a height of 1.5 M. during 5-to 20-minute periods. Tests were grouped by pollen type, location, year, and direction of the wind relative to the line. Data were analyzed to evaluate variability without regard to sampler spacing and variability as a function of separation distance. The mean, standard deviation, coefficient of variation, ratio of maximum to the mean, and ratio of minimum to the mean were calculated for each test, each group of tests, and all cases. The average coefficient of variation is 0.21, the maximum over the mean, 1.39 and the minimum over the mean, 0.69. No relationship was found with experimental conditions. Samples taken at the minimum separation distance had a mean difference of 18 per cent. Differences between pairs of samples increased with distance in 10 of 13 groups. These results suggest that airborne pollens are not always well mixed in the lower atmosphere and that a sample becomes less representative with increasing distance from the sampling location.

A study on the effect of macroeconomic variables and firm ...

African Journals Online (AJOL)

According to conducted studies, financial structure of organization was so important in its value and validity. For this purpose, managers should be aware about the variables affect the financial structure or organization and achieve an optimized financial structure using a proper attitude and scientific theories. The factors ...

Influence of Variable Fluid Properties and Radiative Heat loss on ...

African Journals Online (AJOL)

Consequently, comparative analysis is also performed on the wall shear stress and local heat transfer of the present study with the available results.The results show that the inclusion variable viscosity and thermal conductivity, and radiative heat loss mechanism cause significant effects on the fluid flow velocity, temperature ...

Variability of hyporheic exchange in an experimental gravel bed

NARCIS (Netherlands)

Perk, M. van der; Petticrew, E.L.; Owens, P.N.

2011-01-01

A series of tracer experiments in a large outdoor flume were conducted to examine the variability of hyporheic exchange in gravel bed sediments. An 18 m long section of a 2 m wide flume was filled with a 30 cm thick gravel layer with a porosity of 0.39. The gravel of the 17 cm top layer was

Effective thermal conductivity of superfluid helium: laminar, turbulent and ballistic regimes

Directory of Open Access Journals (Sweden)

Sciacca Michele

2016-06-01

Full Text Available In this paper we extend previous results on the effective thermal conductivity of liquid helium II in cylindrical channels to rectangular channels with high aspect ratio. The aim is to compare the results in the laminar regime, the turbulent regime and the ballistic regime, all of them obtained within a single mesoscopic formalism of heat transport, with heat flux as an independent variable.

Water sources for cyanobacteria below desert rocks in the Negev Desert determined by conductivity

Directory of Open Access Journals (Sweden)

Christopher P. McKay

2016-04-01

Full Text Available We present year round meteorological and conductivity measurements of colonized hypolithic rocks in the Arava Valley, Negev Desert, Israel. The data indicate that while dew is common in the Negev it is not an important source of moisture for hypolithic organisms at this site. The dominance of cyanobacteria in the hypolithic community is consistent with predictions that cyanobacteria are confined to habitats supplied by rain. To monitor the presence of liquid water under the small Negev rocks we developed and tested a simple field conductivity system based on two wires placed about 0.5 cm apart. Based on 21 replicates recorded for one year in the Negev we conclude that in natural rains (0.25 mm to 6 mm the variability between sensor readings is between 20 and 60% decreasing with increasing rain amount. We conclude that the simple small electrical conductivity system described here can be used effectively to monitor liquid water levels in lithic habitats. However, the natural variability of these sensors indicates that several replicates should be deployed. The results and method presented have use in arid desert reclamation programs.

Comparing bulk electrical conductivities spatial series obtained by Time Domain Reflectometry and Electromagnetic Induction sensors

Science.gov (United States)

Saeed, Ali; Ajeel, Ali; dragonetti, giovanna; Comegna, Alessandro; Lamaddalena, Nicola; Coppola, Antonio

2016-04-01

The ability to determine and monitor the effects of salts on soils and plants, are of great importance to agriculture. To control its harmful effects, soil salinity needs to be monitored in space and time. This requires knowledge of its magnitude, temporal dynamics, and spatial variability. Conventional ground survey procedures by direct soil sampling are time consuming, costly and destructive. Alternatively, soil salinity can be evaluated by measuring the bulk electrical conductivity (σb) directly in the field. Time domain reflectometry (TDR) sensors allow simultaneous measurements of water content, θ, and σb. They may be calibrated for estimating the electrical conductivity of the soil solution (σw). However, they have a relatively small observation window and thus they are thought to only provide local-scale measurements. The spatial range of the sensors is limited to tens of centimeters and extension of the information to a large area can be problematic. Also, information on the vertical distribution of the σb soil profile may only be obtained by installing sensors at different depths. In this sense, the TDR may be considered as an invasive technique. Compared to the TDR, other geophysical methods based for example on Electromagnetic Induction (EMI) techniques are non-invasive methods and represent a viable alternative to traditional techniques for soil characterization. The problem is that all these techniques give depth-weighted apparent electrical conductivity (σa) measurements, depending on the specific depth distribution of the σb, as well as on the depth response function of the sensor used. In order to deduce the actual distribution of the bulk electrical conductivity, σb, in the soil profile, one needs to invert the signal coming from EMI. Because of their relatively lower observation window, TDR sensors provide quasi-point values and do not adequately integrate the spatial variability of the chemical concentration distribution in the soil

Statistical variability of hydro-meteorological variables as indicators ...

African Journals Online (AJOL)

Statistical variability of hydro-meteorological variables as indicators of climate change in north-east Sokoto-Rima basin, Nigeria. ... water resources development including water supply project, agriculture and tourism in the study area. Key word: Climate change, Climatic variability, Actual evapotranspiration, Global warming ...

Variable selection for mixture and promotion time cure rate models.

Science.gov (United States)

Masud, Abdullah; Tu, Wanzhu; Yu, Zhangsheng

2016-11-16

Failure-time data with cured patients are common in clinical studies. Data from these studies are typically analyzed with cure rate models. Variable selection methods have not been well developed for cure rate models. In this research, we propose two least absolute shrinkage and selection operators based methods, for variable selection in mixture and promotion time cure models with parametric or nonparametric baseline hazards. We conduct an extensive simulation study to assess the operating characteristics of the proposed methods. We illustrate the use of the methods using data from a study of childhood wheezing. © The Author(s) 2016.

Mesoporous silicon synthesis and applications in Li-ion batteries and solar hydrogen fuel cells

Science.gov (United States)

Wang, Donghai; Dai, Fang; Yi, Ran; Zai, Jianto

2017-05-23

We provide a mesoporous silicon material (PSi) prepared via a template-free and HF-free process. The production process is facile and scalable, and it may be conducted under mild reaction conditions. The silicon may be produced directly by the reduction of a silicon-halogenide precursor (for example, SiCl.sub.4) with an alkaline alloy (for example, NaK alloy). The resulting Si-salt matrix is then annealed for the pore formation and crystallite growth. Final product is obtained by removal of the salt by-products with water.

Heat conduction in a plate-type fuel element with time-dependent boundary conditions

International Nuclear Information System (INIS)

Faya, A.J.G.; Maiorino, J.R.

1981-01-01

A method for the solution of boundary-value problems with variable boundary conditions is applied to solve a heat conduction problem in a plate-type fuel element with time dependent film coefficient. The numerical results show the feasibility of the method in the solution of this class of problems. (Author) [pt

Variability in dynamic properties of tantalum : spall, attenuation and load/unload.

