International Nuclear Information System (INIS)
Ayranci, Guler; Sahin, Melike; Ayranci, Erol
2007-01-01
Apparent molar volumes and apparent molar isentropic compressibilities of ascorbic acid (vitamin C) and thiamine hydrochloride (vitamin B 1 ) were determined from accurately measured density and sound velocity data in water and in aqueous NaCl solutions at (283.15, 293.15, 298.15, 303.15, 308.15, and 313.15) K. These volume and compressibility data were extrapolated to zero concentration using suitable empirical or theoretical equations to determine the corresponding infinite dilution values. Apparent molar expansibilities at infinite dilution were determined from slopes of apparent molar volume vs. temperature plots. Ionization of both ascorbic acid and thiamine hydrochloride were suppressed using sufficiently acidic solutions. Apparent molar volumes at infinite dilution for ascorbic acid and thiamine hydrochloride were found to increase with temperature in acidic solutions and in the presence of co-solute, NaCl. Apparent molar expansibility at infinite dilution were found to be constant over the temperature range studied and were all positive, indicating the hydrophilic character of the two vitamins studied in water and in the presence of co-solute, NaCl. Apparent molar isentropic compressibilities of ascorbic acid at infinite dilution were positive in water and in the presence of co-solute, NaCl, at low molalities. Those of thiamine hydrochloride at infinitive dilution were all negative, consistent with its ionic nature. Transfer apparent molar volumes of vitamins at infinite dilution from water solutions to NaCl solutions at various temperatures were determined. The results were interpreted in terms of complex vitamin-water-co-solute (NaCl) interactions
Energy Technology Data Exchange (ETDEWEB)
Difi, Siham [Université de Montpellier, Institut Charles Gerhardt, UMR 5253 CNRS (France); Saadoune, Ismael [Université Cadi Ayyad, Laboratoire de Chimie des Matériaux et de l’Environnement (Morocco); Sougrati, Moulay Tahar [Université de Montpellier, Institut Charles Gerhardt, UMR 5253 CNRS (France); Hakkou, Rachid [Université Cadi Ayyad, Laboratoire de Chimie des Matériaux et de l’Environnement (Morocco); Edstrom, Kristina [Uppsala University, Department of Chemistry - Ångström laboratory (Sweden); Lippens, Pierre-Emmanuel, E-mail: lippens@univ-montp2.fr [Université de Montpellier, Institut Charles Gerhardt, UMR 5253 CNRS (France)
2016-12-15
The role of iron in Na {sub 1.5}Fe {sub 0.5}Ti {sub 1.5}(PO {sub 4}){sub 3}/C electrode material for Na batteries has been studied by {sup 57}Fe Mössbauer spectroscopy in operando mode. The potential profile obtained in the galvanostatic regime shows three plateaus at different voltages due to different reaction mechanisms. Two of them, at 2.2 and 0.3 V vs Na {sup +}/Na {sup 0}, have been associated to redox processes involving iron and titanium in Na {sub 1.5}Fe {sub 0.5}Ti {sub 1.5}(PO {sub 4}){sub 3}. The role of titanium was previously elucidated for NaTi {sub 2}(PO {sub 4}){sub 3} and the effect of the substitution of Fe for Ti was investigated with {sup 57}Fe Mössbauer spectroscopy. We show that iron is an electrochemically active center at 2.2 V with the reversible Fe {sup 3+}/Fe {sup 2+} transformation and then remains at the oxidation state Fe {sup 2+} along the sodiation until the end of discharge at 0 V.
Energy Technology Data Exchange (ETDEWEB)
Osakoo, Nattawut, E-mail: natawut.work@gmail.com [School of Chemistry, Institute of Science, Suranaree University of Technology, Nakhon Ratchasima, 30000 (Thailand); Pansakdanon, Chaianun [School of Chemistry, Institute of Science, Suranaree University of Technology, Nakhon Ratchasima, 30000 (Thailand); Department of Chemistry, Faculty of Science, Ubon Ratchathani University, Ubon Ratchathani, 34190 (Thailand); Sosa, Narongrit; Deekamwong, Krittanun; Keawkumay, Chalermpan; Rongchapo, Wina [School of Chemistry, Institute of Science, Suranaree University of Technology, Nakhon Ratchasima, 30000 (Thailand); Chanlek, Narong [Synchrotron Light Research Institute, Nakhon Ratchasima, 30000 (Thailand); Jitcharoen, Juthamas [Department of Chemistry, Faculty of Science, Ubon Ratchathani University, Ubon Ratchathani, 34190 (Thailand); Prayoonpokarach, Sanchai [School of Chemistry, Institute of Science, Suranaree University of Technology, Nakhon Ratchasima, 30000 (Thailand); Wittayakun, Jatuporn, E-mail: jatuporn@g.sut.ac.th [School of Chemistry, Institute of Science, Suranaree University of Technology, Nakhon Ratchasima, 30000 (Thailand)
2017-06-01
NaY was synthesized from fumed silica and further modified to form a composite with SBA-15. Textural properties and basicity of the composite NaY-SBA-15 were between those of the parent materials. Paraquat adsorption on NaY was 204.1 mg/g, higher than that on NaY synthesized with rice husk silica from the previous work. SBA-15 was a poor adsorbent for paraquat. Based on the weight of NaY, the adsorption capacity of analytical-grade paraquat on the NaY-SBA-15 composite was 241.5 mg/g-NaY. Moreover, the composite adsorbed blue dye from a commercial grade paraquat. Interaction between the NaY-SBA-15 and paraquat could be from C and N atoms in paraquat with oxygen atom on NaY-SBA-15. - Highlights: • Zeolite NaY/mesoporous SBA-15 composite was synthesized with a simple method. • NaY and SBA-15 coexisted in the composite confirmed by FTIR, CO{sub 2}-TPD and XPS. • Adsorption capacity of paraquat (mg/g-NaY) was improved by NaY and SBA-15 composite. • C and N atoms in paraquat could interact with oxygen atom on NaY-SBA-15 composite.
DEFF Research Database (Denmark)
Jespersen, Thomas; Gavillet, Bruno; van Bemmelen, Miguel X
2006-01-01
In order to identify proteins interacting with the cardiac voltage-gated sodium channel Na(v)1.5, we used the last 66 amino acids of the C-terminus of the channel as bait to screen a human cardiac cDNA library. We identified the protein tyrosine phosphatase PTPH1 as an interacting protein. Pull......-down experiments confirmed the interaction, and indicated that it depends on the PDZ-domain binding motif of Na(v)1.5. Co-expression experiments in HEK293 cells showed that PTPH1 shifts the Na(v)1.5 availability relationship toward hyperpolarized potentials, whereas an inactive PTPH1 or the tyrosine kinase Fyn...... does the opposite. The results of this study suggest that tyrosine phosphorylation destabilizes the inactivated state of Na(v)1.5....
Solid state reactions of MoO3 and Na2MoO4 with (U.85,Ce.15)O2x
International Nuclear Information System (INIS)
Dahale, N.D.; Keskar, Meera; Singh Mudher, K.D.; Chawla, K.L.
1999-01-01
(U .85 ,Ce .15 )MoO 6-x was prepared by the solid state reactions of (U .85 ,Ce .15 )O 2±x with MoO 3 in air at 600 deg C. Solid state reactions of Na 2 MoO 4 with (U .85 ,Ce .15 )MoO 6.x up to 550 deg C in air led to the formation of Na 2 (U .85 ,Ce .15 )Mo 2 O 10-x and Na 2 (U .85 , Ce .15 ) 2 Mo 3 O 16-x . These compounds were characterised by x-ray and thermal methods. The x-ray powder data of (U .85 , Ce .15 ) MoO 6-x were indexed on monoclinic system whereas, data of Na 2 (U .85 ,Ce .15 ) Mo 2 O 10-x and Na 2 (U .85 ,Ce .15 ) 2 Mo 3 O 16-x were indexed on orthorhombic and monoclinic system respectively. (author)
International Nuclear Information System (INIS)
Sevov, S.C.; Corbett, J.D.
1993-01-01
The remaining phases in the Na-In system have been identified and characterized. The indium-richest is Na 15 In 27.4 , with a structure containing novel closo-In 16 clusters interconnected to two kinds of nido-In 11 units and isolated, 4-bonded atoms (Cmcm, Z = 8, a = 16.108 (4) Angstrom, b = 35.279 (8) Angstrom, c = 15.931 (3) Angstrom, R/R w = 0.041/0.044 at the indium-rich limits Na 15 In 27.54 ). Fractional occupancy of two atoms in cluster chain positions were found, one as a function of a narrow nonstoichiometry. The structure is related to that recently established for Na 7 In 11.8 . Resistivity and magnetic properties are consistent with a small (0.5-3.2%) excess of electrons relative to the calculated bonding requirements. The sodium-richest phase is the stable, diamagnetic, and weakly metallic Na 2 In, isostructural with Na 2 Tl (C222 1 , Z = 16, a = 13.855 (1) Angstrom, b = 8.836 (1) Angstrom, c = 11.762 (1) Angstrom, R/R w = 0.030/0.034). A corrected phase diagram is given. 21 refs., 5 figs., 5 tabs
The Na+ transporter, TaHKT1;5-D, limits shoot Na+ accumulation in bread wheat
Byrt, Caitlin Siobhan
2014-10-01
Bread wheat (Triticum aestivum L.) has a major salt tolerance locus, Kna1, responsible for the maintenance of a high cytosolic K+/Na+ ratio in the leaves of salt stressed plants. The Kna1 locus encompasses a large DNA fragment, the distal 14% of chromosome 4DL. Limited recombination has been observed at this locus making it difficult to map genetically and identify the causal gene. Here, we decipher the function of TaHKT1;5-D, a candidate gene underlying the Kna1 locus. Transport studies using the heterologous expression systems Saccharomyces cerevisiae and Xenopus laevis oocytes indicated that TaHKT1;5-D is a Na+-selective transporter. Transient expression in Arabidopsis thaliana mesophyll protoplasts and in situ polymerase chain reaction indicated that TaHKT1;5-D is localised on the plasma membrane in the wheat root stele. RNA interference-induced silencing decreased the expression of TaHKT1;5-D in transgenic bread wheat lines which led to an increase in the Na+ concentration in the leaves. This indicates that TaHKT1;5-D retrieves Na+ from the xylem vessels in the root and has an important role in restricting the transport of Na+ from the root to the leaves in bread wheat. Thus, TaHKT1;5-D confers the essential salinity tolerance mechanism in bread wheat associated with the Kna1 locus via shoot Na+ exclusion and is critical in maintaining a high K+/Na+ ratio in the leaves. These findings show there is potential to increase the salinity tolerance of bread wheat by manipulation of HKT1;5 genes.
The Na+ transporter, TaHKT1;5-D, limits shoot Na+ accumulation in bread wheat
Byrt, Caitlin Siobhan; Xu, Bo; Krishnan, Mahima; Lightfoot, Damien; Athman, Asmini; Jacobs, Andrew Keith; Watson-Haigh, Nathan S.; Plett, Darren; Munns, Rana; Tester, Mark A.; Gilliham, Matthew
2014-01-01
Bread wheat (Triticum aestivum L.) has a major salt tolerance locus, Kna1, responsible for the maintenance of a high cytosolic K+/Na+ ratio in the leaves of salt stressed plants. The Kna1 locus encompasses a large DNA fragment, the distal 14% of chromosome 4DL. Limited recombination has been observed at this locus making it difficult to map genetically and identify the causal gene. Here, we decipher the function of TaHKT1;5-D, a candidate gene underlying the Kna1 locus. Transport studies using the heterologous expression systems Saccharomyces cerevisiae and Xenopus laevis oocytes indicated that TaHKT1;5-D is a Na+-selective transporter. Transient expression in Arabidopsis thaliana mesophyll protoplasts and in situ polymerase chain reaction indicated that TaHKT1;5-D is localised on the plasma membrane in the wheat root stele. RNA interference-induced silencing decreased the expression of TaHKT1;5-D in transgenic bread wheat lines which led to an increase in the Na+ concentration in the leaves. This indicates that TaHKT1;5-D retrieves Na+ from the xylem vessels in the root and has an important role in restricting the transport of Na+ from the root to the leaves in bread wheat. Thus, TaHKT1;5-D confers the essential salinity tolerance mechanism in bread wheat associated with the Kna1 locus via shoot Na+ exclusion and is critical in maintaining a high K+/Na+ ratio in the leaves. These findings show there is potential to increase the salinity tolerance of bread wheat by manipulation of HKT1;5 genes.
Synthesis of (+-)-[1,1'-15N2, 2'-13C]-trans-3'-methylnicotine
International Nuclear Information System (INIS)
Sirimanne, S.R.; Maggio, V.L.; Patterson, D.G. Jr.
1992-01-01
The synthesis of (±)- [1,1'- 15 N 2 , 2'- 13 C]-trans-3'-methylnicotine is reported. 15 N-3-Bromopyridine obtained from bromination of pyridine was formylated with nBuLi/[carbonyl- 13 C]-methyl formate. The resulting 15 n-Pyridine-3-[ 13 C-carbonyl]-carboxaldehyde was reacted with 15 N-methylamine and then the resulting Schiff's base was condensed with succinic anhydride to give (±)- [1,1'- 15 N 2 , 5'- 13 C]-trans-4'-carboxycotinine. Reduction with lithium aluminum hydride and mesylation followed by reduction with Zn/NaI gave (±)-[1,1'- 15 N 2 , 2'- 13 C]-trans-3'-methylnicotine. (Author)
15C-15F Charge Symmetry and the 14C(n,γ)15C Reaction Puzzle
International Nuclear Information System (INIS)
Timofeyuk, N.K.; Thompson, I.J.; Baye, D.; Descouvemont, P.; Kamouni, R.
2006-01-01
The low-energy reaction 14 C(n,γ) 15 C provides a rare opportunity to test indirect methods for the determination of neutron capture cross sections by radioactive isotopes versus direct measurements. It is also important for various astrophysical scenarios. Currently, puzzling disagreements exist between the 14 C(n,γ) 15 C cross sections measured directly, determined indirectly, and calculated theoretically. To solve this puzzle, we offer a strong test based on a novel idea that the amplitudes for the virtual 15 C→ 14 C+n and the real 15 F→ 14 O+p decays are related. Our study of this relation, performed in a microscopic model, shows that existing direct and some indirect measurements strongly contradict charge symmetry in the 15 C and 15 F mirror pair. This brings into question the experimental determinations of the astrophysically important (n,γ) cross sections for short-lived radioactive targets
Ionic conductivity of sodium–strontium germanate Na{sub 4}SrGe{sub 6}O{sub 15}
Energy Technology Data Exchange (ETDEWEB)
Sorokin, N. I., E-mail: nsorokin1@yandex.ru [Russian Academy of Sciences, Shubnikov Institute of Crystallography, Federal Scientific Research Centre “Crystallography and Photonics” (Russian Federation)
2017-03-15
The electrical conductivity of sodium–strontium germanate Na{sub 4}SrGe{sub 6}O{sub 15} (sp. gr. P6{sub 3}/m) has been studied by impedance spectroscopy in the frequency range of 10{sup 2}–4 × 10{sup 4} Hz and a temperature range of 450–600 K. Na4SrGe6O15 crystals were obtained by hydrothermal technique in the Na{sub 2}O–SrO–GeO{sub 2}–H{sub 2}O system (temperature t = 300–600°C and pressure p = 1.4 × 10{sup 8} Pа in the dissolution zone). The ionic conductivity of ceramic Na{sub 4}SrGe{sub 6}O{sub 15} samples is σ = 2.2 × 10{sup –6} S/cm (at 573 K), the activation energy of Na{sup +} ion transfer is E{sub a} = 0.70 ± 0.03 eV.
Membrane self assembly in mixed DMPC/NaC systems by SANS
International Nuclear Information System (INIS)
Kiselev, M.A.; Lombardo, D.; Lesieur, P.; Kisselev, A.M.; Borbely, S.; Simonova, T.N.; Barsukov, L.I.
2008-01-01
Morphological transition in a mixed system of the dimyristoylphosphatidylcholine (DMPC)/sodium cholate (NaC) has been investigated by small-angle scattering of neutron (SANS) and X-ray (SAXS). Structural investigation, performed as a function of temperature and NaC concentration, show that the system containing 15 mM DMPC and 6 mM NaC reveals a strong dependence of SANS spectra on the temperature. The morphological transformations has been interpreted as a micelle-to-vesicle transition which is induced by the temperature variation (TI-MVT). The main features of the obtained results show that the temperature effect are far less profound in the system containing 2 or 12 mM NaC and can be assigned to small morfological changes within the same population of particles (vesicular or micellar, respectively). The main features of the structural analysis suggest that structural transformations at the TI-MVT proceed in the following sequence: globular micelles - rod-like micelles - polymer-like micelles - unilamellar vesicles. More specifically the globular and rod like micelles present an ellipsoidal cross-section rather than circular one, the former being geometrically more favourable for accommodation of bilayer-forming molecules like DMPC into the micellar structures
Effect of cholera toxin on cAMP levels and Na+ influx in isolated intestinal epithelial cells
International Nuclear Information System (INIS)
Hyun, C.S.; Kimmich, G.A.
1982-01-01
Freshly isolated chicken intestinal cells contain approximately 20 pmol adenosine 3',5'-cyclic monophosphate (cAMP)/mg cellular protein. Incubation with 3 μg/ml cholera toxin (CT) at 37 0 C induces an elevation of cellular cAMP beginning 10-15 min after initial exposure. The response is linear with time for 40-50 min and causes a six- to eightfold increase over control levels at steady state. Dibutyryl cAMP and agents that increase cAMP production inhibit Na + influx into the isolated enterocytes. Chlorpromazine completely abolishes the toxin-induced elevation of cAMP in the isolated cells and also reverses the effect on Na + entry. The data provide evidence for a cAMP-mediated control of intestinal cell Na + uptake, which may represent the mechanistic basis for the antiabsorptive effect of CT on Na + during induction of intestinal secretory activity. Studies on the time-dependent effects of chlorpromazine on both intracellular cAMP concentration and Na + influx suggest that the reactivation of the Na + transport system after cAMP-induced inhibition is slow relative to the disappearance of cAMP
Experimental determination of the H2O + 15 wt% NaCl and H2O + 25 wt% NaCl liquidi to 1.4 GPa
Valenti, P.; Schmidt, C.
2009-12-01
The binary H2O+NaCl is one of the most important model systems for chloridic fluids in many geologic environments such as the Earth’s crust, upper mantle, and subducting slabs, and is also applicable to extraterrestrial icy planetary bodies (e.g., Manning 2004, Zolensky et al., 1999). The knowledge on phase equilibria and PVTx properties of this system is still fragmentary at high pressures, e.g., very little has been reported on liquidi at compositions Daniel 2008). In this study, we investigated the liquidus of 15 and 25 wt% NaCl solutions at pressures up to 1.4 GPa. The experiments were performed using a hydrothermal diamond-anvil cell (Bassett et al. 1993) modified for Raman spectroscopy and accurate temperature measurements. A quartz chip, halite, and water were loaded into the sample chamber, which also contained a small trapped air bubble (10 vol%) when it was sealed. The actual salinity was then determined from measurement of the vapor-saturated liquidus temperature. The sample chamber was then compressed until the bubble disappeared. After freezing, phase transitions occurring with increasing temperature were observed optically, and the pressure was determined from the frequency shift of the 464 cm-1 Raman line of quartz (Schmidt and Ziemann 2000). The sample chamber was then compressed further, and the experiment was repeated at various bulk densities until a pressure of ~1.4 GPa was attained. At some conditions, Raman spectra were acquired for identification of the phase assemblage. The solution always crystallized to a single phase upon cooling above ~0.15 GPa at 25 wt% NaCl and above ~1 GPa at 15 wt% NaCl. Raman spectra in the OH stretching region indicate that this phase contains or is a NaCl hydrate other than hydrohalite, probably in solid solution with ice. Melting of this phase produced liquid and hydrohalite and/or ice VI. Ice VI was the last solid that dissolved upon heating, between 1100 MPa, 3 °C and 1370 MPa, 17 °C for 15 wt% NaCl and at
Directory of Open Access Journals (Sweden)
Stähler Frauke
2009-03-01
Full Text Available Abstract Background In rodents, dietary Na+ deprivation reduces gustatory responses of primary taste fibers and central taste neurons to lingual Na+ stimulation. However, in the rat taste bud cells Na+ deprivation increases the number of amiloride sensitive epithelial Na+ channels (ENaC, which are considered as the "receptor" of the Na+ component of salt taste. To explore the mechanisms, the expression of the three ENaC subunits (α, β and γ in taste buds were observed from rats fed with diets containing either 0.03% (Na+ deprivation or 1% (control NaCl for 15 days, by using in situ hybridization and real-time quantitative RT-PCR (qRT-PCR. Since BDNF/TrkB signaling is involved in the neural innervation of taste buds, the effects of Na+ deprivation on BDNF and its receptor TrkB expression in the rat taste buds were also examined. Results In situ hybridization analysis showed that all three ENaC subunit mRNAs were found in the rat fungiform taste buds and lingual epithelia, but in the vallate and foliate taste buds, only α ENaC mRNA was easily detected, while β and γ ENaC mRNAs were much less than those in the fungiform taste buds. Between control and low Na+ fed animals, the numbers of taste bud cells expressing α, β and γ ENaC subunits were not significantly different in the fungiform, vallate and foliate taste buds, respectively. Similarly, qRT-PCR also indicated that Na+ deprivation had no effect on any ENaC subunit expression in the three types of taste buds. However, Na+ deprivation reduced BDNF mRNA expression by 50% in the fungiform taste buds, but not in the vallate and foliate taste buds. The expression of TrkB was not different between control and Na+ deprived rats, irrespective of the taste papillae type. Conclusion The findings demonstrate that dietary Na+ deprivation does not change ENaC mRNA expression in rat taste buds, but reduces BDNF mRNA expression in the fungiform taste buds. Given the roles of BDNF in survival of
Directory of Open Access Journals (Sweden)
Simone Bortolan
2009-11-01
Full Text Available O objetivo deste trabalho foi avaliar a expressão, por RT-qPCR, dos genes de nodulação nodC e nodW e do gene nopP da estirpe CPAC 15, que provavelmente atuam na infecção das raízes da soja. Foram realizados dois experimentos. No primeiro, a expressão dos genes foi avaliada nas células após a incubação com genisteína por 15 min, 1, 4 e 8 horas. Os resultados revelaram que os três genes apresentaram maior expressão imediatamente após o contato com o indutor (15 min. No segundo experimento, a bactéria foi cultivada na presença de indutores (genisteína ou exsudatos de sementes de soja por 48 horas. A expressão dos três genes foi maior na presença de genisteína, com valores de expressão para nodC, nodW e nopP superiores ao controle. Os resultados obtidos confirmam a funcionalidade dos três genes na estirpe CPAC 15, com ênfase para o nopP, cuja funcionalidade em Bradyrhizobium japonicum foi descrita pela primeira vez.The objective of this work was to evaluate, by RT-qPCR, the expression of the nodC and nodW nodulation genes and of the nopP gene of the CPAC 15 strain, which probably play a role in the infection of soybean roots. Two experiments were done. In the first, the gene expression was evaluated in cells after incubation with genistein for 15 min, 1, 4 and 8 hours. Results showed that the three genes showed higher expression immediately after contact with the inducer (15 min. In the second experiment, the bacterium was grown in the presence of inducers (genistein or soybean seed exudates for 48 hours. The expression of the three genes was greater when induced by genistein, and the expression of nodC, nodW and nopP had higher values than the control. The results confirm the functionality of the three genes in the CPAC 15 strain, with an emphasis on the nopP, whose functionality in Bradyrhizobium japonicum was described for the first time.
Study of the Na-C-O and Na-H-O ternary systems in the sodium rich corner
International Nuclear Information System (INIS)
Maupre, J.-P.
1978-02-01
The purpose of this study is to provide a contribution to the understanding of the sodium - carbon - oxygen and sodium - hydrogen - oxygen ternary systems in the sodium rich corner. In order to do this the Na-NaH-Na 2 O-NaOH phase diagram was completed and the Na-Na 2 O-Na 2 CO 3 -C phase diagram was outlined. This work is made up of two parts. The first is devoted to a critical literature survey essential to establish correct phase diagrams. The second is an experimental study followed by a discussion collating our finding to the literary data. The basic experimental technique used is differential thermal analysis (DTA) but it has been completed by quenching, X-ray and chemical analysis methods. The proposed phase diagrams imply that Na-NaH-Na 2 O-NaOH and Na-Na 2 O-Na 2 CO 3 -C systems are reciprocal ternary systems. Temperatures of stable pairs reversal are respectively 410 and 690 0 C. The stable pairs are Na-NaOH and Na-Na 2 CO 3 at elevated temperature, Na 2 O-NaH and Na 2 O-C at low temperature [fr
The two C-terminal tyrosines stabilize occluded Na/K pump conformations containing Na or K ions.
Vedovato, Natascia; Gadsby, David C
2010-07-01
Interactions of the three transported Na ions with the Na/K pump remain incompletely understood. Na/K pump crystal structures show that the extended C terminus of the Na,K-adenosine triphosphatase (ATPase) alpha subunit directly contacts transmembrane helices. Deletion of the last five residues (KETYY in almost all Na/K pumps) markedly lowered the apparent affinity for Na activation of pump phosphorylation from ATP, a reflection of cytoplasmic Na affinity for forming the occluded E1P(Na3) conformation. ATPase assays further suggested that C-terminal truncations also interfere with low affinity Na interactions, which are attributable to extracellular effects. Because extracellular Na ions traverse part of the membrane's electric field to reach their binding sites in the Na/K pump, their movements generate currents that can be monitored with high resolution. We report here electrical measurements to examine how Na/K pump interactions with extracellular Na ions are influenced by C-terminal truncations. We deleted the last two (YY) or five (KESYY) residues in Xenopus laevis alpha1 Na/K pumps made ouabain resistant by either of two kinds of point mutations and measured their currents as 10-mM ouabain-sensitive currents in Xenopus oocytes after silencing endogenous Xenopus Na/K pumps with 1 microM ouabain. We found the low affinity inhibitory influence of extracellular Na on outward Na/K pump current at negative voltages to be impaired in all of the C-terminally truncated pumps. Correspondingly, voltage jump-induced transient charge movements that reflect pump interactions with extracellular Na ions were strongly shifted to more negative potentials; this signals a several-fold reduction of the apparent affinity for extracellular Na in the truncated pumps. Parallel lowering of Na affinity on both sides of the membrane argues that the C-terminal contacts provide important stabilization of the occluded E1P(Na3) conformation, regardless of the route of Na ion entry into the
Directory of Open Access Journals (Sweden)
Gilberto da Cunha Gonçalves
2001-05-01
Full Text Available No presente trabalho, foi estudada a síntese do TAME, em fase líquida, a partir de uma fração C5 e metanol, utilizando Amberlyst 15 como catalisador. A fração C5 utilizada possui uma diolefina, que tem uma alta tendência à formação de gomas e um alto teor de mono-olefinas. Deste modo, o objetivo deste trabalho foi avaliar o efeito da mono-hidrogenação da fração C5 na síntese do TAME. A hidrogenação foi feita a 80oC e 10 kgf/cm2 de H2, usando um catalisador 0,3% Pt/Al2O3. A diolefina foi totalmente hidrogenada e o teor de mono-olefinas significativamente reduzido sem um decréscimo apreciável no teor de isoamilenos reativos. A eterificação foi feita em um reator tipo batelada de 250 mL, com agitação magnética. A temperatura foi variada na faixa de 50 a 90oC, com uma pressão de 10 kgf/cm2 e razão molar isoamileno/metanol de aproximadamente um. Os produtos de reação foram analisados por cromatografia gasosa. A conversão total observada foi aproximadamente a mesma para o os cortes original e mono-hidrogenado. Entretanto, os produtos obtidos utilizando a fração C5 original apresentaram cheiro forte e coloração, mesmos para os testes a temperaturas mais baixas, que são características da formação de gomas. Por outro lado, quando a fração mono-hidrogenada foi usada na eterificação, o cheiro forte e coloração não foram observados. Portanto, a mono-hidrogenação da fração C5 contendo os isoamilenos reativos é necessária para que o TAME produzido na reação de eterificação possa ser adicionado à gasolinaTAME was synthesized in liquid phase from refinery C5 cut and methanol using Amberlyst 15 as catalyst. The C5 stream contains mainly mono-olefins and, in a less amount, a diolefin, which have a high gum formation tendency. The main purpose of this research was to evaluate the effect of mono-hydrogenation of C5 cut on TAME synthesis. The hydrogenation step was carried out at 80 oC and 10 kgf/cm2 of H2
Effect of He pressure on the superconducting transition temperatures of Na2CsC60 and (NH3)4Na2CsC60
International Nuclear Information System (INIS)
Schirber, J.E.; Bayless, W.R.; Rosseinsky, M.J.; Zhou, O.; Fleming, R.M.; Murphy, D.; Fischer, J.E.
1994-01-01
The Na based mixed alkali doped C 60 superconductors show anomalous behavior with respect to the ''universal'' superconducting transition temperature T c vs lattice constant a 0 relation followed by most of the fcc A 3 C 60 superconductors. We have measured dt c /dP for Na 2 CsC 60 and (NH 3 ) 4 Na 2 CsC 60 using solid He as the pressure medium to ∼ 6 kbar finding dT c /dP equal to -0.8±(0.01) K/kbar and -1.0(±0.1)K/kbar for Na 2 CsC 60 and Na 2 (NH 3 ) 4 C 60 respectively. Our value for Na 2 CsC 60 differs markedly from that obtained by Mizuki et al of about -1.3 K/kbar. However, using N 2 or Ar, we obtain values for dT c /dP in substantial agreement with Mizuki et al who used fluorinert to generate their pressure. This work emphasizes the need for compressibility measurements with the same pressure medium in the appropriate temperature range so that meaningful comparisons can be made between various pressure measurements and models which are based on lattic spacing
Rotational dynamics of C60 in Na2RbC60
International Nuclear Information System (INIS)
Christides, C.; Prassides, K.; Neumann, D.A.; Copley, J.R.D.; Mizuki, J.; Tanigaki, K.; Hirosawa, I.; Ebbesen, T.W.
1993-01-01
We have measured the low-energy neutron inelastic-scattering (NIS) spectra of superconducting Na 2 RbC 60 in the temperature range 50-350 K. Well-defined librational peaks are observed at 50 K at 2.83(17) meV (FWHM = 1.7(5) meV). They soften and broaden with increasing temperature. Their behaviour mimics that found in solid C 60 and differs markedly from K 3 C 60 . The rotational barrier for C 60 reorientations in Na 2 RbC 60 is somewhat higher than in pristine C 60 and approximately half as large as in K 3 C 60 . An order-disorder transition is anticipated at a temperature higher than that found in C 60 . (orig.)
Thermodynamic Study of Solid-Liquid Equilibrium in NaCl-NaBr-H2O System at 288.15 K
Li, Dan; Meng, Ling-zong; Deng, Tian-long; Guo, Ya-fei; Fu, Qing-Tao
2018-06-01
The solubility data, composition of the solid solution and refractive indices of the NaCl-NaBr-H2O system at 288.15 K were studied with the isothermal equilibrium dissolution method. The solubility diagram and refractive index diagram of this system were plotted at 288.15 K. The solubility diagram consists of two crystallization zones for solid solution Na(Cl,Br) · 2H2O and Na(Cl,Br), one invariant points cosaturated with two solid solution and two univariant solubility isothermal curves. On the basis of Pitzer and Harvie-Weare (HW) chemical models, the composition equations and solubility equilibrium constant equations of the solid solutions at 288.15 K were acquired using the solubility data, the composition of solid solutions, and binary Pitzer parameters. The solubilities calculated using the new method combining the equations are in good agreement with the experimental data.
Structural variations in wheat HKT1;5 underpin differences in Na+ transport capacity
Xu, Bo
2017-11-27
An important trait associated with the salt tolerance of wheat is the exclusion of sodium ions (Na+) from the shoot. We have previously shown that the sodium transporters TmHKT1;5-A and TaHKT1;5-D, from Triticum monoccocum (Tm) and Triticum aestivum (Ta), are encoded by genes underlying the major shoot Na+-exclusion loci Nax1 and Kna1, respectively. Here, using heterologous expression, we show that the affinity (Km) for the Na+ transport of TmHKT1;5-A, at 2.66 mM, is higher than that of TaHKT1;5-D at 7.50 mM. Through 3D structural modelling, we identify residues D471/a gap and D474/G473 that contribute to this property. We identify four additional mutations in amino acid residues that inhibit the transport activity of TmHKT1;5-A, which are predicted to be the result of an occlusion of the pore. We propose that the underlying transport properties of TmHKT1;5-A and TaHKT1;5-D contribute to their unique ability to improve Na+ exclusion in wheat that leads to an improved salinity tolerance in the field.
Structural variations in wheat HKT1;5 underpin differences in Na+ transport capacity
Xu, Bo; Waters, Shane; Byrt, Caitlin S.; Plett, Darren; Tyerman, Stephen D.; Tester, Mark A.; Munns, Rana; Hrmova, Maria; Gilliham, Mathew
2017-01-01
An important trait associated with the salt tolerance of wheat is the exclusion of sodium ions (Na+) from the shoot. We have previously shown that the sodium transporters TmHKT1;5-A and TaHKT1;5-D, from Triticum monoccocum (Tm) and Triticum aestivum (Ta), are encoded by genes underlying the major shoot Na+-exclusion loci Nax1 and Kna1, respectively. Here, using heterologous expression, we show that the affinity (Km) for the Na+ transport of TmHKT1;5-A, at 2.66 mM, is higher than that of TaHKT1;5-D at 7.50 mM. Through 3D structural modelling, we identify residues D471/a gap and D474/G473 that contribute to this property. We identify four additional mutations in amino acid residues that inhibit the transport activity of TmHKT1;5-A, which are predicted to be the result of an occlusion of the pore. We propose that the underlying transport properties of TmHKT1;5-A and TaHKT1;5-D contribute to their unique ability to improve Na+ exclusion in wheat that leads to an improved salinity tolerance in the field.
International Nuclear Information System (INIS)
Geng, Jiwei; Teng, Xinying; Zhou, Guorong; Leng, Jinfeng; Zhao, Degang
2014-01-01
In situ synthesized TiC particles were prepared by a thermal explosion method. Adding “in situ synthesized” TiC into Zr 60 Cu 10 Al 15 Ni 15 glass matrix to obtain amorphous matrix composites was achieved. The corrosion behavior of Zr 60 Cu 10 Al 15 Ni 15 amorphous composites was evaluated using potentiodynamic polarization measurements in 3.5 wt% NaCl solution at room temperature. The results show that the microhardness and thermal stability are improved apparently, while the TiC (≤0.6 wt%) does not significantly affect the supercooled liquid behavior. Moreover, the corrosion resistance is improved apparently because the nanocrystals accelerate the diffusion of passive elements for faster formation of the protective passive film at nanocrystals/amorphous interfaces. However, when the TiC content is more than 0.6 wt%, both glass forming ability and corrosion resistance are reduced significantly
Directory of Open Access Journals (Sweden)
Marcelo de Almeida Guimarães
2010-06-01
Full Text Available Thlaspi caerulescens é espécie hiperacumuladora de metais como Cd2+, Ni2+ e Zn2+, considerada como uma plantamodelo para estudar a acumulação e tolerância a metais pesados. No entanto, a baixa produção de sementes em nossas condições climáticas tornam necessária a determinação de condições que possam maximizar a germinação e o vigor de suas sementes. Para identificar as melhores condições para a germinação, sementes de T. caerulescens foram colocadas na presença (15 mmol.m-2.s-1, 8 h luz/16 h escuro ou ausência de luz nas temperaturas de 10, 15, 20 e 25 ºC, em papel germitest previamente umedecido com solução de ácido giberélico (GA3 a 0,05% ou água destilada. Foram avaliados a porcentagem de germinação (%G e o índice de velocidade de germinação (IVG. Maior porcentagem de germinação (66% foi observada nos tratamentos com GA3 e temperaturas de 15 e 20 ºC, na presença de luz. Maiores valores do IVG foram obtidos com a utilização de GA3 nas temperaturas de 15 e 20 ºC, tanto na presença quanto na ausência de luz. Maiores germinação e IVG de T. caerulescens foram observados com uso de GA3 na presença de luz nas temperaturas de 15 e 20 ºC.
Synthesis of (+-)-(1,1'- sup 15 N sub 2 , 2'- sup 13 C)-trans-3'-methylnicotine
Energy Technology Data Exchange (ETDEWEB)
Sirimanne, S.R.; Maggio, V.L.; Patterson, D.G. Jr. (Department of Health and Human Services, Atlanta, GA (United States))
1992-03-01
The synthesis of ({+-})- (1,1'-{sup 15}N{sub 2}, 2'-{sup 13}C)-trans-3'-methylnicotine is reported. {sup 15}N-3-Bromopyridine obtained from bromination of pyridine was formylated with nBuLi/(carbonyl-{sup 13}C)-methyl formate. The resulting {sup 15}n-Pyridine-3-({sup 13}C-carbonyl)-carboxaldehyde was reacted with {sup 15}N-methylamine and then the resulting Schiff's base was condensed with succinic anhydride to give ({+-})- (1,1'-{sup 15}N{sub 2}, 5'-{sup 13}C)-trans-4'-carboxycotinine. Reduction with lithium aluminum hydride and mesylation followed by reduction with Zn/NaI gave ({+-})-(1,1'-{sup 15}N{sub 2}, 2'-{sup 13}C)-trans-3'-methylnicotine. (Author).