Energy Technology Data Exchange (ETDEWEB)

Furnish, Michael David; Reinhart, William Dodd; Trott, Wayne Merle; Vogler, Tracy John; Chhabildas, Lalit Chandra

2005-07-01

A suite of impact experiments was conducted to assess spatial and shot-to-shot variability in dynamic properties of tantalum. Samples had a uniform refined {approx}20 micron grain structure with a strong axisymmetric [111] crystallographic texture. Two experiments performed with sapphire windows (stresses of approximately 7 and 12 GPa) clearly showed elastic-plastic loading and slightly hysteretic unloading behavior. An HEL amplitude of 2.8 GPa (corresponding to Y 1.5 GPa) was observed. Free-surface spall experiments showed clear wave attenuation and spallation phenomena. Here, loading stresses were {approx} 12.5 GPa and various ratios of impactor to target thicknesses were used. Spatial and shot-to-shot variability of the spall strength was {+-} 20%, and of the HEL, {+-} 10%. Experiments conducted with smaller diameter flyer plates clearly showed edge effects in the line and point VISAR records, indicating lateral release speeds of roughly 5 km/s.

Analysis of Cattaneo-Christov heat and mass fluxes in the squeezed flow embedded in porous medium with variable mass diffusivity

Directory of Open Access Journals (Sweden)

M. Farooq

Full Text Available This research article investigates the squeezing flow of Newtonian fluid with variable viscosity over a stretchable sheet inserted in Darcy porous medium. Cattaneo-Christov double diffusion models are implemented to scrutinize the characteristics of heat and mass transfer via variable thermal conductivity and variable mass diffusivity. These models are the modification of conventional laws of Fourier’s and Fick’s via thermal and solutal relaxation times respectively. The homotopy analysis Method (HAM is being utilized to provide the solution of highly nonlinear system of coupled partial differential equations after converted into dimensionless governing equations. The behavior of flow parameters on velocity, concentration, and temperature distributions are sketched and analyzed physically. The result indicates that both concentration and temperature distributions decay for higher solutal and thermal relaxation parameters respectively. Keywords: Squeezing flow, Porous medium, Variable viscosity, Cattaneo-Christov heat and mass flux models, Variable thermal conductivity, Variable mass diffusivity

The influence of salinity and drought stress on sodium,potassium and proline content of solanum lycopersicum l. cv. rio grande

International Nuclear Information System (INIS)

Ali, S.; Rab, A.

2017-01-01

The influence of salinity and drought stress on sodium (Na+), potassium (K+) and proline content of Solanum lycopersicum L. (tomato) cv. Rio Grande was investigated by exposing the plants to five salinity levels i.e., 0 (control), 50, 100, 150 and 200 mM NaCl and four drought regimes i.e. 0 (Control), 2, 4 and 6 days, applied from seedling (4-5 true leaves) to the harvesting stage. The means across salinity levels showed an increase in proline content and Na+ concentration but a reduced K+ concentrations, resulting in high Na+/K+ ratios in shoot and root tissue. In contrast, drought stress decreased the Na+ and K+ content, Na+/K+ ratio but increased the proline content in both the root and shoot tissue. The interaction of salinity and drought significantly affected the sodium (Na+) and potassium (K+) contents, Na+/K+ and proline content of the shoot but K+ content and proline accumulation were not significant. The root and shoot tissue of control plants (0 mMNaCl + 0 Days drought stress) had the minimum Na+ content (2316 and 3490 mu M/g D.wt.), Na+/ K+ ratio (0.399 and 0.364) and proline content (0.72 and 1.91 mu M/g F.wt.) but the highest K+ content (6399 and 9603 mu M/g D.wt.). Whereas, the Na+ content increased with salinity, the K+ content declined. It resulted in the maximum Na+/K+ ratio of the root (1.26) and shoot (0.76) with 200 mMNaCl + 0 Days drought stress. The drought stress also increased the Na+/K+ ratio. Thus, the highest Na+/K+ ratio of root (0.78) and shoot (0.77) was recorded in plants grown under 200 mMNaCl+ 6 Days drought stress. The proline content of the root and shoot were 0.462 and 1.904 mu M/g F.wt. respectively in control plants which increased with increasing salinity and drought stress duration. Thus, the maximum proline content of root (10.61 mu M/g F.wt.) and shoot (28.05 mu M/g F.wt.) was recorded in plants exposed to 200 mMNaCl + 6 days drought stress combination. (author)

Conductivity-limiting bipolar thermal conductivity in semiconductors

Science.gov (United States)

Wang, Shanyu; Yang, Jiong; Toll, Trevor; Yang, Jihui; Zhang, Wenqing; Tang, Xinfeng

2015-01-01

Intriguing experimental results raised the question about the fundamental mechanisms governing the electron-hole coupling induced bipolar thermal conduction in semiconductors. Our combined theoretical analysis and experimental measurements show that in semiconductors bipolar thermal transport is in general a “conductivity-limiting” phenomenon, and it is thus controlled by the carrier mobility ratio and by the minority carrier partial electrical conductivity for the intrinsic and extrinsic cases, respectively. Our numerical method quantifies the role of electronic band structure and carrier scattering mechanisms. We have successfully demonstrated bipolar thermal conductivity reduction in doped semiconductors via electronic band structure modulation and/or preferential minority carrier scatterings. We expect this study to be beneficial to the current interests in optimizing thermoelectric properties of narrow gap semiconductors. PMID:25970560

Two-Dimensional Variable Property Conjugate Heat Transfer Simulation of Nanofluids in Microchannels

International Nuclear Information System (INIS)

Ramiar, A.; Ranjbar, A.A.

2013-01-01

Laminar two-dimensional forced convective heat transfer of CuO-water and Al 2 O 3 -water nanofluids in a horizontal microchannel has been studied numerically, considering axial conduction effects in both solid and liquid regions and variable thermal conductivity and dynamic viscosity. The results show that using nanoparticles with higher thermal conductivities will intensify enhancement of heat transfer characteristics and slightly increases shear stress on the wall. The obtained results show more steep changes in Nusselt number for lower diameters and also higher values of Nusselt number by decreasing the diameter of nanoparticles. Also, by utilizing conduction number as the criterion, it was concluded from the results that adding nanoparticles will intensify the axial conduction effect in the geometry considered.

Short timescale variability in the faint sky variability survey

NARCIS (Netherlands)

Morales-Rueda, L.; Groot, P.J.; Augusteijn, T.; Nelemans, G.A.; Vreeswijk, P.M.; Besselaar, E.J.M. van den

2006-01-01

We present the V-band variability analysis of the Faint Sky Variability Survey (FSVS). The FSVS combines colour and time variability information, from timescales of 24 minutes to tens of days, down to V = 24. We find that �1% of all point sources are variable along the main sequence reaching �3.5%

Ion implantation induced conducting nano-cluster formation in PPO

International Nuclear Information System (INIS)

Das, A.; Patnaik, A.; Ghosh, G.; Dhara, S.

1997-01-01

Conversion of polymers and non-polymeric organic molecules from insulating to semiconducting materials as an effect of energetic ion implantation is an established fact. Formation of nano-clusters enriched with carbonaceous materials are made responsible for the insulator-semiconductor transition. Conduction in these implanted materials is observed to follow variable range hopping (VRH) mechanism. Poly(2,6-dimethyl phenylene oxide) [PPO] compatible in various proportion with polystyrene is used as a high thermal resistant insulating polymer. PPO has been used for the first time in the ion implantation study

Resistance controllability and variability improvement in a TaO{sub x}-based resistive memory for multilevel storage application

Energy Technology Data Exchange (ETDEWEB)

Prakash, A., E-mail: amitknp@postech.ac.kr, E-mail: amit.knp02@gmail.com, E-mail: hwanghs@postech.ac.kr; Song, J.; Hwang, H., E-mail: amitknp@postech.ac.kr, E-mail: amit.knp02@gmail.com, E-mail: hwanghs@postech.ac.kr [Department of Materials Science and Engineering, Pohang University of Science and Technology (POSTECH), 77 Cheongam-ro, Nam-gu, Pohang, 790-784 (Korea, Republic of); Deleruyelle, D.; Bocquet, M. [Im2np, UMR CNRS 7334, Aix-Marseille Université, Marseille (France)

2015-06-08

In order to obtain reliable multilevel cell (MLC) characteristics, resistance controllability between the different resistance levels is required especially in resistive random access memory (RRAM), which is prone to resistance variability mainly due to its intrinsic random nature of defect generation and filament formation. In this study, we have thoroughly investigated the multilevel resistance variability in a TaO{sub x}-based nanoscale (<30 nm) RRAM operated in MLC mode. It is found that the resistance variability not only depends on the conductive filament size but also is a strong function of oxygen vacancy concentration in it. Based on the gained insights through experimental observations and simulation, it is suggested that forming thinner but denser conductive filament may greatly improve the temporal resistance variability even at low operation current despite the inherent stochastic nature of resistance switching process.

Dimmable electronic ballasts by variable power density modulation technique

Science.gov (United States)

Borekci, Selim; Kesler, Selami

2014-11-01

Dimming can be accomplished commonly by switching frequency and pulse density modulation techniques and a variable inductor. In this study, a variable power density modulation (VPDM) control technique is proposed for dimming applications. A fluorescent lamp is operated in several states to meet the desired lamp power in a modulation period. The proposed technique has the same advantages of magnetic dimming topologies have. In addition, a unique and flexible control technique can be achieved. A prototype dimmable electronic ballast is built and experiments related to it have been conducted. As a result, a 36WT8 fluorescent lamp can be driven for a desired lamp power from several alternatives without modulating the switching frequency.

Electrical conductivity and modulus formulation in zinc modified bismuth boro-tellurite glasses

Science.gov (United States)

Dhankhar, Sunil; Kundu, R. S.; Dult, Meenakshi; Murugavel, S.; Punia, R.; Kishore, N.

2016-09-01

The ac conductivity of zinc modified tellurium based quaternary glasses having composition 60 TeO2-10 B2O3-(30 - x) Bi2O3-x ZnO; x = 10, 15, 20, 25 and 30 has been investigated in the frequency range 10-1-105 Hz and in temperature range 483-593 K. Frequency and temperature dependent ac conductivity found to obey Jonscher power law modified by Almond-West. DC conductivity, crossover frequency and frequency exponent have been estimated from the fitting of the experimental data of conductivity with Jonscher power law modified by Almond-West. The ac conductivity and its frequency exponent have been analyzed by various theoretical models. In presently studied glasses ac conduction takes place via tunneling of overlapping large polaron tunneling. Activation energy is found to be increased with increase in zinc content and dc conduction takes place via variable range hopping proposed by Mott with some modification suggested by Punia et al. The value of the stretched exponent ( β) obtained by fitting of M^' ' }} reveals the presence of non-Debye type relaxation. Scaling spectra of ac conductivity and electric modulus collapse into a single master curve for all compositions and temperatures, reveals the presence of composition and temperature independent conduction and relaxation process in these glasses. Activation energy of conduction ( W) and electric modulus ( E R ) are nearly equal, indicating that polaron have to overcome the same energy barrier during conduction as well as relaxation processes.

Fuzzy variable impedance control based on stiffness identification for human-robot cooperation

Science.gov (United States)

Mao, Dachao; Yang, Wenlong; Du, Zhijiang

2017-06-01

This paper presents a dynamic fuzzy variable impedance control algorithm for human-robot cooperation. In order to estimate the intention of human for co-manipulation, a fuzzy inference system is set up to adjust the impedance parameter. Aiming at regulating the output fuzzy universe based on the human arm’s stiffness, an online stiffness identification method is developed. A drag interaction task is conducted on a 5-DOF robot with variable impedance control. Experimental results demonstrate that the proposed algorithm is superior.

Populus species from diverse habitats maintain high night-time conductance under drought.

Science.gov (United States)

Cirelli, Damián; Equiza, María Alejandra; Lieffers, Victor James; Tyree, Melvin Thomas

2016-02-01

We investigated the interspecific variability in nocturnal whole-plant stomatal conductance under well-watered and drought conditions in seedlings of four species of Populus from habitats characterized by abundant water supply (mesic and riparian) or from drier upland sites. The study was carried out to determine whether (i) nocturnal conductance varies across different species of Populus according to their natural habitat, (ii) nocturnal conductance is affected by water stress similarly to daytime conductance based on species habitat and (iii) differences in conductance among species could be explained partly by differences in stomatal traits. We measured whole-plant transpiration and conductance (G) of greenhouse-grown seedlings using an automated high-resolution gravimetric technique. No relationship was found between habitat preference and daytime G (GD), but night-time G (GN) was on average 1.5 times higher in riparian and mesic species (P. deltoides Bartr. ex Marsh. and P. trichocarpa Torr. & Gray) than in those from drier environments (P. tremuloides Michx. and P. × petrowskyana Schr.). GN was not significantly reduced under drought in riparian species. Upland species restricted GN significantly in response to drought, but it was still at least one order of magnitude greater that the cuticular conductance until leaf death was imminent. Under both well-watered and drought conditions, GN declined with increasing vapour pressure deficit (D). Also, a small increase in GN towards the end of the night period was observed in P. deltoides and P. × petrowskyana, suggesting the involvement of endogenous regulation. The anatomical analyses indicated a positive correlation between G and variable stomatal pore index among species and revealed that stomata are not likely to be leaky but instead seem capable of complete occlusion, which raises the question of the possible physiological role of the significant GN observed under drought. Further comparisons among

THERMAL CONDUCTIVITY OF THE POTENTIAL REPOSITORY HORIZON

Energy Technology Data Exchange (ETDEWEB)

J.E. BEAN

2004-09-27

The primary purpose of this report is to assess the spatial variability and uncertainty of bulk thermal conductivity in the host horizon for the repository at Yucca Mountain. More specifically, the lithostratigraphic units studied are located within the Topopah Spring Tuff (Tpt) and consist of the upper lithophysal zone (Tptpul), the middle nonlithophysal zone (Tptpmn), the lower lithophysal zone (Tptpll), and the lower nonlithophysal zone (Tptpln). Design plans indicate that approximately 81 percent of the repository will be excavated in the Tptpll, approximately 12 percent in the Tptpmn, and the remainder in the Tptul and Tptpln (BSC 2004 [DIRS 168370]). This report provides three-dimensional geostatistical estimates of the bulk thermal conductivity for the four stratigraphic layers of the repository horizon. The three-dimensional geostatistical estimates of matrix and lithophysal porosity, dry bulk density, and matrix thermal conductivity are also provided. This report provides input to various models and calculations that simulate heat transport through the rock mass. These models include the ''Drift Degradation Analysis, Multiscale Thermohydrologic Model, Ventilation Model and Analysis Report, Igneous Intrusion Impacts on Waste Packages and Waste Forms, Drift-Scale Coupled Processes (DST and TH Seepage) Models'', and ''Drift Scale THM Model''. These models directly or indirectly provide input to the total system performance assessment (TSPA). The main distinguishing characteristic among the lithophysal and nonlithophysal units is the percentage of large-scale (centimeters-meters) voids within the rock. The Tptpul and Tptpll, as their names suggest, have a higher percentage of lithophysae than the Tptpmn and the Tptpln. Understanding the influence of the lithophysae is of great importance to understanding bulk thermal conductivity.