EFEITO DA DESIDRATAÇÃO FOAM MAT NA RETENÇÃO DA VITAMINA C DA POLPA DE CAJAMANGA
Directory of Open Access Journals (Sweden)
Caroline Alves BREDA
2013-04-01
Full Text Available O objetivo do trabalho foi avaliar o efeito da desidratação foam mat na retenção da vitamina C em polpa de cajamanga. A polpa de cajamanga foi elaborada a partir de quatro formulações utilizando três agentes espumantes combinados em diferentes concentrações: 1 pectina cítrica, 2 produto à base de monoglicerídeos destilados, monoestearato de sorbitana e polissorbato 60 (Emustab e 3 produto à base de sacarose, carboximetilcelulose e goma guar (Super Liga Neutra. A composição proximal e o conteúdo de vitamina C foram determinados na polpa fresca e nas polpas desidratadas obtidas a partir das formulações. Os resultados mostraram que a adição de agentes espumantes favoreceu ao incremento de açúcares e fibras na polpa desidratada. Os agentes formadores de espuma influenciaram na retenção da vitamina C. A polpa desidratada contendo 1,5% de Emustab e 1,0% de pectina obteve maior retenção da vitamina (28,55%.
The influence of FLiNaK salt impregnation on the mechanical properties of a 2D woven C/C composite
Energy Technology Data Exchange (ETDEWEB)
Zhang, Dongsheng, E-mail: zhangdongsheng@sinap.ac.cn; Xia, Huihao; Yang, Xinmei, E-mail: yangxinmei@sinap.ac.cn; Feng, Shanglei; Song, Jinliang; Zhou, Xingtai
2017-03-15
Impregnating of molten LiF-NaF-KF salt (LiF-NaF-KF: 46.5–11.5-42 mol%, FLiNaK) into a 2D woven C/C composite was performed at 650 °C under different pressure. The weight gain and mechanical properties change of the 2D woven C/C composite after FLiNaK salt impregnation were measured. The FLiNaK salt distribution into the 2D woven C/C composite was observed by X-ray computed tomography (X-ray CT) and scanning electron microscopy. The results showed that the weight gain of the 2D woven C/C composite increased with increasing impregnating pressure. In X-ray CT images, FLiNaK salt was distributed into the open pores and fissures among fiber bundles and neighboring plies. The interlaminar shear strength, compressive strength, and flexural strength of the 2D woven C/C composite increased with the increase of weight gain. The influence of FLiNaK salt impregnation on the mechanical properties was attributed to the coupling effect of re-densification of FLiNaK salt impregnation and residual stress formed in 2D woven C/C composite. - Highlights: • FLiNaK salt was distributed into the open pores and fissures among fiber bundles. • The mechanical properties of the 2D woven C/C composite increased with the increase of weight gain. • The influence of FLiNaK was attributed to the re-densification of FLiNaK salt and residual stress.
Solubility of NaNd(CO3)2.6H2O(c) in concentrated Na2CO3 and NaHCO3 solutions
International Nuclear Information System (INIS)
Rao, L.; Rai, D.; Felmy, A.R.; Fulton, R.W.; Novak, C.F.
1996-01-01
NaNd(CO 3 ) 2 x 6 H 2 O(c) was identified to be the final equilibrium solid phase in suspensions containing concentrated sodium carbonate (0.1 to 2.0 M) and sodium bicarbonate (0.1 to 1.0 M), with either NaNd(CO 3 ) 2 x 6 H 2 O(c) or Nd 2 (CO 3 ) 3 x xH 2 O(s) as initial solids. A thermodynamic model, based on Pitzer's specific into-interaction approach, was developed to interpret the solubility of NaNd(CO 3 ) 2 x 6 H 2 O(c) as functions of sodium carbonate and sodium bicarbonate concentrations. In this model, the solubility data of NaNd(CO 3 ) 2 x 6 H 2 O(c) were explained by assuming the formation of NdCO 3 + , Nd(CO 3 ) 2 - and Nd(CO 3 ) 3 3- species and invoking the specific ion interactions between Na + and Nd(CO 3 ) 3 3- . Ion interaction parameters for Na + -Nd(CO 3 ) 3 3- were developed to fit the solubility data. Based on the model calculations, Nd(CO 3 ) 3 3- was the predominant aqueous neodymium species in 0.1 to 2 M sodium carbonate and 0.1 to 1 M sodium bicarbonate solutions. The logarithm of the NaNd(CO 3 ) 2 x 6 H 2 O solubility product (NaNd(CO 3 ) 2 x 6 H 2 O(c)=Na + +Nd 3+ +2 CO 3 2- +6 H 2 O) was calculated to be -21.39. This model also provided satisfactory interpretation of the solubility data of the analogous Am(III) system in less concentrated carbonate and bicarbonate solutions. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Zaidi, Asma; Cherif, Karima [Laboratoire de la Matière Condensée et des Nanosciences, Université de Monastir, 5019 (Tunisia); Dhahri, J., E-mail: dhahri.jemai@yahoo.fr [Laboratoire de la Matière Condensée et des Nanosciences, Université de Monastir, 5019 (Tunisia); Hlil, E.K. [Institut Neel, CNRS et Université Joseph Fourier, B.P.166, 38042 Grenoble (France); Zaidi, M.; Alharbi, T. [College of Science of Zulfi, Majmaah University (Saudi Arabia)
2015-11-25
We have studied the effect of Na substitution on structural, magnetic and electrical properties in La{sub 0.67}Pb{sub 0.33-x}Na{sub x}MnO{sub 3} (0 ≤ x ≤ 0.15). All compositions were synthesized using the sol–gel technique. X-ray diffraction and structure refinement show that they crystallize in the rhombohedra structure with the R − 3c space group. All the samples exhibit a paramagnetic (PM)-ferromagnetic (FM) phase transition (T{sub C}) at 363, 328, 305 and 285 K for x = 0, x = 0.05, x = 0.1 and x = 0.15 respectively. The replacement of Pb ion by Na results in a decrease of the metal-semiconductor transition temperature T{sub M-Sc} and the magnetoresistance (MR) as well as the resistivity are found to increase. The electrical resistivity in the entire temperature range fit well with the phenomenological percolation theory based on the phase segregation mechanism. - Graphical abstract: Temperature dependence of MR under several magnetic applied field values for the samples La{sub 0.67}Pb{sub 0.18-x}Na{sub 0.15}MnO{sub 3}. - Highlights: • The samples exhibit PM-FM phase transition. • The electrical transport is investigated. • Low temperature minimum resistivity is observed. • The electrical resistivity in the entire temperature range fit well with the phenomenological percolation model.
Potencial evocado auditivo na monitorização de 15 microlaser cirurgias do tronco cerebral
Directory of Open Access Journals (Sweden)
Luiz Henrique Mattos Pimenta
1989-12-01
Full Text Available Baseados na experiência de 15 casos, os autores salientam a importância do uso sistemático do potencial evocado auditivo do tronco cerebral na monitorização peroperatória do tronco cerebral, área das mais delicadas do cérebro, evitando que o cirurgião seja advertido pelo anestesista de que seu paciente está apresentando bradicardia ou arritmia. Apenas a cirurgia com Laser (acoplado a microscópio permite monitorização contínua, sem interferência de aparelhagem elétrica. Além disso, nos casos relatados, foi verificada a existência de alterações da fisiologia do tronco cerebral quando usados o bipolar ou micro-dissectores, o que não ocorre com o Laser a. CO2.
Energy Technology Data Exchange (ETDEWEB)
Spasic, Z; Simic, G [Institute of Nuclear Sciences Boris Kidric, Vinca, Beograd (Serbia and Montenegro)
1968-11-15
A vacuum chamber wad designed and constructed. It was suitable for study of materials at higher temperatures in vacuum or controlled atmospheres. Zircaloy-2 fatigue at 300 deg C in argon atmosphere was measured. Character of strain is variable one directional (A=1) tension. Obtained results are presented in tables and in the form of Veler's curve. The obtained fatigue limit was {sigma} - 15 kp/mm{sup 2}. The Locati method was allied as well and fatigue limit value obtained was 15,75 kp/mm{sup 2}. Error calculated in reference to the previous value obtained by classical methods was 5%. Konstruisana je i izvedena vakuum-komora koja se pokazala prikladna za izucavanje osobina materijala na povisenim temperaturama u vakuumu ili kontrolisanim atmosferama. Izvrseno je ispitivanje zamaranja Zircaloy-2 na temperaturi 300 deg C u atmosferi preciscenog argona. Karakter opterecenja je bio cisto jednosmerno promenljivo opterecenje (A=1) na zatezanje. Dobiveni rezultati su dati tabelarno i u obliku Velerove krive. Dobijena je granica zamora {sigma} = 15 kp/mm{sup 2}. Primenjen je i metod Locati-a za priblizno odredjivanje granice zamora i dobijena je vrednost 15,75 kp/mm{sup 2}. Greska u odnosu na prethodnu granicu zamora dobijenu klasicnim metodom iznosi 5% (author)
International Nuclear Information System (INIS)
Heyser, J.W.; Chacon, M.J.
1989-01-01
Exogenous proline stimulated the growth of Petunia hybrida cells on 195 mM NaCl 10-fold as compared with cells grown on 195 mM CaCl medium minus proline. L-[ 15 N]-proline was fed to cells growing on 0 and 195 mM CaCl, and its metabolism was followed by 15 N NMR analysis of cell extracts. Total proline and amino acids were determined by ninhydrin assay. Proline and primary amino acids were easily resolved in NMR spectra and the amount of 15 N-label which remained in proline was determined. Reduced catabolism of proline in cells grown on NaCl was evident. The role of exogenous proline in conferring increased NaCl tolerance in this nonhalophyte will be discussed
Study of some excited states in 21Ne-21Na, 18O-18F and 15N-15O nuclei
International Nuclear Information System (INIS)
Drain, D.
1977-01-01
The study of 21 Ne- 21 Na, 18 O- 18 F and 15 N- 15 O nuclei was performed through proton capture and transfer reactions and allows to determine the spins and parities of some excited states, give the gamma deexcitation schemes of these levels, compute the neutron and proton reduced width γ 2 sub(n) and γ 2 sub(p). The levels studied are: in 21 Na 4.15 20 Ne(p,p), (p,p'), (p,p'γ) and (pγ) reactions) and in 21 Ne: E(exc)=4.73, 5.69 and 5.78 MeV ( 20 Ne (p,p) reaction); in 18 O: E(exc) 17 O(d,p) reaction); in 15 O: 8.92 MeV doublet and 8.98 MeV level (angular correlation 14 N(p,γγ) and in 15 N: 9.05 14 N(d,p) reaction). A comparison with theoretical results is discussed and analog states are pointed out [fr
A novel NaV1.5 voltage sensor mutation associated with severe atrial and ventricular arrhythmias.
Wang, Hong-Gang; Zhu, Wandi; Kanter, Ronald J; Silva, Jonathan R; Honeywell, Christina; Gow, Robert M; Pitt, Geoffrey S
2016-03-01
Inherited autosomal dominant mutations in cardiac sodium channels (NaV1.5) cause various arrhythmias, such as long QT syndrome and Brugada syndrome. Although dozens of mutations throughout the protein have been reported, there are few reported mutations within a voltage sensor S4 transmembrane segment and few that are homozygous. Here we report analysis of a novel lidocaine-sensitive recessive mutation, p.R1309H, in the NaV1.5 DIII/S4 voltage sensor in a patient with a complex arrhythmia syndrome. We expressed the wild type or mutant NaV1.5 heterologously for analysis with the patch-clamp and voltage clamp fluorometry (VCF) techniques. p.R1309H depolarized the voltage-dependence of activation, hyperpolarized the voltage-dependence of inactivation, and slowed recovery from inactivation, thereby reducing the channel availability at physiologic membrane potentials. Additionally, p.R1309H increased the "late" Na(+) current. The location of the mutation in DIIIS4 prompted testing for a gating pore current. We observed an inward current at hyperpolarizing voltages that likely exacerbates the loss-of-function defects at resting membrane potentials. Lidocaine reduced the gating pore current. The p.R1309H homozygous NaV1.5 mutation conferred both gain-of-function and loss-of-function effects on NaV1.5 channel activity. Reduction of a mutation-induced gating pore current by lidocaine suggested a therapeutic mechanism. Copyright © 2016 Elsevier Ltd. All rights reserved.
Shy, Diana; Gillet, Ludovic; Abriel, Hugues
2013-04-01
The cardiac sodium current (INa) is responsible for the rapid depolarization of cardiac cells, thus allowing for their contraction. It is also involved in regulating the duration of the cardiac action potential (AP) and propagation of the impulse throughout the myocardium. Cardiac INa is generated by the voltage-gated Na(+) channel, NaV1.5, a 2016-residue protein which forms the pore of the channel. Over the past years, hundreds of mutations in SCN5A, the human gene coding for NaV1.5, have been linked to many cardiac electrical disorders, including the congenital and acquired long QT syndrome, Brugada syndrome, conduction slowing, sick sinus syndrome, atrial fibrillation, and dilated cardiomyopathy. Similar to many membrane proteins, NaV1.5 has been found to be regulated by several interacting proteins. In some cases, these different proteins, which reside in distinct membrane compartments (i.e. lateral membrane vs. intercalated disks), have been shown to interact with the same regulatory domain of NaV1.5, thus suggesting that several pools of NaV1.5 channels may co-exist in cardiac cells. The aim of this review article is to summarize the recent works that demonstrate its interaction with regulatory proteins and illustrate the model that the sodium channel NaV1.5 resides in distinct and different pools in cardiac cells. This article is part of a Special Issue entitled: Cardiomyocyte Biology: Cardiac Pathways of Differentiation, Metabolism and Contraction. Copyright © 2012 Elsevier B.V. All rights reserved.
Chu, Chia-Ching; Huang, Hsien-Yu; Whang, Thou-Jen; Tsai, Chin-Chun
2018-03-21
Vibrational levels (v = 6-42) of the NaH C 1 Σ + state including the inner and outer wells and the near-dissociation region were observed by pulsed optical-optical double resonance fluorescence depletion spectroscopy. The absolute vibrational quantum number is identified by comparing the vibrational energy difference of this experiment with the ab initio calculations. The outer well with v up to 34 is analyzed using the Dunham expansion and a Rydberg-Klein-Rees (RKR) potential energy curve is constructed. A hybrid double-well potential combined with the RKR potential, the ab initio calculation, and a long-range potential is able to describe the whole NaH C 1 Σ + state including the higher vibrational levels (v = 35-42). The dissociation energy of the NaH C 1 Σ + state is determined to be D e (C) = 6595.10 ± 5 cm -1 and then the dissociation energy of the NaH ground state D e (X) = 15 807.87 ± 5 cm -1 can be derived.
Cai, Benzhi; Wang, Ning; Mao, Weike; You, Tao; Lu, Yan; Li, Xiang; Ye, Bo; Li, Faqian; Xu, Haodong
2014-01-01
Our in vitro studies revealed that a transcription factor, Forkhead box protein O1 (FoxO1), negatively regulates the expression of NaV1.5, a main α subunit of the cardiac Na+ channel, by altering the promoter activity of SCN5a in HL-1 cardiomyocytes. The in vivo role of FoxO1 in the regulation of cardiac NaV1.5 expression remains unknown. The present study aimed to define the role of FoxO1 in the regulation of NaV1.5 expression and cardiac Na+ channel activity in mouse ventricular cardiomyocy...
Inhibition of epithelial Na+ transport by atriopeptin, protein kinase c, and pertussis toxin
International Nuclear Information System (INIS)
Mohrmann, M.; Cantiello, H.F.; Ausiello, D.A.
1987-01-01
The authors have recently shown the selective inhibition of an amiloride-sensitive, conductive pathway for Na + by atrial natriuretic peptide and 8-bromoguanosine 3',5'-cyclic monophosphate (8-BrcGMP) in the renal epithelial cell line, LLC-PK i . Using 22 Na + fluxes, they further investigated the modulation of Na + transport by atrial natriuretic peptide and by agents that increase cGMP production, activate protein kinase c, or modulate guanine nucleotide regulatory protein function. Sodium nitroprusside increases intracellular cGMP concentrations without affecting cAMP concentrations and completely inhibits amiloride-sensitive Na + uptake in a time- and concentration-dependent manner. Oleoyl 2-acetylglycerol and phorbol 12-myristate 13-acetate, activators of protein kinase c, inhibit Na + uptake by 93 ± 13 and 51 ± 10%, respectively. Prolonged incubation with phorbol ester results in the downregulation of protein kinase c activity and reduces the inhibitory effect of atrial natriuretic peptide, suggesting that the action of this peptide involves stimulation of protein kinase c. Pertussis toxin, which induces the ADP-ribosylation of a 41-kDa guanine nucleotide regulatory protein in LLC-PK i cells, inhibits 22 Na + influx to the same extent as amiloride. Thus, increasing cGMP, activating protein kinase c, and ADP-ribosylating a guanine nucleotide regulatory protein all inhibit Na + uptake. These events may be sequentially involved in the action of atrial natriuretic peptide
Facile Synthesis and Superior Catalytic Activity of Nano-TiN@N-C for Hydrogen Storage in NaAlH4.
Zhang, Xin; Ren, Zhuanghe; Lu, Yunhao; Yao, Jianhua; Gao, Mingxia; Liu, Yongfeng; Pan, Hongge
2018-05-09
Herein, we synthesize successfully ultrafine TiN nanoparticles (hydrogen storage in NaAlH 4 . Adding 7 wt % nano-TiN@N-C induces more than 100 °C reduction in the onset dehydrogenation temperature of NaAlH 4 . Approximately 4.9 wt % H 2 is rapidly released from the 7 wt % nano-TiN@N-C-containing NaAlH 4 at 140 °C within 60 min, and the dehydrogenation product is completely hydrogenated at 100 °C within 15 min under 100 bar of hydrogen, exhibiting significantly improved desorption/absorption kinetics. No capacity loss is observed for the nano-TiN@N-C-containing sample within 25 de-/hydrogenation cycles because nano-TiN functions as an active catalyst instead of a precursor. A severe structural distortion with extended bond lengths and reduced bond strengths for Al-H bonding when the [AlH 4 ] - group adsorbs on the TiN cluster is demonstrated for the first time by density functional theory calculations, which well-explains the reduced de-/hydrogenation temperatures of the nano-TiN@N-C-containing NaAlH 4 . These findings provide new insights into designing and synthesizing high-performance catalysts for hydrogen storage in complex hydrides.
40 CFR 721.6505 - Polymers of C13C15 oxoalcohol ethoxolates.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polymers of C13C15 oxoalcohol... Specific Chemical Substances § 721.6505 Polymers of C13C15 oxoalcohol ethoxolates. (a) Chemical substance... polymers of C13C15 oxoalcohol ethoxolates (PMNs P-96-950/951) are subject to reporting under this section...
Kahlenberg, Volker; Mayerl, Michael Jean-Philippe; Schmidmair, Daniela; Krüger, Hannes; Tribus, Martina
2018-04-01
In the course of an exploratory study on the quaternary system Na2O-K2O-CaO-SiO2 single crystals of the first anhydrous sodium potassium calcium silicate have been obtained from slow cooling of a melt in the range between 1250 and 1050 °C. Electron probe micro analysis suggested the following idealized molar ratios of the oxides for the novel compound: K2O:Na2O:CaO:SiO2 = 1:1:12:8 (or KNaCa6Si4O15). Single-crystal diffraction measurements on a crystal with chemical composition K1.08Na0.92Ca6Si4O15 resulted in the following basic crystallographic data: monoclinic symmetry, space group P 21/ c, a = 8.9618(9) Å, b = 7.3594(6) Å, c = 11.2453(11) Å, β= 107.54(1)°, V = 707.2(1) Å3, Z = 2. Structure solution was performed using direct methods. The final least-squares refinement converged at a residual of R(|F|) = 0.0346 for 1288 independent reflections and 125 parameters. From a structural point of view, K1.08Na0.92Ca6Si4O15 belongs to the group of mixed-anion silicates containing [Si2O7]- and [SiO4]-units in the ratio 1:2. The mono- and divalent cations occupy a total of four crystallographically independent positions located in voids between the tetrahedra. Three of these sites are exclusively occupied by calcium. The fourth site is occupied by 54(1)% K and 46%(1) Na, respectively. Alternatively, the structure can be described as a heteropolyhedral framework based on corner-sharing silicate tetrahedra and [CaO6]-octahedra. The network can build up from kröhnkite-like [Ca(SiO4)2O2]-chains running along [001]. A detailed comparison with other A2B6Si4O15-compounds including topological and group-theoretical aspects is presented.
International Nuclear Information System (INIS)
Sadeghi, Rahmat; Ziamajidi, Fatemeh
2006-01-01
The improved isopiestic method has been used to obtain activities of water for aqueous solutions of poly(ethylene glycol) 400/NaCl at T = (293.15, 298.15, 303.15, 308.15, and 313.15) K. From these measurements, values of the vapour pressure of solutions were determined. The effect of temperature on the (vapour + liquid) equilibrium of {poly(ethylene glycol) + NaCl + H 2 O} systems has been studied. It was found that the slope of the constant activity lines for water increased with increasing temperature. The results have been discussed on the basis of the effect of temperature on the hydrophobicity of the polymer. Also it was found that the vapour pressure depression for an aqueous (PEG + NaCl) system is more than the sum of those for the corresponding binary solutions. Furthermore, the segment-based local composition Wilson model has been used for the correlation of the experimental water activity data. The agreement between the correlation and the experimental data are good
Hoekstra, R; Morgenstern, R; Olson, RE
1996-01-01
Absolute cross sections for C3+(6-->5) emission at 465.7 nm after collisions of C4+ ions with ground state Na(3s) and laser excited aligned Na(Sp) atoms are measured over the collision energy range of 3-7 keV amu(-1). For Na(3s) polarizations are observed by measuring the linear polarization of the
Yolk-shell structured Sb@C anodes for high energy Na-ion batteries
Energy Technology Data Exchange (ETDEWEB)
Song, Junhua; Yan, Pengfei; Luo, Langli; Qi, Xingguo; Rong, Xiaohui; Zheng, Jianming; Xiao, Biwei; Feng, Shuo; Wang, Chongmin; Hu, Yong-Sheng; Lin, Yuehe; Sprenkle, Vincent L.; Li, Xiaolin
2017-10-01
Despite great advances in sodium-ion battery developments, the search for high energy and stable anode materials remains a challenge. Alloy or conversion-typed anode materials are attractive candidates of high specific capacity and low voltage potential, yet their applications are hampered by the large volume expansion and hence poor electrochemical reversibility and fast capacity fade. Here, we use antimony (Sb) as an example to demonstrate the use of yolk-shell structured anodes for high energy Na-ion batteries. The Sb@C yolk-shell structure prepared by controlled reduction and selective removal of Sb2O3 from carbon coated Sb2O3 nanoparticles can accommodate the Sb swelling upon sodiation and improve the structural/electrical integrity against pulverization. It delivers a high specific capacity of ~554 mAh•g-1, good rate capability (315 mhA•g-1 at 10C rate) and long cyclability (92% capacity retention over 200 cycles). Full-cells of O3-Na0.9[Cu0.22Fe0.30Mn0.48]O2 cathodes and Sb@C-hard carbon composite anodes demonstrate a high specific energy of ~130 Wh•kg-1 (based on the total mass of cathode and anode) in the voltage range of 2.0-4.0 V, ~1.5 times energy of full-cells with similar design using hard carbon anodes.
Ito, Yusuke; Kobayashi, Sayako; Nakamura, Nobuhiro; Miyagi, Hisako; Esaki, Masahiro; Hoshijima, Kazuyuki; Hirose, Shigehisa
2013-01-01
Freshwater (FW) fishes actively absorb salt from their environment to tolerate low salinities. We previously reported that vacuolar-type H+-ATPase/mitochondrion-rich cells (H-MRCs) on the skin epithelium of zebrafish larvae (Danio rerio) are primary sites for Na+ uptake. In this study, in an attempt to clarify the mechanism for the Na+ uptake, we performed a systematic analysis of gene expression patterns of zebrafish carbonic anhydrase (CA) isoforms and found that, of 12 CA isoforms, CA2a and CA15a are highly expressed in H-MRCs at larval stages. The ca2a and ca15a mRNA expression were salinity-dependent; they were upregulated in 0.03 mM Na+ water whereas ca15a but not ca2a was down-regulated in 70 mM Na+ water. Immunohistochemistry demonstrated cytoplasmic distribution of CA2a and apical membrane localization of CA15a. Furthermore, cell surface immunofluorescence staining revealed external surface localization of CA15a. Depletion of either CA2a or CA15a expression by Morpholino antisense oligonucleotides resulted in a significant decrease in Na+ accumulation in H-MRCs. An in situ proximity ligation assay demonstrated a very close association of CA2a, CA15a, Na+/H+ exchanger 3b (Nhe3b), and Rhcg1 ammonia transporter in H-MRC. Our findings suggest that CA2a, CA15a, and Rhcg1 play a key role in Na+uptake under FW conditions by forming a transport metabolon with Nhe3b. PMID:23565095
Differential calcium sensitivity in NaV 1.5 mixed syndrome mutants.
Abdelsayed, Mena; Baruteau, Alban-Elouen; Gibbs, Karen; Sanatani, Shubhayan; Krahn, Andrew D; Probst, Vincent; Ruben, Peter C
2017-09-15
SCN5a mutations may express gain-of-function (Long QT Syndrome-3), loss-of-function (Brugada Syndrome 1) or both (mixed syndromes), depending on the mutation and environmental triggers. One such trigger may be an increase in cytosolic calcium, accompanying exercise. Many mixed syndromes mutants, including ∆KPQ, E1784K, 1795insD and Q1909R, are found in calcium-sensitive regions. Elevated cytosolic calcium attenuates gain-of-function properties in ∆KPQ, 1795insD and Q1909R, but not in E1784K. By contrast, elevated cytosolic calcium further exacerbates gain-of-function in E1784K by destabilizing slow inactivation. Action potential modelling, using a modified O'Hara Rudy model, suggests that elevated heart rate rescues action potential duration in ∆KPQ, 1795insD and Q1909R, but not in E1784K. Action potential simulations suggest that E1784K carriers have an increased intracellular sodium-to-calcium ratio under bradycardia and tachycardia conditions. Elevated cytosolic calcium, which is common during high heart rates, ameliorates or exacerbates the mixed syndrome phenotype depending on the genetic signature. Inherited arrhythmias may arise from mutations in the gene for SCN5a, which encodes the cardiac voltage-gated sodium channel, Na V 1.5. Mutants in Na V 1.5 result in Brugada Syndrome (BrS1), Long-QT Syndrome (LQT3) or mixed syndromes (an overlap of BrS1/LQT3). Exercise is a potential arrhythmogenic trigger in mixed syndromes. We aimed to determine the effects of elevated cytosolic calcium, which is common during exercise, in mixed syndrome Na V 1.5 mutants. We used whole-cell patch clamp to assess the biophysical properties of Na V 1.5 wild-type (WT), ∆KPQ, E1784K, 1795insD and Q1909R mutants in human embryonic kidney 293 cells transiently transfected with the Na V 1.5 α subunit (WT or mutants), β1 subunit and enhanced green fluorescent protein. Voltage-dependence and kinetics were measured at cytosolic calcium levels of approximately 0, 500 and 2500
Combustion of Na2B4O7 + Mg + C to synthesis B4C powders
International Nuclear Information System (INIS)
Jiang Guojian; Xu Jiayue; Zhuang Hanrui; Li Wenlan
2009-01-01
Boron carbide powder was fabricated by combustion synthesis (CS) method directly from mixed powders of borax (Na 2 B 4 O 7 ), magnesium (Mg) and carbon. The adiabatic temperature of the combustion reaction of Na 2 B 4 O 7 + 6 Mg + C was calculated. The control of the reactions was achieved by selecting reactant composition, relative density of powder compact and gas pressure in CS reactor. The effects of these different influential factors on the composition and morphologies of combustion products were investigated. The results show that, it is advantageous for more Mg/Na 2 B 4 O 7 than stoichiometric ratio in Na 2 B 4 O 7 + Mg + C system and high atmosphere pressure in the CS reactor to increase the conversion degree of reactants to end product. The final product with the minimal impurities' content could be fabricated at appropriate relative density of powder compact. At last, boron carbide without impurities could be obtained after the acid enrichment and distilled water washing.
International Nuclear Information System (INIS)
Ashburn, D.A.; Garcia, K.; Hanners, J.L.; Silks, L.A. III; Unkefer, C.J.
1994-01-01
Currently, there is a great emphasis on elucidating the structure, function, and dynamics of DNA. Much of the research involved in this study uses nuclear magnetic resonance (NMR) spectroscopy. Effective use of NMR spectroscopy for DNA molecules with mw > 10,000 requires stable isotope enrichment. We present strategies for site-specific isotopic labeling of the purine bases adenosine and guanosine and the biosynthesis of (U- 13 C, 15 N) DNA from methylotropic bacteria. With commercially available 6-chloropurine, an effective two-step route leads to 2'-deoxy-(amino- 15 N)adenosine (dA). The resulting d(amino- 15 N)A is used in a series of reactions to synthesize 2'-deoxy-(2- 13 C,1,amino- 15 N 2 )guanosine or any combination thereof. An improved biosynthesis of labeled DNA has been accomplished using Methylobacterium extorquens AS1. Each liter of growth medium contains 4 g of methanol to yield 1 g of lyophilized cells. As much as 200 mg of RNA per liter of culture has been obtained. We are currently developing large-scale isolation protocols. General synthetic pathways to oligomeric DNA will be presented
Application of inverse kinematics to [sup 1]H+[sup 23]Na[yields][sup 12]C+[sup 12]C
Energy Technology Data Exchange (ETDEWEB)
Bennett, S.J. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Clarke, N.M. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Freer, M. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Fulton, B.R. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Hall, S.J. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Karban, O. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Murgatroyd, J.T. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Tungate, G. (School of Physics and Space Research, Birmingham Univ. (United Kingdom)); Gyapong, G.J. (Dept. of Physics, York Univ. (United Kingdom)); Jarvis, N.S. (Dept. of Physics, York Univ. (United Kingdom)); Watson, D.L. (Dept. of Physics, York Univ. (United Kingdom)); Rae, W.D.M. (Dept. of Nuclear Physics, Oxford Univ. (United Kingdom)); Smith, A.E. (Dept. of Nuclear; Charissa Collaboration
1993-08-15
Some experimental techniques used in the measurement and analysis of inverse kinematic reactions are described and applied to a kinematically complete study of the [sup 1]H([sup 23]Na, [sup 12]C)[sup 12]C reaction at an incident energy of 180 MeV. An excitation function is obtained for the energy range of 18.5 to 19.2 MeV in [sup 24]Mg*; equivalent to proton energies from 7.1 MeV to 7.8 MeV for the [sup 23]Na(p, [sup 12]C)[sup 12]C reaction. (orig.)
Directory of Open Access Journals (Sweden)
Bruno de Freitas Valbon
2013-02-01
Full Text Available Descrevemos a importância da tomografia de córnea e segmento anterior na propedêutica do exame complementar na avaliação de ectasia. Esta descrição da interpretação clínica dos índices da tomografia de córnea e segmento anterior (Pentacam - Oculus, Wetzlar, Germany neste relato de caso, demonstra a relevância de uma nova tecnologia na avaliação da córnea e segmento anterior na suspeita de ceratocone. O diagnóstico de ceratocone foi excluído pela análise dos índices tomográficos de ectasia. Detectou-se assimetria entre os lados nasal e temporal por meio da avaliação do mapa de profundidade de câmara anterior. No exame biomicroscópico sob midríase foi constatado subluxação do cristalino, sendo assim devemos estar atentos não somente aos índices tomográficos corneanos na avaliação do exame complementar e sim analisarmos outros dados importantes oferecidos pela tomografia de córnea e segmento anterior.
Crystal structure of Na3Sc2(PO4)3 at 60 deg C
International Nuclear Information System (INIS)
Lazoryak, B.I.; Kalinin, V.B.; Stefanovich, S.Yu.; Efremov, V.A.
1980-01-01
The structure of the ferroelectric phase of Na 3 Sc 2 (PO 4 ) 3 compound was studied. Na 3 Sc 2 (PO 4 ) 3 monocrystal heated by a jet of warm N 2 was investigated at 60 deg C. The rhombohedron modification was determined: a=8.927(3), c=22.34(4) A, Z=6, space group R anti 3c. Interatomic distances and inner angles of polyhedrons in Na 3 Sc 2 (PO 4 ) 3 structure were determined
Energy Technology Data Exchange (ETDEWEB)
Rard, Joseph A. E-mail: rard1@llnl.gov; Clegg, Simon L.; Platford, Robert
2003-06-01
In 1968, R.F. Platford reported the results from extensive isopiestic vapor-pressure measurements for the {l_brace}zNaCl+(1-z)Na{sub 2}SO{sub 4}{r_brace}(aq) system at T=298.15 K, using NaCl(aq) as the isopiestic reference standard [R.F. Platford, J. Chem. Eng. Data 13 (1968) 46-48]. However, only derived quantities were reported, and the experimental isopiestic equilibrium molalities were not given. The complete set of original isopiestic molalities from that study is tabulated in the present report. In addition, published thermodynamic information for this system is reviewed and the isopiestic equilibrium molalities, electromotive force measurements for five different types of electrochemical cells, and enthalpies of mixing from these other studies are critically assessed and recalculated consistently. These combined results are used to evaluate at T=298.15 K the two mixing parameters of Pitzer's ion-interaction model, {sup S}{theta}(Cl,SO{sub 4})=(1.236{+-}0.032{sub 5}){center_dot}10{sup -2} kg{center_dot}mol{sup -1} and {psi}(Na,Cl,SO{sub 4})=(1.808{+-}0.086){center_dot}10{sup -3} kg{sup 2}{center_dot}mol{sup -2}, and their temperature derivatives {l_brace}{partial_derivative}{sup S}{theta}(Cl,SO{sub 4})/{partial_derivative}T{r_brace}{sub p}=(2.474{+-}0.460){center_dot}10{sup -5} kg{center_dot}mol{sup -1}{center_dot}K{sup -1} and {l_brace}{partial_derivative}{psi}(Na,Cl,SO{sub 4})/{partial_derivative}T{r_brace}{sub p}=-(6.228{+-}0.186){center_dot}10{sup -5} kg{sup 2}{center_dot}mol{sup -2}{center_dot}K{sup -1}. Also reported are parameters for an extended ion-interaction model for Na{sub 2}SO{sub 4}(aq), valid from T=(273.15 to 323.15) K, that were required for this mixed electrolyte solution analysis.
Comparison of halo of 11Be, 15C, and 19C
Kharab, R.; Kumar, R.; Singh, P.; Sharma, H. C.
2007-12-01
We have compared the halo of 11Be, 15C, and 19C nuclei by analyzing the one-neutron stripping reaction data on the Be target at 60-, 54-, and 57-MeV/ A beam energies, respectively, within the framework of the eikonal approximation approach. The determination of effective range through the comparison of the total cross section data and prediction has revealed that the halo of 19C is the well developed, while that of 15C is the least and that of 11Be lies in between these two. The longitudinal momentum distribution data also strengthen these observations.
International Nuclear Information System (INIS)
Szczepanska-Konkel, M.; Yusufi, A.N.; Dousa, T.P.
1987-01-01
Since phosphonoformic acid (PFA) acts as a specific competitive inhibitor of Na+-Pi co-transport across renal brush-border membrane (BBM), we employed the [ 14 C]PFA as a probe to determine the mechanism of its interaction with rat renal BBM. The binding of [ 14 C]PFA to BBM vesicles (BBMV), with Na+ present in extravesicular medium (Na+o), was time- and temperature-dependent. The replacement of Na+o with other monovalent cations reduced the PFA binding by -80%. Cl- was the most effective accompanying monovalent anion as NaCl for maximum PFA binding. The Na+o increased the apparent affinity of BBMV for [ 14 C]PFA binding, but it did not change the maximum binding capacity. The maximum [ 14 C]PFA binding was achieved at Na+o approximately equal to 50 mM. The extent of Na+-dependent [ 14 C]PFA binding correlated with percent inhibition by an equimolar dose of PFA of the dependent BBMV uptake of 32Pi. Intravesicular Na+ (Na+i) decreased [ 14 C]PFA binding, on BBMV, and this inhibition by Na+i was dependent on the presence of Na+o. The increase in Na+i, at constant [Na+]o, decreased the Vmax, but not the Km, for [ 14 C]PFA binding on BBMV. Bound [ 14 C]PFA was displaced from BBMV by phosphonocarboxylic acids proportionally to their ability to inhibit gradient-dependent Pi transport, whereas other monophosphonates, diphosphonates, L-proline, or D-glucose did not influence the [ 14 C]PFA binding. The Na+-dependent binding of [ 14 C]PFA and of [ 3 H]phlorizin by BBMV was 10 times higher than binding of these ligands to renal basolateral membranes and to mitochondria. [ 14 C]PFA probably binds onto the same locus on the luminal surface of BBM, where Pi and Na+ form a ternary complex with the Na+-Pi co-transporter
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Employment. 8c.40 Section 8c.40... BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF COMMERCE § 8c.40 Employment... discrimination in employment under any program or activity conducted by the agency. The definitions, requirements...
SPREMEMBE V PRIPOZNAVANJU PRIHODKOV IZ POGODB S STRANKAMI PO PREHODU NA MSRP 15
Kovačec, Gregor
2016-01-01
Prihodki so eden najpomembnejših faktorjev pri določanju uspešnosti poslovanja podjetja. Zaradi slabe urejenosti tega področja s strani tedanjih rešitev v Mednarodnih standardih računovodskega poročanja oziroma ameriških Splošno sprejetih načel računovodenja (GAAP), sta se mednarodni odbor IASB in ameriški FASB že leta 2002 odločila, da je čas za prenovo obstoječih standardov. Maja 2014 je bil na podlagi sodelovanja obeh odborov izdan nov standard MSRP 15 – Prihodki iz pogodb s strankami. MSR...