Steady nanofluid flow with variable fluid possessions over a linearly extending surface: A Lie group exploration

Directory of Open Access Journals (Sweden)

Kalidas Das

2018-03-01

Full Text Available The temperament of stream characteristic, heat and mass transfer of MHD forced convective flow over a linearly expanding porous medium has been scrutinized in the progress exploration. The germane possessions of the liquid like viscosity along with thermal conductivity are believed to be variable in nature, directly influenced by the temperature of flow. As soon as gaining the system of leading equations of the stream, Lie symmetric group transformations have been employed to come across the fitting parallel conversions to alter the central PDEs into a suit of ODEs. The renovated system of ODE with appropriate boundary conditions is numerically solved with the assistance of illustrative software MAPLE 17. The consequences of the relevant factors of the system have been exemplified through charts and graphs. An analogous qualified survey has been prepared among present inquiry and subsisting reads and achieved an admirable accord between them. The variable viscosity parameter has more significant effect on nanofluid velocity than regular fluid and temporal profile as well as nanoparticle concentration is also influenced with variable viscosity. Keywords: Nanofluid, Stretching sheet, Variable viscosity, Variable thermal conductivity, Lie symmetry group

Effect of point defects on the thermal conductivity of UO2: molecular dynamics simulations

Energy Technology Data Exchange (ETDEWEB)

Liu, Xiang-Yang [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Stanek, Christopher Richard [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Andersson, Anders David Ragnar [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2015-07-21

The thermal conductivity of uranium dioxide (UO₂) fuel is an important materials property that affects fuel performance since it is a key parameter determining the temperature distribution in the fuel, thus governing, e.g., dimensional changes due to thermal expansion, fission gas release rates, etc. [1] The thermal conductivity of UO₂ nuclear fuel is also affected by fission gas, fission products, defects, and microstructural features such as grain boundaries. Here, molecular dynamics (MD) simulations are carried out to determine quantitatively, the effect of irradiation induced point defects on the thermal conductivity of UO₂, as a function of defect concentrations, for a range of temperatures, 300 – 1500 K. The results will be used to develop enhanced continuum thermal conductivity models for MARMOT and BISON by INL. These models express the thermal conductivity as a function of microstructure state-variables, thus enabling thermal conductivity models with closer connection to the physical state of the fuel [2].

[Effects of NaCl stress on cation contents in different pumpkin cultivars' seedlings].

Science.gov (United States)

Li, Wei-Xin; Chen, Gui-Lin; Ren, Liang-Yu; Wang, Peng

2008-03-01

With the seedlings of 19 pumpkin cultivars as test materials, this paper studied the variations of Na+, K+, Ca2+, Na+/K+, Na+/Ca2+, SN+, K+ and SNa+, ca2+ in their shoots and roots under the stress of 300 mmol NaCl x L(-1). The results showed that after an 8-day exposure to 300 mmol NaCl x L(-1), the Na+ content in the seedlings increased significantly while the K+ content decreased, resulting in the brokenness of ion balance. The root Na+ content, shoot Na+/K+ and Na+/Ca2+ ratios, and SNa+, K+ and SNa+, Ca2+ of Cucurbita moschata (Q1) were significantly higher than those of C. maxima (H2) and C. ficifolia (H3). The variation tendency of these parameters of different pumpkin cultivars' seedlings were nearly consistent with the salt injury index of the seedlings under NaCl stress, which further proved that the strong salt-tolerance of Q1 was related to the lower values of shoot Na+/K+, Na+/Ca2+, SNa+, K+ and SNa+, Ca2+, and the high contents of K+ and Ca2+, while the salt-sensitivity of H2 and H3 was related to the higher values of shoot Na+/K+, Na+/Ca2+, SNa+, K+ and SNa+, Ca2+, and low contents of K+ and Ca2+ under NaCl stress.

Variable viscosity and thermal conductivity effects on MHD flow and heat transfer in viscoelastic fluid over a stretching sheet

International Nuclear Information System (INIS)

Salem, Ahmed M.

2007-01-01

The problem of flow and heat transfer of an electrically conducting viscoelastic fluid over a continuously stretching sheet in the presence of a uniform magnetic field is analyzed for the case of power-law variation in the sheet temperature. The fluid viscosity and thermal conductivity are assumed to vary as a function of temperature. The basic equations comprising the balance laws of mass, linear momentum, and energy modified to include the electromagnetic force effect, the viscous dissipation, internal heat generation or absorption and work due to deformation are solved numerically

Are Ontario Teachers Paid More Equitably? Do Local Variables Matter?

Directory of Open Access Journals (Sweden)

Xiaobin Li

2010-05-01

Full Text Available This study investigated whether Ontario’s education funding reform of 1998 made teacher salaries more equitable. It also examined whether selected local variables had the same influence on teacher salaries in 2001-02 as they did in 1995-96 before the reform. Average teacher salaries before the reform in 1995-96 and after the reform in 2001-02 among school boards and among census divisions were compared to see whether the variation in teacher salaries increased or decreased. A partial correlation analysis was conducted to examine the influence on teacher salaries from local variables, which were derived from a literature review. This study finds that (a teachers are paid more equitably today than before the reform, and (b local variables no longer really matter, as a result of the changed provincial funding formula.

Complex electric conductivity of rocks

International Nuclear Information System (INIS)

Rocha, B.R.P. da.

1982-01-01

Laboratory measurements of complex conductivity were made on 28 drill-core samples from area MM1-Prospect 1 of the Carajas Mining District. The objective of this research was to help interpret field geophysical survey of the area using Induced Polarization and AFMAG methods. A petrographic study of the samples was done, using thin sections, polished sections and X-ray diffraction. Copper content, in the form of sulfides, was determined using atomic absorption. As a result of the petrographic study, the samples were classified in five distinct groups: granite, biotite schist, amphibolite and magnetite quartzite-iron formation. The grade of Cu was variable in the five groups, ranging from 50 ppm to 6000 ppm. In conclusion, these measurements show that the field Induced Polarization and AFMAG anomalies near these three drill holes (F1, F2 and F3) are due primarily to the magnetic iron formation, and secondarily due to associated low-grade chalcopyrite mineralization. (author) [pt

SAGE-VAR: AN INFRARED SURVEY OF VARIABILITY IN THE MAGELLANIC CLOUDS

Energy Technology Data Exchange (ETDEWEB)

Riebel, D. [Department of Physics, United States Naval Academy, 572 C Holloway Road, Annapolis, MD 21402 (United States); Boyer, M. L. [Observational Cosmology Laboratory, Code 665, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States); Srinivasan, S. [Academia Sinica, Institute of Astronomy and Astrophysics, P.O. Box 23-141, Taipei 10617, Taiwan (China); Whitelock, P.; Feast, M. [Astrophysics, Cosmology and Gravity Centre, Astronomy Department, University of Cape Town, Rondebosch 7701 (South Africa); Meixner, M.; Shiao, B. [Space Telescope Science Institute, 3700 San Martin Drive, Baltimore, MD 21218 (United States); Babler, B.; Meade, M.; Whitney, B. [Department of Astronomy, University of Wisconsin-Madison, Madison, WI 53706 (United States); Groenewegen, M. A. T. [Royal Observatory of Belgium, Ringlaan 3, B-1180 Brussels (Belgium); Ita, Y., E-mail: riebel.d@gmail.com [Astronomical Institute, Graduate School of Science, Tohoku University, 6-3 Aramaki Aoba, Aoba-ku, Sendai, Miyagi 980-8578 (Japan)

2015-07-01

We present the first results from the Surveying the Agents of Galaxy Evolution (SAGE)-Var program, a follow up to the Spitzer legacy program SAGE (Meixner et al.). We obtained four epochs of photometry at 3.6 and 4.5 μm covering the bar of the LMC and the central region of the SMC in order to probe the variability of extremely red sources missed by variability surveys conducted at shorter wavelengths, and to provide additional epochs of observation for known variables. Our six total epochs of observations allow us to probe infrared (IR) variability on 15 different timescales ranging from ∼20 days to ∼5 yr. Out of a full catalog of 1 717 554 (LMC) and 457 760 (SMC) objects, we find 10 (LMC) and 6 (SMC) large amplitude Asymptotic Giant Branch (AGB) variables without optically measured variability owing to circumstellar dust obscuration. The catalog also contains multiple observations of known AGB variables, type I and II Cepheids, eclipsing variables, R CrB stars, and young stellar objects, which will be discussed in following papers. Here we present IR Period–Luminosity (PL) relations for classical Cepheids in the Magellanic Clouds, as well as improved PL relationships for AGB stars pulsating in the fundamental mode using mean magnitudes constructed from six epochs of observations.

SAGE-VAR: AN INFRARED SURVEY OF VARIABILITY IN THE MAGELLANIC CLOUDS

International Nuclear Information System (INIS)

Riebel, D.; Boyer, M. L.; Srinivasan, S.; Whitelock, P.; Feast, M.; Meixner, M.; Shiao, B.; Babler, B.; Meade, M.; Whitney, B.; Groenewegen, M. A. T.; Ita, Y.

2015-01-01

We present the first results from the Surveying the Agents of Galaxy Evolution (SAGE)-Var program, a follow up to the Spitzer legacy program SAGE (Meixner et al.). We obtained four epochs of photometry at 3.6 and 4.5 μm covering the bar of the LMC and the central region of the SMC in order to probe the variability of extremely red sources missed by variability surveys conducted at shorter wavelengths, and to provide additional epochs of observation for known variables. Our six total epochs of observations allow us to probe infrared (IR) variability on 15 different timescales ranging from ∼20 days to ∼5 yr. Out of a full catalog of 1 717 554 (LMC) and 457 760 (SMC) objects, we find 10 (LMC) and 6 (SMC) large amplitude Asymptotic Giant Branch (AGB) variables without optically measured variability owing to circumstellar dust obscuration. The catalog also contains multiple observations of known AGB variables, type I and II Cepheids, eclipsing variables, R CrB stars, and young stellar objects, which will be discussed in following papers. Here we present IR Period–Luminosity (PL) relations for classical Cepheids in the Magellanic Clouds, as well as improved PL relationships for AGB stars pulsating in the fundamental mode using mean magnitudes constructed from six epochs of observations

The Temperature and Salinity Variabilities at Cisadane Estuary

Directory of Open Access Journals (Sweden)

Hadikusumah

2008-11-01

Full Text Available The study was conducted at Cisadane Estuary at 18 oceanographic station in Transition Monsoon Season I, East Monsoon Season, and Transition Monsoon Season II from 2003 to 2005. The area of the study was located at the longitude of 106.58° - 106.70° E and the latitude of 5.96° - 6.02°S. The measurements of temperature, salinity, tubidity and light transmision used CTD (Conductivity, Temperature and Depth Model SBE-19. The result shows that the temperature and salinity vertical profil variabilities at Cisadane Estuary underwent a change in the influence of Transition Monsoon Season I, East Monsoon Season, and Transition Monsoon Season II, for example it was obtained the leg time of the maximum salinity of Transition Monsoon Season II as the same as that of East Monsoon Season. Based on the horizontal and vertical distribution pattern analysis of the interaction between low salinity fresh water of Cisadane River and high salinity sea water of Java Sea, it was also influenced by the season variability and tide. The surface layer was much more influenced by the low salinity and the heat of sunray (seasonal variability with the weaker intensity to the lower layer. The change of the heat energy by the increase of seasonal temperature occurred in September 2003 to May 2004 ((ΔE = 600.6 ⋅ 105 Joule, July to November 2005 (ΔE = 84.9 Joule. The decrease of the heat energy occurred in June to September 2003 ((-267.6 ⋅ 105, May ke October 2004 (ΔE = 189.3 ⋅ 105 Joule and October 2004 to July 2005 (ΔE = -215.4 ⋅ 105 Joule.

All varieties of encoding variability are not created equal: Separating variable processing from variable tasks

Science.gov (United States)

Huff, Mark J.; Bodner, Glen E.

2014-01-01

Whether encoding variability facilitates memory is shown to depend on whether item-specific and relational processing are both performed across study blocks, and whether study items are weakly versus strongly related. Variable-processing groups studied a word list once using an item-specific task and once using a relational task. Variable-task groups’ two different study tasks recruited the same type of processing each block. Repeated-task groups performed the same study task each block. Recall and recognition were greatest in the variable-processing group, but only with weakly related lists. A variable-processing benefit was also found when task-based processing and list-type processing were complementary (e.g., item-specific processing of a related list) rather than redundant (e.g., relational processing of a related list). That performing both item-specific and relational processing across trials, or within a trial, yields encoding-variability benefits may help reconcile decades of contradictory findings in this area. PMID:25018583

The Structure of Character Strengths: Variable- and Person-Centered Approaches

Directory of Open Access Journals (Sweden)

Małgorzata Najderska

2018-02-01

Full Text Available This article examines the structure of character strengths (Peterson and Seligman, 2004 following both variable-centered and person-centered approaches. We used the International Personality Item Pool-Values in Action (IPIP-VIA questionnaire. The IPIP-VIA measures 24 character strengths and consists of 213 direct and reversed items. The present study was conducted in a heterogeneous group of N = 908 Poles (aged 18–78, M = 28.58. It was part of a validation project of a Polish version of the IPIP-VIA questionnaire. The variable-centered approach was used to examine the structure of character strengths on both the scale and item levels. The scale-level results indicated a four-factor structure that can be interpreted based on four of the five personality traits from the Big Five theory (excluding neuroticism. The item-level analysis suggested a slightly different and limited set of character strengths (17 not 24. After conducting a second-order analysis, a four-factor structure emerged, and three of the factors could be interpreted as being consistent with the scale-level factors. Three character strength profiles were found using the person-centered approach. Two of them were consistent with alpha and beta personality metatraits. The structure of character strengths can be described by using categories from the Five Factor Model of personality and metatraits. They form factors similar to some personality traits and occur in similar constellations as metatraits. The main contributions of this paper are: (1 the validation of IPIP-VIA conducted in variable-centered approach in a new research group (Poles using a different measurement instrument; (2 introducing the person-centered approach to the study of the structure of character strengths.

CONSTRUCTING ACCOUNTING UNCERTAINITY ESTIMATES VARIABLE

Directory of Open Access Journals (Sweden)

Nino Serdarevic

2012-10-01

Full Text Available This paper presents research results on the BIH firms’ financial reporting quality, utilizing empirical relation between accounting conservatism, generated in created critical accounting policy choices, and management abilities in estimates and prediction power of domicile private sector accounting. Primary research is conducted based on firms’ financial statements, constructing CAPCBIH (Critical Accounting Policy Choices relevant in B&H variable that presents particular internal control system and risk assessment; and that influences financial reporting positions in accordance with specific business environment. I argue that firms’ management possesses no relevant capacity to determine risks and true consumption of economic benefits, leading to creation of hidden reserves in inventories and accounts payable; and latent losses for bad debt and assets revaluations. I draw special attention to recent IFRS convergences to US GAAP, especially in harmonizing with FAS 130 Reporting comprehensive income (in revised IAS 1 and FAS 157 Fair value measurement. CAPCBIH variable, resulted in very poor performance, presents considerable lack of recognizing environment specifics. Furthermore, I underline the importance of revised ISAE and re-enforced role of auditors in assessing relevance of management estimates.

Process variables in organizational stress management intervention evaluation research: a systematic review.