Dodrill, Michael W; Beezhold, Donald H; Meighan, Terence; Kashon, Michael L; Fedan, Jeffrey S
2011-01-25
Earlier, we found in functional experiments that lipopolysaccharide (LPS; 4mg/kg; i.p.) hyperpolarized the epithelium by stimulating the transepithelial transport of Na(+) in guinea-pig tracheal epithelium. Epithelial sodium channel (ENaC) activity and Na(+),K(+)-pump activity were increased. In this study, we hypothesized that LPS increases the expression of ENaC and the Na(+),K(+)-pump in the epithelium and investigated the levels of transcription and protein abundance. Using qPCR, the effects of LPS on the transcription of αENaC, α(1) Na(+),K(+)-pump, COX-2, eNOS, iNOS, IL-1β, and TNF-α were measured at 3 and 18h. In the epithelium, LPS increased the transcription of COX-2, IL-1β, and, to a nonsignificant extent, TNF-α at 3h, but not at 18h. In alveolar macrophages, TNF-α, and, to a nonsignificant extent, COX-2 and IL-1β were up-regulated at 3h, but not at 18h. Even though LPS stimulated the transcription of some genes, αENaC and α(1) Na(+),K(+)-ATPase transcription were not affected. The expressions of α-, β-, and γ-ENaC and α(1) Na(+),K(+)-pump from the tracheal epithelium and kidney cortex/medulla were investigated by western blotting. All three ENaC subunits were detected as cleavage fragments, yet LPS had no effect on their expression. LPS increased the expression of the α(1) subunit and the α(1), α(2), and α(3) subunits, collectively, of the Na(+),K(+)-pump. Taken together, these data indicate that LPS increases Na(+) transport downstream of the genetic level, in part, by stimulating the expression of the Na(+),K(+)-pump. Published by Elsevier B.V.
Chou, I.-Ming; Lee, R.D.
1983-01-01
Solubilities of halite in the ternary system NaCl-CsCl-H2O have been determined by the visual polythermal method at 1 atm from 20 to 100??C along five constant CsCl/(CsCl + H2O) weight ratio lines. These five constant weight ratios are 0.1, 0.2, 0.3, 0.4, and 0.5. The maximum uncertainties in these measurements are ??0.02 wt % NaCl and ??0.15??C. The data along each constant CsCl/(CsCl + H2O) weight ratio line were regressed to a smooth curve. The maximum deviation of the measured solubilities from the smooth curves is 0.06 wt % NaCl. Isothermal solubilities of halite were calculated from smoothed curves at 25, 50, and 75??C.
Park, Young-Uk; Bai, Jianming; Wang, Liping; Yoon, Gabin; Zhang, Wei; Kim, Hyungsub; Lee, Seongsu; Kim, Sung-Wook; Looney, J Patrick; Kang, Kisuk; Wang, Feng
2017-09-13
Ion exchange is a ubiquitous phenomenon central to wide industrial applications, ranging from traditional (bio)chemical separation to the emerging chimie douce synthesis of materials with metastable structure for batteries and other energy applications. The exchange process is complex, involving substitution and transport of different ions under non-equilibrium conditions, and thus difficult to probe, leaving a gap in mechanistic understanding of kinetic exchange pathways toward final products. Herein, we report in situ tracking kinetic pathways of Li + /Na + substitution during solvothermal ion-exchange synthesis of Li x Na 1.5-x VOPO 4 F 0.5 (0 ≤ x ≤ 1.5), a promising multi-Li polyanionic cathode for batteries. The real-time observation, corroborated by first-principles calculations, reveals a selective replacement of Na + by Li + , leading to peculiar Na + /Li + /vacancy orderings in the intermediates. Contradicting the traditional belief of facile topotactic substitution via solid solution reaction, an abrupt two-phase transformation occurs and predominantly governs the kinetics of ion exchange and transport in the 1D polyanionic framework, consequently leading to significant difference of Li stoichiometry and electrochemical properties in the exchanged products. The findings may help to pave the way for rational design of ion exchange synthesis for making new materials.
Controvérsias na fibrose cística: do pediatra ao especialista
Directory of Open Access Journals (Sweden)
Ribeiro Jose Dirceu
2002-01-01
Full Text Available Objetivos: nos últimos 70 anos, a fibrose cística emergiu da obscuridade para o reconhecimento como a mais importante doença hereditária, potencialmente letal, incidente na raça branca. Embora seja uma doença genética, na qual o defeito básico acomete células de vários órgãos, nem todos os indivíduos expressam respostas clínicas na mesma intensidade. Várias manifestações clínicas, principalmente pulmonares e digestivas, podem ocorrer durante a vida dos pacientes fibrocísticos. O objetivo deste artigo é propiciar ao pediatra geral uma visão atualizada dos principais assuntos referentes à fibrose cística. Fontes dos dados: revisão sistemática e atualizada em fonte de dados oficial (Medline. Síntese dos dados: foram revisados 79 artigos sobre fibrose cística, de periódicos internacionais, colocando, de modo atual e crítico, os principais eventos relacionados com a incidência, a fisiopatogenia, as manifestações clínicas, o diagnóstico e o tratamento da fibrose cística. Conclusões: apesar de não existir cura para essa doença, muitos conhecimentos novos sobre a etiologia e a fisiopatologia, adquiridos nas duas últimas décadas, propiciaram uma nova abordagem para o tratamento da fibrose cística. A compreensão dos mecanismos básicos da doença pulmonar, bem como das manifestações digestivas na fibrose cística, decorrente dos conhecimentos de pesquisas recentes, tem sido a chave para o aumento da sobrevida e a melhora da qualidade de vida dos pacientes.
Energy Technology Data Exchange (ETDEWEB)
Ashburn, D.A.; Garcia, K.; Hanners, J.L.; Silks, L.A. III; Unkefer, C.J. [Los Alamos National Laboratory, NM (United States)
1994-12-01
Currently, there is a great emphasis on elucidating the structure, function, and dynamics of DNA. Much of the research involved in this study uses nuclear magnetic resonance (NMR) spectroscopy. Effective use of NMR spectroscopy for DNA molecules with mw > 10,000 requires stable isotope enrichment. We present strategies for site-specific isotopic labeling of the purine bases adenosine and guanosine and the biosynthesis of (U-{sup 13}C, {sup 15}N) DNA from methylotropic bacteria. With commercially available 6-chloropurine, an effective two-step route leads to 2{prime}-deoxy-(amino-{sup 15}N)adenosine (dA). The resulting d(amino-{sup 15}N)A is used in a series of reactions to synthesize 2{prime}-deoxy-(2-{sup 13}C,1,amino-{sup 15}N{sub 2})guanosine or any combination thereof. An improved biosynthesis of labeled DNA has been accomplished using Methylobacterium extorquens AS1. Each liter of growth medium contains 4 g of methanol to yield 1 g of lyophilized cells. As much as 200 mg of RNA per liter of culture has been obtained. We are currently developing large-scale isolation protocols. General synthetic pathways to oligomeric DNA will be presented.
Directory of Open Access Journals (Sweden)
Rafaela do Socorro Souza e Silva Moura
2014-01-01
Full Text Available Fundamento: Em pacientes com hipertensão arterial sistêmica, a microalbuminúria é um marcador de lesão endotelial e está associada a um risco aumentado de doença cardiovascular. Objetivo: O objetivo do presente estudo foi determinar os fatores que influenciam a ocorrência de microalbumiúria em pacientes hipertensos com creatinina sérica menor que 1,5 mg/dL. Métodos: Foram incluídos no estudo 133 pacientes brasileiros atendidos em um ambulatório multidisciplinar para hipertensos. Pacientes com creatinina sérica maior do que 1,5 mg/dL e aqueles com diabete mellitus foram excluídos do estudo. A pressão arterial sistólica e diastólica foi aferida. O índice de massa corporal (IMC e a taxa de filtração glomerular estimada pela fórmula CKD-EPI foram calculados. Em um estudo transversal, creatinina, cistatina C, colesterol total, HDL colesterol, LDL colesterol, triglicerídeos, proteína C-reativa (PCR e glicose foram mensurados em amostra de sangue. A microalbuminúria foi determinada na urina colhida em 24 horas. Os hipertensos foram classificados pela presença de um ou mais critérios para síndrome metabólica. Resultados: Em análise de regressão múltipla, os níveis séricos de cistatina C, PCR, o índice aterogênico log TG/HDLc e a presença de três ou mais critérios para síndrome metabólica foram positivamente correlacionados com a microalbuminuria (r2: 0,277; p < 0,05. Conclusão: Cistatina C, PCR, log TG/HDLc e presença de três ou mais critérios para síndrome metabólica, independentemente da creatinina sérica, foram associados com a microalbuminúria, um marcador precoce de lesão renal e de risco cardiovascular em pacientes com hipertensão arterial essencial.
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AJ15 (Link to dictyBase) - G01152 DDB0232964 Contig-U16520-...to library) Clone ID FC-AJ15 (Link to dictyBase) Atlas ID - NBRP ID G01152 dictyBase ID DDB0232964 Link to C...ontig Contig-U16520-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC...KIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICTESGLLALRERRMRVTHTDFKKAKEKVL YRKTAGAPEGLYM*kkknqnqk Trans...vih*qlviwrrlsmxitpschqp*tralcpyhvfv--- ---ELLNQLDGFDASTDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDIKTKRKIFEI HTAKMNLSEDVNLEEFVMSKDDLSGADIKAICT
On the differences between 1.5oC and 2oC of global warming
King, A.
2017-12-01
The Paris Agreement of 2015 has resulted in a drive to limit global warming to 2oC with an aim for a lower 1.5oC target. It is therefore vital that we understand some of the differences we would expect between these two levels of global warming. My research uses coupled climate model projections to investigate where and for what variables we can differentiate between worlds of 1.5oC and 2oC global warming. I place a particular focus on climate extremes and population exposure to those extremes. I have found that there are perceptible benefits in limiting global warming to 1.5oC as opposed to 2oC through reduced frequency and intensity of heat extremes, both over land and in ocean areas where thermal stress on coral has resulted in bleaching. Differences in high and low precipitation extremes between the 1.5oC and 2oC global warming levels are projected for some regions. I have also examined how "scalable" changes from the 1.5oC to 2oC level are. In areas of the world such as Eastern China I find that changes in anthropogenic aerosol concentrations will influence the level of change projected at 1.5oC and 2oC, such that past warming is likely to be a poor indicator of future changes. Overall, my research finds clear benefits to limiting global warming to 1.5oC relative to higher levels.
17 CFR 240.15c3-1d - Satisfactory Subordination Agreements (Appendix D to 17 CFR 240.15c3-1).
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Satisfactory Subordination...-Counter Markets § 240.15c3-1d Satisfactory Subordination Agreements (Appendix D to 17 CFR 240.15c3-1). (a) Introduction. (1) This Appendix sets forth minimum and non-exclusive requirements for satisfactory...
Sreedharan, O. M.; Madan, B. S.; Gnanamoorthy, J. B.
1983-12-01
The compound NaCrO 2(s) is an important corrosion product in sodium-cooled LMFBRs. The standard Gibbs energy of formation of NaCrO 2(s) is required for the computation of threshold oxygen levels in Na(1) for the formation of NaCrO 2(s) on 18-8 stainless steels. For this purpose the emf of the galvanic cell: Pt, NaCrO 2, Cr 2O 3, Na 2CrO 4/15 YSZ/O 2 ( P O 2 = 0.21 atm, air), Pt was measured over 784-1012 K to be: (E±4.4)(mV) = 483.67-0.34155 T(K). From this, the standard Gibbs energy of formation of NaCrO 2(s) from the elements ( ΔG f,T0) and from the oxides ( ΔG f,OX,T0) was calculated to be: [ΔG f,T0(NaCrO 2, s)±1.86] (kJ/mol) =-869.98 + 0.18575 T(K) , [ΔG f,OX,T0(NaCr0 2, s)±4.8] (kJ/mol) = -104.25-0.00856 T(K) . The molar heat capacity, C P0, of NaCrO 2(s) was measured by DSC to be (350-600 K): C P0(NaCrO 2, s) (J/K mol) = 27.15 + 0.1247 T (K) , From these data, values of -99.3 kJ/mol and 91.6 J/K mol were computed for ΔH f,2980 and S 2980 of NaCrO 2(s). The internal consistency was checked with the use of enthalpy data on Na 2CrO 4(s). From the standard Gibbs energy of formation of NaCrO 2(s) the equation logC 0(wppm) = 3.9905-3147.6 T(K) was derived, where C 0 is the threshold oxygen level for the formation of NaCrO 2(s) on 18-8 stainless steels.
Structural Stability and Electronic Properties of Na2C6O6 for a Rechargeable Sodium-ion Battery
Yamashita, Tomoki; Fujii, Akihiro; Momida, Hiroyoshi; Oguchi, Tamio
2014-03-01
Sodium-ion batteries have been explored as a promising alternative to lithium-ion batteries owing to a significant advantage of a natural abundance of sodium. Recently, it has been reported that disodium rhodizonate, Na2C6O6, exhibit good electrochemical properties and cycle performance as a minor-metal free organic cathode for sodium-ion batteries. However, its crystal structures during discharge/charge cycle still remain unclear. In this work, we theoretically propose feasible crystal structures of Na2+xC6O6 using first principles calculations. A structural phase transition has been found: Na4C6O6 has a different C6O6 packing arrangement from Na2C6O6. Electronic structures of Na2+xC6O6 during discharge/charge cycle are also discussed. Our predictions could be the key to understanding the discharge/charge process of Na2C6O6. Supported by MEXT program ``Elements Strategy Initiative to Form Core Rersearch Center'' (since 2012), MEXT; Ministry of Education Culture, Sports, Science and Technology, Japan.
International Nuclear Information System (INIS)
Sugiyama, Daisuke; Fujita, Tomonari
2004-01-01
In the concept for TRU waste disposal in Japan, cement is a potential waste packaging and backfilling material and is expected to provide chemical containment. In the presence of some reactive ions in a saline groundwater, the chemical properties of cement materials should be affected. In this study, the mechanism of sorption of sodium (Na) on C-S-H and the effect of sodium chloride (NaCl) concentration on dissolution of Calcium Silicate Hydrate (C-S-H) are discussed by measuring the sorption isotherm of sodium onto C-S-H gel (Ca/Si = 0.65-1.2). Based on the experimental results, it is showed that sodium sorbs by substitution for Ca in C-S-H phases and leaching of Ca from C-S-H is enhanced in NaCl solution ( -1 mol dm -3 ). The results of sorption experiments are reasonably well modelled by the ion-exchange model assuming some calcium sites with different ion-exchange log K values. It is also suggested that the dissolution of C-S-H can be modelled reasonably well by considering the effect of ionic strength on activity coefficients of aqueous species for high Ca/Si ratio of C-S-H, and the effect of exchange of sodium with calcium of C-S-H on leaching of Ca becomes obvious for lower Ca/Si ratio of C-S-H. (author)
Energy Technology Data Exchange (ETDEWEB)
Cigala, Rosalia Maria; Crea, Francesco; Lando, Gabriele; Milea, Demetrio [Dipartimento di Chimica Inorganica, Chimica Analitica e Chimica Fisica, Universita di Messina, Via Ferdinando Stagno d' Alcontres, 31, I-98166 Messina (Vill. S. Agata) (Italy); Sammartano, Silvio, E-mail: ssammartano@unime.i [Dipartimento di Chimica Inorganica, Chimica Analitica e Chimica Fisica, Universita di Messina, Via Ferdinando Stagno d' Alcontres, 31, I-98166 Messina (Vill. S. Agata) (Italy)
2010-11-15
The acid-base properties of concentrated phytic acid were studied in self-medium and in NaCl{sub aq} (0.5 {<=} I/mol . L{sup -1} {<=} 4.0) by ISE-H{sup +} potentiometry and by direct calorimetry, at T = 298.15 K. At ligand concentrations c{sub (Phy)} > 0.012 mol . L{sup -1}, the formation of several binuclear H{sub i}(Phy){sub 2} (2 {<=} i {<=} 10) species was observed, in addition to the mononuclear H{sub i}Phy (1 {<=} i {<=} 7) ones. The solubility of phytate dodecasodium salt was studied in pure water and in NaCl{sub aq} at different ionic strengths; the total solubility in pure water is S{sub 0}{sup T}=(0.300{+-}0.004)mol.L{sup -1} and it decreases markedly with increasing ionic strength; for example the total solubility of Na{sub 12}Phy at I = 3.0 mol . L{sup -1} is 0.008 mol . L{sup -1}. By the dependence on ionic strength (salt concentration) of the solubility, it was possible to calculate the activity coefficients of phytate as a function of medium concentration. Direct calorimetric titrations were also carried out on Na{sub 12}Phy aqueous solutions at different phytate concentrations (0.025 {<=} c{sub (Phy)}/mol . L{sup -1} {<=} 0.100) and without addition of supporting electrolyte, in order to calculate the enthalpy changes for the protonation equilibria in self-medium of the binuclear H{sub i}(Phy){sub 2} species, at T = 298.15 K. It was observed that the {Delta}H/kJ . mol{sup -1} of the binuclear species are, within the experimental error, independent of the ionic strength; for example for the H{sub 2}(Phy){sub 2} species we obtained: {Delta}H{sub 22} = (-23.6 {+-} 0.6) kJ . mol{sup -1}, and (-23.7 {+-} 0.2) kJ . mol{sup -1} at I = 0.50 and 2.0 mol . L{sup -1}, respectively.
Preparation of 15N-13C-fulminic acid
International Nuclear Information System (INIS)
Wilmes, R.; Winnewisser, M.
1993-01-01
The precursor for the title compound was prepared in a three-step synthesis. The 13 C-label was incorporated in the first step employing 2- 13 C-ethyl acetate and the 15 N-label in the last step, using 15 N-sodium nitrite. Upon pyrolysis the precursor forms three fragments, one of them being the title compound. (Author)
Proteína C reactiva como marcador inflamatorio en la enfermedad periodontal
Directory of Open Access Journals (Sweden)
Víctor Martínez-Aguilar
2017-01-01
Full Text Available La Proteína C Reactiva (PCR es una de las proteínas plasmáticas que aparecen en la fase aguda de la inflamación. La periodontitis se relaciona con niveles elevados de PCR en adul tos y con una reducción de la misma después de su tratamiento. La diabetes, por otro lado, es una enfermedad que compromete la respuesta tanto inflamatoria como reparativa del organismo y los tejidos periodontales son particularmente sensibles a su efecto. La PCR por lo tanto, puede ser útil en el diagnóstico y en la determinación de progresión de la enfermedad periodontal (EP. El objetivo del presente estudio fue evaluar los niveles de PCR en pacientes con EP y pacientes con EP y diabetes mellitus tipo 2 (DM2. Se incluyeron 60 sujetos distribuidos en 3 grupos: 15 pacientes con EP (Grupo 1, 15 pacientes con EP y DM2 (grupo 2 y 30 pacientes sistémicamente sanos (grupo 3. A cada uno de los participantes se les realizaron pruebas bioquímicas: Proteína C Re activa (NycoCard® PCR, HbA1c (NycoCard® y glucosa en sangre. Para el diagnóstico de la enfermedad periodontal se siguieron los parámetros del 5° Taller Europeo de Periodontología. Para evaluar las diferencias entre los grupos se usó la prueba de Kruskal Wallis. Se encontraron diferencias estadísticas significativas al comparar la concentración de PCR en los 3 grupos (p<0.01, siendo el grupo de pacientes sanos el que presentaba el menor promedio (4.88±0.08 y los mayores promedios para los grupos de EP (5 .95±2.23 y EP/DM2 (5.21±0.20. Además se encontraron diferencias significativas (p<0.01 en los tres grupos con respecto a la concentración hemoglobina, talla, IMC y PI. Los resultados indican que los niveles séricos de PCR se elevan en pacientes con EP y en pacientes con EP y DM2. Aunque se notó esta diferencia, existen diversos factores tanto locales como sistémicos que pueden potencialmente influir en los niveles de PCR y estos representan una limitación y dificultad al momento de
17 CFR 240.15c1-2 - Fraud and misrepresentation.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Fraud and misrepresentation. 240.15c1-2 Section 240.15c1-2 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-2 Fraud and...
Directory of Open Access Journals (Sweden)
Rafiza Abdul Razak
2015-05-01
Full Text Available This paper presents the mechanical function and characterization of an artificial lightweight geopolymer aggregate (ALGA using LUSI (Sidoarjo mud and alkaline activator as source materials. LUSI stands for LU-Lumpur and SI-Sidoarjo, meaning mud from Sidoarjo which erupted near the Banjarpanji-1 exploration well in Sidoarjo, East Java, Indonesia on 27 May 2006. The effect of NaOH molarity, LUSI mud/Alkaline activator (LM/AA ratio, and Na2SiO3/NaOH ratio to the ALGA are investigated at a sintering temperature of 950 °C. The results show that the optimum NaOH molarity found in this study is 12 M due to the highest strength (lowest AIV value of 15.79% with lower water absorption and specific gravity. The optimum LUSI mud/Alkaline activator (LM/AA ratio of 1.7 and the Na2SiO3/NaOH ratio of 0.4 gives the highest strength with AIV value of 15.42% with specific gravity of 1.10 g/cm3 and water absorption of 4.7%. The major synthesized crystalline phases were identified as sodalite, quartz and albite. Scanning Electron Microscope (SEM image showed more complete geopolymer matrix which contributes to highest strength of ALGA produced.
Abdul Razak, Rafiza; Abdullah, Mohd Mustafa Al Bakri; Hussin, Kamarudin; Ismail, Khairul Nizar; Hardjito, Djwantoro; Yahya, Zarina
2015-01-01
This paper presents the mechanical function and characterization of an artificial lightweight geopolymer aggregate (ALGA) using LUSI (Sidoarjo mud) and alkaline activator as source materials. LUSI stands for LU-Lumpur and SI-Sidoarjo, meaning mud from Sidoarjo which erupted near the Banjarpanji-1 exploration well in Sidoarjo, East Java, Indonesia on 27 May 2006. The effect of NaOH molarity, LUSI mud/Alkaline activator (LM/AA) ratio, and Na2SiO3/NaOH ratio to the ALGA are investigated at a sintering temperature of 950 °C. The results show that the optimum NaOH molarity found in this study is 12 M due to the highest strength (lowest AIV value) of 15.79% with lower water absorption and specific gravity. The optimum LUSI mud/Alkaline activator (LM/AA) ratio of 1.7 and the Na2SiO3/NaOH ratio of 0.4 gives the highest strength with AIV value of 15.42% with specific gravity of 1.10 g/cm3 and water absorption of 4.7%. The major synthesized crystalline phases were identified as sodalite, quartz and albite. Scanning Electron Microscope (SEM) image showed more complete geopolymer matrix which contributes to highest strength of ALGA produced. PMID:26006238
International Nuclear Information System (INIS)
Lu, Xuena; Shang, Yu; Zhang, Sen; Deng, Chao
2015-01-01
Highlights: • Li 0.85 Na 0.15 V 3 O 8 nanosheet with superionic conductive layer was constructed. • Li x V 2 O 5 surface layer provides facile pathways for lithium migration. • Li x V 2 O 5 -Li 0.85 Na 0.15 V 3 O 8 composite displays good high rate capability. - Abstract: Poor ion transport and rate capability are the main challenges for LiV 3 O 8 as cathode material for lithium ion batteries. Here we report a novel strategy for enhancing lithium ion transport by building superionic pathways on the surface of Li 0.85 Na 0.15 V 3 O 8 nanosheet. The two-dimensional Li 0.85 Na 0.15 V 3 O 8 nanoparticle with an ion conductive layer of Li x V 2 O 5 on its surface is constructed by a modified sol–gel strategy with carefully controlled sodium incorporation and elements stoichiometry. Ultrathin Li x V 2 O 5 surface layer not only provides facile pathways for lithium migration, but also increases the structure stability during cycling. The Li x V 2 O 5 -Li 0.85 Na 0.15 V 3 O 8 composite displays good high rate capability of 172.3 mAh g −1 at 5C and excellent cycling stability of 98.9% over fifty cycles. This superior electrochemical property is attributed to the occupation of lithium site by Na + in LiV 3 O 8 host crystals and the surface superionic pathways of Li x V 2 O 5 phase. Therefore, the advantages of both high ion transport and the structure stabilization in present study put forward a new strategy for achieving high-performance LiV 3 O 8 electrode material with tailored nanoarchitecture
Directory of Open Access Journals (Sweden)
Isabela da Costa César
Full Text Available A utilização de produtos naturais e suplementos contendo extratos secos de isoflavonas aumentou na última década, devido, principalmente, aos efeitos benéficos atribuídos a estes compostos no alívio dos sintomas da menopausa. Genisteína, daidzeína e gliciteína são as agliconas mais abundantes nos extratos de soja, ocorrendo também como glicosídeos. Tendo em vista seus usos, não existe ainda na literatura uma definição da quantidade mínima de cada uma das agliconas que os extratos ou cápsulas de isoflavonas devem ter, e também não existe um método oficial para o controle de qualidade dos mesmos. O presente trabalho apresenta um método por CCD para análise qualitativa das três agliconas e de seus glicosídeos em extratos e cápsulas de isoflavonas, antes e após hidrólise ácida. A análise quantitativa das cápsulas de isoflavonas, realizada por cromatografia líquida de alta eficiência (CLAE, revelou grandes variações nos teores das três agliconas, após hidrólise ácida. Os teores variaram da seguinte forma, nos 18 lotes de cápsulas avaliados: daidzeína (13,34 a 76,20 mg/cápsula, genisteína (0,61 a 27,18 mg/cápsula e gliciteína (0,49 a 8,80 mg/cápsula.
Aqueous partial molar heat capacities and volumes for NaReO4 and NaTcO4
International Nuclear Information System (INIS)
Lemire, R.J.; Saluja, P.P.S.; Campbell, A.B.
1989-01-01
As part of the Canadian Nuclear Fuel Waste Management Program, data are required to model the equilibrium thermodynamic behavior of key radionuclides at temperatures above 25 degree C. A flow microcalorimeter/densimeter system has been commissioned to measure heat capacities and densities of solutions containing radioactive species. Measurements for solutions of aqueous NaReO 4 (a common analogue for NaTcO 4 ) were made at seven temperatures (15 to 100 degree C) over the concentration range 0.05 to 0.2 mol·kg -1 . Subsequently, measurements were made for NaTcO 4 solutions under similar conditions. The heat capacity and density data are analyzed using Pitzer's ion-interaction model, and values of the NaReO 4 partial molar heat capacities are compared to literature values based on integral heats of solution. The agreement between the two sets of NaReO 4 data is good below 75 degree C, but only fair at the higher temperatures. Values of the partial molar volumes have also been derived. The uncertainties introduced by using thermodynamic data for ReO 4 - , in the absence of data for TcO 4 - , are discussed
Energy Technology Data Exchange (ETDEWEB)
Widerlund, Anders, E-mail: Anders.Widerlund@ltu.se; Chlot, Sara; Öhlander, Björn
2014-07-01
Organic C and total N concentrations, C/N ratios, δ{sup 15}N and δ{sup 13}C values in {sup 210}Pb-dated sediment cores were used to reconstruct historical changes in organic matter (OM) accumulation in three Swedish lakes receiving nutrient-rich mine waters. Ammonium-nitrate-based explosives and sodium cyanide (NaCN) used in gold extraction were the major N sources, while lesser amounts of P originated from apatite and flotation chemicals. The software IsoSource was used to model the relative contribution of soil, terrestrial and littoral vegetation, and phytoplankton detritus in the lake sediments. In one lake the IsoSource modelling failed, suggesting the presence of additional, unknown OM sources. In two of the lakes sedimentary detritus of littoral vegetation and phytoplankton had increased by 15–20% and 20–35%, respectively, since ∼ 1950, when N- and P-rich mine waters began to reach the lakes. Today, phytoplankton is the dominating OM component in these lake sediments, which appears to be a eutrophication effect related to mining operations. Changes in the N isotopic composition of biota, lake water, and sediments related to the use of ammonium-nitrate-based explosives and NaCN were evident in the two studied systems. However, N isotope signals in the receiving waters (δ{sup 15}N ∼ + 9‰ to + 19‰) were clearly shifted from the primary signal in explosives (δ{sup 15}N–NO{sub 3} = + 3.4 ± 0.3‰; δ{sup 15}N–NH{sub 4} = − 8.0 ± 0.3‰) and NaCN (δ{sup 15}N = + 1.1 ± 0.5‰), and direct tracing of the primary N isotope signals in mining chemicals was not possible in the receiving waters. Systems where mine waters with a well known discharge history are a major point source of N with well-defined isotopic composition should, however, be suitable for further studies of processes controlling N isotope signatures and their transformation in aquatic systems receiving mine waters. - Highlights: • Historical mining-related changes in organic
Results from the BRACE 1.5 study: Climate change impacts of 1.5 C and 2 C warming
O'Neill, B. C.; Anderson, B.; Monaghan, A. J.; Ren, X.; Sanderson, B.; Tebaldi, C.
2017-12-01
In 2015, 195 countries negotiated the Paris Agreement on climate change, which set long-term goals of limiting global mean warming to well below 2 C and possibly 1.5 C. This event stimulated substantial scientific interest in climate outcomes and impacts on society associated with those levels of warming. Recently, the first set of global climate model simulations explicitly designed to meet those targets were undertaken with the Community Earth System Model (CESM) for use by the research community (Sanderson et al, accepted). The BRACE 1.5 project models societal impacts from these climate outcomes, combined with assumptions about future socioeconomic conditions according to the Shared Socioeconomic Pathways. These analyses build on a recently completed study of the Benefits of Reduced Anthropogenic Climate changE (BRACE), published as a set of 20 papers in Climatic Change, which examined the difference in impacts between two higher scenarios resulting in about 2.5 C and 3.7 C warming by late this century. BRACE 1.5 consists of a set of six papers to be submitted to a special collection in Environmental Research Letters that takes a similar approach but focuses on impacts at 1.5 and 2 C warming. We ask whether impacts differ substantially between the two climate scenarios, accounting for uncertainty in climate outcomes through the use of initial condition ensembles of CESM simulations, and in societal conditions by using alternative SSP-based development pathways. Impact assessment focuses on the health and agricultural sectors; modeling approaches include the use of a global mutli-region CGE model for economic analysis, both a process-based and an empirical crop model, a model of spatial population change, a model of climatic suitability for the aedes aegypti mosquito, and an epidemiological model of heat-related mortality. A methodological analysis also evaluates the use of climate model emulation techniques for providing climate information sufficient to
Chaudhary, Doongar R; Seo, Juyoung; Kang, Hojeong; Rathore, Aditya P; Jha, Bhavanath
2018-05-01
High and fluctuating salinity is characteristic for coastal salt marshes, which strongly affect the physiology of halophytes consequently resulting in changes in stable isotope distribution. The natural abundance of stable isotopes (δ 13 C and δ 15 N) of the halophyte plant Salicornia brachiata and physico-chemical characteristics of soils were analysed in order to investigate the relationship of stable isotope distribution in different populations in a growing period in the coastal area of Gujarat, India. Aboveground and belowground biomass of S. brachiata was collected from six different populations at five times (September 2014, November 2014, January 2015, March 2015 and May 2015). The δ 13 C values in aboveground (-30.8 to -23.6 ‰, average: -26.6 ± 0.4 ‰) and belowground biomass (-30.0 to -23.1 ‰, average: -26.3 ± 0.4 ‰) were similar. The δ 13 C values were positively correlated with soil salinity and Na concentration, and negatively correlated with soil mineral nitrogen. The δ 15 N values of aboveground (6.7-16.1 ‰, average: 9.6 ± 0.4 ‰) were comparatively higher than belowground biomass (5.4-13.2 ‰, average: 7.8 ± 0.3 ‰). The δ 15 N values were negatively correlated with soil available P. We conclude that the variation in δ 13 C values of S. brachiata was possibly caused by soil salinity (associated Na content) and N limitation which demonstrates the potential of δ 13 C as an indicator of stress in plants.
Liu, Zheng; Fei, Xiao-Wei; Fang, Yan-Jia; Shi, Wen-Jie; Zhang, Yu-Qiu; Mei, Yan-Ai
2008-09-01
In this report, the effects of C(6)-ceramide on the voltage-gated inward Na(+) currents (I(Na)), two types of main K(+) current [outward rectifier delayed K(+) current (I(K)) and outward transient K(+) current (I(A))], and cell death in cultured rat cerebellar granule cells were investigated. At concentrations of 0.01-100 microM, ceramide produced a dose-dependent and reversible inhibition of I(Na) without alteration of the steady-state activation and inactivation properties. Treatment with C(2)-ceramide caused a similar inhibitory effect on I(Na). However, dihydro-C(6)-ceramide failed to modulate I(Na). The effect of C(6)-ceramide on I(Na) was abolished by intracellular infusion of the Ca(2+)-chelating agent, 1,2-bis (2-aminophenoxy) ethane-N, N, N9, N9-tetraacetic acid, but was mimicked by application of caffeine. Blocking the release of Ca(2+) from the sarcoplasmic reticulum with ryanodine receptor blocker induced a gradual increase in I(Na) amplitude and eliminated the effect of ceramide on I(Na). In contrast, the blocker of the inositol 1,4,5-trisphosphate-sensitive Ca(2+) receptor did not affect the action of C(6)-ceramide. Intracellular application of GTPgammaS also induced a gradual decrease in I(Na) amplitude, while GDPbetaS eliminated the effect of C(6)-ceramide on I(Na). Furthermore, the C(6)-ceramide effect on I(Na) was abolished after application of the phospholipase C (PLC) blockers and was greatly reduced by the calmodulin inhibitors. Fluorescence staining showed that C(6)-ceramide decreased cell viability and blocking I(Na) by tetrodotoxin did not mimic the effect of C(6)-ceramide, and inhibiting intracellular Ca(2+) release by dantrolene could not decrease the C(6)-ceramide-induced cell death. We therefore suggest that increased PLC-dependent Ca(2+) release through the ryanodine-sensitive Ca(2+) receptor may be responsible for the C(6)-ceramide-induced inhibition of I(Na), which does not seem to be associated with C(6)-ceramide-induced granule
Fung, Ka Wai; Wright, David W; Gor, Jayesh; Swann, Marcus J; Perkins, Stephen J
2016-12-01
During the activation of complement C4 to C4b, the exposure of its thioester domain (TED) is crucial for the attachment of C4b to activator surfaces. In the C4b crystal structure, TED forms an Arg 104 -Glu 1032 salt bridge to tether its neighbouring macroglobulin (MG1) domain. Here, we examined the C4b domain structure to test whether this salt bridge affects its conformation. Dual polarisation interferometry of C4b immobilised at a sensor surface showed that the maximum thickness of C4b increased by 0.46 nm with an increase in NaCl concentration from 50 to 175 mM NaCl. Analytical ultracentrifugation showed that the sedimentation coefficient s 20,w of monomeric C4b of 8.41 S in 50 mM NaCl buffer decreased to 7.98 S in 137 mM NaCl buffer, indicating that C4b became more extended. Small angle X-ray scattering reported similar R G values of 4.89-4.90 nm for C4b in 137-250 mM NaCl. Atomistic scattering modelling of the C4b conformation showed that TED and the MG1 domain were separated by 4.7 nm in 137-250 mM NaCl and this is greater than that of 4.0 nm in the C4b crystal structure. Our data reveal that in low NaCl concentrations, both at surfaces and in solution, C4b forms compact TED-MG1 structures. In solution, physiologically relevant NaCl concentrations lead to the separation of the TED and MG1 domain, making C4b less capable of binding to its complement regulators. These conformational changes are similar to those seen previously for complement C3b, confirming the importance of this salt bridge for regulating both C4b and C3b. © 2016 The Author(s).
Capture cross-section and rate of the 14 C (n, γ) 15 C reaction from ...
Indian Academy of Sciences (India)
We calculate the Coulomb dissociation of 15C on a Pb target at 68 MeV/u incident beam energy within the fully quantum mechanical distorted wave Born approximation formalism of breakup reactions. The capture cross-section and the subsequent rate of the 14C(, )15C reaction are calculated from the ...
Activity coefficients of NaF in (glucose+water) and (sucrose+water) mixtures at 298.15 K
Energy Technology Data Exchange (ETDEWEB)
Hernandez-Luis, Felipe [Departamento de Quimica Fisica, Universidad de La Laguna, Tenerife (Spain)]. E-mail: ffhelu@ull.es; Galleguillos, Hector R. [Departamento de Ingenieria Quimica, Universidad de Antofagasta, Antofagasta (Chile); Vazquez, Mario V. [Instituto de Quimica, Facultad de Ciencias Exactas y Naturales, Universidad de Antioquia, Medellin (Colombia)
2004-11-01
The activity coefficients of NaF in (glucose+water) and (sucrose+water) mixtures were experimentally determined at 298.15 K from electromotive force measurements of the following electrochemical cell containing two ion selective electrodes (ISEs):Na-ISE|NaF(m),sugar(Y),H2O(100-Y)|F-ISEThe molality (m) varied between ca. 0.01 mol.kg{sup -1} and saturation, while the mass fractions of sugar in the mixture (Y) were 0, 0.10, 0.20, 0.30 and 0.40. The values for electromotive force were analyzed using different models for describing the variations of the activity coefficients with concentration, including an extended Debye-Huckel, the Pitzer and the Scatchard equations. Results obtained with the different models were in good agreement. Once E{sup -}bar was determined, the mean coefficients of ionic activity for NaF, the free energy of transference from the water to the (sugar+water) mixture, and the primary NaF hydration number were calculated. The variation of these magnitudes with the composition of the mixture is comparative discussed in terms of the ion-solvent and ion-ion interactions with results from the literature for NaCl in (glucose+water) and (sucrose+water) systems.
Chen, Yanjun; Xu, Youlong; Sun, Xiaofei; Zhang, Baofeng; He, Shengnan; Li, Long; Wang, Chao
2018-02-01
A prospective NASICON-type F-doped Na3V2(PO4)2.93F0.07/C (F-0.07-NVP/C) composite is synthesized by a solid-state reaction method. F-doping can restrain the structural degradation from Na3V2(PO4)3 to V2(PO4)3 and enhance the structural stability. Meanwhile, it can decrease the particle size to diminish the pathway of Na+ diffusion, which can increase ionic conductivity efficiently. The kinetic behavior is significantly improved and it is beneficial to reinforcing the electrochemical performance of F-doping composites. Compared with Undoped-NVP/C sample, F-0.07-NVP/C composite delivers a 113 mAh g-1 discharge capacity at 10 mA g-1, which is very close to the theoretical capacity (117 mAh g-1). As for cycle performance, a reversible capacity of 97.8 mAh g-1 can be obtained and it retains 86% capacity after 1000 cycles at 200 mA g-1. F-0.07-NVP/C composite presents the highest DNa+ (2.62 × 10-15 cm2s-1), two orders of magnitude higher than the undoped sample (4.8 × 10-17 cm2s-1). This outstanding electrochemical performance is ascribed to the synergetic effect from improved kinetic behavior and enhanced structural stability due to F-doping. Hence, the F-doped composite would be a promising cathode material in SIB for energy storage and conversion.