Science.gov (United States)

Havermans, Bo M; Schlevis, Roosmarijn Mc; Boot, Cécile Rl; Brouwers, Evelien Pm; Anema, Johannes; van der Beek, Allard J

2016-09-01

This systematic review aimed to explore which process variables are used in stress management intervention (SMI) evaluation research. A systematic review was conducted using seven electronic databases. Studies were included if they reported on an SMI aimed at primary or secondary stress prevention, were directed at paid employees, and reported process data. Two independent researchers checked all records and selected the articles for inclusion. Nielsen and Randall's model for process evaluation was used to cluster the process variables. The three main clusters were context, intervention, and mental models. In the 44 articles included, 47 process variables were found, clustered into three main categories: context (two variables), intervention (31 variables), and mental models (14 variables). Half of the articles contained no reference to process evaluation literature. The collection of process evaluation data mostly took place after the intervention and at the level of the employee. The findings suggest that there is great heterogeneity in methods and process variables used in process evaluations of SMI. This, together with the lack of use of a standardized framework for evaluation, hinders the advancement of process evaluation theory development.

MEASUREMENT OPTIMALIZATION OF ZAKAT DISTRIBUTION AT LEMBAGA AMIL ZAKAT USING VARIABLE MEASUREMENT OF ECONOMY

Directory of Open Access Journals (Sweden)

Marissa Haque

2016-09-01

Full Text Available The aim of this research conducted is to optimalize the zakat distribution using economy variabel measurement. Design/Metodology. The Quantitative Research Method is used to analyze financial data, with Optimalize Model as Z variable design, Measurement of Economy as Y variable and Objective Output as X variable, using AMOS program and SEM as tool analysis to confirm that the model can be used as a measurement tool. Research result. Using some indicators to analyze every variable, obtaining output and objective result, influence optimalization of measurement of economy. Conclusion. The measurement of optimalization of zakat distribution using measurement of economy variable, with independent variable/output exogenous and objective, can be used as a model to measure Lembaga Amil Zakat performance. Furthermore, this research need to have some indicators’ development especially in the area of objective variable. Key words:   Output, Objective, Measurement of Economy, Distribution Optimalization, Zakat JEL Classification: D64

SODIUM-POTASSIUM-CHLORIDE COTRANSPORT IN THE REGULATION OF VASCULAR MYOGENIC TONE

Directory of Open Access Journals (Sweden)

S. N. Orlov

2014-01-01

Full Text Available The article discusses the data on the functioning of Na+,K+,2Cl– cotransport – the carrier providing electroneutral symport of sodium, potassium and chloride, as well as molecular mechanisms of the regulation and physiological significance of this carrier. We analyzed the novel data on involvement of ubiquitous isoform of Na+,K+,2Cl–cotransporter (NKCC1 in regulation of vascular smooth muscle contraction, and role of this carrier in the regulation of cell volume and intracellular chloride concentration.

Guidelines for the Investigation of Mediating Variables in Business Research.

Science.gov (United States)

MacKinnon, David P; Coxe, Stefany; Baraldi, Amanda N

2012-03-01

Business theories often specify the mediating mechanisms by which a predictor variable affects an outcome variable. In the last 30 years, investigations of mediating processes have become more widespread with corresponding developments in statistical methods to conduct these tests. The purpose of this article is to provide guidelines for mediation studies by focusing on decisions made prior to the research study that affect the clarity of conclusions from a mediation study, the statistical models for mediation analysis, and methods to improve interpretation of mediation results after the research study. Throughout this article, the importance of a program of experimental and observational research for investigating mediating mechanisms is emphasized.

Conducting polymer coated neural recording electrodes

Science.gov (United States)

Harris, Alexander R.; Morgan, Simeon J.; Chen, Jun; Kapsa, Robert M. I.; Wallace, Gordon G.; Paolini, Antonio G.

2013-02-01

Objective. Neural recording electrodes suffer from poor signal to noise ratio, charge density, biostability and biocompatibility. This paper investigates the ability of conducting polymer coated electrodes to record acute neural response in a systematic manner, allowing in depth comparison of electrochemical and electrophysiological response. Approach. Polypyrrole (Ppy) and poly-3,4-ethylenedioxythiophene (PEDOT) doped with sulphate (SO4) or para-toluene sulfonate (pTS) were used to coat iridium neural recording electrodes. Detailed electrochemical and electrophysiological investigations were undertaken to compare the effect of these materials on acute in vivo recording. Main results. A range of charge density and impedance responses were seen with each respectively doped conducting polymer. All coatings produced greater charge density than uncoated electrodes, while PEDOT-pTS, PEDOT-SO4 and Ppy-SO4 possessed lower impedance values at 1 kHz than uncoated electrodes. Charge density increased with PEDOT-pTS thickness and impedance at 1 kHz was reduced with deposition times up to 45 s. Stable electrochemical response after acute implantation inferred biostability of PEDOT-pTS coated electrodes while other electrode materials had variable impedance and/or charge density after implantation indicative of a protein fouling layer forming on the electrode surface. Recording of neural response to white noise bursts after implantation of conducting polymer-coated electrodes into a rat model inferior colliculus showed a general decrease in background noise and increase in signal to noise ratio and spike count with reduced impedance at 1 kHz, regardless of the specific electrode coating, compared to uncoated electrodes. A 45 s PEDOT-pTS deposition time yielded the highest signal to noise ratio and spike count. Significance. A method for comparing recording electrode materials has been demonstrated with doped conducting polymers. PEDOT-pTS showed remarkable low fouling during

Concurrent variable-interval variable-ratio schedules in a dynamic choice environment.

Science.gov (United States)

Bell, Matthew C; Baum, William M

2017-11-01

Most studies of operant choice have focused on presenting subjects with a fixed pair of schedules across many experimental sessions. Using these methods, studies of concurrent variable- interval variable-ratio schedules helped to evaluate theories of choice. More recently, a growing literature has focused on dynamic choice behavior. Those dynamic choice studies have analyzed behavior on a number of different time scales using concurrent variable-interval schedules. Following the dynamic choice approach, the present experiment examined performance on concurrent variable-interval variable-ratio schedules in a rapidly changing environment. Our objectives were to compare performance on concurrent variable-interval variable-ratio schedules with extant data on concurrent variable-interval variable-interval schedules using a dynamic choice procedure and to extend earlier work on concurrent variable-interval variable-ratio schedules. We analyzed performances at different time scales, finding strong similarities between concurrent variable-interval variable-interval and concurrent variable-interval variable- ratio performance within dynamic choice procedures. Time-based measures revealed almost identical performance in the two procedures compared with response-based measures, supporting the view that choice is best understood as time allocation. Performance at the smaller time scale of visits accorded with the tendency seen in earlier research toward developing a pattern of strong preference for and long visits to the richer alternative paired with brief "samples" at the leaner alternative ("fix and sample"). © 2017 Society for the Experimental Analysis of Behavior.

Periodic optical variability of radio-detected ultracool dwarfs

International Nuclear Information System (INIS)

Harding, L. K.; Golden, A.; Singh, Navtej; Sheehan, B.; Butler, R. F.; Hallinan, G.; Boyle, R. P.; Zavala, R. T.