Arctic sea ice at 1.5 and 2 °C
Screen, James A.
2018-05-01
In the Paris Agreement, nations committed to a more ambitious climate policy target, aiming to limit global warming to 1.5 °C rather than 2 °C above pre-industrial levels. Climate models now show that achieving the 1.5 °C goal would make a big difference for Arctic sea ice.
Directory of Open Access Journals (Sweden)
Garba Ibrahim Hassan
2006-09-01
Full Text Available OBJECTIVES: total serum vitamin C (L-ascorbic acid concentration was measured in 90 pregnant women, 30 in each trimester (age range 18-35 years and a control group of age-matched non-pregnant women. METHODS: total serum vitamin C concentration was measured using the 2.4-dinitrophenylhydrazine method which involves the conversion of vitamin C to dehydroascorbic acid in the presence of copper (II ions and subsequent measurement of the resulting bis-hydrazone at 540nm. RESULTS: the total vitamin C concentration in the first trimester was 2.55 ± 0.82 mg/dl and 2.32 ± 0.40 mg/dl and 0.77 ± 0.10 mg/dl in the second and third trimesters respectively. Relative to serum total vitamin C concentration in the controls (3.15 ± 0.13 mg/dl these values are significantly lower (p OBJETIVOS: a concentração sérica total de vitamina C (ácido 1-ascórbico foi medida em 90 mulheres grávidas sendo 30 em cada trimestre (idade de 18-35 anos e um grupo controle, pareado por idade, de mulheres não grávidas. MÉTODOS: a concentração sérica total de vitamina C foi medida usando o método 2.4-dinitrofenilhidrazina que envolve a conversão de vitama C a ácido dehidroascorbico na presença de íons cobre II e, em seguida, medindo a resultante bi-hidrazona em 540 nm. RESULTADOS: a concentração total de vitamina C no primeiro semestre foi de 2.55 ± 0,13 mg/dL e de 2,32 ± 0,40 mg/dL e 0,77 ± 0,10 mg/dL no segundo e terceiro trimestres, respectivamente. Estes valores são significativamente mais baixos do que nos controles (3,15 ± 0,13 mg/dL(p<0,05. CONCLUSÕES: reduzida concentração de vitamina C sérica na gestação pode indicar a sua utilização para retirar o excesso de espécies oxigênio-reativas e manter a homeostase normal. Assim, recomenda-se a suplementação de vitamina C na gestação para aumentar o seu baixo nível no organismo e previnir a predisposição para o baixo peso ao nascer, parto prematuro e pré-eclâmpsia, condições associadas
Solubilization of Na,K-ATPase from rabbit kidney outer medulla using only C12E8
Directory of Open Access Journals (Sweden)
H.L. Santos
2002-03-01
Full Text Available SDS, C12E8, CHAPS or CHAPSO or a combination of two of these detergents is generally used for the solubilization of Na,K-ATPase and other ATPases. Our method using only C12E8 has the advantage of considerable reduction of the time for enzyme purification, with rapid solubilization and purification in a single chromatographic step. Na,K-ATPase-rich membrane fragments of rabbit kidney outer medulla were obtained without adding SDS. Optimum conditions for solubilization were obtained at 4ºC after rapid mixing of 1 mg of membrane Na,K-ATPase with 1 mg of C12E8/ml, yielding 98% recovery of the activity. The solubilized enzyme was purified by gel filtration on a Sepharose 6B column at 4ºC. Non-denaturing PAGE revealed a single protein band with phosphomonohydrolase activity. The molecular mass of the purified enzyme estimated by gel filtration chromatography was 320 kDa. The optimum apparent pH obtained for the purified enzyme was 7.5 for both PNPP and ATP. The dependence of ATPase activity on ATP concentration showed high (K0.5 = 4.0 µM and low (K0.5 = 1.4 mM affinity sites for ATP, with negative cooperativity. Ouabain (5 mM, oligomycin (1 µg/ml and sodium vanadate (3 µM inhibited the ATPase activity of C12E8-solubilized and purified Na,K-ATPase by 99, 81 and 98.5%, respectively. We have shown that Na,K-ATPase solubilized only with C12E8 can be purified and retains its activity. The activity is consistent with the form of (alphaß2 association.
Extreme heat waves under 1.5 °C and 2 °C global warming
Dosio, Alessandro; Mentaschi, Lorenzo; Fischer, Erich M.; Wyser, Klaus
2018-05-01
Severe, extreme, and exceptional heat waves, such as those that occurred over the Balkans (2007), France (2003), or Russia (2010), are associated with increased mortality, human discomfort and reduced labour productivity. Based on the results of a very high-resolution global model, we show that, even at 1.5 °C warming, a significant increase in heat wave magnitude is expected over Africa, South America, and Southeast Asia. Compared to a 1.5 °C world, under 2 °C warming the frequency of extreme heat waves would double over most of the globe. In a 1.5 °C world, 13.8% of the world population will be exposed to severe heat waves at least once every 5 years. This fraction becomes nearly three times larger (36.9%) under 2 °C warming, i.e. a difference of around 1.7 billion people. Limiting global warming to 1.5 °C will also result in around 420 million fewer people being frequently exposed to extreme heat waves, and ~65 million to exceptional heat waves. Nearly 700 million people (9.0% of world population) will be exposed to extreme heat waves at least once every 20 years in a 1.5 °C world, but more than 2 billion people (28.2%) in a 2 °C world. With current emission trends threatening even the 2 °C target, our study is helpful to identify regions where limiting the warming to 1.5 °C would have the strongest benefits in reducing population exposure to extreme heat.
Energy Technology Data Exchange (ETDEWEB)
Hamano, A. (Sasebo College of Tehcnology, Nagasaki (Japan)); Kito, K. (Nippon Steel Chemical Co. Ltd., Tokyo (Japan))
1993-10-30
Sodium chlorate (NaOCl) aqueous solution is used widely as a bleach. Attempts have been made to extract crystals from this aqueous solution, but only with difficulty because of instability of the generated crystals. Generating Na3PO4 and solid solution has been attempted as a method to stabilize the crystals. The present study has prepared a phase equilibrium diagram for three components of NaOCl-Na3PO4-H2O at 5[degree]C and 10[degree]C for theoretical elucidation thereof. In the prepared diagram, the conjugate lines linking the saturated solution with the solution containing solid phase have not crossed at one point, but scattered on the solid phase line. This has made clear that no double salt has been generated, but solid solution has been produced. The mol ratio of NaOCl in the generated solid solution was 0.071 to 0.447 at 15[degree]C and 0.026 to 0.6 at 5[degree]C indicating that solid solution with composition of wider range than in literatures reported conventionally has been produced. 8 refs., 2 figs., 2 tabs.
Directory of Open Access Journals (Sweden)
EVANGELISTA REGINA MARTA
2002-01-01
Full Text Available Mangas 'Tommy Atkins' produzidas na região de Ibirá, São Paulo, foram pulverizadas na pré-colheita com cloreto de cálcio, nas concentrações de 0,0%, 2,5% e 5,0%, em três épocas de seu desenvolvimento (40; 60 e 90 dias após a floração a fim de verificar a influência do cálcio na estrutura da parede celular destes frutos através de microscopia eletrônica de transmissão, imediatamente após a colheita e depois de 35 dias de armazenamento. Para fixar o material da polpa, utilizou-se metodologia descrita por Jacob e Gowanlock (1995. Nas condições experimentais, verificou-se que os frutos do tratamento-controle (sem cloreto de cálcio, no dia da colheita, já apresentavam desestruturação da parede celular e dissolução da lamela média (LM. A degradação da parede celular ocorre inicialmente na LM, levando à formação de espaços vazios bastante distintos, apresentando uma dissolução ainda maior, com o armazenamento prolongado (35 dias. Os frutos tratados com cloreto de cálcio a 5,0% apresentaram uma LM bem definida e ausência de espaços vazios, mesmo após o armazenamento, mostrando ser uma concentração efetiva na preservação da lamela média.
Martin, Gary E; Hilton, Bruce D; Irish, Patrick A; Blinov, Kirill A; Williams, Antony J
2007-10-01
Utilization of long-range (1)H--(15)N heteronuclear chemical shift correlation has continually grown in importance since the first applications were reported in 1995. More recently, indirect covariance NMR methods have been introduced followed by the development of unsymmetrical indirect covariance processing methods. The latter technique has been shown to allow the calculation of hyphenated 2D NMR data matrices from more readily acquired nonhyphenated 2D NMR spectra. We recently reported the use of unsymmetrical indirect covariance processing to combine (1)H--(13)C GHSQC and (1)H--(15)N GHMBC long-range spectra to yield a (13)C--(15)N HSQC-HMBC chemical shift correlation spectrum that could not be acquired in a reasonable period of time without resorting to (15)N-labeled molecules. We now report the unsymmetrical indirect covariance processing of (1)H--(13)C GHMBC and (1)H--(15)N IMPEACH spectra to afford a (13)C--(15)N HMBC-IMPEACH spectrum that has the potential to span as many as six to eight bonds. Correlations for carbon resonances long-range coupled to a protonated carbon in the (1)H--(13)C HMBC spectrum are transferred via the long-range (1)H--(15)N coupling pathway in the (1)H--(15)N IMPEACH spectrum to afford a much broader range of correlation possibilities in the (13)C--(15)N HMBC-IMPEACH correlation spectrum. The indole alkaloid vincamine is used as a model compound to illustrate the application of the method. (c) 2007 John Wiley & Sons, Ltd.
Directory of Open Access Journals (Sweden)
Wayan Bebas
2015-08-01
Full Text Available The aims of this study were to determine the viability and motility of Landrace pig’sspermatozoa in the Beltsville Thawing Solution (BTS diluent with addition vitamin C which werestored at a temperature of 15ºC. During the storage process, metabolic activity of spermatozoaproduce free radicals that can reduce the viability and motility of spermatozoa thus it needs theaddition of antioxidants. Vitamin C is an antioxidant that can be used to scavengethe free radicals.This study used vitamin C added into the BTS diluent with scavenge dose is 0.1 mg/ml, 0.2 mg/mland a dose of 0.3 mg/ml. The results showed that a dose of 0.1 mg/ml is the best dose to maintainthe viability and motility of Landrace pigs spermatozoa were storage at a temperature of 15ºC.
LASERTERAPIA NA INFLAMAÇÃO PULMONAR EXPERIMENTAL EM RATTUS NORVEGICUS OCASIONADO PELA PAPAÍNA
Directory of Open Access Journals (Sweden)
Diego Rodrigues Pessoa
2017-01-01
Full Text Available Resumo: A Doença Pulmonar Obstrutiva Crônica (DPOC é caracterizada pela limitação do fluxo aéreo decorrente da dilatação dos espaços aéreos distais aos bronquíolos terminais. Analisar os efeitos da laserterapia quanto ao processo cicatricial na lesão pulmonar experimental em Rattus Novergicus. Utilizaram-se trinta animais agrupados em três grupos de dez animais: grupo controle (GC (não recebeu nada, grupo DPOC (GD (foi pulverizado 3 doses de papaína 3mg/kg e grupo DPOC + Laser (GDL (após 7 dias da indução da lesão com papaína foi tratado com laser de 660 nm durante 15 dias.Para analise dos resultados foi realizado o lavado broncoalveolar. Quanto ao Lavado: GC (número de células normais, GD (aumento de células inflamatórias e GDL (diminuição de células inflamatórias. A laserterapia diminui o numero de células inflamatórias, entretanto, não possui efeito reconstrutor do parênquima pulmonar apenas estabiliza a lesão comprovando sua ação anti-inflamatória.
Energy Technology Data Exchange (ETDEWEB)
Bouziane, M. [Laboratoire de Chimie du Solide Appliquée, Faculté des Sciences, Université Mohammed V-Agdal, Avenue Ibn Batouta, BP 1014 Rabat (Morocco); Taibi, M., E-mail: taibiens@yahoo.fr [Laboratoire de Physico-Chimie des Matériaux (LAF 502), Ecole Normale Supérieure, Université Mohammed V-Agdal, BP 5118 Rabat (Morocco); Boukhari, A. [Laboratoire de Chimie du Solide Appliquée, Faculté des Sciences, Université Mohammed V-Agdal, Avenue Ibn Batouta, BP 1014 Rabat (Morocco)
2013-11-15
Electrical properties of Pb{sub 2}Na{sub 0.8}Eu{sub 0.2}Nb{sub 4.8}Fe{sub 0.2}O{sub 15} tungsten bronze compound were investigated. Ferroelectric phase transition of diffuse type is observed at 395 °C. Conductivity study as a function of temperature (RT-600 °C) and at three different frequencies (10, 100 and 1000 kHz) suggests the existence of dominant ionic conduction. The rise of ac conductivity on increasing temperature supports the NTCR (negative temperature coefficient of resistance) behaviour of the material. The activation energies have been evaluated from ac conductivity using Arrhenius equation and discussed. Different conduction mechanisms were identified. For comparison, the conducting properties of Pb{sub 2}Na{sub 0.8}R{sub 0.2}Nb{sub 4.8}Fe{sub 0.2}O{sub 15} (R=Dy, Nd, La) were also investigated. - Graphical abstract: Thermal evolution of lnσ{sub ac} of Pb{sub 2}Na{sub 0.8}Eu{sub 0.2}Nb{sub 4.8}Fe{sub 0.2}O{sub 15} at selected frequencies. Display Omitted - Highlights: • We found that TB compounds exhibit a diffuse type of first- order transition. • A negative temperature coefficient of resistance (NTCR) behaviour is observed. • Three conduction mechanisms were identified: n-and/or p-type at low temperatures. • The conduction mechanism in the studied compounds is very complex.
Ferroelectric domain structures in -oriented K0.15Na0.85NbO3 lead-free single crystal
Directory of Open Access Journals (Sweden)
Yan Chen
2015-03-01
Full Text Available In this work, ferroelectric domain structures of -oriented K0.15Na0.85NbO3 single crystal are characterized. Transmission electron microscopy (TEM observation revealed high-density of laminate domain structures in the crystal and the lattices of the neighboring domains are found to be twisted in a small angle. Superlattice diffraction spots of 1 2 { eeo } and 1 2 { ooe } in electron diffraction patterns are observed in the crystal, revealing the a+a+c− tilting of oxygen octahedral in the perovskite structure. The piezoresponse of domains and in-situ poling responses of K0.15Na0.85NbO3 crystal are observed by piezoresponse force microscopy (PFM, and the results assure its good ferroelectric properties.
Directory of Open Access Journals (Sweden)
Jesús Orlando Yepes
2006-06-01
Full Text Available Introducción. El virus de la hepatitis C se asocia a diversas hepatopatías como hepatitis aguda, hepatitis crónica, esteatosis, cirrosis y carcinoma hepatocelular. Numerosos estudios han explorado mecanismos virales implicados en el establecimiento de la infección persistente y en las propiedades oncogénicas e inmunomoduladoras de la proteína core del virus de la hepatitis C. Las investigaciones orientadas a evaluar los cambios en la expresión de genes celulares endógenos inducidos por la proteína core son importantes para identificar genes candidatos responsables de los mecanismos de patogenicidad del virus de la hepatitis C. Objetivos. Comparar perfiles de expresión e identificar genes celulares endógenos en la línea celular derivada de carcinoma hepatocelular humano, HepG2, con expresión transitoria de la proteína core del virus de la hepatitis C. Materiales y métodos. Se utilizó la técnica de presentación diferencial de ARN mensajero por RT-PCR en células HepG2 con y sin expresión transitoria de la proteína core del virus de la hepatitis C o de la proteína verde fluorescente, obtenidas previamente con el sistema de expresión del Semliki Forest Virus, mediante transducción de partículas recombinantes rSFVCore o rSFV-GFP. Resultados. Se observaron diferencias en las intensidades de las bandas de ARNm expresadas en células HepG2 transducidas con rSFV-Core comparadas con células sin transducir y trasducidas con rSFV-GFP. Un ARNm de 258 pb expresado diferencialmente en células HepG2 transducidas con rSFV-Core fue clonado e identificado como selenocisteína liasa. Conclusión. Los resultados confirman que la expresión de la proteína core del virus de la hepatitis C se asocia con cambios en la expresión de ARN mensajeros específicos, incluido al gen selenocisteina liasa, el cual puede estar involucrado en la fisiopatología del carcinoma hepatocelular.
Long-term adaptation of methanol-fed thermophilic (55°C) sulfate-reducing reactors to NaCl
Vallero, M.V.G.; Lettinga, G.; Lens, P.N.L.
2003-01-01
A laboratory-scale upflow anaerobic sludge bed (UASB) reactor was operated during 273 days at increasing NaCl concentrations (0.5-12.5 g NaCl l(-1)) to assess whether the stepwise addition of the salt NaCl results in the acclimation of that sludge. The 6.5-1 thermophilic (55 degreesC), sulfidogenic
Distribution of spin dipole transition strength in the 15N(n,p)15C reaction
International Nuclear Information System (INIS)
Cellar, A.; Alford, W.P.; Helmer, R.; Abegg, R.; Frekers, D.; Haeusser, O.; Henderson, R.S.; Jackson, K.P.; Vetterli, M.; Yen, S.; Jeppesen, R.; Larson, B.; Mildenberger, J.; Pointon, B.W.; Trudel, A.
1990-08-01
The reaction 15 N(n,p) 15 C was studied at a neutron energy of 288 MeV using the TRIUMF (n,p) charge exchange facility and a high pressure gas target. The angular distributions for spin dipole (ΔL=1) transitions to the states in 15 C at energies 0 MeV and 0.740 MeV, as well as for higher excitation energies, were measured and the results were compared with DWIA calculations. The measured distribution of the spin dipole strength agrees well with shell model predictions, indicating that a rather simple model provides a satisfactory description of the 15 N ground state, and of positive parity states in 15 C up to about 18 MeV excitation. The magnitude of the peak cross sections (at ≅ 7 degrees) is described well by the calculations when the theoretical cross section is renormalized by a factor 0.7. The calculated cross sections near zero degrees are generally smaller than experimental data. It this is a general feature of ΔL=1 transitions, it suggests that estimates of GT strength based on a multipole decomposition of measured cross sections may be too high. (Author) (41 refs., 3 tabs., 14 figs.)
The influence of Na2O on the hydration of C3A II. Suspension hydration
Spierings, G.A.C.M.; Stein, H.N.
1976-01-01
The influence of Na2O on the hydration of C3A was studied in suspensions from the start of the reaction onwards. The heat evolution rate in very early stages of the hydration, measured at varying NaOH concentrations, and SEM, indicate that at NaOH concentrations larger then 0.1 M the reaction
International Nuclear Information System (INIS)
Denhoefer, G.
1980-01-01
In this thesis different aspects of the reaction 12 C + 12 C were studied. The first part deals with high spin states in the mirror nucki 23 Na and 23 Mg experially with the states resonantly populated at Esub(cm) = 19.3 MeV. For the state at 9.80 MeV in 23 Na with (p,γ) angular correlation measurements a spin of 17/2 + and by Doppler form analysis a lifetime of (21 +- 9)fs was found. The probably analogous state at 9.61 MeV in 23 Mg decays both under p-emission to 22 Na and under γ-emission. Because of the p-decay probabilities to 3 + and 4 + of 22 Na, which were observed in (p,n) coincidence measurements, it has also the spin 17/2 + . In the second part of this thesis it was studied whether the reaction 12 C + 12 C at incident energies between 26 MeV and 42 MeV can be described using the statistical model. (orig./HSI) [de
3D organic Na4C6O6/graphene architecture for fast sodium storage with ultralong cycle life.
Gu, Jianan; Gu, Yue; Yang, Shubin
2017-11-23
Sodium-ion batteries (SIBs) have aroused increasing interest as one of the most promising replacements for lithium-ion batteries (LIBs). Here, a novel organic-inorganic 3D Na 4 C 6 O 6 -graphene architecture was successfully fabricated from commercial Na 2 C 6 O 6 and for the first time applied for sodium storage. Hence, the 3D Na 4 C 6 O 6 -graphene architecture exhibits a high reversible capacity, good cyclic performance and high-rate capability for sodium storage.
Energy Technology Data Exchange (ETDEWEB)
Zheng, Shili, E-mail: slzheng@ipe.ac.cn [National Engineering Laboratory for Hydrometallurgical Cleaner Production Technology, Key Laboratory of Green Process and Engineering, Institute of Process Engineering, Chinese Academy of Sciences, Beijing (China); Wang, Xinran; Yan, Hong [National Engineering Laboratory for Hydrometallurgical Cleaner Production Technology, Key Laboratory of Green Process and Engineering, Institute of Process Engineering, Chinese Academy of Sciences, Beijing (China); University of Chinese Academy of Sciences, No. 19A Yuquan Road, Beijing (China); Du, Hao; Zhang, Yi [National Engineering Laboratory for Hydrometallurgical Cleaner Production Technology, Key Laboratory of Green Process and Engineering, Institute of Process Engineering, Chinese Academy of Sciences, Beijing (China)
2016-09-15
Highlights: • Nanostructured Na{sub 1.08}V{sub 6}O{sub 15} was synthesized through additive-free sol-gel process. • Prepared Na{sub 1.08}V{sub 6}O{sub 15} demonstrated high capacity and sufficient cycling stability. • The reaction temperature was optimized to allow scalable Na{sub 1.08}V{sub 6}O{sub 15} fabrication. - Abstract: Developing high-capacity cathode material with feasibility and scalability is still challenging for lithium-ion batteries (LIBs). In this study, a high-capacity ternary sodium vanadate compound, nanostructured NaV{sub 6}O{sub 15}, was template-free synthesized through sol-gel process with high producing efficiency. The as-prepared sample was systematically post-treated at different temperature and the post-annealing temperature was found to determine the cycling stability and capacity of NaV{sub 6}O{sub 15}. The well-crystallized one exhibited good electrochemical performance with a high specific capacity of 302 mAh g{sup −1} when cycled at current density of 0.03 mA g{sup −1}. Its relatively long-term cycling stability was characterized by the cell performance under the current density of 1 A g{sup −1}, delivering a reversible capacity of 118 mAh g{sup −1} after 300 cycles with 79% capacity retention and nearly 100% coulombic efficiency: all demonstrating its significant promise of proposed strategy for large-scale synthesis of NaV{sub 6}O{sub 15} as cathode with high-capacity and high energy density for LIBs.
International Nuclear Information System (INIS)
Culbert, P.A.; Jianming Lu; Adam, M.J.
1997-01-01
The synthesis of methyl 15-(4-trimethylstannylphenyl)pentadecanoate (p-SnPPA), a precursor for the regiospecific production of 15-(4-[ 123 I]-iodophenyl)pentadecanoic acid, is described. The stannylated precursor is synthesized in six steps from 4-bromophenylacetylene in an overall yield of 16%. p-SnPPA reacts with N.C.A. [ 123 I]NaI in the presence of peracetic acid to yield IPPA in 62% radiochemical yield following hydrolysis. (author)
Costa Neto, João Moreira da; Teixeira, Raquel Graça; Sá, Marcelo Jorge Cavalcanti de; Lima, Alessandra Estrela da Silva; Jacinto Aragão, Glauber Sergio; Teixeira, Marcelo Weinstein; Martins Filho, Emanoel Ferreira; Toríbio, Júlia Morena de Miranda Leão; Azevedo, Adílio Santos de
2010-01-01
Foi avaliada, em cães, a influência da farinha de algas marinhas (Lithothamnium calcareum) como suplemento mineral na cicatrização de falha óssea cortical reconstituída com autoenxerto cortical. Foram utilizados dez cães adultos, machos, sem raça definida, com peso entre 10 e 15kg. O enxerto, constituído de um bloco cilíndrico de osso cortical foi obtido da diáfise proximal da ulna, mediante ostectomia com trefina de oito milímetros de diâmetro. Igualmente criada...
Australian climate extremes at 1.5 °C and 2 °C of global warming
King, Andrew D.; Karoly, David J.; Henley, Benjamin J.
2017-06-01
To avoid more severe impacts from climate change, there is international agreement to strive to limit warming to below 1.5 °C. However, there is a lack of literature assessing climate change at 1.5 °C and the potential benefits in terms of reduced frequency of extreme events. Here, we demonstrate that existing model simulations provide a basis for rapid and rigorous analysis of the effects of different levels of warming on large-scale climate extremes, using Australia as a case study. We show that limiting warming to 1.5 °C, relative to 2 °C, would perceptibly reduce the frequency of extreme heat events in Australia. The Australian continent experiences a variety of high-impact climate extremes that result in loss of life, and economic and environmental damage. Events similar to the record-hot summer of 2012-2013 and warm seas associated with bleaching of the Great Barrier Reef in 2016 would be substantially less likely, by about 25% in both cases, if warming is kept to lower levels. The benefits of limiting warming on hydrometeorological extremes are less clear. This study provides a framework for analysing climate extremes at 1.5 °C global warming.
Zhang, Xin; Liu, Yongfeng; Wang, Ke; Li, You; Gao, Mingxia; Pan, Hongge
2015-12-21
A nanocrystalline CeO2@C-containing NaAlH4 composite is successfully synthesized in situ by hydrogenating a NaH-Al mixture doped with CeO2@C. Compared with NaAlH4 , the as-prepared CeO2@C-containing NaAlH4 composite, with a minor amount of excess Al, exhibits significantly improved hydrogen storage properties. The dehydrogenation onset temperature of the hydrogenated [NaH-Al-7 wt % CeO2@C]-0.04Al sample is 77 °C lower than that of the pristine sample because of a reduced kinetic barrier. More importantly, the dehydrogenated sample absorbs ∼4.7 wt % hydrogen within 35 min at 100°C and 10 MPa of hydrogen. Compositional and structural analyses reveal that CeO2 is converted to CeH2 during ball milling and that the newly formed CeH2 works with the excess of Al to synergistically improve the hydrogen storage properties of NaAlH4. Our findings will aid in the rational design of novel catalyst-doped complex hydride systems with low operating temperatures, fast kinetics, and long-term cyclability. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
International Nuclear Information System (INIS)
Leilei, Zhang; Hejun, Li; Kezhi, Li; Shouyang, Zhang; Qiangang, Fu; Yulei, Zhang; Jinhua, Lu; Wei, Li
2014-01-01
Highlights: • CSH coatings were prepared by combination of magnetron sputter ion plating, CVD and UECD. • Na + and CO 3 2− were developed to co-substitute hydroxyapatite. • SiC nanowires were introduced into Na-doped carbonated hydroxyapatite. • CSH coatings showed excellent cell activity and cell proliferation behavior. - Abstract: A carbon/SiC nanowire/Na-doped carbonated hydroxyapatite multilayer coating (CSH coating) was prepared on carbon/carbon composites using a combination method of magnetron sputter ion plating, chemical vapor deposition and ultrasound-assisted electrochemical deposition procedure. The morphology, microstructure and chemical composition of the coating were investigated by scanning electron microscopy (SEM), energy dispersive spectroscopy (EDS), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), Raman spectroscopy and X-ray photoelectron spectroscopy (XPS). The results showed that the CSH coating was consisted of three components: carbon layer, SiC nanowires and Na-doped carbonated hydroxyapatite. The carbon layer provided a dense and uniform surface structure for the growth of SiC nanowires. The SiC nanowires exhibited a porous structure, favoring the infiltration of Na-doped carbonated hydroxyapatite crystals. The Na-doped carbonated hydroxyapatite could infiltrate into the pores of SiC nanowires and finally cover the SiC nanowires entirely with a needle shape. The osteoblast-like MG63 cells were employed to assess the in vitro biocompatibility of the CSH coating. The MG63 cells favorably spread and grew well across the CSH coating surface with plenty of filopods and microvilli, exhibiting excellent cell activity. Moreover, the CSH coating elicited higher cell proliferation as compared to bare carbon/carbon composites. In conclusion, the CSH offers great potential as a coating material for future medical application in hard tissue replacement
Energy Technology Data Exchange (ETDEWEB)
Leilei, Zhang, E-mail: zhangleilei1121@aliyun.com; Hejun, Li; Kezhi, Li; Shouyang, Zhang; Qiangang, Fu; Yulei, Zhang; Jinhua, Lu; Wei, Li
2014-09-15
Highlights: • CSH coatings were prepared by combination of magnetron sputter ion plating, CVD and UECD. • Na{sup +} and CO{sub 3}{sup 2−} were developed to co-substitute hydroxyapatite. • SiC nanowires were introduced into Na-doped carbonated hydroxyapatite. • CSH coatings showed excellent cell activity and cell proliferation behavior. - Abstract: A carbon/SiC nanowire/Na-doped carbonated hydroxyapatite multilayer coating (CSH coating) was prepared on carbon/carbon composites using a combination method of magnetron sputter ion plating, chemical vapor deposition and ultrasound-assisted electrochemical deposition procedure. The morphology, microstructure and chemical composition of the coating were investigated by scanning electron microscopy (SEM), energy dispersive spectroscopy (EDS), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), Raman spectroscopy and X-ray photoelectron spectroscopy (XPS). The results showed that the CSH coating was consisted of three components: carbon layer, SiC nanowires and Na-doped carbonated hydroxyapatite. The carbon layer provided a dense and uniform surface structure for the growth of SiC nanowires. The SiC nanowires exhibited a porous structure, favoring the infiltration of Na-doped carbonated hydroxyapatite crystals. The Na-doped carbonated hydroxyapatite could infiltrate into the pores of SiC nanowires and finally cover the SiC nanowires entirely with a needle shape. The osteoblast-like MG63 cells were employed to assess the in vitro biocompatibility of the CSH coating. The MG63 cells favorably spread and grew well across the CSH coating surface with plenty of filopods and microvilli, exhibiting excellent cell activity. Moreover, the CSH coating elicited higher cell proliferation as compared to bare carbon/carbon composites. In conclusion, the CSH offers great potential as a coating material for future medical application in hard tissue replacement.
Arctic Sea Ice in a 1.5°C Warmer World
Niederdrenk, Anne Laura; Notz, Dirk
2018-02-01
We examine the seasonal cycle of Arctic sea ice in scenarios with limited future global warming. To do so, we analyze two sets of observational records that cover the observational uncertainty of Arctic sea ice loss per degree of global warming. The observations are combined with 100 simulations of historical and future climate evolution from the Max Planck Institute Earth System Model Grand Ensemble. Based on the high-sensitivity observations, we find that Arctic September sea ice is lost with low probability (P≈ 10%) for global warming of +1.5°C above preindustrial levels and with very high probability (P> 99%) for global warming of +2°C above preindustrial levels. For the low-sensitivity observations, September sea ice is extremely unlikely to disappear for +1.5°C warming (P≪ 1%) and has low likelihood (P≈ 10%) to disappear even for +2°C global warming. For March, both observational records suggest a loss of 15% to 20% of Arctic sea ice area for 1.5°C to 2°C global warming.
Projected drought risk in 1.5°C and 2°C warmer climates
Lehner, F.; Coats, S.; Stocker, T. F.; Pendergrass, A. G.; Sanderson, B. M.; Raible, C.; Smerdon, J. E.
2017-12-01
The large socioeconomic costs of droughts make them a crucial target for impact assessments of climate change scenarios. Using multiple drought metrics and a set of simulations with the Community Earth System Model (CESM) targeting 1.5°C and 2°C above preindustrial global mean temperatures, we investigate changes in aridity and the risk of consecutive drought years. The latter metric is motivated by recent droughts in California and the US Southwest in general, where consecutive years of moderate precipitation deficit can quickly lead to significant drought and elevated pressure on water resources. If warming is limited to 2°C, these simulations suggest little change in drought risk for the U.S. Southwest and Central Plains compared to present day, an interesting result that arises from a delicate balance between increases in evaporative demand and precipitation in CESM in that region. In the Mediterranean, central Europe, and a number of other regions across the globe, however, drought risk increases significantly for both 1.5°C and 2°C warming targets, and the additional 0.5°C of the 2°C climate leads to significantly higher drought risk. Our study suggests that limiting anthropogenic warming to 1.5°C rather than 2°C, as aspired to by the Paris Climate Agreement, may have benefits for future drought risk but that such benefits may be regional and in some cases highly uncertain. We will therefore also discuss the robustness of results across different drought metrics as well as the model uncertainties associated with drought projections for low warming targets.
Directory of Open Access Journals (Sweden)
Gislaine Iachstel Manetta
2011-09-01
Full Text Available The present study investigates the ƒÂ13C and ƒÂ15N isotopic composition in frozen samples (control, samples in alcohol and in formaldehyde of Plagioscion squamosissimus and Hypophthalmus edentatus. From each individual we extracted a strip of muscle from the region above the lateral line, in the dorsal fin base, that was divided into three equal parts, each one was submitted to one type of treatment: freeze . control group (-15oC, conservation in alcohol 70%and fixation in formaldehyde 4%. Samples were kept under those treatments for 30 days, washed and submerged in distilled water for 4 hours. Afterwards, they were dried up in air oven at 60oC for 48 hours and macerated until the obtaining of a fine powder. A significant difference was found in isotopic values of carbon and nitrogen, between the control and the samples in alcohol and formaldehyde, except for ƒÂ13C from the H. edentatus samples in formaldehyde. The carbon isotopic values of samples in alcohol were mostly enriched compared to control, whereas the samples in formaldehyde presented depleted values in relation to the control. The nitrogen isotopic values for both samples preserved in alcohol and formaldehyde were enriched when compared to the values of frozen samples, independently of used preservatives. Therefore, the isotopic correction should be accomplished according to the isotope and preservative employed for species of freshwater fish.O presente estudo investiga a composicao isotopica de ƒÂ13C e ƒÂ15N entre as amostras congeladas (controle, em alcool e em formol de Plagioscion squamosissimus e Hypophthalmus edentatus. De cada individuo foi extraida uma faixa de musculo localizada na regiao acima da linha lateral, na base da nadadeira dorsal, a qual foi subdividida em tres partes iguais, sendo cada uma delas submetida a um tipo de tratamento: congelamento - grupo control (-15oC, conservacao em alcool 70% e fixacao em formol 4%. As amostras foram mantidas nos
Complete fusion of the 12C+12O, 14N+12C and 15N+12C systems
International Nuclear Information System (INIS)
Conjeaud, M.; Gary, S.; Harar, S.; Wieleczko, J.P.
1978-01-01
Cross sections for evaporation residues following the complete fusion of the 12 C+ 12 C, 14 N+ 12 C and 15 N+ 12 C systems have been measured with a E-ΔE counter telescope in a wide range of incident energies. They are fairly well reproduced by evaporation calculations based on the statistical theory. The total fusion excitation function of the 12 C+ 12 C system shows strong structure, which is compared to the predictions of the reaction cross sections derived from coupled channel calculations and to the integrated inelastic cross sections. Critical angular momenta have been obtained from the fusion cross-section data and these values are discussed in the framework of compound nucleus and entrance channel effects. A striking difference is observed between the fusion cross sections of the 14 N+ 12 C and 15 N+ 12 C systems and shows the importance of the valence nucleons of colliding ions in the fusion process. A possible interpretation might be the influence of the yrast line of the compound nuclei. (Auth.)
Vallero, M.V.G.; Hulshoff Pol, L.W.; Lettinga, G.; Lens, P.N.L.
2003-01-01
The effect of NaCl on thermophilic (55degreesC) methanol conversion in the presence of excess of sulfate (COD/SO42-=0.5) was investigated in two 6.5L lab-scale upflow anaerobic sludge bed reactors inoculated with granular sludge previously not adapted to NaCl
The effect of NaCl on thermophilic
Giraldo, Esther; Hinchado, María D; Ortega, Eduardo
2013-09-01
Extracellular heat shock proteins of 72 kDa (eHsp72) and noradrenaline (NA) can act as "danger signals" during exercise-induced stress by activating neutrophil function (chemotaxis, phagocytosis, and fungicidal capacity). In addition, post-exercise concentrations of NA increase the expression and release of Hsp72 by human neutrophils, and adrenoreceptors and cAMP are involved in the stimulation of neutrophils by eHsp72. This suggests an interaction between the two molecules in the modulation of neutrophils during exercise-induced stress. Given this context, the aim of the present investigation was to study the combined activity of post-exercise circulating concentrations of NA and eHsp72 on the neutrophil phagocytic process, and to evaluate the role of cAMP as intracellular signal in these effects. Results showed an accumulative stimulation of chemotaxis induced by NA and eHsp72. However, while NA and eHsp72, separately, stimulate the phagocytosis and fungicidal activity of neutrophils, when they act together they do not modify these capacities of neutrophils. Similarly, post-exercise concentrations of NA and eHsp72 separately increased the intracellular level of cAMP, but NA and eHsp72 acting together did not modify the intracellular concentration of cAMP. These results confirm that cAMP can be involved in the autocrine/paracrine physiological regulation of phagocytosis and fungicidal capacity of human neutrophils mediated by NA and eHsp72 in the context of exercise-induced stress. Copyright © 2013 Wiley Periodicals, Inc.
Energy Technology Data Exchange (ETDEWEB)
McCleskey, M; Mukhamedzhanov, A M; Trache, L; Tribble, R E; Banu, A; Eremenko, V; Goldberg, V Z; Lui, Y W; McCleskey, E; Roeder, B T; Spiridon, A; Carstoiu, F; Burjan, V; Hons, Z; Thompson, I J
2014-04-17
The 14C + n <--> 15C system has been used as a test case in the evaluation of a new method to determine spectroscopic factors that uses the asymptotic normalization coefficient (ANC). The method proved to be unsuccessful for this case. As part of this experimental program, the ANCs for the 15C ground state and first excited state were determined using a heavy-ion neutron transfer reaction as well as the inverse kinematics (d,p) reaction, measured at the Texas A&M Cyclotron Institute. The ANCs were used to evaluate the astrophysical direct neutron capture rate on 14C, which was then compared with the most recent direct measurement and found to be in good agreement. A study of the 15C SF via its mirror nucleus 15F and a new insight into deuteron stripping theory are also presented.