2013-01-01

A fraction of very low mass stars and brown dwarfs are known to be radio active, in some cases producing periodic pulses. Extensive studies of two such objects have also revealed optical periodic variability, and the nature of this variability remains unclear. Here, we report on multi-epoch optical photometric monitoring of six radio-detected dwarfs, spanning the ∼M8-L3.5 spectral range, conducted to investigate the ubiquity of periodic optical variability in radio-detected ultracool dwarfs. This survey is the most sensitive ground-based study carried out to date in search of periodic optical variability from late-type dwarfs, where we obtained 250 hr of monitoring, delivering photometric precision as low as ∼0.15%. Five of the six targets exhibit clear periodicity, in all cases likely associated with the rotation period of the dwarf, with a marginal detection found for the sixth. Our data points to a likely association between radio and optical periodic variability in late-M/early-L dwarfs, although the underlying physical cause of this correlation remains unclear. In one case, we have multiple epochs of monitoring of the archetype of pulsing radio dwarfs, the M9 TVLM 513–46546, spanning a period of 5 yr, which is sufficiently stable in phase to allow us to establish a period of 1.95958 ± 0.00005 hr. This phase stability may be associated with a large-scale stable magnetic field, further strengthening the correlation between radio activity and periodic optical variability. Finally, we find a tentative spin-orbit alignment of one component of the very low mass binary, LP 349–25.

Periodic optical variability of radio-detected ultracool dwarfs

Energy Technology Data Exchange (ETDEWEB)

Harding, L. K.; Golden, A.; Singh, Navtej; Sheehan, B.; Butler, R. F. [Centre for Astronomy, National University of Ireland, Galway, University Road, Galway (Ireland); Hallinan, G. [Cahill Center for Astrophysics, California Institute of Technology, 1200 East California Boulevard, MC 249-17, Pasadena, CA 91125 (United States); Boyle, R. P. [Vatican Observatory Research Group, Steward Observatory, University of Arizona, Tucson, AZ 85721 (United States); Zavala, R. T., E-mail: lkh@astro.caltech.edu [United States Naval Observatory, Flagstaff Station, Flagstaff, AZ 86001 (United States)

2013-12-20

A fraction of very low mass stars and brown dwarfs are known to be radio active, in some cases producing periodic pulses. Extensive studies of two such objects have also revealed optical periodic variability, and the nature of this variability remains unclear. Here, we report on multi-epoch optical photometric monitoring of six radio-detected dwarfs, spanning the ∼M8-L3.5 spectral range, conducted to investigate the ubiquity of periodic optical variability in radio-detected ultracool dwarfs. This survey is the most sensitive ground-based study carried out to date in search of periodic optical variability from late-type dwarfs, where we obtained 250 hr of monitoring, delivering photometric precision as low as ∼0.15%. Five of the six targets exhibit clear periodicity, in all cases likely associated with the rotation period of the dwarf, with a marginal detection found for the sixth. Our data points to a likely association between radio and optical periodic variability in late-M/early-L dwarfs, although the underlying physical cause of this correlation remains unclear. In one case, we have multiple epochs of monitoring of the archetype of pulsing radio dwarfs, the M9 TVLM 513–46546, spanning a period of 5 yr, which is sufficiently stable in phase to allow us to establish a period of 1.95958 ± 0.00005 hr. This phase stability may be associated with a large-scale stable magnetic field, further strengthening the correlation between radio activity and periodic optical variability. Finally, we find a tentative spin-orbit alignment of one component of the very low mass binary, LP 349–25.

Conductivity in insulators due to implantation of conducting species

International Nuclear Information System (INIS)

Prawer, S.; Kalish, R.

1993-01-01

Control of the surface conductivity of insulators can be accomplished by high dose ion implantation of conductive species. The use of C + as the implant species is particularly interesting because C can either form electrically insulating sp 3 bonds or electrically conducting sp 2 bonds. In the present work, fused quartz plates have been irradiated with 100 keV C + ions to doses up to 1 x 10 17 ions/cm 2 at room temperature and at 200 deg C. The ion beam induced conductivity was monitored in-situ and was found to increase by up to 8 orders to magnitude for the ion dose range studied. Xe implantations over a similar range did not induce any changes in the conductivity showing that the increase in conductivity is caused by the presence of the C in the fused quartz matrix and not by damage. The dependence of the conductivity on implantation temperature and on post implantation annealing sheds light on the clustering of the C implants. The temperature dependence of the conductivity for the highest doses employed (1 x 10 17 C + /cm 2 ) can be described very well by lnσ α T. This is considered to be a peculiar dependence which does not comply with any of the standard models for conduction. 9 refs., 1 tab., 6 figs

Investigation of load reduction for a variable speed, variable pitch, and variable coning wind turbine

Energy Technology Data Exchange (ETDEWEB)

Pierce, K. [Univ. of Utah, Salt Lake City, UT (United States)

1997-12-31

A two bladed, variable speed and variable pitch wind turbine was modeled using ADAMS{reg_sign} to evaluate load reduction abilities of a variable coning configuration as compared to a teetered rotor, and also to evaluate control methods. The basic dynamic behavior of the variable coning turbine was investigated and compared to the teetered rotor under constant wind conditions as well as turbulent wind conditions. Results indicate the variable coning rotor has larger flap oscillation amplitudes and much lower root flap bending moments than the teetered rotor. Three methods of control were evaluated for turbulent wind simulations. These were a standard IPD control method, a generalized predictive control method, and a bias estimate control method. Each control method was evaluated for both the variable coning configuration and the teetered configuration. The ability of the different control methods to maintain the rotor speed near the desired set point is evaluated from the RMS error of rotor speed. The activity of the control system is evaluated from cycles per second of the blade pitch angle. All three of the methods were found to produce similar results for the variable coning rotor and the teetered rotor, as well as similar results to each other.

About hidden influence of predictor variables: Suppressor and mediator variables

Directory of Open Access Journals (Sweden)

Milovanović Boško

2013-01-01

Full Text Available In this paper procedure for researching hidden influence of predictor variables in regression models and depicting suppressor variables and mediator variables is shown. It is also shown that detection of suppressor variables and mediator variables could provide refined information about the research problem. As an example for applying this procedure, relation between Atlantic atmospheric centers and air temperature and precipitation amount in Serbia is chosen. [Projekat Ministarstva nauke Republike Srbije, br. 47007

Totally Optimal Decision Trees for Monotone Boolean Functions with at Most Five Variables

KAUST Repository

Chikalov, Igor

2013-01-01

In this paper, we present the empirical results for relationships between time (depth) and space (number of nodes) complexity of decision trees computing monotone Boolean functions, with at most five variables. We use Dagger (a tool for optimization of decision trees and decision rules) to conduct experiments. We show that, for each monotone Boolean function with at most five variables, there exists a totally optimal decision tree which is optimal with respect to both depth and number of nodes.

Process variables in organizational stress management intervention evaluation research: a systematic review

NARCIS (Netherlands)

Havermans, B.M.; Schelvis, R.M.C.; Boot, C.R.L.; Brouwers, E.P.M.; Anema, J.R.; Beek, A.J. van der

2016-01-01

Objectives This systematic review aimed to explore which process variables are used in stress management intervention (SMI) evaluation research. Methods A systematic review was conducted using seven electronic databases. Studies were included if they reported on an SMI aimed at primary or secondary

Process variables in organizational stress management intervention evaluation research : A systematic review

NARCIS (Netherlands)

Havermans, B.M.; Schlevis, Roosmarijn Mc; Boot, Cécile Rl; Brouwers, E.P.M.; Anema, Johannes R; van der Beek, Allard J

2016-01-01

OBJECTIVES: This systematic review aimed to explore which process variables are used in stress management intervention (SMI) evaluation research. METHODS: A systematic review was conducted using seven electronic databases. Studies were included if they reported on an SMI aimed at primary or

A brief history of residual alkali metal destruction development in the UK

International Nuclear Information System (INIS)