Passivity of alloy C-22 in NaCl solutions
International Nuclear Information System (INIS)
Rodriguez, Martin A.; Carranza, Ricardo M.
2004-01-01
Alloy C-22 has been proposed as the corrosion resistant barrier of high-level waste nuclear containers. This alloy must be resistant to corrosion in multi-ionic solutions for a period of time as long as 10,000 years. The aim of the present work was to study the corrosion behavior of alloy C-22 in NaCl solutions. General and crevice corrosion were studied by means of electrochemical techniques. Open circuit potential was measured over the time, electrochemical impedance spectroscopy (EIS) measurements were carried out at open circuit and passivity potentials, as well as cyclic potentiodynamic polarization curves. Corrosion rates obtained by EIS measurements were acceptable for a waste nuclear container ( P ) values increased with open circuit potential and polarization time at constant potential. This was attributed to an increase in oxide film thickness and its aging respectively. The passive oxide form on alloy C-22 at the studied conditions presented a n-type semiconductor behavior in the passive potential range. Repassivation potential values (E R1 ) were determined for alloy C-22 at the studied conditions using PCA probes. (author) [es
Energy Technology Data Exchange (ETDEWEB)
Ge, Jianbang; Wang, Shuai; Zhang, Feng; Zhang, Long; Jiao, Handong [State Key Laboratory of Advanced Metallurgy, University of Science and Technology Beijing, Beijing, 100083 (China); Zhu, Hongmin [Department of Metallurgy, Materials Science, and Materials Processing, Tohoku University, Sendai 980-8579 (Japan); Jiao, Shuqiang, E-mail: sjiao@ustb.edu.cn [State Key Laboratory of Advanced Metallurgy, University of Science and Technology Beijing, Beijing, 100083 (China)
2015-08-30
Highlights: • The electrodeposition of carbon films with a Mo{sub 2}C interlayer. • Carbon diffusion engenders the formation of Mo{sub 2}C interlayer. • The Mo{sub 2}C interlayer has a good adhesion. - Abstract: The electrodeposition of carbon films with a Mo{sub 2}C interlayer was investigated in LiCl-NaCl-Na{sub 2}CO{sub 3} melts at 900 °C. Cyclic voltammetry was applied to study the electrochemical reaction mechanism on Mo and Pt electrodes, indicating that, two reduction reactions including carbon deposition and carbon monoxide evolution, may take place on the two electrodes simultaneously during the cathodic sweep. Carbon films with a continuous Mo{sub 2}C interlayer were prepared by constant voltage electrolysis, showing a good adhesion between Mo substrate and carbon films. The carbon films with a Mo{sub 2}C interlayer were characterized using X-ray diffraction measurement, Raman spectroscopy, scanning electron microscopy and transmission electron microscopy. The results reveal that carbon materials deposited on the electrodes are mainly composed of graphite and carbon diffusion in Mo (or Mo{sub 2}C) leads to the formation and growth of Mo{sub 2}C interlayer.
Schleussner, C. F.
2016-12-01
Robust appraisals of climate impacts at different levels of global-mean temperature increase are vital to guide assessments of dangerous anthropogenic interference with the climate system. By establishing 1.5°C as the long term temperature limit for global average temperature increase and inviting a special report of the IPCC on the impacts of 1.5°C, the Paris Agreement has put such assessments high on the post-Paris science agenda. Here I will present recent findings of climate impacts at 1.5°C, including extreme weather events, water availability, agricultural yields, sea-level rise and risk of coral reef loss. In particular, I will present findings from a recent study that attempts to differentiate between such impacts at warming levels of 1.5°¸C and 2°C above pre-industrial (Schleussner et al., 2016). By analyzing changes in indicators for 26 world regions as applicable, the study found regional dependent differences between a 1.5°C and 2°C warming. Regional hot-spots of change emerge with tropical regions bearing the brunt of the impacts of an additional 0.5°C warming. These findings highlight the importance of regional differentiation to assess both future climate risks and different vulnerabilities to incremental increases in global-mean temperature. Building on that analysis, I will discuss limitations of existing approaches to differentiate between warming levels and outline opportunities for future work on refining our understanding of the difference between impacts at 1.5°C and 2°C warming. ReferencesSchleussner, C.-F. et al. Differential climate impacts for policy relevant limits to global warming: the case of 1.5°C and 2°C. Earth Syst. Dyn. 7, 327-351 (2016).
Electrochemical Deposition of Aluminum from NaCl-AlCl3 Melts
DEFF Research Database (Denmark)
Li, Qingfeng; Hjuler, H. A.; Berg, Rolf W.
1990-01-01
Electrochemical deposition of aluminum from NaAlCl4 melts saturated with NaCl onto a glassy carbon electrode at175°C has been studied by voltammetry, chronoamperometry, and constant current deposition. The deposition of aluminumwas found to proceed via a nucleation/growth mechanism, and the nucle......Electrochemical deposition of aluminum from NaAlCl4 melts saturated with NaCl onto a glassy carbon electrode at175°C has been studied by voltammetry, chronoamperometry, and constant current deposition. The deposition of aluminumwas found to proceed via a nucleation/growth mechanism......, and the nucleation process was found to be progressive.The morphology of aluminum deposits was examined with photomicroscopy. It was shown that depending on the currentdensities (c.d.) applied, three types of aluminum deposits could be obtained, namely, spongy deposits formed at lower c.d.(below 0.7 mA/cm2), smooth...... layers deposited at intermediate c.d. (between 2 and 10 mA/cm2), and dendritic or porous depositsobtained at high c.d. (above 15 mA/cm2). However, the smooth aluminum deposits were about five times more voluminousthan the theoretical value. The spongy deposits were formed due to difficulties...
26 CFR 1.381(c)(15)-1 - Indebtedness of certain personal holding companies.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Indebtedness of certain personal holding companies. 1.381(c)(15)-1 Section 1.381(c)(15)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(15...
Suplementação de vitaminas na prevenção de câncer
Directory of Open Access Journals (Sweden)
SILVA Cyntia Rosa de Melo
2001-01-01
Full Text Available Este trabalho constitui uma revisão de dados epidemiológicos sobre a relação entre o consumo de vitaminas e prevenção de câncer. Estudos observacionais evidenciam uma associação inversa consistente entre a ingestão de frutas e hortaliças e risco de câncer, e um efeito protetor das vitaminas C, E e dos carotenóides contra certos tipos de câncer. Resultados de estudos de intervenção, na prevenção primária de câncer, são contraditórios, sendo que em dois desses estudos o beta-caroteno, suplementado em doses consideradas farmacológicas, isolado ou associado à vitamina E ou à vitamina A, mostrou-se deletério para tabagistas. Ao contrário, a ingestão de doses mais fisiológicas de antioxidantes parece ser mais eficaz, sendo que a ação sinérgica dessas substâncias na quimioprevenção de câncer já foi demonstrada tanto em modelo in vivo de carcinogênese quanto em estudo epidemiológico de intervenção. Como estratégia de prevenção de câncer preconiza-se o consumo de dietas ricas em frutas e hortaliças, que aportem cerca de 150 mg de vitamina C, 30 mg de vitamina E e 4 mg de carotenóides. A ingestão de quantidades mais elevadas, na forma de suplementos, não está recomendada.
Directory of Open Access Journals (Sweden)
Rodrigo Cuiabano Paes Leme
Full Text Available OBJETIVO: Avaliar se existe diferença no estadiamento de doentes submetidos à ressecção intestinal por câncer colorretal no sistema previdenciário e na clínica privada. MÉTODO: Foram estudados de forma retrospectiva 41 doentes (16 homens e 25 mulheres com idade média de 59,4 anos operados no sistema previdenciário (SP e 33 doentes (18 homens e 15 mulheres com idade média de 60,8 anos operados na clínica privada (CP. Foram avaliados o estadiamento TNM, a frequência de operações de urgência, de operações paliativas e do uso de colostomia. RESULTADOS: Não se observou diferença entre o estadiamento dos dois grupos. A frequência de operações de urgência foi 26,8% no SP e 12,1% na CP (p=0,100. As operações paliativas ( 19,5% SP x 6,1% CP e o uso de colostomia ( 26,8 SP X 15,2 CP foram maiores no sistema previdenciário porém os valores não foram estatisticamente significantes, valores de p=0,087 e p=0,352 respectivamente. CONCLUSÃO: Não há diferença significante entre o estadiamento TNM de doentes operados no sistema previdenciário e privado.
International Nuclear Information System (INIS)
Benaud, Olivier; Berthet, Jean-Claude; Thuery, Pierre; Ephritikhine, Michel
2011-01-01
In contrast to the neutral macrocycle [UN* 2 (N,C)] (1) [N* = N(SiMe 3 ) 3 ; N,C = CH 2 SiMe 2 N-(SiMe 3 )] which was quite inert toward I 2 , the anionic bismetallacycle [NaUN*(N,C) 2 ] (2) was readily transformed into the enlarged monometallacycle [UN*(N,N)I] (4) [N,N = (Me 3 Si)NSiMe 2 CH 2 CH 2 SiMe 2 N(SiMe 3 )] resulting from C-C coupling of the two CH 2 groups, and [NaUN*(N,O) 2 ] (3) [N,O = OC(=CH 2 )SiMe 2 N(SiMe 3 )], which is devoid of any U-C bond, was oxidized into the UV bismetallacycle [Na{UN*(N,O) 2 }2(μ-I)] (5). Sodium amalgam reduction of 4 gave the U(III) compound [UN*(N,N)] (6). Addition of MN 3 or MCN to the (N,C), (N,N), and (N,O) metallacycles 1, 4, and 5 led to the formation of the anionic azide or cyanide derivatives M[UN* 2 (N,C)(N 3 )] [M = Na, 7a or Na(15-crown-5), 7b], M[UN* 2 (N,C)(CN)] [M = NEt 4 , 8a or Na(15-crown-5), 8b or K(18-crown-6), 8c], M[UN*(N,N)(N 3 ) 2 ] [M = Na, 9a or Na(THF)4, 9b], [NEt 4 ][UN*(N,N)(CN) 2 ] (10), M[UN*(N,O) 2 (N 3 )] [M = Na, 11a or Na(15-crown-5), 11b], M[UN*(N,O) 2 (CN)] [M = NEt 4 , 12a or Na(15-crown-5), 12b]. In the presence of excess iodine in THF, the cyanide 12a was converted back into the iodide 5, while the azide 11a was transformed into the neutral UV complex [U(N{SiMe 3 }-SiMe 2 C{CHI}O) 2 I(THF)] (13). The X-ray crystal structures of 4, 7b, 8a-c, 9b, 10, 12b, and 13 were determined. (authors)
Hot spots of crop production changes at 1.5°C and 2°C
Schleussner, C. F.; Deryng, D.; Mueller, C.; Elliott, J. W.; Saeed, F.; Folberth, C.; Liu, W.; Wang, X.; Pugh, T.
2017-12-01
Studying changes in global and regional crop production is central for assessing the benefits of limiting global average temperature below 1.5ºC versus 2ºC. Projections of future climatic impacts on crop production are commonly focussed on focussing on mean changes. However, substantial risks are posed by extreme weather events such as heat waves and droughts that are of great relevance for imminent policy relevant questions such as price shocks or food security. Preliminary research on the benefits of keeping global average temperature increase below 1.5ºC versus 2ºC above pre-industrial levels has indicated that changes in extreme weather event occurrences will be more pronounced than changes in the mean climate. Here we will present results of crop yield projections for a set of global gridded crop models (GGCMs) for four major staple crops at 1.5°C and 2°C warming above pre-industrial levels using climate forcing data from the Half a degree Additional warming, Prognosis and Projected Impacts (HAPPI) project. We will assess changes in crop production on the global and regional level, and identify hot spots of change. The unique multi-ensemble setup allows to identify changes in extreme yield losses with multi-year to multi-decadal return periods, and thus elucidate the consequences for global and regional food security.
43. Calmodulin regulating calcium sensitivity of Na channels
Directory of Open Access Journals (Sweden)
R. Vegiraju
2016-07-01
Full Text Available By extrapolating information from existing research and observing previous assumptions regarding the structure of the Na Channel, this experiment was conducted under the hypothesis that the Na Channel is in part regulated by the calmodulin protein, as a result proving calcium sensitivity of the Na Channel. Furthermore, we assume that there is a one to one stoichiometry between the Na Channel and the Calmodulin. There has been extensive research into the functionality and structure of sodium ion channels (Na channels, as several diseases are associated with the lack of regulation of sodium ions, that is caused by the disfunction of these Na channels. However, one highly controversial matter in the field is the importance of the protein calmodulin (CaM and calcium in Na channel function. Calmodulin is a protein that is well known for its role as a calcium binding messenger protein, and that association is believed to play an indirect role in regulating the Na channel through the Na channel’s supposed calcium sensitivity. While there are proponents for both sides, there has been relatively little research that provides strong evidence for either case. In this experiment, the effect of calmodulin on NaV 1.5 is tested by preparing a set of cardiac cells (of the human specie with the NaV 1.5 C-Termini and CaM protein, which were then to be placed in solutions with varying concentrations of calcium. We took special care to test multiple concentrations of calcium, as previous studies have tested very low concentrations, with Manu Ben-Johny’s team from the John Hopkins laboratory in particular testing up to a meager 50 micromolar, despite producing a well-respected paper (By comparison, the average Na channel can naturally sustain a concentration of almost 1-2 millimolar and on some occasions, reaching even higher concentrations. After using light scattering and observing the signals given off by the calcium interacting with these Nav1.5/Ca
Bevza, O V; Veklich, T O; Shkrabak, O A; Rodik, R V; Kal'chenko, V I; Kosterin, S O
2013-01-01
The inhibition of the Na+,K(+)-ATPase activity of the myometrium cell plasma membranes with calixarene C-107 (5,17-diamino(2-pyridyl) methylphosphono-11,23-di-tret-butyl-26,28-dihydroxy-25,27-dipropoxycalix[4]arene) was investigated. It has been shown that calixarene C-107 reduced the Na+,K(+)-ATPase activity more efficiently than ouabain did, while it did not practically influence the "basal" Mg(2+)-ATPase activity of the same membrane. The magnitude of the cofficient of inhibition I0.5 was 33 +/- 4 nM, Hill coefficient was 0.38 +/- 0.06. The model calixarene C-150--the calixarene "scaffold" (26,28-dihydroxy-25,27-dipropoxycalix[4]arene), and the model compound M-3 (4-hydroxyaniline(2-pyridine)methylphosphonic acid)--a fragment of the calixarene C-107, had practically no influence on the enzymatic activity of Na+,K(+)-ATPase and Mg(2+)-ATPase. We carried out the computer simulation of interaction of calixarenes C-107 and the mentioned model compound with ligand binding sites of the Na+,K(+)-ATPase of plasma membrane and structure foundation of their intermolecular interaction was found out. The participation of hydrogen, hydrophobic, electrostatic and pi-pi (stacking) interaction between calixarene and enzyme aminoacid residues, some of which are located near the active center of Na+,K(+)-ATPase, was discussed.
Efeitos do mp3 player na audição
Directory of Open Access Journals (Sweden)
Daniela Dalapicula Barcelos
2014-06-01
Full Text Available Objetivo investigar se há dano e a extensão do mesmo com o uso de MP3 player. Métodos aplicação do exame de Emissões Otoacústicas por Produto de Distorção e Emissões Otoacústicas Transientes, em 30 indivíduos expostos ao MP3 Player, sendo 15 deles no grupo controle (intensidade média de 85 dBNA e 15 no grupo análise (intensidade média de 110 dBNA, ambos expostos por 15 minutos. O método utilizado para análise estatística foi inferencial (teste “t” para amostras pareadas. Resultados o grupo controle apresentou alteração na frequência de 1,5kHz nas Emissões Otoacústicas Transientes e na frequência de 6kHz no Produto de Distorção. Enquanto o grupo análise apresentou alteração nas frequências de 2, 3, 4kHz e na amplitude média de todas as frequências, nas Emissões Otoacústicas Transientes e nas frequências de 3 e 6kHz na Produto de Distorção. Conclusão o estudo mostrou que pessoas expostas a ruídos intensos, sendo o aparelho de MP3 Player fonte deste estudo, apresentam diminuição significante da amplitude, que indica alteração temporária das células da cóclea, podendo tornar-se uma lesão permanente caso a exposição seja contínua.
New structures in the continuum of 15C populated by two-neutron transfer
International Nuclear Information System (INIS)
Cappuzzello, F.; Rea, C.; Bonaccorso, A.; Bondì, M.; Carbone, D.; Cavallaro, M.; Cunsolo, A.; Foti, A.; Orrigo, S.E.A.; Rodrigues, M.R.D.; Taranto, G.
2012-01-01
The 13 C( 18 O, 16 O) 15 C reaction has been studied at 84 MeV incident energy. The ejectiles have been detected at forward angles and 15 C excitation energy spectra have been obtained up to about 20 MeV. Several known bound and resonant states of 15 C have been identified together with two unknown structures at 10.5 MeV (FWHM=2.5 MeV) and 13.6 MeV (FWHM=2.5 MeV). Calculations based on the removal of two uncorrelated neutrons from the projectile describe a significant part of the continuum observed in the energy spectra. In particular the structure at 10.5 MeV is dominated by a resonance of 15 C near the 13 C+n+n threshold. Similar structures are found in nearby nuclei such as 14 C and 11 Be.
Veklich, T O; Shkrabak, O A; Cherenok, S O; Kal'chenko, V I; Kosterin, S O
2012-01-01
The aim of our investigation was to determine structural features of calix[4]arene C-99 which are important for its inhibition properties relative to Na+,K(+)-ATPase of uterus myocite plasma membrane. Therefore we studied the effect of calix[4]arenes C-296, C-297, C-424, C-425, C-426, C-427, which are structurally similar to this inhibitor, on the mentioned enzyme activity. We have shown that calixarenes C-296 and C-297 which have two additional propoxy groups on the lower rim of macrocycle are less effective inhibitors of Na+,K(+)-ATPase relative to calixarene C-99. Calixarenes C-425 and C-427 which have on the upper rim of macrocycle three and four phosponic residues, respectively, also inhibit Na+,K(+)-ATPase activity less effectively as compared to calixarene C-99. Both calixarenes: C-424, which has only two carbonate residues on the upper rim, and C-426, which has on the upper rim ketomethilphosphonate residues instead of hydroxymethilphosphonate residues of calixarene C-99, do not affect Na+,K(+)-ATPase activity. We have made respective conclusions concerning the role of certain chemical groups of calixarene C-99 during its interaction with Na+,K(+)-ATPase.
Directory of Open Access Journals (Sweden)
Khaydukov K.V.
2017-01-01
Full Text Available The novel core@shell nanocrystals β-NaLuF4@NaLuF4 co-doped with rare-earth ions Er3+, Yb3+, Ce3+ have been synthesized. The nano-particles indicate the intensive lines of anti-Stokes luminescence in the telecommunication С - band of spectrum when pumped at 970-980 nm. The nanoparticles have been characterized by transmission electron microscopy and spectrofluorimetry. The nanoparticles have a size 40-80 nm and possess the intensive photo-luminescence 73 nm bandwidth centered around 1530 nm. The photo-luminescence kinetics of β-NaLuF4: Er3+/ Yb3+/ Ce3+ has been studied in IR range of spectrum. We have demonstrated that doping with cerium ions prevents serial stepwise excitation of erbium ions. Consequently, the lifetime of transition in erbium 4I13/2→4I15/2 has risen up to 6.9 ms. Intensity of 1530 nm line in Er3+ ions excited at 980 nm has been increased up to 6 times. Therefore, the nanoparticles are applicable to fabrication of compact waveguide amplifiers for C - band.
Discursos e vozes na cobertura jornalística das COP15 e 16
Directory of Open Access Journals (Sweden)
Ilza Maria Tourinho Girardi
2013-12-01
Full Text Available O texto apresenta um exercício de análise da cobertura das Conferências da ONU sobre Mudanças Climáticas, COP 15 e 16, em revistas brasileiras e portuguesas publicadas em 2009 e 2010. Examina como foi construído o discurso sobre sustentabilidade e quais foram as vozes acionadas. Por meio da leitura produzida, teórica e metodologicamente baseada na análise do discurso e das fontes, foi possível evidenciar a predominância de um discurso ecotecnocrático e a opção privilegiada por fontes dos campos político e econômico
AgMIP Coordinated Global and Regional Assessments for 1.5°C and 2.0°C
Rosenzweig, C.
2017-12-01
The Agricultural Model Intercomparison and Improvement Project (AgMIP) has developed novel methods for Coordinated Global and Regional Assessments (CGRA) of agriculture and food security in a changing world. The present study performs a proof-of-concept of the CGRA to demonstrate advantages and challenges of the framework. This effort responds to the request by UNFCCC for the implications of limiting global temperature increases to 1.5°C and 2.0°C above pre-industrial conditions. The protocols for the 1.5°C/2.0°C assessment establish explicit and testable linkages across disciplines and scales, connecting outputs and inputs from the Shared Socio-economic Pathways (SSPs), Representative Agricultural Pathways (RAPs), HAPPI and CMIP5 ensemble scenarios, global gridded crop models, global agricultural economic models, site-based crop models, and within-country regional economic models. CGRA results show that at the global scale, mixed areas of positive and negative simulated yield changes, with declines in some breadbasket regions led to overall declines in productivity at both 1.5°C and 2.0°C. These projected global yield changes resulted in increases in prices of major commodities in a global economic model. Simulations for 1.5°C and 2.0°C using site-based crop models had mixed results depending on region and crop, but with more negative effects on productivity at 2.0°C than at 1.5°C for the most part. In conjunction with price changes from the global economics models, these productivity declines resulted generally in small positive effects on regional farm livelihoods, showing that farming systems should continue to be viable under high mitigation scenarios. CGRA protocols focus on how mitigation actions and effects differ across scales, with main mechanisms studied in the integrated assessment models being policies and technologies that reduce direct non-CO2 emissions from agriculture, reduce CO2 emissions from land use change and forest sink enhancement
Progress in 15N and 13C separation by isotopic exchange
International Nuclear Information System (INIS)
Axente, D.
2004-01-01
An experimental study of 15 N separation by isotopic exchange in NO, NO 2 - HNO 3 system under pressure is presented. The pressure increase in 15 N separation plant improved the isotopic transport between the two phases circulated in counter-current in the packed column according to a better kinetics of isotopic exchange at higher pressures. The operation of 15 N separation plant at a pressure of 1.8 atm (absolute) will permit doubling of 10 M nitric acid flow rate and of 15 N production of a given column. The improved performance at a higher pressure is significant for large scale 15 N production, which would be utilized for uranium nitride fuels for FBRs. Enrichment of 13 C by chemical exchange between CO 2 and amine carbamate in nonaqueous solvent has been modelled. For process optimization the steady state separation and the height equivalent to a theoretical plate (HETP) have been determined for different experimental conditions and simulated for higher pressures than atmospheric one. At lower temperature (5 deg C) as the pressure increases the quantity of CO 2 dissolved in amine solution increases. For process analysis at higher pressures and lower temperatures, the two steps model has been considered. At 0.9 MPa pressure and 5 deg C the reaction rate is higher than at 25 deg C and atmospheric pressure, the value of HETP being lower with more than 100% than at 25 deg C. (author)
Directory of Open Access Journals (Sweden)
Luiz Eduardo Imbelloni
2006-12-01
Full Text Available JUSTIFICATIVA E OBJETIVOS: Estudar baixa dose de bupivacaína hipobárica a 0,15% e hiperbárica a 0,5% em pacientes ambulatoriais para procedimentos cirúrgicos anorretais. MÉTODO: Dois grupos de 50 pacientes, estado físico ASA I e II, submetidos a intervenções cirúrgicas anorretais, em posição de canivete, receberam 6 mg de bupivacaína a 0,15% hipobárica na posição cirúrgica (Grupo 1 ou 6 mg de bupivacaína a 0,5% hiperbárica na posição sentada por cinco minutos, e depois colocados em posição de canivete (Grupo 2. Avaliou-se bloqueio sensitivo e motor, primeira micção, deambulação, complicações e necessidade de analgésico. Foram acompanhados até o terceiro dia de pós-operatório e questionados sobre cefaléia pós-punção ou sintomas neurológicos transitórios, e até 30 dias sobre complicação neurológica permanente. Para análise estatística foram utilizados os testes t de Student, mediana de Mood e Exato de Fisher, sendo p JUSTIFICATIVA Y OBJETIVOS: Estudiar baja dosis de bupivacaína hipobárica a 0,15% e hiperbara a 0,5% en pacientes ambulatoriales para procedimientos quirúrgicos anorrectales. MÉTODO: Dos grupos de 50 pacientes, estado físico ASA I y II, sometidos a intervenciones quirúrgicas anorrectales, en posición de cuchilla, recibieron 6 mg de bupivacaína a 0,15% hipobárica en la posición quirúrgica (Grupo 1 o 6 mg de bupivacaína a 0,5% hiperbara en la posición sentada por cinco minutos, y después colocados en posición de cuchilla (Grupo 2. Se evaluaron los bloqueos sensitivo y motor, primera micción, deambulación, complicaciones y necesidad de analgésico. Se monitorearon hasta el tercer día de postoperatorio y preguntados sobre cefalea pospunción o síntomas neurológicos temporales, y hasta 30 días sobre complicación neurológica permanente. Para análisis estadística fueron utilizadas las pruebas t de Student, mediana de Mood y Exacto de Fisher, siendo p BACKGROUND AND
Impacts on terrestrial biodiversity of moving from a 2°C to a 1.5°C target
Smith, Pete; Price, Jeff; Molotoks, Amy; Warren, Rachel; Malhi, Yadvinder
2018-05-01
We applied a recently developed tool to examine the reduction in climate risk to biodiversity in moving from a 2°C to a 1.5°C target. We then reviewed the recent literature examining the impact of (a) land-based mitigation options and (b) land-based greenhouse gas removal options on biodiversity. We show that holding warming to 1.5°C versus 2°C can significantly reduce the number of species facing a potential loss of 50% of their climatic range. Further, there would be an increase of 5.5-14% of the globe that could potentially act as climatic refugia for plants and animals, an area equivalent to the current global protected area network. Efforts to meet the 1.5°C target through mitigation could largely be consistent with biodiversity protection/enhancement. For impacts of land-based greenhouse gas removal technologies on biodiversity, some (e.g. soil carbon sequestration) could be neutral or positive, others (e.g. bioenergy with carbon capture and storage) are likely to lead to conflicts, while still others (e.g. afforestation/reforestation) are context-specific, when applied at scales necessary for meaningful greenhouse gas removal. Additional effort to meet the 1.5°C target presents some risks, particularly if inappropriately managed, but it also presents opportunities. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'.
Directory of Open Access Journals (Sweden)
Dana Galuska
Full Text Available Replacement of proinsulin C-peptide in type 1 diabetes ameliorates nerve and kidney dysfunction, conditions which are associated with a decrease in Na,K-ATPase activity. We determined the molecular mechanism by which long term exposure to C-peptide stimulates Na,K-ATPase expression and activity in primary human renal tubular cells (HRTC in control and hyperglycemic conditions.HRTC were cultured from the outer cortex obtained from patients undergoing elective nephrectomy. Ouabain-sensitive rubidium ((86Rb(+ uptake and Na,K-ATPase activity were determined. Abundance of Na,K-ATPase was determined by Western blotting in intact cells or isolated basolateral membranes (BLM. DNA binding activity was determined by electrical mobility shift assay (EMSA. Culturing of HRTCs for 5 days with 1 nM, but not 10 nM of human C-peptide leads to increase in Na,K-ATPase α(1-subunit protein expression, accompanied with increase in (86Rb(+ uptake, both in normal- and hyperglycemic conditions. Na,K-ATPase α(1-subunit expression and Na,K-ATPase activity were reduced in BLM isolated from cells cultured in presence of high glucose. Exposure to1 nM, but not 10 nM of C-peptide increased PKCε phosphorylation as well as phosphorylation and abundance of nuclear ERK1/2 regardless of glucose concentration. Exposure to 1 nM of C-peptide increased DNA binding activity of transcription factor ZEB (AREB6, concomitant with Na,K-ATPase α(1-subunit mRNA expression. Effects of 1 nM C-peptide on Na,K-ATPase α(1-subunit expression and/or ZEB DNA binding activity in HRTC were abolished by incubation with PKC or MEK1/2 inhibitors and ZEB siRNA silencing.Despite activation of ERK1/2 and PKC by hyperglycemia, a distinct pool of PKCs and ERK1/2 is involved in regulation of Na,K-ATPase expression and activity by C-peptide. Most likely C-peptide stimulates sodium pump expression via activation of ZEB, a transcription factor that has not been previously implicated in C
17 CFR 240.15c1-8 - Sales at the market.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sales at the market. 240.15c1... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-8 Sales at the market... securities exchange that such security is being offered to such customer “at the market” or at a price...
An experimental investigation of Na incorporation in cordierite in low P/high T metapelites
Tropper, Peter; Wyhlidal, Stefan; Haefeker, Udo A.; Mirwald, Peter W.
2018-04-01
The aim of this experimental study was to investigate the incorporation of Na in cordierite in metapelites as a function of temperature and pressure using natural quartzphyllite rocks as starting materials. The experiments were performed in a hydrothermal apparatus as well as a piston-cylinder apparatus with two natural quartzphyllite samples, which represent the protolith rocks of the hornfelses from the Brixen Granite contact aureole near Franzensfeste. Sample W shows high muscovite contents (57 wt%) and only accessory plagioclase while sample SP5 has high plagioclase (16 wt%) and lower muscovite contents (20 vol%). The experiments were done dry at pressures of 0.15, 0.3 and 0.6 GPa in a temperature range of 550 °C to 780 °C. The Na content of the newly formed cordierites shows a systematic variation and decreases linearly with increasing temperatures and no influence of pressure and melting on the Na contents of cordierite was observed. The experiments also show that the difference in mineral assemblage considerably shifts the obtained Na contents of cordierite. The P-independent temperature correlations for both sets of experiments can be described with the linear relationships: T (°C) = (Na [apfu] - 0.4052)/(-0.000487); R2 = 0.96; (±20 °C, calibration W) and T (°C) = (Na [apfu] - 0.3671)/(-0.000383); R2 = 0.94; (±15 °C, calibration SP5). The difference between the two temperatures is large and the SP5 experiments yield temperatures that are up to 100 °C higher. This is not unexpected since theoretical phase relations in the system NMASH predict different Na contents depending on the buffering assemblage (plagioclase vs. paragonite). On the other hand these T differences could also reflect disequilibrium behaviour in the SP5 experiments. Detailed micro-Raman spectroscopic investigations reveal that cordierites from both experiments show disordered structures but the SP5 experiments show a much higher degree of Si-Al disorder and the elevated Na
Su, X.; Takahashi, K.; Fujimori, S.; Hasegawa, T.; Tanaka, K.; Shiogama, H.; Emori, S.; LIU, J.; Hanasaki, N.; Hijioka, Y.; Masui, T.
2017-12-01
Large uncertainty exists in the temperature projections, including contributions from carbon cycle, climate system and aerosols. For the integrated assessment models (IAMs), like DICE, FUND and PAGE, however, the scientific uncertainties mainly rely on the distribution of (equilibrium) climate sensitivity. This study aims at evaluating the emission pathways by limiting temperature increase below 2.0 ºC or 1.5 ºC after 2100 considering scientific uncertainties, and exploring how socioeconomic indicators are affected by such scientific uncertainties. We use a stochastic version of the SCM4OPT, with an uncertainty measurement by considering alternative ranges of key parameters. Three climate cases, namely, i) base case of SSP2, ii) limiting temperature increase below 2.0 ºC after 2100 and iii) limiting temperature increase below 1.5 ºC after 2100, and three types of probabilities - i) >66% probability or likely, ii) >50% probability or more likely than not and iii) the mean of the probability distribution, are considered in the study. The results show that, i) for the 2.0ºC case, the likely CO2 reduction rate in 2100 ranges from 75.5%-102.4%, with mean value of 88.1%, and 93.0%-113.1% (mean 102.5%) for the 1.5ºC case; ii) a likely range of forcing effect is found for the 2.0 ºC case (2.7-3.9 Wm-2) due to scientific uncertainty, and 1.9-3.1 Wm-2 for the 1.5 ºC case; iii) the carbon prices within 50% confidential interval may differ a factor of 3 for both the 2.0ºC case and the 1.5 ºC case; iv) the abatement costs within 50% confidential interval may differ a factor of 4 for both the 2.0ºC case and the 1.5 ºC case. Nine C4MIP carbon cycle models and nineteen CMIP3 AOGCMs are used to account for the scientific uncertainties, following MAGICC 6.0. These uncertainties will result in a likely radiative forcing range of 6.1-7.5 Wm-2 and a likely temperature increase of 3.1-4.5 ºC in 2100 for the base case of SSP2. If we evaluate the 2 ºC target by limiting the
Directory of Open Access Journals (Sweden)
Roberto B. F. Branco
2007-08-01
Full Text Available Estudaram-se os efeitos da aplicação de CO2, via água de irrigação, e da enxertia do tomateiro no transporte de 15N e na produção do tomateiro. Os tratamentos foram arranjados em delineamento inteiramente ao acaso no esquema fatorial 2 x 2 (com e sem CO2 na água de irrigação e tomateiro enxertado e pé-franco. A injeção do CO2 na água iniciou-se aos 34 dias após o transplante das mudas (DAT e se prolongou em todas as irrigações. A aplicação do sulfato de amônio com abundância em átomos de 15N de 3,13% nas plantas destinadas à análise foi feita aos 45 DAT quando as plantas estavam em plena frutificação. Após 14 dias da aplicação do fertilizante (15N as plantas foram colhidas, lavadas, secadas e enviadas ao laboratório, para análise do 15N nos seus tecidos. Os resultados demonstraram que o CO2 e a enxertia não alteraram o transporte de 15N na planta. A produção de frutos comerciais foi maior quando se aplicou CO2 na água.The effects of CO2 application through irrigation water, and of grafting in transport of 15N and in the tomato production, were studied. These treatments were arranged in a 2 x 2 factorial scheme (with and without CO2 in irrigation water and grafted and non-grafted tomato, in a completely randomized design, with four replications. The injection of CO2 into the water began at 34 days after transplant of seedlings (DAT and continued for all irrigations. The application of the sulfate of ammonium with abundance in atoms of 15N of 3.13% in plants destined to analysis was done at 45 DAT when the plants were in the middle of fructification. After 14 days of fertilizer (15N application the plants were harvested, washed, dried and sent for analysis of 15N in plant tissue. The results demonstrated that CO2 and the grafting did not alter the transport of 15N in the plant. The production of commercial fruits was larger when CO2 was applied in water.
Energy Technology Data Exchange (ETDEWEB)
Noubigh, Adel [Laboratoire de Physico-chimie des materiaux, IPEST, BP51, 2070 La MARSA (Tunisia)], E-mail: Adel.anoubigh@ipest.rnu.tn; Cherif, Mourad [IPEIEM, Universite de Tunis-El Manar, BP244. 2096. El Manar II (Tunisia); Provost, Elise [Laboratoire Chimie et procedes, ENSTA, 32 Rue de Boulevard Victor, 75739 Paris, Cedex 15 (France); Abderrabba, Manef [Laboratoire de Physico-chimie des materiaux, IPEST, BP51, 2070 La MARSA (Tunisia)
2008-11-15
This paper is continuation of the study concerning the solubility-temperature dependence data for some phenolic compounds (PhC), contained in olive mill wastewater (OMWW), in two nitrate salts (KNO{sub 3} and NaNO{sub 3}) aqueous solutions. The solubilities of PhC were determined in the temperature ranging from (293.15 to 318.15) K. It has been observed that the solubility, in aqueous nitrate solutions, increases with increasing temperature. Results showed that alkali metal nitrate has a salting-out effect on the solubility of PhC. The effect of the anion of the electrolyte on the solubility of PhC is observed by comparing these results with values reported in the previous papers for the effect of LiCl, NaCl and KCl. For each cation, the solubilites of the phenolic compounds are higher with nitrate anion than with chloride anion. Results were interpreted in terms of the salt hydration shells and the ability of the solute to form hydrogen-bond with water. The solubility data were accurately correlated by a semi empirical equation. The standard molar Gibbs free energies of transfer of PhC ({delta}{sub tr}G{sup 0}) from pure water to aqueous solutions of the nitrate salts have been calculated from the solubility data. The decrease in solubility is correlated to the positive {delta}{sub tr}G{sup 0} value which is mainly of enthalpic origin.
Cormie, A. B.; Schwarcz, H. P.
1996-11-01
We have examined the relationship of bone collagen δ15N and δ13C to climatic variables, humidity, temperature, and amount of precipitation using fifty-nine specimens of North American white-tailed deer ( Odocoileus virginianus) from forty-six different locations. In previous studies of African mammals there was a significant correlation between bone collagen δ15N and local amount of precipitation. Results presented here similarly show an increase in δ15N with decreasing amount of precipitation but only for 25% of the animals, namely those consuming more than 10% C 4 plants. These animals also exhibited a significant correlation between δ13C and temperature which mirrors previous observations for grasses suggesting that these deer consume grasses during times of population and nutrient stress. In contrast, even in dry areas containing high proportions of C 4 grasses, the majority of the deer had consumed low amounts of C 4 plants and these deer did not have δ15N which correlate with amount of precipitation. Only when deer deviated from their normal feeding pattern by consuming C 4 plants or grasses did their δ15N correlate with amount of rainfall. For these animals, consumption of C 4 plants or grasses may signal conditions of water and nutrient stress. An increase in δ15N of bone collagen may result from combined effects from excretion of concentrated urine (to conserve water) and increased internal recycling of nitrogen (to conserve nitrogen).
Synthesis of Novel C-2- or C-15-Labeled BODIPY—Estrone Conjugates
Directory of Open Access Journals (Sweden)
Ildikó Bacsa
2018-04-01
Full Text Available Novel BODIPY–estrone conjugates were synthesized via Cu(I-catalyzed azide–alkyne cycloaddition (CuAAC. Estrone-alkynes or an estrone-azide as starting compounds were synthesized via Michael addition or Sonogashira reaction as key steps. Fluorescent dyes based on BODIPY-core were provided by azide or alkyne functional groups. Fluorescent labeling of estrone was efficiently achieved at the C-2 or C-15 position. The newly-elaborated coupling procedures might have a broad applicability in the synthesis of fluorescent-labeled estrone conjugates suitable for biological assays.