Fletcher, Brian

2014-01-01

The reactors at Dounreay are being decommissioned and there is a need to remove all the residual alkali metal before they can be dismantled. When the Prototype Fast Reactor was shut down work was started to remove the bulk sodium and development of the Water Vapour Nitrogen (WVN) process for the destruction of the residual alkali metal commenced. This development has been ongoing to the present day. Trials began with small amounts of sodium and NaK before moving to larger scale experiments. The development raised a number of issues. As knowledge was built up, the development was expanded to deal with NaK pools in the DFR. Differences in the behaviour of NaK and sodium led to various different processes being developed. This paper presents a brief history of the alkali metal destruction process development within the UK and highlights some of the lessons learnt for future application during reactor decommissioning (authors)

Theoretical models for electron conduction in polymer systems—I. Macroscopic calculations of d.c. transient conductivity after pulse irradiation

Science.gov (United States)

Bartczak, Witold M.; Kroh, Jerzy

The simulation of the transient d.c. conductivity in a quasi one-dimensional system of charges produced by a pulse of ionizing radiation in a solid sample has been performed. The simulation is based on the macroscopic conductivity equations and can provide physical insight into d.c. conductivity measurements, particularly for the case of transient currents in samples with internal space charge. We consider the system of mobile (negative) and immobile (positive) charges produced by a pulse of ionizing radiation in the sample under a fixed external voltage V0. The presence of space charge results in an electric field which is a function of both the spatial and the time variable: E( z, t). Given the space charge density, the electric field can be calculated from the Poisson equation. However, for an arbitrary space charge distribution, the corresponding equations can only be solved numerically. The two non-trivial cases for which approximate analytical solutions can be provided are: (i) The density of the current carriers n( z, t) is negligible in comparison with the density of immobile space charge N( z). A general analytical solution has been found for this case using Green's functions. The solutions for two cases, viz. the homogeneous distribution of space charge N( z) = N, and the non-homogeneous exponential distribution N( z) = A exp(- Bz), have been separately discussed. (ii) The space charge created in the pulse without any space charge present prior to the irradiation.

Pseudo-transient Continuation Based Variable Relaxation Solve in Nonlinear Magnetohydrodynamic Simulations

International Nuclear Information System (INIS)

Chen, Jin

2009-01-01

Efficient and robust Variable Relaxation Solver, based on pseudo-transient continuation, is developed to solve nonlinear anisotropic thermal conduction arising from fusion plasma simulations. By adding first and/or second order artificial time derivatives to the system, this type of method advances the resulting time-dependent nonlinear PDEs to steady state, which is the solution to be sought. In this process, only the stiffness matrix itself is involved so that the numerical complexity and errors can be greatly reduced. In fact, this work is an extension of integrating efficient linear elliptic solvers for fusion simulation on Cray XIE. Two schemes are derived in this work, first and second order Variable Relaxations. Four factors are observed to be critical for efficiency and preservation of solution's symmetric structure arising from periodic boundary condition: refining meshes in different coordinate directions, initializing nonlinear process, varying time steps in both temporal and spatial directions, and accurately generating nonlinear stiffness matrix. First finer mesh scale should be taken in strong transport direction; Next the system is carefully initialized by the solution with linear conductivity; Third, time step and relaxation factor are vertex-based varied and optimized at each time step; Finally, the nonlinear stiffness matrix is updated by just scaling corresponding linear one with the vector generated from nonlinear thermal conductivity.

An AO-assisted Variability Study of Four Globular Clusters

Science.gov (United States)

Salinas, R.; Contreras Ramos, R.; Strader, J.; Hakala, P.; Catelan, M.; Peacock, M. B.; Simunovic, M.

2016-09-01

The image-subtraction technique applied to study variable stars in globular clusters represented a leap in the number of new detections, with the drawback that many of these new light curves could not be transformed to magnitudes due to severe crowding. In this paper, we present observations of four Galactic globular clusters, M 2 (NGC 7089), M 10 (NGC 6254), M 80 (NGC 6093), and NGC 1261, taken with the ground-layer adaptive optics module at the SOAR Telescope, SAM. We show that the higher image quality provided by SAM allows for the calibration of the light curves of the great majority of the variables near the cores of these clusters as well as the detection of new variables, even in clusters where image-subtraction searches were already conducted. We report the discovery of 15 new variables in M 2 (12 RR Lyrae stars and 3 SX Phe stars), 12 new variables in M 10 (11 SX Phe and 1 long-period variable), and 1 new W UMa-type variable in NGC 1261. No new detections are found in M 80, but previous uncertain detections are confirmed and the corresponding light curves are calibrated into magnitudes. Additionally, based on the number of detected variables and new Hubble Space Telescope/UVIS photometry, we revisit a previous suggestion that M 80 may be the globular cluster with the richest population of blue stragglers in our Galaxy. Based on observations obtained at the Southern Astrophysical Research (SOAR) telescope, which is a joint project of the Ministério da Ciência, Tecnologia, e Inovação (MCTI) da República Federativa do Brasil, the U.S. National Optical Astronomy Observatory (NOAO), the University of North Carolina at Chapel Hill (UNC), and Michigan State University (MSU).

Sub-nA spatially resolved conductivity profiling of surface and interface defects in ceria films

Directory of Open Access Journals (Sweden)

Tim Farrow

2015-03-01

Full Text Available Spatial variability of conductivity in ceria is explored using scanning probe microscopy with galvanostatic control. Ionically blocking electrodes are used to probe the conductivity under opposite polarities to reveal possible differences in the defect structure across a thin film of CeO2. Data suggest the existence of a large spatial inhomogeneity that could give rise to constant phase elements during standard electrochemical characterization, potentially affecting the overall conductivity of films on the macroscale. The approach discussed here can also be utilized for other mixed ionic electronic conductor systems including memristors and electroresistors, as well as physical systems such as ferroelectric tunneling barriers.

Variable importance in latent variable regression models

NARCIS (Netherlands)

Kvalheim, O.M.; Arneberg, R.; Bleie, O.; Rajalahti, T.; Smilde, A.K.; Westerhuis, J.A.

2014-01-01

The quality and practical usefulness of a regression model are a function of both interpretability and prediction performance. This work presents some new graphical tools for improved interpretation of latent variable regression models that can also assist in improved algorithms for variable

Apparent soil electrical conductivity in two different soil types

Directory of Open Access Journals (Sweden)

Wilker Nunes Medeiros

Full Text Available ABSTRACT Mapping the apparent soil electrical conductivity (ECa has become important for the characterization of the soil variability in precision agriculture systems. Could the ECa be used to locate the soil sampling points for mapping the chemical and physical soil attributes? The objective of this work was to examine the relations between ECa and soil attributes in two fields presenting different soil textures. In each field, 50 sampling points were chosen using a path that presented a high variability of ECa obtained from a preliminary ECa map. At each sampling point, the ECa was measured in soil depths of 0-20, 0-40 and 0-60 cm. In addition, at each point, soil samples were collected for the determination of physical and chemical attributes in the laboratory. The ECa data obtained for different soil depths was very similar. A large number of significant correlations between ECa and the soil attributes were found. In the sandy clay loam texture field there was no correlation between ECa and organic matter or between ECa and soil clay and sand content. However, a significant positive correlation was shown for the remaining phosphorus. In the sandy loam texture field the ECa had a significant positive correlation with clay content and a significant negative correlation with sand content. The results suggest that the mapping of apparent soil electrical conductivity does not replace traditional soil sampling, however, it can be used as information to delimit regions in a field that have similar soil attributes.

Conducting Polymers

Indian Academy of Sciences (India)

would exhibit electronic conductivity, their conductivities (of compressed pellets) were indeed measured by others, and were found to be .... Polyaniline. Polyphenylene. Polypheny lene- vinylene. Table 1. G!NeRAl I ARTICl! structure. Maximum conductivity Stem Stability. Processability. ~. 1.5 x 105. Reacts with Film not n air.