Directory of Open Access Journals (Sweden)
M. S. Neto
1998-12-01
Full Text Available A Histiocitose das células de Langerhans (HCL acometendo o trato genital tem uma incidência rara com apenas 48 casos relatados na literatura1-5 . Considerando somente as lesões da região anogenital, esse número cai para dois casos descritos1,2. Reportamos o 3º caso de HCL anogenital em uma paciente de 31 anos, branca, cuja comprovação diagnóstica foi feita através de microscopia eletrônica. O tratamento realizado foi quimioterapia sistêmica e excisão cirúrgica local.The Langerhans cell histiocytosis (LCH of the genital tract is rare, with only 48 cases related in the literature1-5. There were reported only 2 cases in the anogenital region1,2. We reported the third case of LCH in the anogenital region; patient was female, 31 years-old, caucasian and the diagnosis was confirmed by electron microscopic magnification. The treatment was local surgical excision and systemic chemotherapy.
Impacts on terrestrial biodiversity of moving from a 2°C to a 1.5°C target
Price, Jeff; Molotoks, Amy; Warren, Rachel
2018-01-01
We applied a recently developed tool to examine the reduction in climate risk to biodiversity in moving from a 2°C to a 1.5°C target. We then reviewed the recent literature examining the impact of (a) land-based mitigation options and (b) land-based greenhouse gas removal options on biodiversity. We show that holding warming to 1.5°C versus 2°C can significantly reduce the number of species facing a potential loss of 50% of their climatic range. Further, there would be an increase of 5.5–14% of the globe that could potentially act as climatic refugia for plants and animals, an area equivalent to the current global protected area network. Efforts to meet the 1.5°C target through mitigation could largely be consistent with biodiversity protection/enhancement. For impacts of land-based greenhouse gas removal technologies on biodiversity, some (e.g. soil carbon sequestration) could be neutral or positive, others (e.g. bioenergy with carbon capture and storage) are likely to lead to conflicts, while still others (e.g. afforestation/reforestation) are context-specific, when applied at scales necessary for meaningful greenhouse gas removal. Additional effort to meet the 1.5°C target presents some risks, particularly if inappropriately managed, but it also presents opportunities. This article is part of the theme issue ‘The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'. PMID:29610386
Perfil epidemiológico de pacientes na fila de transplante de córnea no estado de Pernambuco - Brasil
Directory of Open Access Journals (Sweden)
Hirlana Gomes Almeida
2014-01-01
Full Text Available Objetivo: Descrever o perfil epidemiológico de pacientes na fila de transplante de córnea no estado de Pernambuco, Brasil. Métodos: Estudo transversal e retrospectivo realizado no período 01/06/2011 a 31/05/2012, com 871 pacientes cadastrados na fila de espera para transplante de córnea na Central de Notificação, Captação e Distribuição de Órgãos de Pernambuco (CNCDO/PE. Os dados foram coletados por meio de protocolos baseados nas fichas de cadastro de receptor de córnea. Resultados: Em relação à frequência, obteve-se 54% do gênero feminino, 35% na faixa etária de 61 a 80 anos; 60% transplantados; 52% provenientes da região Metropolitana do Recife; 57% que aguardaram 1 a 6 meses o transplante; 82% com indicação de transplante óptico; 5% com prioridade na fila de espera (destes 48% por perfuração ocular e 37% cujo centro transplantador era a Fundação Altino Ventura (FAV. As principais indicações para transplante de córnea foram leucoma (33%, ceratocone (22% e ceratopatia bolhosa (18%. Conclusão: Verificou-se que a maioria dos pacientes encontra-se na faixa etária de 61 a 80 anos; era da Mesorregião Metropolitana de Recife; foi submetida ao transplante de córnea; aguardou de um a seis meses para realizar o transplante; teve como diagnóstico o leucoma, seguido por ceratocone e ceratopatia bolhosa; teve como indicação o transplante óptico e teve como centro transplantador a FAV.
Reduced probability of ice-free summers for 1.5 °C compared to 2 °C warming
Jahn, Alexandra
2018-05-01
Arctic sea ice has declined rapidly with increasing global temperatures. However, it is largely unknown how Arctic summer sea-ice impacts would vary under the 1.5 °C Paris target compared to scenarios with greater warming. Using the Community Earth System Model, I show that constraining warming to 1.5 °C rather than 2.0 °C reduces the probability of any summer ice-free conditions by 2100 from 100% to 30%. It also reduces the late-century probability of an ice cover below the 2012 record minimum from 98% to 55%. For warming above 2 °C, frequent ice-free conditions can be expected, potentially for several months per year. Although sea-ice loss is generally reversible for decreasing temperatures, sea ice will only recover to current conditions if atmospheric CO2 is reduced below present-day concentrations. Due to model biases, these results provide a lower bound on summer sea-ice impacts, but clearly demonstrate the benefits of constraining warming to 1.5 °C.
Percepção monocular da profundidade ou relevo na ilusão da máscara côncava na esquizofrenia
Directory of Open Access Journals (Sweden)
Arthur Alves
2014-03-01
Full Text Available Este trabalho foi desenvolvido com o propósito de investigar a percepção monocular da profundidade ou relevo da máscara côncava por 29 indivíduos saudáveis, sete indivíduos com esquizofrenia sob uso de antipsicótico por um período inferior ou igual a quatro semanas e 29 sob uso de antipsicótico por um período superior a quatro semanas. Os três grupos classificaram o reverso de uma máscara policromada em duas situações de iluminação, por cima e por baixo. Os resultados indicaram que a maioria dos indivíduos com esquizofrenia inverteu a profundidade da máscara côncava na condição de observação monocular e perceberam-na como convexa, sendo, portanto, suscetíveis à ilusão da máscara côncava. Os indivíduos com esquizofrenia sob uso de medicação antipsicótica pelo período superior a quatro semanas estimaram a convexidade da máscara côncava iluminada por cima em menor comprimento comparados aos indivíduos saudáveis.
Optimization and kinetics decomposition of monazite using NaOH
International Nuclear Information System (INIS)
MV Purwani; Suyanti; Deddy Husnurrofiq
2015-01-01
Decomposition of monazite with NaOH has been done. Decomposition performed at high temperature on furnace. The parameters studied were the comparison NaOH / monazite, temperature and time decomposition. From the research decomposition for 100 grams of monazite with NaOH, it can be concluded that the greater the ratio of NaOH / monazite, the greater the conversion. In the temperature influences decomposition 400 - 700°C, the greater the reaction rate constant with increasing temperature greater decomposition. Comparison NaOH / monazite optimum was 1.5 and the optimum time of 3 hours. Relations ratio NaOH / monazite with conversion (x) following the polynomial equation y = 0.1579x 2 – 0.2855x + 0.8301 (y = conversion and x = ratio of NaOH/monazite). Decomposition reaction of monazite with NaOH was second orde reaction, the relationship between temperature (T) with a reaction rate constant (k), k = 6.106.e - 1006.8 /T or ln k = - 1006.8/T + 6.106, frequency factor A = 448.541, activation energy E = 8.371 kJ/mol. (author)
Directory of Open Access Journals (Sweden)
Chi-Chun Ho
2017-10-01
Full Text Available Thiopurines are clinically useful in the management of diverse immunological and malignant conditions. Nevertheless, these purine analogues can cause lethal myelosuppression, which may be prevented by prospective testing for variants in the thiopurine S-methyltransferase (TPMT and, in East Asians, Nudix hydrolase 15 (NUDT15 genes. Two single-tube, tetra-primer amplification refractory mutation system polymerase chain reaction (ARMS-PCR assays were developed to genotype the common loss-of-function variants NUDT15 c.415C>T (rs116855232 and TPMT*3C c.719A>G (rs1142345. In a group of 60 unselected patients, one and seven were found to be homozygous and heterozygous, respectively, for NUDT15 c.415C>T; one was found to be heterozygous for TPMT*3C c.719A>G. There was no non-specific amplification, and the genotypes were 100% concordant with Sanger sequencing. Limit-of-detection for both assays was below 1 ng of heterozygous template per reaction. Time- and cost-effective ARMS-PCR assays, suitable for genotyping East-Asian patients for thiopurine intolerance, were successfully developed and validated.
International Nuclear Information System (INIS)
Chou, Y.L.; Yeh, J.W.; Shih, H.C.
2010-01-01
The purpose of this study is to investigate the electrochemical properties of the Co 1.5 CrFeNi 1.5 Ti 0.5 Mo x high-entropy alloys in three aqueous environments which simulate acidic, marine, and basic environments at ambient temperature (∼25 o C). The potentiodynamic polarisation curves of the Co 1.5 CrFeNi 1.5 Ti 0.5 Mo x alloys, obtained in aqueous solutions of H 2 SO 4 and NaOH, clearly revealed that the corrosion resistance of the Mo-free alloy was superior to that of the Mo-containing alloys. On the other hand, the lack of hysteresis in cyclic polarisation tests and SEM micrographs confirmed that the Mo-containing alloys are not susceptible to pitting corrosion in NaCl solution.
The effect of Na vapor on the Na content of chondrules
Lewis, R. Dean; Lofgren, Gary E.; Franzen, Hugo F.; Windom, Kenneth E.
1993-01-01
Chondrules contain higher concentrations of volatiles (Na) than expected for melt droplets in the solar nebula. Recent studies have proposed that chondrules may have formed under non-canonical nebular conditions such as in particle/gas-rich clumps. Such chondrule formation areas may have contained significant Na vapor. To test the hypothesis of whether a Na-rich vapor would minimize Na volatilization reaction rates in a chondrule analog and maintain the Na value of the melt, experiments were designed where a Na-rich vapor could be maintained around the sample. A starting material with a melting point lower that typical chondrules was required to keep the logistics of working with Na volatilization from NaCl within the realm of feasibility. The Knippa basalt, a MgO-rich alkali olivine basalt with a melting temperature of 1325 +/- 5 C and a Na2O content of 3.05 wt%, was used as the chondrule analog. Experiments were conducted in a 1 atm, gas-mixing furnace with the fO2 controlled by a CO/CO2 gas mixture and fixed at the I-W buffer curve. To determine the extent of Na loss from the sample, initial experiments were conducted at high temperatures (1300 C - 1350 C) for duration of up to 72 h without a Na-rich vapor present. Almost all (up to 98%) Na was volatilized in runs of 72 h. Subsequent trials were conducted at 1330 C for 16 h in the presence of a Na-rich vapor, supplied by a NaCl-filled crucible placed in the bottom of the furnace. Succeeding Knudsen cell weight-loss mass-spectrometry analysis of NaCl determined the P(sub Na) for these experimental conditions to be in the 10(exp -6) atm range. This value is considered high for nebula conditions but is still plausible for non-canonical environments. In these trials the Na2O content of the glass was maintained or in some cases increased; Na2O values ranged from 2.62% wt to 4.37% wt. The Na content of chondrules may be controlled by the Na vapor pressure in the chondrule formation region. Most heating events capable
Directory of Open Access Journals (Sweden)
Rahman Md Mizanur
2014-09-01
Full Text Available Two feeding trials were conducted to determine the optimum feeding frequency in growing Korean rockfish, (Sebastes schlegeli reared at the temperatures of 15°C and 19°C. Fish averaging 92.2±0.7 g (mean±standard deviation [SD] at 15.0±0.5°C and 100.2±0.4 g (mean±SD at 19.0±0.5°C water temperature were randomly distributed into each of 15 indoor tanks containing 250-L sea water from a semi-recirculation system. A total of five feeding frequency groups were set up in three replicates as follows: one meal in a day at 08:00 hour, two meals a day at 08:00 and 17:00 hours, three meals a day at 08:00, 14:00, and 20:00 hours, four meals a day at 08:00, 12:00, 16:00, and 20:00 hours, and one meal every 2 days at 08:00 hour. Fish were fed at the rate of 1.2% body weight (BW/d at 15°C and 1.5% BW/d at 19°C. At the end of 8 wks of feeding trial weight gain and specific growth rate were significantly higher at the fish fed groups of one meal a day and two meals a day at 15°C and fish fed groups of 1 meal every 2 days at 19°C were significantly lower than those of all other fish fed groups. Glutamic oxaloacetic transaminase and glutamic pyruvic transaminase of fish fed group at 1 meal every 2 days was significantly higher than those of all other fish fed groups in both experiments. Weight gain, specific growth rate and condition factor were gradually decreased as the feeding frequency increased. The results indicate that growing Korean rockfish 92 and 100 g perform better at 15°C than 19°C water temperature. As we expected, current results have indicated that a feeding frequency of 1 meal a day is optimal for the improvement of weight gain in growing Korean rockfish grown from 92 g to 133 g at 15°C and 100 g to 132 g at 19°C water temperature.
International Nuclear Information System (INIS)
Bakel, A.J.; Ebert, W.L.; Strachan, D.M.
1996-01-01
The corrosion behavior of a borosilicate glass containing 20 mass 5 Na 2 O was assessed using static dissolution tests. This glass (LD6-5412) is representative of high Na glasses that may be used to stabilize Hanford low-level radioactive waste. The normalized mass loss (NL) decreases as NL(Na) ∼ NL(B) > NL(Si) in 20 and 40 C for tests conducted at glass surface area to leachant volume (S/V) ratio of 10 m -1 , and decreases as NL(Na) > NL(B) ∼ NL(Si) in 90 C tests conducted at 10 m -1 and in all tests conducted at higher S/V. The difference in the corrosion behavior is probably caused by the influence of dissolved glass components in the leachates. The NL(Na) is greater than the NL(B) or NL(Si) in all the tests conducted. Results from long-term tests at 2,000 m -1 show that the preferential release of Na persists for longer than one year at all temperatures and indicate that Na is released from this glass by an ion exchange process
Gupta, Pratibha; Sharma, Satyawati; Saxena, Sanjay
2014-03-01
Steviol glycosides are natural non-caloric sweeteners which are extracted from the leaves of Stevia rebaudiana plant. Present study deals the effect of salts (NaCl and Na2CO3) on callus and suspension culture of Stevia plant for steviol glycoside (SGs) production. Yellow-green and compact calli obtained from in vitro raised Stevia leaves sub-cultured on MS medium supplemented with 2.0 mg l(-1) NAA and different concentrations of NaCl (0.05-0.20%) and Na2CO3 (0.0125-0.10%) for 2 weeks, and incubated at 24 ± 1 °C and 22.4 μmol m(-2) s(-1) light intensity provided by white fluorescent tubes for 16 h. Callus and suspension biomass cultured on salts showed less growth as well as browning of medium when compared with control. Quantification of SGs content in callus culture (collected on 15th day) and suspension cultures (collected at 10th and 15th days) treated with and without salts were analyzed by HPLC. It was found that abiotic stress induced by the salts increased the concentration of SGs significantly. In callus, the quantity of SGs got increased from 0.27 (control) to 1.43 and 1.57% with 0.10% NaCl, and 0.025% Na2CO3, respectively. However, in case of suspension culture, the same concentrations of NaCl and Na2CO3 enhanced the SGs content from 1.36 (control) to 2.61 and 5.14%, respectively, on the 10th day.
Synthesis of Li(x)Na(2-x)Mn2S3 and LiNaMnS2 through redox-induced ion exchange reactions
International Nuclear Information System (INIS)
Luthy, Joshua A.; Goodman, Phillip L.; Martin, Benjamin R.
2009-01-01
Na 2 Mn 2 S 3 was oxidatively deintercalated using iodine in acetonitrile to yield Na 1.3 Mn 2 S 3 , with lattice constants nearly identical to that of the reactant. Lithium was then reductively intercalated into the oxidized product to yield Li 0.7 Na 1.3 Mn 2 S 3 . When heated, this metastable compound decomposed to form a new crystalline compound, LiNaMnS 2 , along with MnS and residual Na 2 Mn 2 S 3 . Single crystal X-ray diffraction structural analysis of LiNaMnS 2 revealed that this compound crystallizes in P-3m1 with cell parameters a=4.0479(6) A, c=6.7759(14) A, V=96.15(3) A 3 (Z=1, wR2=0.0367) in the NaLiCdS 2 structure-type. - Graphical abstract: Structure of LiNaMnS 2 . Li and Mn are statistically distributed in edge-shared tetrahedral environments linked into infinite planes. Sodium ions occupy interlayer sites
Directory of Open Access Journals (Sweden)
Pavel K. Mykhailiuk
2015-01-01
Full Text Available A one-pot reaction between C2F5CH2NH2·HCl, NaNO2 and electron-deficient alkynes gives C2F5-substituted pyrazoles in excellent yields. The transformation smoothly proceeds in dichloromethane/water, tolerates the presence of air, and requires no purification of products by column chromatography. Mechanistically, C2F5CH2NH2·HCl and NaNO2 react first in water to generate C2F5CHN2, that participates in a [3 + 2] cycloaddition with electron-deficient alkynes in dichloromethane.
Asian climate change under 1.5–4 °C warming targets
Directory of Open Access Journals (Sweden)
Ying Xu
2017-06-01
Full Text Available Based on simulations of 18 CMIP5 models under three RCP scenarios, this article investigates changes in mean temperature and precipitation and their extremes over Asia in the context of global warming targets of 1.5–4 °C, and further compares the differences between 1.5 °C and 2 °C targets. Results show that relative to the pre-industrial era, the mean temperature over Asia increases by 2.3 °C, 3.0 °C, 4.6 °C, and 6.0 °C at warming targets of 1.5 °C, 2 °C, 3 °C, and 4 °C, respectively, with stronger warming in high latitudes than in low latitudes. The corresponding enhancement in mean precipitation over the entire Asian region is 4.4%, 5.8%, 10.2%, and 13.0%, with significant regional differences. In addition, an increase in warm extremes, a decrease in cold extremes, and a strengthening in the variability of amounts of extreme precipitation are projected. Under the 1.5 °C target, compared with the climate under the 2 °C target, the mean temperature will be lower by 0.5–1 °C over Asia; the mean precipitation will be less by 5%–20% over most of Asia, but will be greater by about 10%–15% over West Asia and western South Asia; extreme high temperatures will be uniformly cooler throughout the Asian region, and the warming in extreme low temperatures will decrease significantly in high latitudes of Asia; extreme precipitation will be weaker over most of Asia but will be stronger over West Asia and western South Asia. Under the 1.5 °C and 2 °C warming targets, the probability of very hot weather (anomalies greater than 1σ, σ is standard deviation, extremely hot weather (anomalies greater than 3σ, and extremely heavy precipitation (anomalies greater than 3σ occurring will increase by at least once, 10%, and 10%, respectively, compared to the reference period (1861–1900.
Uncertain impacts on economic growth when stabilizing global temperatures at 1.5°C or 2°C warming
Pretis, Felix; Schwarz, Moritz; Tang, Kevin; Haustein, Karsten; Allen, Myles R.
2018-05-01
Empirical evidence suggests that variations in climate affect economic growth across countries over time. However, little is known about the relative impacts of climate change on economic outcomes when global mean surface temperature (GMST) is stabilized at 1.5°C or 2°C warming relative to pre-industrial levels. Here we use a new set of climate simulations under 1.5°C and 2°C warming from the `Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) project to assess changes in economic growth using empirical estimates of climate impacts in a global panel dataset. Panel estimation results that are robust to outliers and breaks suggest that within-year variability of monthly temperatures and precipitation has little effect on economic growth beyond global nonlinear temperature effects. While expected temperature changes under a GMST increase of 1.5°C lead to proportionally higher warming in the Northern Hemisphere, the projected impact on economic growth is larger in the Tropics and Southern Hemisphere. Accounting for econometric estimation and climate uncertainty, the projected impacts on economic growth of 1.5°C warming are close to indistinguishable from current climate conditions, while 2°C warming suggests statistically lower economic growth for a large set of countries (median projected annual growth up to 2% lower). Level projections of gross domestic product (GDP) per capita exhibit high uncertainties, with median projected global average GDP per capita approximately 5% lower at the end of the century under 2°C warming relative to 1.5°C. The correlation between climate-induced reductions in per capita GDP growth and national income levels is significant at the p economic inequality between countries and is relevant to discussions of loss and damage under the United Nations Framework Convention on Climate Change. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a
Uncertain impacts on economic growth when stabilizing global temperatures at 1.5°C or 2°C warming
Schwarz, Moritz; Tang, Kevin; Haustein, Karsten; Allen, Myles R.
2018-01-01
Empirical evidence suggests that variations in climate affect economic growth across countries over time. However, little is known about the relative impacts of climate change on economic outcomes when global mean surface temperature (GMST) is stabilized at 1.5°C or 2°C warming relative to pre-industrial levels. Here we use a new set of climate simulations under 1.5°C and 2°C warming from the ‘Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) project to assess changes in economic growth using empirical estimates of climate impacts in a global panel dataset. Panel estimation results that are robust to outliers and breaks suggest that within-year variability of monthly temperatures and precipitation has little effect on economic growth beyond global nonlinear temperature effects. While expected temperature changes under a GMST increase of 1.5°C lead to proportionally higher warming in the Northern Hemisphere, the projected impact on economic growth is larger in the Tropics and Southern Hemisphere. Accounting for econometric estimation and climate uncertainty, the projected impacts on economic growth of 1.5°C warming are close to indistinguishable from current climate conditions, while 2°C warming suggests statistically lower economic growth for a large set of countries (median projected annual growth up to 2% lower). Level projections of gross domestic product (GDP) per capita exhibit high uncertainties, with median projected global average GDP per capita approximately 5% lower at the end of the century under 2°C warming relative to 1.5°C. The correlation between climate-induced reductions in per capita GDP growth and national income levels is significant at the p economic inequality between countries and is relevant to discussions of loss and damage under the United Nations Framework Convention on Climate Change. This article is part of the theme issue ‘The Paris Agreement: understanding the physical and social challenges for
Nakagawa, Mariko; Tabara, Aya; Ushijima, Yuki; Matsunaga, Kotaro; Seguchi, Masaharu
2016-05-01
Rice flour was stored at 15 °C/9 months, at 35 °C/14 days, or dry-heated at 120 °C/20 min. The breadmaking properties baked with this rice flour/fresh gluten flour deteriorated. In addition, the rice flour was mixed with oil in water vigorously, and oil-binding ability was measured. Every rice flour subjected to storage or dry-heated at 120 °C showed higher hydrophobicity, owing to changes in proteins. Then, proteins in the stored rice flour were excluded with NaOH solution, and bread baked with the deproteinized rice flour showed the same breadmaking properties as unstored rice flour/fresh gluten flour. The viscoelasticity of wheat glutenin fraction decreased after the addition of dry-heated rice flour in a mixograph profile. DDD staining increased Lab in color meter, which suggested an increase in SH groups in rice protein. The increase in SH groups caused a reduction in wheat gluten protein resulting in a deterioration of rice bread quality. .
Directory of Open Access Journals (Sweden)
Collings Matthew D
2002-11-01
Full Text Available Highly concentrated NaCl brines are important geothermal fluids; chloride complexation of metals in such brines increases the solubility of minerals and plays a fundamental role in the genesis of hydrothermal ore deposits. There is experimental evidence that the molecular nature of the NaCl–water system changes over the pressure–temperature range of the Earth's crust. A transition of concentrated NaCl–H2O brines to a "hydrous molten salt" at high P and T has been argued to stabilize an aqueous fluid phase in the deep crust. In this work, we have done molecular dynamic simulations using classical potentials to determine the nature of concentrated (0.5–16 m NaCl–water mixtures under ambient (25°C, 1 bar, hydrothermal (325°C, 1 kbar and deep crustal (625°C, 15 kbar conditions. We used the well-established SPCE model for water together with the Smith and Dang Lennard-Jones potentials for the ions (J. Chem. Phys., 1994, 100, 3757. With increasing temperature at 1 kbar, the dielectric constant of water decreases to give extensive ion-association and the formation of polyatomic (NanClmn-m clusters in addition to simple NaCl ion pairs. Large polyatomic (NanClmn-m clusters resemble what would be expected in a hydrous NaCl melt in which water and NaCl were completely miscible. Although ion association decreases with pressure, temperatures of 625°C are not enough to overcome pressures of 15 kbar; consequently, there is still enhanced Na–Cl association in brines under deep crustal conditions.
Experimental investigation on the combined use of C1O2 and NaC1O for drinking water treatment
International Nuclear Information System (INIS)
Sani, B.; Rossi, L.; Santianni, D.; Anichini, B.; Caretti, C.; Lubello, C.
2005-01-01
In Italy, most of the plants producing water for human consumption, use Chlorine Dioxide (C1O 2 ) and Sodium Hypochlorite (NaC1O) for the oxidation and disinfection treatments. These chemical disinfectants, which are very effective as regards the oxidation power, the disinfection capability and the bacteriostatic action, produce by-products harmful for human health: Chlorite and Trihalomethanes (THMs) respectively. The Italian Regulations (D.Lgs. 31/2001) sets very restrictive limits for the maximum concentration of these by-products in drinking water. Moreover, from December 2006, the limit for chlorite will be even more restrictive and, with present treatment process, the compliance with the regulation will be very difficult. Therefore the experimentation of alternative treatment techniques and products is of great interest. This article presents an experimental investigation on the combined use of C1O 2 and NaC1O in the treatment of final water from two different plants producing drinking water in Florence. The main objective of this investigation was to evaluate the use of these two products in combination so as to keep the advantages (disinfection efficiency and stability in water) and to minimize the disadvantages (by-products formation) present when using this products separately. Positive results achieved in the experimental phase were used to evaluate the possible applications on real drinking water treatment conditions [it
International Nuclear Information System (INIS)
Adams, J.M.; Haselden, D.A.
1984-01-01
The structure of a carbon monoxide adduct of cobalt-exchanged zeolite A, Co/sub 5.25/Na/sub 1.5/-A x 1.5CO, has been determined by Rietveld neutron profile refinement. All exchangeable cations are located in sites adjacent to the 6-ring; 3.75 of the cobalt cations sit 0.4 A inside the β-cage (Co(2)) and are arranged tetrahedrally about the eight 6-rings sites in the β-cage. The sodium cations (Na(1)) reside just inside the α-cage in sites similar to those found previously for zeolites 3A, 4A, and 5A. The remaining 1.5 cobalt cations (Co(1)) are located in sites similar to those for sodium, but they are also coordinated to the carbon monoxide molecules, which lie on, or close-to, the threefold axis which passes through the 6-ring. Inside the β-cage there is a tetrahedral aluminum complex of AlO 4 type, the oxygen atoms (O*) of which point toward six rings not occupied by cobalt cations, Co(2). Each of the oxygen atoms of this complex is involved in a hydrogen bond (2.83 A) to the 6-ring oxygen O(3). Approximately 2/3 of these bonds are of type O*-H ... O(3) and 1/3 of type O* ...H-O(3)
Directory of Open Access Journals (Sweden)
Rita de Cássia Félix Alvarez
2007-12-01
Full Text Available A garantia de alta produtividade de grãos de arroz no sistema de cultivo irrigado por aspersão tem estimulado a utilização de maiores doses de fertilizantes, principalmente os nitrogenados. Contudo, o manejo inadequado da adubação nitrogenada pode resultar em acamamento das plantas. A aplicação de reguladores vegetais pode carrear fotoassimilados para produção de grãos em detrimento do crescimento vegetativo excessivo. Este trabalho teve por objetivos: avaliar a influência do regulador de crescimento etil-trinexapac nas características de crescimento da planta e no acúmulo e distribuição de N (15N nas partes e na planta inteira de arroz; e verificar a contribuição do N absorvido em diferentes estádios de desenvolvimento na formação da panícula, nos componentes do rendimento e na massa de grãos de arroz. O experimento foi realizado em casa de vegetação, sob condições controladas. Os tratamentos foram constituídos de não-aplicação ou aplicação de regulador de crescimento vegetal (0 e 200 g ha-1 i.a. de etil-trinexapac em quatro estádios de desenvolvimento das plantas (1 - início ao final do perfilhamento, 2 - final do perfilhamento à diferenciação do primórdio da panícula, 3 - diferenciação do primórdio da panícula ao florescimento e 4 - florescimento à maturação fisiológica. Foi utilizado o delineamento experimental de blocos ao acaso, dispostos em esquema fatorial 2 x 4, com três repetições. As plantas foram postas em um grupo de 48 vasos. Em um grupo de 24 vasos, com solução nutritiva e NH4SO4 enriquecido (15N, no início de cada estádio preestabelecido de desenvolvimento da planta ao final de cada um deles, as plantas foram coletadas e separadas em suas partes constituintes. Em outro grupo de vasos (24 vasos, no final de cada estádio, em vez de serem coletadas, as plantas voltavam a se desenvolver em solução nutritiva com NH4SO4 natural, para então serem coletadas no final do ciclo. O
International Nuclear Information System (INIS)
Fang, Pinyang; Liu, Peng; Xi, Zengzhe; Long, Wei; Li, Xiaojuan
2014-01-01
Highlights: • Manganese modified KNBT ceramics were synthesized using the solid state process. • d 33 and T c of KNBT ceramics were improved by manganese modification. • d 33 and T c of KNBT-Mn50 ceramic were 28 pC/N and 657 °C, respectively. - Abstract: Aurivillius oxides, (K 0.16 Na 0.84 ) 0.5 Bi 4.5 Ti 4 O 15 (KNBT) with manganese doping, were synthesized by using the conventional solid state reaction method. Influence of manganese doping on structure and electric properties of the KNBT ceramics was investigated. Phase analysis was performed by X-ray diffraction analyses (XRD) and Raman spectroscopy. Microstructural morphology was assessed by the scanning electron microscopy (SEM). Piezoelectric performances of manganese modified KNBT ceramics were improved significantly compared with that of the KNBT ceramic. The maximum of piezoelectric coefficient (d 33 ) was found to be 28 pC/N for the KNBT-Mn50 ceramic, together with high Curie temperature (T c ∼ 657 °C) and high resistivity (higher than 10 6 Ω cm). In addition, excellent temperature stability of piezoelectric performances was exhibited for manganese modified KNBT lead-free piezoelectric ceramics
Different NaCl-Induced Calcium Signatures in the Arabidopsis thaliana Ecotypes Col-0 and C24
Schmöckel, Sandra M.
2015-02-27
A common feature of stress signalling pathways are alterations in the concentration of cytosolic free calcium ([Ca2+]cyt), which allow the specific and rapid transmission of stress signals through a plant after exposure to a stress, such as salinity. Here, we used an aequorin based bioluminescence assay to compare the NaCl-induced changes in [Ca2+]cyt of the Arabidopsis ecotypes Col-0 and C24. We show that C24 lacks the NaCl specific component of the [Ca2+]cyt signature compared to Col-0. This phenotypic variation could be exploited as a screening methodology for the identification of yet unknown components in the early stages of the salt signalling pathway.
Different NaCl-Induced Calcium Signatures in the Arabidopsis thaliana Ecotypes Col-0 and C24
Schmö ckel, Sandra M.; Garcia, Alexandre F.; Berger, Bettina; Tester, Mark A.; Webb, Alex A. R.; Roy, Stuart J.
2015-01-01
A common feature of stress signalling pathways are alterations in the concentration of cytosolic free calcium ([Ca2+]cyt), which allow the specific and rapid transmission of stress signals through a plant after exposure to a stress, such as salinity. Here, we used an aequorin based bioluminescence assay to compare the NaCl-induced changes in [Ca2+]cyt of the Arabidopsis ecotypes Col-0 and C24. We show that C24 lacks the NaCl specific component of the [Ca2+]cyt signature compared to Col-0. This phenotypic variation could be exploited as a screening methodology for the identification of yet unknown components in the early stages of the salt signalling pathway.
Activity coefficients of LiCl in (PEG 4000 + water) at T = (288.15, 298.15, and 308.15) K
International Nuclear Information System (INIS)
Morales, Jaime W.; Galleguillos, Hector R.; Graber, Teofilo A.; Hernandez-Luis, Felipe
2010-01-01
The electromotive force of the cell containing two ion-selective electrodes (ISE), Na-ISE|LiCl(m),PEG4000(w),H 2 O(1-w)|Cl-ISE has been measured at temperatures of (288.15, 298.15, and 308.15) K as a function of the mass fraction of PEG 4000 (w) in the mixture. w was varied between 0 and 0.25 in 0.05-unit steps and the molality of the electrolyte (m) was between c.a. (0.03 and 5.8) mol . kg -1 . The values of the standard electromotive force, E 0 , were determined using routine methods of extrapolation, together with extended Debye-Hueckel and Pitzer equations. The results obtained produced good internal consistency for all the temperatures studied. Once E 0 was determined, the mean ionic activity coefficients for LiCl, the Gibbs free energy of transfer from the water to (PEG 4000 + water), and the primary LiCl hydration number were calculated.
Activity coefficients of LiCl in (PEG 4000 + water) at T = (288.15, 298.15, and 308.15) K
Energy Technology Data Exchange (ETDEWEB)
Morales, Jaime W.; Galleguillos, Hector R.; Graber, Teofilo A. [Centro de Investigacion Cientifico y Tecnologico para la Mineria, Departamento de Ingenieria Quimica, Universidad de Antofagasta (Chile); Hernandez-Luis, Felipe, E-mail: ffhelu@ull.e [Departamento de Quimica Fisica, Universidad de La Laguna, Tenerife (Spain)
2010-10-15
The electromotive force of the cell containing two ion-selective electrodes (ISE), Na-ISE|LiCl(m),PEG4000(w),H{sub 2}O(1-w)|Cl-ISE has been measured at temperatures of (288.15, 298.15, and 308.15) K as a function of the mass fraction of PEG 4000 (w) in the mixture. w was varied between 0 and 0.25 in 0.05-unit steps and the molality of the electrolyte (m) was between c.a. (0.03 and 5.8) mol . kg{sup -1}. The values of the standard electromotive force, E{sup 0}, were determined using routine methods of extrapolation, together with extended Debye-Hueckel and Pitzer equations. The results obtained produced good internal consistency for all the temperatures studied. Once E{sup 0} was determined, the mean ionic activity coefficients for LiCl, the Gibbs free energy of transfer from the water to (PEG 4000 + water), and the primary LiCl hydration number were calculated.
17 CFR 240.15c1-7 - Discretionary accounts.
2010-04-01
... transactions or purchase or sale which are excessive in size or frequency in view of the financial resources... Securities Exchange Act of 1934 Rules Relating to Over-The-Counter Markets § 240.15c1-7 Discretionary...
Neurological disease mutations compromise a C-terminal ion pathway in the Na(+)/K(+)-ATPas
DEFF Research Database (Denmark)
Poulsen, Hanne; Khandelia, Himanshu; Morth, Jens Preben
2010-01-01
severe neurological diseases. This novel model for ion transport by the Na(+)/K(+)-ATPase is established by electrophysiological studies of C-terminal mutations in familial hemiplegic migraine 2 (FHM2) and is further substantiated by molecular dynamics simulations. A similar ion regulation is likely...
Neurological disease mutations compromise a C-terminal ion pathway in the Na(+)/K(+)-ATPase
DEFF Research Database (Denmark)
Poulsen, Hanne; Khandelia, Himanshu; Morth, J Preben
2010-01-01
severe neurological diseases. This novel model for ion transport by the Na(+)/K(+)-ATPase is established by electrophysiological studies of C-terminal mutations in familial hemiplegic migraine 2 (FHM2) and is further substantiated by molecular dynamics simulations. A similar ion regulation is likely...
Avoiding Extremes: Benefits of Staying below +1.5 °C Compared to +2.0 °C and +3.0 °C Global Warming
Directory of Open Access Journals (Sweden)
Claas Teichmann
2018-03-01
Full Text Available The need to restrict global mean temperature to avoid irreversible climate change is supported by scientific evidence. The need became political practice at the Conference of the Parties in 2015, where the participants decided to limit global warming to not more than +2.0 °C compared to pre-industrial times and to rather aim for a limit of +1.5 °C global warming. Nevertheless, a clear picture of what European climate would look like under +1.5 °C, +2.0 °C and +3.0 °C global warming level (GWL is still missing. In this study, we will fill this gap by assessing selected climate indices related to temperature and precipitation extremes, based on state of the art regional climate information for Europe taken from the European branch of the World Climate Research Program Coordinated Regional Downscaling Experiment (EURO-CORDEX ensemble. To assess the impact of these indices under climate change, we investigate the spatial extent of the area of the climate change signal in relation to the affected population. This allows us to demonstrate which climate extremes could be avoided when global warming is kept well below +2.0 °C or even +1.5 °C compared to higher GWLs. The European north–south gradient of tropical nights and hot days is projected to be intensified with an increasing global warming level. For precipitation-related indices, an overall increase in precipitation extremes is simulated, especially under +3.0 °C GWL, for mid- and northern Europe, whereas an increase in dry days is projected for many regions in southern Europe. The benefit of staying below +1.5 °C GWL compared to +2.0 °C GWL is the avoidance of an additional increase in tropical nights and hot days parallel to an increase in dry days in parts of southern Europe as well as an increase in heavy precipitation in parts of Scandinavia. Compared to +3.0 °C GWL, the benefit of staying at +1.5 °C GWL is to avoid a substantial increase (i.e., an increase of more than five dry
Post-growth annealing treatment effects on properties of Na-doped CuInS2 thin films
International Nuclear Information System (INIS)
Zribi, M.; Kanzari, M.; Rezig, B.
2008-01-01
Structural and optical properties of Na-doped CuInS 2 thin films grown by double source thermal evaporation method were studied. The films were annealed from 250 to 500 deg. C in a vacuum after evaporation. X-ray diffraction pattern indicated that there are traces of Cu and In 6 S 7 , which disappeared on annealing above 350 deg. C. Good quality CuInS 2 :Na 0.3% films were obtained on annealing at 500 deg. C. Furthermore, we found that the absorption coefficient of Na-doped CuInS 2 thin films reached 1.5 x 10 5 cm -1 . The change in band gap of the doped samples annealed in the temperatures from 250 to 500 deg. C was in the range 0.038-0.105 eV
Uncertain impacts on economic growth when stabilizing global temperatures at 1.5°C or 2°C warming.
Pretis, Felix; Schwarz, Moritz; Tang, Kevin; Haustein, Karsten; Allen, Myles R
2018-05-13
Empirical evidence suggests that variations in climate affect economic growth across countries over time. However, little is known about the relative impacts of climate change on economic outcomes when global mean surface temperature (GMST) is stabilized at 1.5°C or 2°C warming relative to pre-industrial levels. Here we use a new set of climate simulations under 1.5°C and 2°C warming from the 'Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) project to assess changes in economic growth using empirical estimates of climate impacts in a global panel dataset. Panel estimation results that are robust to outliers and breaks suggest that within-year variability of monthly temperatures and precipitation has little effect on economic growth beyond global nonlinear temperature effects. While expected temperature changes under a GMST increase of 1.5°C lead to proportionally higher warming in the Northern Hemisphere, the projected impact on economic growth is larger in the Tropics and Southern Hemisphere. Accounting for econometric estimation and climate uncertainty, the projected impacts on economic growth of 1.5°C warming are close to indistinguishable from current climate conditions, while 2°C warming suggests statistically lower economic growth for a large set of countries (median projected annual growth up to 2% lower). Level projections of gross domestic product (GDP) per capita exhibit high uncertainties, with median projected global average GDP per capita approximately 5% lower at the end of the century under 2°C warming relative to 1.5°C. The correlation between climate-induced reductions in per capita GDP growth and national income levels is significant at the p < 0.001 level, with lower-income countries experiencing greater losses, which may increase economic inequality between countries and is relevant to discussions of loss and damage under the United Nations Framework Convention on Climate Change.This article is part of
Site occupancies in ternary C15 ordered Laves phases
International Nuclear Information System (INIS)
Kotula, P.G.; Chu, F.; Thoma, D.J.; Mitchell, T.E.; Anderson, I.M.; Bentley, J.
1996-01-01
Site occupancies in three C15-structured AB 2 (X) Laves phases have been determined by Atom Location by CHanneling Enhanced MIcroanalysis (ALCHEMI). In NbCr 2 (V), the results were consistent with exclusive site occupancies of Nb for the A sublattice and Cr and V for the B sublattice. The B-site occupancy of V is not expected from atom size effects alone. In NbCr 2 (Ti), the results were consistent with Ti partitioning mostly to the A sites with some anti-site defects likely. In HfV 2 (Nb), the results were consistent with Nb partitioning between the A and B sites. The results of the ALCHEMI analyses of these ternary C15 Laves phase materials will be discussed with respect to previously determined phase diagrams and first-principles total energy and electronic structure calculations
Li, Guangqiang; Jiang, Danlu; Wang, Hui; Lan, Xinzheng; Zhong, Honghai; Jiang, Yang
2014-11-01
A novel electrode material for sodium-ion batteries (NIBs), Na3V2(PO4)3 with a rhombohedral, Na+ superionic conductor (NASICON)-type structure, was synthesised via a solid-state carbon-thermal reduction reaction assisted by mechanochemical activation. Electron microscopy analysis showed that the synthesised Na3V2(PO4)3 particles had an average size of 300 nm, being coated with a uniform layer of carbon 3 nm in thickness. As a cathode material, Na3V2(PO4)3/C exhibited an initial specific discharge capacity of 98.17 mAh g-1 at 0.1C for potentials ranging from 2.5 to 3.8 V. This was owing to the V3+/V4+ redox couple, which corresponded to the two-phase transition between Na3V2(PO4)3 and NaV2(PO4)3. The cathode lost 4.92% of its discharge specific capacity after 50 cycles. As an anode material, Na3V2(PO4)3/C exhibited an initial specific discharge capacity of 63.2 mAh g-1 at 0.1C for potentials ranging from 1.0 to 2.5 V. This was owing to the V2+/V3+ redox couple, which corresponded to the two-phase transition between Na3V2(PO4)3 and Na4V2(PO4)3. The anode lost approximately 5.41% of its discharge specific capacity after 50 cycles. The three-dimensional channel structure of NaV2(PO4)3 and the changes induced in its lattice parameters during the charge/discharge processes were simulated on the basis of density functional theory.
International Nuclear Information System (INIS)
Wang Chunming; Wang Jinfeng; Zheng Limei; Zhao Minglei; Wang Chunlei
2010-01-01
The dielectric, piezoelectric, and electromechanical properties of B-site cobalt-modified sodium lanthanum bismuth titanate (Na 0.5 La 0.5 Bi 4 Ti 4 O 15 , NLBT) piezoelectric ceramics were investigated. The piezoelectric properties of NLBT ceramics can be enhanced by cobalt modifications. The NLBT ceramics modified with 0.2 wt.% cobalt trioxide (NLBT-C4) possess good piezoelectric properties, with piezoelectric coefficient d 33 of 27 pC/N, electromechanical coupling factors (k p and k t ) of 6.5% and 28.5%, and mechanical quality factor Q m (k p mode) of 3400. The Curie temperature T c of cobalt-modified NLBT ceramics was found to slightly higher than that of pure NLBT ceramics. A large dielectric abnormity in dielectric loss tan δ was observed in NLBT ceramics, which can be significantly suppressed by cobalt modification. Thermal annealing studies presented the cobalt-modified NLBT ceramics possess stable piezoelectric properties.
Energy Technology Data Exchange (ETDEWEB)
Iqbal, Muhammad Javed [Department of Chemistry, Quaid-i-Azam University, Islamabad, Capital 54320 (Pakistan)]. E-mail: mjiqauchem@yahoo.com; Malik, Qaisar Mahmood [Department of Chemistry, Quaid-i-Azam University, Islamabad, Capital 54320 (Pakistan)]. E-mail: qaisar_@hotmail.com
2005-12-15
The apparent molar volume of paracetamol (4-acetamidophenol) in water, 0.1 M HCl and 0.154 M NaCl as solvents at (298.15, 303.15, 308.15 and 310.65) K temperatures and at a pressure of 101.325 kPa were determined from the density data obtained with the help of a vibrating-tube Anton Paar DMA-48 densimeter. The partial molar volume, V {sub m}, of paracetamol in these solvents at different temperatures was evaluated by extrapolating the apparent molar volume versus molality plots to m = 0. In addition, the partial molar expansivity, E {sup .}, the isobaric coefficient of thermal expansion, {alpha} {sub p}, and the interaction coefficient, S {sub v}, have also been computed. The expansivity data show dependence of E {sup .} values on the structure of the solute molecules.
International Nuclear Information System (INIS)
Iqbal, Muhammad Javed; Malik, Qaisar Mahmood
2005-01-01
The apparent molar volume of paracetamol (4-acetamidophenol) in water, 0.1 M HCl and 0.154 M NaCl as solvents at (298.15, 303.15, 308.15 and 310.65) K temperatures and at a pressure of 101.325 kPa were determined from the density data obtained with the help of a vibrating-tube Anton Paar DMA-48 densimeter. The partial molar volume, V m , of paracetamol in these solvents at different temperatures was evaluated by extrapolating the apparent molar volume versus molality plots to m = 0. In addition, the partial molar expansivity, E . , the isobaric coefficient of thermal expansion, α p , and the interaction coefficient, S v , have also been computed. The expansivity data show dependence of E . values on the structure of the solute molecules
States of 15C via the (18O,16O) reaction
Cappuzzello, F; Cunsolo, A; Foti, A; Orrigo, S E A; Rodrigues, M R D; Borello-Lewin, T; Carbone, D; Schillaci, C
2010-01-01
A study of the 15C states was pursued in 2008 at the Catania INFN-LNS laboratory by the 13C(18O,16O)15C reaction at 84 MeV incident energy. The 16O ejectiles were detected at forward angles by the MAGNEX magnetic spectrometer. Thanks to an innovative technique the ejectiles were identified without the need of time of flight measurements. Exploiting the large momentum acceptance (25%) and solid angle (50 msr) of the spectrometer, the 15C energy spectra were obtained with a quite relevant yield up to about 20 MeV excitation energy. The application of the powerful technique of the trajectory reconstruction did allow to get an energy resolution of about 250 keV FWHM, limited mainly by straggling effects. The spectra show several known low lying states up to about 7 MeV excitation energy as well as two unknown resonant structures at about 11.4 and 13.5 MeV. The strong excitation of these latter together with the measured width of about 2 MeV FWHM could indicate the presence of collective modes of excitation connec...
Energy Technology Data Exchange (ETDEWEB)
Tanis, Elizabeth A.; Simon, Adam; Tschauner, Oliver; Chow, Paul; Xiao, Yuming; Burnley, Pamela; Cline II, Christopher J.; Hanchar, John M.; Pettke, Thomas; Shen, Guoyin; Zhao, Yusheng (MUN); (Michigan); (CIW); (UNLV); (Bern)
2015-08-26
Rutile (TiO₂) is an important host phase for high field strength elements (HFSE) such as Nb in metamorphic and subduction zone environments. The observed depletion of Nb in arc rocks is often explained by the hypothesis that rutile sequesters HFSE in the subducted slab and overlying sediment, and is chemically inert with respect to aqueous fluids evolved during prograde metamorphism in the forearc to subarc environment. However, field observations of exhumed terranes, and experimental studies, indicate that HFSE may be soluble in complex aqueous fluids at high pressure (i.e., >0.5 GPa) and moderate to high temperature (i.e., >300 °C). In this study, we investigated experimentally the mobility of Nb in NaCl- and NaF-bearing aqueous fluids in equilibrium with Nb-bearing rutile at pressure-temperature conditions applicable to fluid evolution in arc environments. Niobium concentrations in aqueous fluid at rutile saturation were measured directly by using a hydrothermal diamond-anvil cell (HDAC) and synchrotron X-ray fluorescence (SXRF) at 2.1 to 6.5 GPa and 300–500 °C, and indirectly by performing mass loss experiments in a piston-cylinder (PC) apparatus at ~1 GPa and 700–800 °C. The concentration of Nb in a 10 wt% NaCl aqueous fluid increases from 6 to 11 μg/g as temperature increases from 300 to 500 °C, over a pressure range from 2.1 to 2.8 GPa, consistent with a positive temperature dependence. The concentration of Nb in a 20 wt% NaCl aqueous fluid varies from 55 to 150 μg/g at 300 to 500 °C, over a pressure range from 1.8 to 6.4 GPa; however, there is no discernible temperature or pressure dependence. The Nb concentration in a 4 wt% NaF-bearing aqueous fluid increases from 180 to 910 μg/g as temperature increases from 300 to 500 °C over the pressure range 2.1 to 6.5 GPa. The data for the F-bearing fluid indicate that the Nb content of the fluid exhibits a dependence on temperature between 300 and 500 °C at ≥2 GPa, but there is no observed
Influence of defects on the incommensurate modulation in irradiated Ba2NaNb5O15
International Nuclear Information System (INIS)
Barre, S.; Mutka, H.; Roucau, C.; Litzler, A.; Schneck, J.; Toledano, J.C.; Bouffard, S.; Rullier-Albenque, F.
1991-01-01
Defect-induced properties of barium sodium niobate (Ba 2 NaNb 5 O 15 ) have been studied as a function of electron irradiation dose. Birefringence measurements at low doses indicate that the lock-in transition temperature, originally at about 280 degree C, decreases linearly with increasing dose. Complementary irradiations in situ in a high-voltage electron microscope show that the incommensurate phase can be stabilized down to room temperature. Simultaneously the satellite diffraction spots broaden and the lock-in transition becomes diffuse. The modification of the hysteresis of the birefringence, observed already at the lowest doses, indicates a progressive extension of the stability range of the 2q modulated phase to lower temperatures as the defect concentration increases. A similar conclusion can be drawn from the satellite reflection dark-field electron micrographs that show, once the incommensurate phase is stabilized at room temperature, the doubly modulated texture characteristic of the 2q modulated phase. Low doses of irradiation do not change qualitatively the configuration of the residual discommensurations in the lock-in phase nor the temperature dependence of the incommensurability. Accordingly, already in the as-grown samples the defects dominate the pinning of the incommensurate modulation and the intrinsic properties of this incommensurate system are not clearly observable
International Nuclear Information System (INIS)
Roy, Rabindra N.; Roy, Lakshmi N.; LeNoue, Sean R.; Denton, Cole E.; Simon, Ashley N.; Richards, Sarah J.; Moore, Andrew C.; Roy, Chandra N.; Redmond, R. Ryan; Bryant, Paul A.
2006-01-01
Values of the second thermodynamic dissociation constant pK 2 of N-[tris(hydroxymethyl)methyl-3-amino]propanesulfonic acid (Taps) have been determined at twelve temperatures from 278.15 K to 328.15 K including 310.15 K by measurements of the electromotive-force for cells without liquid junction of the type: Pt|H 2 (g, p - bar =101.325 kPa)|Taps (m 1 ), NaTapsate (m 2 ), NaCl (m 3 )|AgCl|Ag, where m denotes molality. The pK 2 values for the dissociation of Taps are represented by the equation: pK 2 =2969.61.(K/T) - 17.05052+2.73697.ln(T/K). The values of pK 2 for Taps were found to be (8.502+/-0.0007) at T=298.15 K and (8.225+/-0.0009) at T=310.15 K, respectively, indicating thereby to be useful as buffer solutions for pH control in the region 7.4 to 8.5. The thermodynamic quantities, ΔG - bar , ΔH - bar , ΔS - bar , and ΔC p - bar dissociation process of Taps have been derived from the temperature coefficients of the pK 2
Directory of Open Access Journals (Sweden)
Glauber José de Castro Gava
2006-01-01
Full Text Available Este trabalho teve como objetivo estudar as possíveis alterações na produção e partição da fitomassa vegetal, no acúmulo de nitrogênio total e do nitrogênio na planta proveniente do fertilizante (NPPF, utilizando-se uréia (15N aplicada em adubação de cobertura, na cultura do milho, na fase de implantação do manejo de semeadura direta. Com essa finalidade foi desenvolvido um experimento em campo, em Nitossolo localizado na Fazenda Água Sumida próximo ao município de Barra Bonita (SP. O delineamento experimental foi o de blocos completos ao acaso, com quatro repetições. Os tratamentos estudados foram: sistema de plantio convencional (uma aração e duas gradagens e sistema de semeadura direta, ambos adubados com uréia (15N, na dose de 100 kg ha-1 de N em cobertura. Em todos os tratamentos, foi feita adubação de semeadura, aplicando-se 25 kg ha-1 de N na forma de uréia, 80 kg ha-1 de P2O5 na forma de superfosfato simples e 60 kg ha-1 de K2O como cloreto de potássio. No fim do ciclo foram realizadas comparações entre os tratamentos, da produtividade da cultura; da acumulação de nitrogênio pela parte aérea e parte subterrânea; da utilização do nitrogênio da uréia (15N pela cultura do milho e do nitrogênio residual do fertilizante no solo. As modificações no solo causadas pela implantação da semeadura direta não restringiram a disponibilidade de N para as plantas de milho e, por conseguinte, a produção de material seco. A eficiência de utilização do fertilizante nitrogenado (EUFN pelo milho e a recuperação do fertilizante nitrogenado no solo (RFNS foram, respectivamente, em torno de 45% e 30% para o N-uréia aplicado em cobertura não havendo diferença entre os sistemas de cultivo convencional e direto. Independentemente do sistema, o nitrogênio não recuperado da uréia, aplicado em cobertura na cultura do milho (NNR foi em média de 25%.This work aimed to study possible alterations in the production
Directory of Open Access Journals (Sweden)
Diego V. Beckmann
2010-02-01
Full Text Available O objetivo deste experimento foi isolar a musculatura epaxial da medula espinhal de cães submetidos à laminectomia dorsal modificada (LDM e averiguar se os músculos influenciaram na formação da fibrose epidural, na compressão medular e no aparecimento dos sinais neurológicos. Para isso, dez cães hígidos foram submetidos à LDM entre as vértebras T13 e L1 e distribuídos aleatoriamente em dois grupos denominados controle (I onde a medula espinhal permaneceu exposta sem a presença de implante, e tratado (IIonde foi colocado um im-plante a base de alumínio entre a musculatura epaxial adjacente e a medula espinhal exposta pela LDM. As avaliações constaram de exames neurológicos diários até 180 dias de pós-operatório (PO; mielografia, decorridos 15, 30 e 60 dias de PO; e avaliação macroscópica mediante a reintervenção cirúrgica. Não houve diferença durante as avaliações neurológicas. Aos 15 dias de PO, foi verificado na mielografia, que o grau de compressão da linha de contraste foi maior no grupo tratado (PThe purpose of this study was to isolate the adjacent epaxial musculature from exposed spinal cord by modified dorsal laminectomy in dogs with aluminum implant and to verify whether the muscles contribute to form epidural fibrosis, spinal cord compression, and development of neurological signs. Ten dogs were submitted to modified dorsal laminectomy between T13 and L1 and then distributed along two groups. Dogs in the group 1 remained with the spinal cord exposed without the implant; dogs in the group 2 had an aluminum implant inserted between the epaxial muscles and the exposed spinal cord. Neurological examination was daily performed until 180 days post surgery. Additionally, myelography at 15, 30, and 60 days post surgery and macroscopic evaluation of the implant at six months post surgery were done. There was no difference between groups in the neurological examination. A statistical difference in the degree of
International Nuclear Information System (INIS)
Darriet, J.; Maazaz, A.; Bouloux, J.C.; Delmas, C.
1982-01-01
New ternary oxides of formulas Na 5 NbO 5 and Na 5 TaO 5 have been prepared. They crystallize in the monoclinic system (space group C2/c). The crystal structure of Na 5 NbO 5 has been determined. It derives from a NaCl-type structure by ordering of the cations and of the oxygen vacancies in the anionic sublattice, the corresponding formula being Nasub(5/6)Nbsub(1/6)Osub(5/6)vacant sub(1/6). Sodium and niobium have a distorted square-pyramidal surrounding. (author)
Directory of Open Access Journals (Sweden)
Greca Fernando Hintz
2000-01-01
Full Text Available A sacropromonto-fixação no tratamento do prolapso retal é freqüentemente realizada através do uso de telas, suturas ou associações destas com ressecções. O objetivo deste trabalho foi comparar a reação da parede retal em contato com duas telas macroporosas de polipropileno, bem como determinar a incorporação de colágeno às telas. Dezoito cães adultos, pesando entre 10 e 15 kg, divididos em 2 grupos de 9 animais, foram submetidos à laparotomia e retopexia pré-sacra, sendo a tela fixada com pontos de fio monofilamentar de náilon 3.0. No primeiro grupo utilizou-se a tela denominada X (porosidade = 4 mm x 3 mm, espessura = 0,2 mm e no segundo a tela de Prolene® (porosidade = 164 m x 96 m, espessura = 0,7 mm. No 30º dia de pós-operatório os animais foram sacrificados. A reação tissular foi avaliada macro e microscópicamente. Os parâmetros macroscópicos analisados foram: presença de seroma, hematoma, abscesso, fístula, estenose, aderência e não incorporação da tela. Na avaliação microscópica foram verificados: reação inflamatória, fibrose, presença de células gigantes e infiltração fibroblástica além da incorporação qualitativa e quantitativa de colágeno à tela. Verificou-se que na análise macroscópica e histológica as telas se comportaram de maneira semelhante. Já a densitometria do colágeno revelou maior incorporação de colágeno I (maduro na tela X, não havendo diferença significante quanto ao colágeno III (imaturo. Concluiu-se não haver diferença de parâmetros macroscópicos, histopatológicos ou de incorporação de colágeno III entre as duas telas. A tela com poros maiores incorporou mais colágeno I e consequentemente mais colágeno total.
International Nuclear Information System (INIS)
Ziemer, S.P.; Niederhauser, T.L.; Merkley, E.D.; Price, J.L.; Sorenson, E.C.; McRae, B.R.; Patterson, B.A.; Origlia-Luster, M.L.; Woolley, E.M.
2006-01-01
We have measured the densities of aqueous solutions of glycine, glycine plus equimolal HCl, and glycine plus equimolal NaOH at temperatures 278.15 ≤ T/K ≤ 368.15, molalities 0.01 ≤ m/mol . kg -1 ≤ 1.0, and at p = 0.35 MPa, using a vibrating tube densimeter. We have also measured the heat capacities of these solutions at 278.15 ≤ T/K ≤ 393.15 and at the same m and p using a fixed-cell differential scanning calorimeter. We used the densities to calculate apparent molar volumes V φ and the heat capacities to calculate apparent molar heat capacities C p,φ for these solutions. We used our results and values of V φ (T, m) and C p,φ (T, m) for HCl(aq), NaOH(aq), NaCl(aq) from the literature to calculate parameters for Δ r C p,m (T, m) for the first and second proton dissociations from protonated aqueous cationic glycine. We then integrated this value of Δ r C p,m (T, m) in an iterative algorithm, using Young's Rule to account for the effects of speciation and chemical relaxation on the observed V φ and C p,φ of the solutions. This procedure yielded parameters for V φ (T, m) and C p,φ (T, m) for glycinium chloride {H 2 Gly + Cl - (aq)} and sodium glycinate {Na + Gly - (aq)} which successfully modeled our observed results. We have then calculated values of Δ r C p,m , Δ r H m , Δ r V m , and pQ a for the first and second proton dissociations from protonated aqueous glycine as functions of T and m
International Nuclear Information System (INIS)
Lamela, J; Ródenas, A; Lifante, G; Jaque, D; Jaque, F; Kaminskii, A A
2008-01-01
In this paper we report on experimental evidence of laser light confinement between ferroelectric domains in the neodymium doped Ba 2 NaNb 5 O 15 ferroelectric crystal. High contrast near field optical microscopy images have been obtained as a consequence of the periodic modulation in the refractive index caused by the presence of 2D antiparallel ferroelectric domains
Papel de la proteína C reactiva en las enfermedades cardiovasculares
Directory of Open Access Journals (Sweden)
Fernando Manzur, MD., FACC
2011-08-01
Full Text Available La proteína C-reactiva (PCR, un marcador sensible de inflamación, es un predictor independiente de enfermedad cardiovascular futura (ECV, que es una de las principales causas de muerte en todo el mundo. El papel de la inflamación en esta entidad ha sido bien documentado en la última década, y se ha demostrado inflamación en todas las fases de la aterosclerosis, desde el inicio y el crecimiento, hasta la ruptura de la placa. La PCR es una proteína de fase aguda, altamente sensible como marcador de inflamación general. En estudios experimentales, se ha determinado la presencia de PCR en arterias que presentan lesiones ateroscleróticas. También se ha demostrado que, en forma directa, la PCR induce la producción de otras células inflamatorias y que disminuye la expresión de la óxido nítrico sintetasa. Es decir, desde el punto de vista biológico, la PCR participa en el proceso aterogénico. En adultos, la PCR, detectada con técnicas ultrasensibles (PCRus, se asocia con los factores de riesgo tradicionales y su concentración predice eventos cardiovasculares.
Na7 [Fe2S6 ] , Na2 [FeS2 ] and Na2 [FeSe2 ] : New 'reduced' sodium chalcogenido ferrates
Stüble, Pirmin; Peschke, Simon; Johrendt, Dirk; Röhr, Caroline
2018-02-01
Three new 'reduced' FeII containing sodium chalcogenido ferrates were obtained applying a reductive synthetic route. The mixed-valent sulfido ferrate Na7 [Fe2S6 ] , which forms bar-shaped crystals with metallic greenish luster, was synthesized in pure phase from natural pyrite and elemental sodium at a maximum temperature of 800 °C. Its centrosymmetric triclinic structure (SG P 1 bar , a = 764.15(2), b = 1153.70(2), c = 1272.58(3) pm, α = 62.3325 (7) , β = 72.8345 (8) , γ = 84.6394 (8) ° , Z = 3, R1 = 0.0185) exhibits two crystallographically different [Fe2S6 ] 7 - dimers of edge-sharing [FeS4 ] tetrahedra, with somewhat larger Fe-S distances than in the fully oxidized FeIII dimers of e.g. Na6 [Fe2III S6 ] . In contrast to the localized AFM ordered pure di-ferrates(III), the Curie-Weiss behavior of the magnetic susceptibility proves the rarely observed valence-delocalized S = 9/2 state of the mixed-valent FeIII /FeII dimer. The nearly spin-only value of the magnetic moment combined with the chemical bonding not generally differing from that in pure ferrates(II) and (III), provides a striking argument, that the reduction of the local Fe spin moments observed in all condensed sulfido ferrate moieties is connected with the AFM spin ordering. The two isotypic ferrates(II) Na2 [FeS2 ] and Na2 [FeSe2 ] with chain-like structural units (SG Ibam, a = 643.54(8)/ 660.81(1), b = 1140.2(2)/1190.30(2) c = 562.90(6)/585.59(1) pm, Z = 4, R1 = 0.0372/0.0466) crystallize in the K2 [ZnO2 ] -type structure. Although representing merely further members of the common series of chalcogenido metallates(II) Na2 [MIIQ2 ] , these two new phases, together with Na6 [FeS4 ] and Li2 [FeS2 ] , are the only examples of pure FeII alkali chalcogenido ferrates. The new compounds allow for a general comparison of di- and chain ferrates(II) and (III) and mixed-valent analogs concerning the electronic and magnetic properties (including Heisenberg super-exchange and double-exchange interactions
Directory of Open Access Journals (Sweden)
Luiz Antenor Rizzon
2005-06-01
Full Text Available A uva Isabel (Vitis labrusca é a cultivar de videira mais difundida na Região Vitícola da Serra Gaúcha. Entre outras finalidades, é utilizada para a elaboração de vinho tinto de mesa, o qual, geralmente, apresenta acidez elevada, devido ao teor de ácido tartárico livre. O objetivo do presente trabalho foi avaliar a influência de diferentes doses de carbonato de cálcio (0,0; 0,5; 1,0; 1,5; 2,0; 2,5 e 3,0 g L-1 na correção da acidez e na composição do vinho Isabel da Serra Gaúcha. O estudo foi realizado na Embrapa Uva e Vinho, em Bento Gonçalves - RS, na safra de 2002. O delineamento experimental utilizado foi o de blocos casualizados, com sete tratamentos e quatro repetições. As análises dos vinhos, realizadas dez dias após o tratamento, constaram da densidade, álcool, acidez total, acidez volátil, pH, açúcares redutores, extrato seco, extrato seco reduzido, cinzas, densidade ótica a 420, 520 e 620 nm, intensidade de cor e coloração, efetuadas através de métodos físico-químicos. O ácido tartárico foi determinado através da cromatografia líquida de alta eficiência (CLAE. O potássio e o cálcio foram analisados por espectrofotometria de absorção atômica. Além da redução da acidez do vinho Isabel, o carbonato de cálcio interferiu na cor, no extrato seco, nas cinzas e no teor de elementos minerais do vinho Isabel.Isabel grape (Vitis labrusca is the variety mostly spread in the Serra Gaúcha Region which is used, among other purposes, to elaborate red table wines. This wine usually presents high acidity, due to the level of free tartaric acid. The purpose of this work was to evaluate the effect of different doses of calcium carbonate in acidity and in the Isabel wine composition of the Serra Gaúcha region. The study carried out at Embrapa Uva e Vinho consisted of application in Isabel wine, from the 2002 vintage, different concentrations of calcium carbonate (0,0; 0,5; 1,0; 1,5; 2,0; 2,5 and 3,0 g L-1. The
Record-breaking climate extremes in Africa under stabilized 1.5 °C and 2 °C global warming scenarios
Nangombe, Shingirai; Zhou, Tianjun; Zhang, Wenxia; Wu, Bo; Hu, Shuai; Zou, Liwei; Li, Donghuan
2018-05-01
Anthropogenic forcing is anticipated to increase the magnitude and frequency of extreme events1, the impacts of which will be particularly hard-felt in already vulnerable locations such as Africa2. However, projected changes in African climate extremes remain little explored, particularly in the context of the Paris Agreement targets3,4. Here, using Community Earth System Model low warming simulations5, we examine how heat and hydrological extremes may change in Africa under stabilized 1.5 °C and 2 °C scenarios, focusing on the projected changing likelihood of events that have comparable magnitudes to observed record-breaking seasons. In the Community Earth System Model, limiting end-of-century warming to 1.5 °C is suggested to robustly reduce the frequency of heat extremes compared to 2 °C. In particular, the probability of events similar to the December-February 1991/1992 southern African and 2009/2010 North African heat waves is estimated to be reduced by 25 ± 5% and 20 ± 4%, respectively, if warming is limited to 1.5 °C instead of 2 °C. For hydrometeorological extremes (that is, drought and heavy precipitation), by contrast, signal differences are indistinguishable from the variation between ensemble members. Thus, according to this model, continued efforts to limit warming to 1.5 °C offer considerable benefits in terms of minimizing heat extremes and their associated socio-economic impacts across Africa.
White, Caroline N; Liu, Chia-Chi; Garcia, Alvaro; Hamilton, Elisha J; Chia, Karin K M; Figtree, Gemma A; Rasmussen, Helge H
2010-04-30
Cellular signaling can inhibit the membrane Na(+)-K(+) pump via protein kinase C (PKC)-dependent activation of NADPH oxidase and a downstream oxidative modification, glutathionylation, of the beta(1) subunit of the pump alpha/beta heterodimer. It is firmly established that cAMP-dependent signaling also regulates the pump, and we have now examined the hypothesis that such regulation can be mediated by glutathionylation. Exposure of rabbit cardiac myocytes to the adenylyl cyclase activator forskolin increased the co-immunoprecipitation of NADPH oxidase subunits p47(phox) and p22(phox), required for its activation, and increased superoxide-sensitive fluorescence. Forskolin also increased glutathionylation of the Na(+)-K(+) pump beta(1) subunit and decreased its co-immunoprecipitation with the alpha(1) subunit, findings similar to those already established for PKC-dependent signaling. The decrease in co-immunoprecipitation indicates a decrease in the alpha(1)/beta(1) subunit interaction known to be critical for pump function. In agreement with this, forskolin decreased ouabain-sensitive electrogenic Na(+)-K(+) pump current (arising from the 3:2 Na(+):K(+) exchange ratio) of voltage-clamped, internally perfused myocytes. The decrease was abolished by the inclusion of superoxide dismutase, the inhibitory peptide for the epsilon-isoform of PKC or inhibitory peptide for NADPH oxidase in patch pipette solutions that perfuse the intracellular compartment. Pump inhibition was also abolished by inhibitors of protein kinase A and phospholipase C. We conclude that cAMP- and PKC-dependent inhibition of the cardiac Na(+)-K(+) pump occurs via a shared downstream oxidative signaling pathway involving NADPH oxidase activation and glutathionylation of the pump beta(1) subunit.
17 CFR 240.15c1-9 - Use of pro forma balance sheets.
2010-04-01
... pro forma balance sheets. The term manipulative, deceptive, or other fraudulent device or contrivance... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Use of pro forma balance sheets. 240.15c1-9 Section 240.15c1-9 Commodity and Securities Exchanges SECURITIES AND EXCHANGE...
Future emissions pathways consistent with limiting warming to 1.5°C
Millar, R.; Fuglestvedt, J. S.; Grubb, M.; Rogelj, J.; Skeie, R. B.; Friedlingstein, P.; Forster, P.; Frame, D. J.; Pierrehumbert, R.; Allen, M. R.
2016-12-01
The stated aim of the 2015 UNFCCC Paris Agreement is `holding the increase in global average temperature to well below 2°C above pre-industrial levels and to pursue efforts to limit temperature increases to 1.5°C'. We show that emissions reductions proportional to those achieved in an ambitious mitigation scenario, RCP2.6, but beginning in 2017, give a median estimated peak warming of 1.5°C, with a likely (66% probability) range of uncertainty of 1.2-2.0°C. Such a scenario would be approximately consistent with the most ambitious interpretation of the 2030 emissions pledges, but requires reduction rates exceeding 0.3GtC/yr/yr after 2030. A steady reduction at less than half this rate would achieve the same temperature outcome if initiated in 2020. Limiting total CO2 emissions after 2015 to 200GtC would limit future warming to likely less than 0.6°C above present, consistent with 1.5°C above pre-industrial, based on the distribution of responses of the CMIP5 Earth System, but the CMIP5 simulations do not correspond to scenarios that aim to limit warming to such low levels. If future CO2 emissions are successfully adapted to the emerging climate response so as to limit warming in 2100 to 0.6°C above present, and non-CO2 emissions follow the ambitious RCP2.6 scenario, then we estimate that resulting CO2 emissions will unlikely be restricted to less than 250GtC given current uncertainties in climate system response, although still-poorly-modelled carbon cycle feedbacks, such as release from permafrost, may encroach on this budget. Even under a perfectly successful adaptive mitigation regime, emissions consistent with limiting warming to 0.6°C above present are unlikely to be greater than 500GtC.These estimates suggest the 1.5°C goal may not yet be geophysically insurmountable but will nevertheless require, at minimum, the full implementation of the most ambitious interpretation of the Paris pledges followed by accelerated and more fundamental changes in our
Uso de resíduos industriais na remediação de solo contaminado com cádmio e zinco
Directory of Open Access Journals (Sweden)
Marcio Osvaldo Lima Magalhães
2011-06-01
Full Text Available Este trabalho teve como objetivo avaliar a utilização de dois resíduos industriais na redução de disponibilidade de zinco e cádmio em solo contaminado. O experimento foi conduzido em casa de vegetação na Universidade Federal Rural do Rio de Janeiro por 225 dias, utilizando-se um substrato contaminado com zinco e cádmio, coletado no pátio de minério do Porto de Itaguaí, e próximo ao local de disposição de resíduo perigoso da Cia Mercantil e Industrial Ingá em Itaguaí, RJ. O substrato foi tratado com dois agentes inertizantes, assim descritos: um resíduo industrial com característica alcalina (Escória de Aciaria em duas doses 4 e 6%, e outro com alto teor de óxido de ferro como adsorvente (Carepa de Laminação, em dose única de 1%. Após o plantio das mudas de Eucalyptus urophylla, foram feitas coletas do substrato em cada unidade experimental para determinação das frações biodisponíveis (extraído com MgCl2 e a não disponível. O substrato não tratado apresentava alto teor de cádmio e zinco na fração biodisponível. Os tratamentos causaram uma redução na disponibilidade desses elementos no solo, evidenciado na absorção diferenciada pelas plantas. Por causa da maior disponibilidade do cádmio e zinco no solo sem adição dos inertizantes, as plantas não resistiram aos altos teores desses elementos e morreram 30 dias após a implantação do experimento. A produção de massa seca foi influenciada positivamente pela aplicação dos agentes inertizantes, apresentando melhor resposta na maior dose de escória de aciaria. A maior dose também propiciou as menores concentrações dos elementos nas plantas, sem provocar deficiência do micronutriente zinco e mantendo o cádmio a níveis não tóxicos para as espécies de eucalipto. Apesar de apresentar menores concentrações de cádmio na dose de 6% de Escória de Aciaria,essa dose resultou na maior extração desse elemento pelas plantas.
DEFF Research Database (Denmark)
Petitprez, Séverine; Jespersen, Thomas; Pruvot, Etienne
2008-01-01
S SCN5A mutation. METHODS AND RESULTS: SCN5A was screened for mutations in a male patient with type-1 BrS pattern ECG. Wild-type (WT) and mutant Na(v)1.5 channels were expressed in HEK293 cells. Sodium currents (I(Na)) were analysed using the whole-cell patch-clamp technique at 37 degrees C......AIMS: Brugada syndrome (BrS) is characterized by arrhythmias leading to sudden cardiac death. BrS is caused, in part, by mutations in the SCN5A gene, which encodes the sodium channel alpha-subunit Na(v)1.5. Here, we aimed to characterize the biophysical properties and consequences of a novel Br....... The electrophysiological effects of the mutation were simulated using the Luo-Rudy model, into which the transient outward current (I(to)) was incorporated. A new mutation (C1850S) was identified in the Na(v)1.5 C-terminal domain. In HEK293 cells, mutant I(Na) density was decreased by 62% at -20 mV. Inactivation of mutant...
Modification of NaK (Na and K) dissolution device at the L.E.C.I
International Nuclear Information System (INIS)
Mansard, Bernard; Ducas, Serge; Riviere, Michel
1969-12-01
As three NaK dissolution devices had been operated since 1965 and as irradiation assemblies with a greater capacity (2 to 3 times) are now to be used, the modification of these dissolution devices is addressed. This requires a better control of the dissolution reaction (the NaK + alcohol reaction is highly exothermic and results in an effervescence which requires a greater volume). The objectives are therefore to delay the dissolution, to trigger it, to stop it, to control it at will, and to release heat. The new device is then described with its vessel, its cap, its ball valve, and its two tight sleeves. The operation principle is described, as well as the NaK draining process, and the NaK dissolution. Safety, time saving and raw matter saving issues are finally outlined
Scenario dependence of future changes in climate extremes under 1.5 °C and 2 °C global warming.
Wang, Zhili; Lin, Lei; Zhang, Xiaoye; Zhang, Hua; Liu, Liangke; Xu, Yangyang
2017-04-20
The 2015 Paris Agreement aims to limit global warming below 2 °C and pursue efforts to even limit it to 1.5 °C relative to pre-industrial levels. Decision makers need reliable information on the impacts caused by these warming levels for climate mitigation and adaptation measures. We explore the changes in climate extremes, which are closely tied to economic losses and casualties, under 1.5 °C and 2 °C global warming and their scenario dependence using three sets of ensemble global climate model simulations. A warming of 0.5 °C (from 1.5 °C to 2 °C) leads to significant increases in temperature and precipitation extremes in most regions. However, the projected changes in climate extremes under both warming levels highly depend on the pathways of emissions scenarios, with different greenhouse gas (GHG)/aerosol forcing ratio and GHG levels. Moreover, there are multifold differences in several heavily polluted regions, among the scenarios, in the changes in precipitation extremes due to an additional 0.5 °C warming from 1.5 °C to 2 °C. Our results demonstrate that the chemical compositions of emissions scenarios, not just the total radiative forcing and resultant warming level, must be considered when assessing the impacts of global 1.5/2 °C warming.
DEFF Research Database (Denmark)
Hangaard, Lise; Bouzinova, Elena; Stæhr, Christian Albeck
2017-01-01
Communication between vascular smooth muscle cells (VSMCs) is dependent on gap junctions and is regulated by the Na-K-ATPase. The Na-K-ATPase is therefore important for synchronized VSMC oscillatory activity, i.e., vasomotion. The signaling between the Na-K-ATPase and gap junctions is unknown. We...... coupling in rat mesenteric small arteries in vitro. Phosphorylation of cSrc kinase and connexin43 (Cx43) were semiquantified by Western blotting. Micromole concentration of ouabain reduced the amplitude of norepinephrine-induced vasomotion and desynchronized Ca2+ transients in VSMC in the arterial wall...
Cubic Crystal-Structured SnTe for Superior Li- and Na-Ion Battery Anodes.
Park, Ah-Ram; Park, Cheol-Min
2017-06-27
A cubic crystal-structured Sn-based compound, SnTe, was easily synthesized using a solid-state synthetic process to produce a better rechargeable battery, and its possible application as a Sn-based high-capacity anode material for Li-ion batteries (LIBs) and Na-ion batteries (NIBs) was investigated. The electrochemically driven phase change mechanisms of the SnTe electrodes during Li and Na insertion/extraction were thoroughly examined utilizing various ex situ analytical techniques. During Li insertion, SnTe was converted to Li 4.25 Sn and Li 2 Te; meanwhile, during Na insertion, SnTe experienced a sequential topotactic transition to Na x SnTe (x ≤ 1.5) and conversion to Na 3.75 Sn and Na 2 Te, which recombined into the original SnTe phase after full Li and Na extraction. The distinctive phase change mechanisms provided remarkable electrochemical Li- and Na-ion storage performances, such as large reversible capacities with high Coulombic efficiencies and stable cyclabilities with fast C-rate characteristics, by preparing amorphous-C-decorated nanostructured SnTe-based composites. Therefore, SnTe, with its interesting phase change mechanisms, will be a promising alternative for the oncoming generation of anode materials for LIBs and NIBs.
Directory of Open Access Journals (Sweden)
Edison Roberto Parise
2007-06-01
Full Text Available OBJETIVO: Revisar a importância da resistência insulínica no desenvolvimento da hepatite C crônica e sua interferência na resposta ao tratamento antiviral de pacientes infectados pelo vírus da hepatite C. FONTE DE DADOS: Revisão bibliográfica de trabalhos publicados pelo MEDLINE e dados dos próprios autores. SÍNTESE DE DADOS: Nos últimos anos, grande número de publicações tem demonstrado importante associação entre resistência insulínica e hepatite C crônica. Aumento na prevalência de diabetes mellitus tipo 2, desenvolvimento de esteatose hepática (principalmente nos pacientes com infecção pelo genótipo não-3, progressão mais rápida da doença e redução na taxa de resposta virológica sustentada ao tratamento com interferon peguilado e ribavirina, têm sido todos associados à presença de resistência insulínica nos pacientes infectados pelo vírus da hepatite C. A produção aumentada de fator de necrose tumoral pelo core do vírus da hepatite C é o principal mecanismo responsável pelo aparecimento da resistência insulínica. O fator de necrose tumoral afetaria a fosforilação do substrato do receptor de insulina diminuindo a captação de glicose e acarretando hiperinsulinemia compensatória. Aumento da siderose hepática e alterações dos níveis circulantes das adipocitocinas podem ter efeito adicional sobre a sensibilidade à insulina na hepatite C crônica. CONCLUSÕES: O diagnóstico e o tratamento da resistência insulínica nesses pacientes podem não só evitar o aparecimento das complicações, mas também prevenir a progressão da doença e, possivelmente, aumentar a taxa de resposta virológica sustentada ao tratamento com interferon peguilado e ribavirina.OBJECTIVE: To revise the importance of insulin resistance in the development of chronic hepatitis C and its interference in the response to the antiviral treatment of these patients. DATA SOURCE: Bibliographic revision of published papers in the
Santoso, Imam; Taskinen, Pekka
2016-08-01
Knowledge of phase equilibria in the TeO2-Na2O-SiO2 system at elevated temperatures is important for ceramic and glass industries and for improving the operation of the smelting process of tellurium-containing materials. A review of previous investigations has indicated, however, that there are omissions in the available datasets on the liquidus temperatures of the molten TeO2-Na2O-SiO2 mixtures. The employed experimental method included equilibration of mixtures made from high purity oxides, rapid quenching of the equilibrated samples in water and followed by compositional analysis of the phases using an electron probe X-ray microanalyzer. The liquidus and phase equilibria in the TeO2-SiO2, TeO2-Na2O, and SiO2-TeO2-Na2O systems have been studied for a wide range of compositions between 723 K (500 °C) and 1473 K (1200 °C) at TeO2, SiO2, and Na2SiO3 saturations. New data have been generated in the SiO2-TeO2-Na2O system at SiO2 saturation. The liquidus compositions in the TeO2-Na2O system at TeO2 saturation have been compared with the previous data and an assessed phase diagram.
Resonances in the nuclear reactions 15N + 12C and 15N + 16O
International Nuclear Information System (INIS)
Monnehan, G.A.
1987-06-01
The reaction 12 C + 15 N have been studied at 15 N beam energies between 30 and 70 MeV. For each reaction, about twelve residual nuclei have been identified through the γ-ray detection method. Excitation functions were obtained for the fusion and peripheral channels. Resonances are seen in the channels containing at least one α particle at energies below 50 MeV. At higher energies, strong structures are observed in the direct reaction channels. The evolution of the fusion cross section is well reproduced by a model based on the statistical desexcitation of the compound nucleus if the discrete states of the residual nuclei are taken into account. The favourable observation of resonant phenomena in 15 N induced reactions can be understood in terms of a small number of channels open to the grazing wave. In the range 50 to 60 MeV, there is a strong coupling between the fusion and the direct reaction channels. The occurrence of resonances above E lab = 50 MeV in the peripheral channels is explained with the band crossing and effective barrier models. In the 15 N induced reactions, the absorption of the surface waves is weak [fr
Modelling of phase equilibria in CH4–C2H6–C3H8–nC4H10–NaCl–H2O systems
International Nuclear Information System (INIS)
Li, Jun; Zhang, Zhigang; Luo, Xiaorong; Li, Xiaochun
2015-01-01
Highlights: • A new model was established for the phase equilibria of C1–C2–C3–nC4–brine systems. • The model can reproduce of hydrocarbon–brine equilibria to high T&P and salinity. • The model can well predict H 2 O solubility in light hydrocarbon rich phases. - Abstract: A thermodynamic model is presented for the mutual solubility of CH 4 –C 2 H 6 –C 3 H 8 –nC 4 H 10 –brine systems up to high temperature, pressure and salinity. The Peng–Robinson model is used for non-aqueous phase fugacity calculations, and the Pitzer model is used for aqueous phase activity calculations. The model can accurately reproduce the experimental solubilities of CH 4 , C 2 H 6 , C 3 H 8 and nC 4 H 10 in water or NaCl solutions and H 2 O solubility in the non-aqueous phase. The experimental data of mutual solubility for the CH 4 –brine subsystem are sufficient for temperatures exceeding 250 °C, pressures exceeding 1000 bar and NaCl molalities greater than 6 molal. Compared to the CH 4 –brine system, the mutual solubility data of C 2 H 6 –brine, C 3 H 8 –brine and nC 4 H 10 –brine are not sufficient. Based on the comparison with the experimental data of H 2 O solubility in C 2 H 6 -, C 3 H 8 - or nC 4 H 10 -rich phases, the model has an excellent capability for the prediction of H 2 O solubility in hydrocarbon-rich phases, as these experimental data were not used in the modelling. Predictions of hydrocarbon solubility (at temperatures up to 200 °C, pressures up to 1000 bar and NaCl molalities greater than 6 molal) were made for the C 2 H 6 –brine, C 3 H 8 –brine and nC 4 H 10 –brine systems. The predictions suggest that increasing pressure generally increases the hydrocarbon solubility in water or brine, especially in the lower-pressure region. Increasing temperature usually decreases the hydrocarbon solubility at lower temperatures but increases the hydrocarbon solubility at higher temperatures. Increasing water salinity dramatically decreases
Lysoněk, Milan
2017-01-01
SSL/TLS je moderní kryptografický protokol, který zabezpečuje komunikaci mezi klientem a serverem. Avšak na tento protokol existují útoky, které mohou ohrozit komunikaci buď odposloucháváním nebo jejím narušením. Obrana proti těmto útokům a testování zranitelností protokolů je ale značně náročný proces. Tato práce popisuje zranitelnosti SSL/TLS protokolu a implementuje vybrané útoky v tlsfuzzeru --- nástroj pro testování SSL/TLS implementací. Výsledná implementace útoků je demonstrována na tř...
Eficácia na utilização de córneas no transplante penetrante
Directory of Open Access Journals (Sweden)
Ghanem Vinícius Coral
2003-01-01
Full Text Available OBJETIVOS: 1 Verificar qual o impacto da criação do Cadastro Técnico Único (CTU para o Hospital das Clínicas da Universidade de Campinas (Unicamp no tempo de preservação de córneas utilizadas em transplantes penetrantes eletivos, e 2 comparar a incidência de falência primária em transplantes penetrantes de córnea nos períodos pré e pós-criação do CTU. MÉTODOS: Foi realizado estudo retrospectivo no Hospital de Clínicas da Unicamp, avaliando-se 15 transplantes penetrantes de córnea consecutivos entre 1 de janeiro e 30 de abril de 2000 e 24 transplantes consecutivos entre 1 de maio e 20 de setembro de 2000 (córneas sob o controle do Cadastro Técnico Único, num total de 39 transplantes. RESULTADOS: O tempo médio entre a preparação das córneas e o transplante foi de 3,8 dias (±1,78 no período pré-CTU, e de 6,0 dias (±2,97 no período pós-CTU, representando aumento no tempo de preservação de 36,7%. Houve diferença estatisticamente significativa (p=0,02 entre os dois grupos. Nenhum caso de falência primária do enxerto foi observado entre os 39 pacientes transplantados nos dois grupos. CONCLUSÃO: Com base nestes resultados, conclui-se que a nova disposição do Sistema Estadual de Transplantes aumentou de forma estatisticamente significativa o período de permanência das córneas no meio de preservação, o que pode comprometer o tempo de vida útil do transplante, aumentar a incidência de falência primária ou levar a maior número de córneas perdidas por excederem o tempo de preservação limite, preconizado na literatura.
Wall relaxation rates for an optically pumped NA vapor
International Nuclear Information System (INIS)
Swenson, D.R.; Anderson, L.W.
1986-01-01
The wall relaxation rates for an optically pumped Na vapor have been measured for a variety of wall surfaces. We find that fluorocarbon rubber (Fluorel, Viton) and organosilicones (silicone rubber, dry film) at a temperature of 250 C have respectively relaxation rates that correspond on the average to 10 to 15 and 200 to 500 bounces before depolarization occurs. 7 refs., 3 figs
Vulnerabilities and resilience of European power generation to 1.5 °C, 2 °C and 3 °C warming
Tobin, I.; Greuell, W.; Jerez, S.; Ludwig, F.; Vautard, R.; van Vliet, M. T. H.; Bréon, F.-M.
2018-04-01
The electricity sector is currently considered mainly on the emission side of the climate change equation. In order to limit climate warming to below 2 °C, or even 1.5 °C, it must undergo a rapid transition towards carbon neutral production by the mid-century. Simultaneously, electricity generating technologies will be vulnerable to climate change. Here, we assess the impacts of climate change on wind, solar photovoltaic, hydro and thermoelectric power generation in Europe using a consistent modelling approach across the different technologies. We compare the impacts for different global warming scenarios: +1.5 °C, +2 °C and +3 °C. Results show that climate change has negative impacts on electricity production in most countries and for most technologies. Such impacts remain limited for a 1.5 °C warming, and roughly double for a 3 °C warming. Impacts are relatively limited for solar photovoltaic and wind power potential which may reduce up to 10%, while hydropower and thermoelectric generation may decrease by up to 20%. Generally, impacts are more severe in southern Europe than in northern Europe, inducing inequity between EU countries. We show that a higher share of renewables could reduce the vulnerability of power generation to climate change, although the variability of wind and solar PV production remains a significant challenge.
Electrical analysis of inter-growth structured Bi4Ti3O12-Na0.5Bi4.5Ti4O15 ceramics
Jiang, Xiangping; Jiang, Yalin; Jiang, Xingan; Chen, Chao; Tu, Na; Chen, Yunjing
2017-06-01
Inter-growth bismuth layer-structured ferroelectrics (BLSFs), Bi4Ti3O12-Na0.5Bi4.5Ti4O15 (BIT-NBT), were successfully synthesized using the traditional solid-state reaction method. X-ray diffraction (XRD) Rietveld refinements were conducted using GSAS software. Good agreement and low residual are obtained. The XRD diffraction peaks can be well indexed into I2cm space group. The inter-growth structure was further observed in the high-resolution TEM image. Dielectric and impedance properties were measured and systematically analyzed. At the temperature range 763-923 K (below {T}{{c}}), doubly ionized oxygen vacancies (OVs) are localized and the short-range hopping leads to the relaxation processes with an activation energy of 0.79-1.01 eV. Above {T}{{c}}, the doubly charged OVs are delocalized and become free ones, which contribute to the long-range dc conduction. The reduction in relaxation species gives rise to a higher relaxation activation energy ˜1.6 eV. Project supported by the National Natural Science Foundation of China (Grant Nos. 51562014, 51262009, and 51602135).
C-O volatiles in Apollo 15 and Apollo 17 picritic glasses
Rutherford, Malcolm J.; Fogel, Robert A.
1993-01-01
A15 and A17 primitive picritic glasses have been examined by FTIR for the presence of dissolved C-O species to determine the role of C-O gasses on driving lunar fire-fountains. A15 green and yellow glasses were extensively studied and found to be free of dissolved C species down to FTIR detection limits (10-100 ppm; species and sample specific). Preliminary data on A17 orange glasses are similarly devoid of FTIR detectable C-O species. Re-analyses of the C-O driving mechanism theory for mare volcanism demonstrates the need to determine the fO2 of the lunar interior; the factor that most critically determined the role of C gasses in the fire-fountaining events. Oxygen fugacities equivalent to IW-0.5 and above imply dissolved CO3(=) in the primitive glasses at levels above FTIR detection. The f02's below IW-0.5 imply concentrations of CO3(=) below FTIR detection. Recent data suggesting lunar mantle fO2's of IW-2 or less, strongly mitigate against finding FTIR measurable dissolved CO3(=) consistent with the findings of this study.
International Nuclear Information System (INIS)
Hyushin, G. D.
2006-01-01
An increase in the NaOH concentration in the NaOH-TiO 2 (rutile)-H 2 O system at a temperature of 500 deg. C and a pressure of 0.1 GPa leads to the crystallization R-TiO 2 + Na 2 Ti 6 O 13 → Na 2 Ti 3 O 7 → Na 16 Ti 10 O 28 . Crystals of the Na 2 Ti 6 O 13 titanate (space group C2/m) have the three-dimensional framework structure Ti 6 O 13 . The structure of the Na 2 Ti 3 O 7 titanate (space group P2 1 /m) contains the two-dimensional layers Ti 3 O 7 . The structure of the Na 16 Ti 10 O 28 titanate (space group P-1) is composed of the isolated ten-polyhedron cluster precursors Ti 10 O 28 . In all the structures, the titanium atoms have an octahedral coordination (MTiO 6 ). The matrix self-assembly of the Na 2 Ti 6 O 13 and Na 2 Ti 3 O 7 (Na 4 Ti 6 O 14 ) crystal structures from Na 4 M 12 invariant precursors is modeled. These precursors are clusters consisting of twelve M polyhedra linked through the edges. It is demonstrated that the structurally rigid precursors Na 4 M 12 control all processes of the subsequent evolution of the crystal-forming titanate clusters. The specific features of the self-assembly of the Na 2 Ti 3 O 7 structure that result from the additional incorporation of twice the number of sodium atoms into the composition of the high-level clusters are considered
Activity of NaOH buffered by silicate solids in molten sodium acetate-water at 3170C
International Nuclear Information System (INIS)
Weres, O.; Tsao, L.
1988-01-01
Silica and sodium acetate are present in the steam generator tube sheet crevices of many nuclear power plants. Trace solutes in the condensate are tremendously concentrated in the crevices by boiling. Sparingly soluble sodium silicates and other solids precipitate from the crevice liquid leaving an extremely concentrated molten mixture of water, sodium acetate and other salts. The precipitates buffer the activity of sodium hydroxide in the superheated liquid that remains. The activity of NaOH corresponding to the buffers quartz/sodium disilicate and sodium disilicate/sodium metasilicate at 317 0 C has been determined experimentally. The sodium hydroxide content of a sodium acetate-water melt buffered by these reactions was determined by chemical analysis, and the corresponding activity of NaOH at temperature was calculated using the recently published Pitzer-Simonson Model of molten salt-water mixtures. The molten mixture of sodium acetate and water plays the role solvent in these experiments and calculations. The free energies of formation of solid sodium silicates at 317 0 C were also determined. The activity of NaOH corresponding to other silicate and phosphate buffers was calculated using published thermodynamic data and estimated from phase diagrams
Scenario dependence of future changes in climate extremes under 1.5 °C and 2 °C global warming
Wang, Zhili; Lin, Lei; Zhang, Xiaoye; Zhang, Hua; Liu, Liangke; Xu, Yangyang
2017-01-01
The 2015 Paris Agreement aims to limit global warming below 2 °C and pursue efforts to even limit it to 1.5 °C relative to pre-industrial levels. Decision makers need reliable information on the impacts caused by these warming levels for climate mitigation and adaptation measures. We explore the changes in climate extremes, which are closely tied to economic losses and casualties, under 1.5 °C and 2 °C global warming and their scenario dependence using three sets of ensemble global climate model simulations. A warming of 0.5 °C (from 1.5 °C to 2 °C) leads to significant increases in temperature and precipitation extremes in most regions. However, the projected changes in climate extremes under both warming levels highly depend on the pathways of emissions scenarios, with different greenhouse gas (GHG)/aerosol forcing ratio and GHG levels. Moreover, there are multifold differences in several heavily polluted regions, among the scenarios, in the changes in precipitation extremes due to an additional 0.5 °C warming from 1.5 °C to 2 °C. Our results demonstrate that the chemical compositions of emissions scenarios, not just the total radiative forcing and resultant warming level, must be considered when assessing the impacts of global 1.5/2 °C warming. PMID:28425445
Cyclopentanone: A raw material for production of C15 and C17 fuel precursors
International Nuclear Information System (INIS)
Hronec, Milan; Fulajtárova, Katarína; Liptaj, Tibor; Štolcová, Magdaléna; Prónayová, Naďa; Soták, Tomáš
2014-01-01
The synthesis of diesel or jet fuels intermediates from furfural or 5-hydroxymethylfurfural (HMF) via aqueous aldol-condensation with cyclopentanone was studied. Cyclopentanone is the product of furfural rearrangement in an aqueous system. Since the aldol-condensation reaction is conducted in an aqueous solution all these biomass-derived reactants can be applied as water solutions formed in the processes of their preparation. The aldol condensation of furfural with cyclopentanone is at low concentration of base and molar ratio of reactants 2:1 highly selective and after 40–80 min of reaction at a temperature of 40–100 °C more than 95 mol% yield of 2,5-bis (2-furylmethylidene) cyclopentan-1-one (F 2 C) was obtained. When instead of furfural as a reactant HMF was used higher than 98 mol% yield of 2,5-bis (5-hydroxymethyl-2-furylmethylidene) cyclopentan-1-one was achieved. The final products of aldol condensation of furfural and HMF are exclusively corresponding dimers, what enables to obtain after subsequent hydrogenation/hydrodeoxygenation step dialkylcyclopentane type of diesel or jet fuels having C 15 or C 17 molecules. - Highlights: • The aldol condensation of biomass derived cyclopentanone with furfural and HMF. • More than 95 mol % yields of products are achieved. • The products are compounds having exclusively 15 or 17 carbon atoms in molecule. • Reactants can be used as diluted aqueous solutions. • The products are separated as solids insoluble in water
Proteína C reactiva e gravidade da bronquiolite aguda
Directory of Open Access Journals (Sweden)
S. Costa
2009-01-01
Full Text Available Resumo: O diagnóstico de bronquiolite aguda é essencialmente clínico. A utilidade de exames laboratoriais, em particular do doseamento da proteína C reactiva (PCR, não está bem estabelecida.O objectivo deste trabalho foi avaliar a relação entre o valor da PCR e os marcadores indirectos de gravidade em doentes com diagnóstico de bronquiolite.Foram incluídos no estudo todos os doentes admitidos no Serviço de Pediatria do HSJ durante o ano de 2006 e que tiveram como diagnóstico principal bronquiolite, tendo sido feita uma revisão retrospectiva do processo clínico desses doentes.Foram incluídos 176 doentes com idades compreendidas entre zero e 36 meses (mediana de 4 meses; 63,1% eram do sexo masculino. O doseamento da PCR tinha sido efectuado em 94,3% dos doentes, com valores compreendidos entre zero e 256 mg/L e com mediana de 11 mg/L.O valor da PCR, na população estudada, apresentou uma relação estatisticamente significativa com a admissão em unidade de cuidados intensivos (UCI (p=0,008, a duração do internamento hospitalar (p=0,025 e a necessidade de oxigenoterapia (p=0,022.Desta forma, este trabalho coloca a hipótese de o valor de PCR poder ser um marcador de gravidade e ter significado prognóstico em doentes com bronquiolite. Mais estudos são necessários para validar estes resultados e esclarecer se existe uma relação real entre as variáveis estudadas ou se esta é produzida pelo efeito confundidor de outras infecções.Rev Port Pneumol 2009; XV (1: 55-65 Abstract: A diagnosis of bronchiolitis is made clinically and the use of supportive laboratory examinations, including the quantification of C reactive protein (CRP, is not well established.The aim of this study was to evaluate the correlation between CRP value and indirect markers of disease severity in patients with bronchiolitis.This study included the patients diagnosed with bronchiolitis admitted to the Pediatrics Department of S. João Hospital in 2006. A
48 CFR 15.403-4 - Requiring certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b).
2010-10-01
... or pricing data (10 U.S.C. 2306a and 41 U.S.C. 254b). 15.403-4 Section 15.403-4 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES CONTRACTING BY NEGOTIATION Contract Pricing 15.403-4 Requiring certified cost or pricing data (10 U.S.C. 2306a and 41 U.S.C...
Directory of Open Access Journals (Sweden)
Maria Rosa Bet de Moraes Silva
2009-04-01
Full Text Available OBJETIVO: Avaliar alterações do endotélio corneano após aplicação de mitomicina C na esclera por meio de microscopia eletrônica de transmissão e de varredura e correlacionar as alterações com tempo, concentração e entre os dois métodos de avaliação. MÉTODOS: Foi avaliado o endotélio corneano dos olhos de 32 coelhos albinos distribuídos em 4 grupos experimentais com 8 coelhos cada um. A mitomicina C foi aplicada sob retalho escleral no olho direito por 5 minutos. Nos grupos G1 e G2 a concentração da mitomicina C foi de 0,5 mg/ml e nos grupos G3 e G4 a concentração foi de 0,2 mg/ml. O exame foi realizado com 15 dias após nos grupos G1 e G3 e com 30 dias nos grupos G2 e G4. Dos 8 animais 4 foram preparados para microscopia eletrônica de transmissão e 4 para microscopia eletrônica de varredura. Os olhos esquerdos de todos animais serviram como controle. RESULTADOS: À microscopia eletrônica de transmissão foram observadas alterações do endotélio corneano em todos os grupos experimentais: rarefação do citoplasma, dilatação e fragmentação das cisternas do retículo endoplasmático rugoso, aparelhos de Golgi com dilatação das cisternas, redução de vacúolos e irregularidades da membrana celular interna sendo mais intensas em G1 e G2. À microscopia eletrônica de varredura foram observadas alterações em todos grupos experimentais, exceto G1: alteração de forma e tamanho das células e projeções filopoidais mais longas. CONCLUSÕES: 1 - A mitomicina C causou alteração no endotélio da córnea tanto na concentração de 0,5 mg/ml como de 0,2 mg/ml observadas 15 e 30 dias após a aplicação; 2 - As alterações foram mais intensas com a maior concentração de mitomicina C (0,5 mg/ml na microscopia eletrônica de transmissão e não na microscopia eletrônica de varredura; 3 - As alterações tiveram correlação com o tempo na microscopia eletrônica de varredura e não na microscopia eletrônica de
Directory of Open Access Journals (Sweden)
Vijayalakshmi Shankar
2017-11-01
Full Text Available Activated calcium oxide extracted from crab shell impregnated on Na-ZSM-5 has been investigated. Crab shells were collected, powdered and calcined at 900 °C, and CaO was impregnated on Na-ZSM-5 and calcined at 550 °C for 10 h. The CaO/Na-ZSM-5 was characterized by X-ray diffraction, scanning electron microscopy and BET surface area. The prepared catalyst was tested for its catalytic activity by transesterifing neem oil into biodiesel in the presence of methanol. The influence of various parameters including reaction time, temperature, methanol to oil ratio, catalyst concentration and dosage were also investigated. Produced biodiesel have also been tested using proton NMR spectroscopy. Biodiesel yield as 95% has been achieved with 15% CaO impregnated on Na-ZSM-5 at 75 °C. The optimum transesterification reaction conditions were identified as follows: reaction temperature, 75 °C; reaction time, 6 h; methanol-to-neem oil molar ratio, 12:1; catalyst dosage, 0.2 g; and catalyst concentration, 15%. Based on the above study, it can be concluded that the calcium oxide impregnated Na-ZSM-5 can be a potential catalyst for biodiesel production.
Fate of 15N and 14C from labelled plant material
DEFF Research Database (Denmark)
Rasmussen, Jim; Gjettermann, Birgitte; Eriksen, Jørgen
2008-01-01
strength of labelled plant residues in dissolved inorganic N (DIN) and dissolved organic N (DON) in pore water from the plough layer, and (ii) the plant uptake of organically bound N. Litterbags containing 14C- and 15N-labelled ryegrass or clover roots or leaves were inserted into the sward of a ryegrass......–clover mixture in early spring. The fate of the released 14C and 15N was monitored in harvested biomass, roots, soil, and pore water percolating from the plough layer. No evidence of plant uptake of dual-labelled organic compounds from the dual-labelled residues could be observed. N in pore water from the plough...
Climate Impacts in Europe Under +1.5°C Global Warming
Jacob, Daniela; Kotova, Lola; Teichmann, Claas; Sobolowski, Stefan P.; Vautard, Robert; Donnelly, Chantal; Koutroulis, Aristeidis G.; Grillakis, Manolis G.; Tsanis, Ioannis K.; Damm, Andrea; Sakalli, Abdulla; Vliet, van Michelle T.H.
2018-01-01
The Paris Agreement of the United Nations Framework Convention on Climate Change aims not only at avoiding +2°C warming (and even limit the temperature increase further to +1.5°C), but also sets long-term goals to guide mitigation. Therefore, the best available science is required to inform
Suplementação de vitaminas na prevenção de câncer
SILVA, Cyntia Rosa de Melo; NAVES, Maria Margareth Veloso
2001-01-01
Este trabalho constitui uma revisão de dados epidemiológicos sobre a relação entre o consumo de vitaminas e prevenção de câncer. Estudos observacionais evidenciam uma associação inversa consistente entre a ingestão de frutas e hortaliças e risco de câncer, e um efeito protetor das vitaminas C, E e dos carotenóides contra certos tipos de câncer. Resultados de estudos de intervenção, na prevenção primária de câncer, são contraditórios, sendo que em dois desses estudos o beta-caroteno, suplement...
Energy Technology Data Exchange (ETDEWEB)
Roy, Rabindra N. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States)]. E-mail: rroy@drury.edu; Roy, Lakshmi N. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); LeNoue, Sean R. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); Denton, Cole E. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); Simon, Ashley N. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); Richards, Sarah J. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); Moore, Andrew C. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); Roy, Chandra N. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); Redmond, R. Ryan [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States); Bryant, Paul A. [Walter H. Hoffman Department of Chemistry, Drury University, 900 N. Benton Avenue, Springfield, MO 65802 (United States)
2006-04-15
Values of the second thermodynamic dissociation constant pK{sub 2} of N-[tris(hydroxymethyl)methyl-3-amino]propanesulfonic acid (Taps) have been determined at twelve temperatures from 278.15 K to 328.15 K including 310.15 K by measurements of the electromotive-force for cells without liquid junction of the type: Pt|H{sub 2} (g, p{sup -}bar =101.325 kPa)|Taps (m{sub 1}), NaTapsate (m{sub 2}), NaCl (m{sub 3})|AgCl|Ag, where m denotes molality. The pK{sub 2} values for the dissociation of Taps are represented by the equation: pK{sub 2}=2969.61.(K/T) - 17.05052+2.73697.ln(T/K). The values of pK{sub 2} for Taps were found to be (8.502+/-0.0007) at T=298.15 K and (8.225+/-0.0009) at T=310.15 K, respectively, indicating thereby to be useful as buffer solutions for pH control in the region 7.4 to 8.5. The thermodynamic quantities, {delta}G{sup -}bar , {delta}H{sup -}bar , {delta}S{sup -}bar , and {delta}C{sub p}{sup -}bar dissociation process of Taps have been derived from the temperature coefficients of the pK{sub 2}.
(13)C-(15)N correlation via unsymmetrical indirect covariance NMR: application to vinblastine.
Martin, Gary E; Hilton, Bruce D; Blinov, Kirill A; Williams, Antony J
2007-12-01
Unsymmetrical indirect covariance processing methods allow the derivation of hyphenated 2D NMR data from the component 2D spectra, potentially circumventing the acquisition of the much lower sensitivity hyphenated 2D NMR experimental data. Calculation of HSQC-COSY and HSQC-NOESY spectra from GHSQC, COSY, and NOESY spectra, respectively, has been reported. The use of unsymmetrical indirect covariance processing has also been applied to the combination of (1)H- (13)C GHSQC and (1)H- (15)N long-range correlation data (GHMBC, IMPEACH, or CIGAR-HMBC). The application of unsymmetrical indirect covariance processing to spectra of vinblastine is now reported, specifically the algorithmic extraction of (13)C- (15)N correlations via the unsymmetrical indirect covariance processing of the combination of (1)H- (13)C GHSQC and long-range (1)H- (15)N GHMBC to produce the equivalent of a (13)C- (15)N HSQC-HMBC correlation spectrum. The elimination of artifact responses with aromatic solvent-induced shifts (ASIS) is shown in addition to a method of forecasting potential artifact responses through the indirect covariance processing of the GHSQC spectrum used in the unsymmetrical indirect covariance processing.
Emission pathways to achieve 2.0°C and 1.5°C climate targets
Su, Xuanming; Takahashi, Kiyoshi; Fujimori, Shinichiro; Hasegawa, Tomoko; Tanaka, Katsumasa; Kato, Etsushi; Shiogama, Hideo; Masui, Toshihiko; Emori, Seita
2017-06-01
We investigated the feasibilities of 2.0°C and 1.5°C climate targets by considering the abatement potentials of a full suite of greenhouse gases, pollutants, and aerosols. We revised the inter-temporal dynamic optimization model DICE-2013R by introducing three features as follows. First, we applied a new marginal abatement cost curve derived under moderate assumptions regarding future socioeconomic development—the Shared Socioeconomic Pathways 2 (SSP2) scenario. Second, we addressed emission abatement for not only industrial CO2 but also land-use CO2, CH4, N2O, halogenated gases, CO, volatile organic compounds, SOx, NOx, black carbon and organic carbon. Third, we improved the treatment of the non-CO2 components in the climate module based on MAGICC 6.0. We obtained the following findings: (1) It is important to address the individual emissions in an analysis of low stabilization scenarios because abating land-use CO2, non-CO2 and aerosol emissions also contributes to maintaining a low level of radiative forcing and substantially affects the climate costs. (2) The 2.0°C target can be efficiently reached under the assumptions of the SSP2 scenario. (3) The 1.5°C target can be met with early deep cuts under the assumption of a temperature overshoot, and it will triple the carbon price and double the mitigation cost compared with the 2.0°C case.
Schleussner, Carl-Friedrich; Lissner, Tabea K.; Fischer, Erich M.; Wohland, Jan; Perrette, Mahé; Golly, Antonius; Rogelj, Joeri; Childers, Katelin; Schewe, Jacob; Frieler, Katja; Mengel, Matthias; Hare, William; Schaeffer, Michiel
2016-04-01
Robust appraisals of climate impacts at different levels of global-mean temperature increase are vital to guide assessments of dangerous anthropogenic interference with the climate system. The 2015 Paris Agreement includes a two-headed temperature goal: "holding the increase in the global average temperature to well below 2 °C above pre-industrial levels and pursuing efforts to limit the temperature increase to 1.5 °C". Despite the prominence of these two temperature limits, a comprehensive overview of the differences in climate impacts at these levels is still missing. Here we provide an assessment of key impacts of climate change at warming levels of 1.5 °C and 2 °C, including extreme weather events, water availability, agricultural yields, sea-level rise and risk of coral reef loss. Our results reveal substantial differences in impacts between a 1.5 °C and 2 °C warming that are highly relevant for the assessment of dangerous anthropogenic interference with the climate system. For heat-related extremes, the additional 0.5 °C increase in global-mean temperature marks the difference between events at the upper limit of present-day natural variability and a new climate regime, particularly in tropical regions. Similarly, this warming difference is likely to be decisive for the future of tropical coral reefs. In a scenario with an end-of-century warming of 2 °C, virtually all tropical coral reefs are projected to be at risk of severe degradation due to temperature-induced bleaching from 2050 onwards. This fraction is reduced to about 90 % in 2050 and projected to decline to 70 % by 2100 for a 1.5 °C scenario. Analyses of precipitation-related impacts reveal distinct regional differences and hot-spots of change emerge. Regional reduction in median water availability for the Mediterranean is found to nearly double from 9 % to 17 % between 1.5 °C and 2 °C, and the projected lengthening of regional dry spells increases from 7 to 11 %. Projections for
Efeito do cloreto de cálcio na qualidade de abacaxi 'Pérola' minimamente processado
Directory of Open Access Journals (Sweden)
Antoniolli Lucimara Rogéria
2003-01-01
Full Text Available O objetivo deste trabalho foi avaliar os efeitos do cloreto de cálcio na qualidade do abacaxi 'Pérola' minimamente processado. Os tratamentos, arranjados em delineamento inteiramente casualizado e dispostos em esquema fatorial 3x5, consistiram das concentrações de CaCl2 e dos períodos de armazenamento, com três repetições. Frutos previamente sanitizados foram descascados mecanicamente, fatiados manualmente e imersos em solução de CaCl2 a 1% e a 2% e em água (controle, durante 30 segundos. As fatias foram acondicionadas em embalagens de polietileno tereftalato e mantidas à temperatura de 4±1degreesC durante períodos de 0, 3, 6, 9 e 12 dias. A textura não foi influenciada por nenhum dos fatores estudados. Constatou-se menor atividade peroxidásica nos frutos tratados com CaCl2 2%. Quanto à coloração, a imersão em solução de CaCl2 1% resultou em fatias mais escurecidas, com menor valor L* e maior valor a* ao final do período de armazenamento. A utilização de CaCl2 em abacaxi 'Pérola' minimamente processado não proporciona efeitos benéficos na textura, e interfere negativamente na coloração da polpa do fruto.
The potential contribution of disruptive low-carbon innovations to 1.5 °C climate mitigation
Wilson, C.; Pettifor, H.; Cassar, E.; Kerr, L.; Wilson, M.
2018-01-01
This paper investigates the potential for consumer-facing innovations to contribute emission reductions for limiting warming to 1.5 °C. First, we show that global integrated assessment models which characterise transformation pathways consistent with 1.5 °C mitigation are limited in their ability to analyse the emergence of novelty in energy end-use. Second, we introduce concepts of disruptive innovation which can be usefully applied to the challenge of 1.5 °C mitigation. Disruptive low-carbo...
Lifescience Database Archive (English)
Full Text Available FC (Link to library) FC-AI15 (Link to dictyBase) - G01730 DDB0214993 Contig-U15123-1 FC-AI...15E (Link to Original site) - - - - - - FC-AI15E 856 Show FC-AI15 Library FC (Link to library) Clone ID FC-AI...3-1 Original site URL http://dictycdb.biol.tsukuba.ac.jp/CSM/FC/FC-AI/FC-AI15Q.Se...q.d/ Representative seq. ID FC-AI15E (Link to Original site) Representative DNA sequence >FC-AI15 (FC-AI15Q) /CSM/FC/FC-AI/FC-AI...AAAAAAAATA sequence update 1996.12.24 Translated Amino Acid sequence kt*riyi*KMMIKYITIAILFIASLVKADLQFSLCPTCV
Spencer, Brady L; Shenoy, Anukul T; Orihuela, Carlos J; Nahm, Moon H
2017-08-01
As a species, Streptococcus pneumoniae (the pneumococcus) utilizes a diverse array of capsular polysaccharides to evade the host. In contrast to large variations in sugar composition and linkage formation, O-acetylation is a subtle capsular modification that nonetheless has a large impact on capsular shielding and recognition of the capsule by vaccine-elicited antibodies. Serotype 15B, which is included in the 23-valent pneumococcal polysaccharide vaccine (PPV23), carries the putative O-acetyltransferase gene wciZ The coding sequence of wciZ contains eight consecutive TA repeats [(TA) 8 ]. Replication slippage is thought to result in the addition or loss of TA repeats, subsequently causing frameshift and truncation of WciZ to yield a nonacetylated serotype, 15C. Using sensitive serological tools, we show that serotype 15C isolates whose wciZ contains seven or nine TA repeats retain partial O-acetylation, while serotype 15C isolates whose wciZ contains six TA repeats have barely detectable O-acetylation. We confirmed by inhibition enzyme-linked immunosorbent assay that (TA) 7 serotype 15C is ∼0.1% as acetylated as serotype 15B, while serotype 15X is nonacetylated. To eliminate the impact of genetic background, we created isogenic serotype 15B, (TA) 7 serotype 15C, and 15BΔ wciZ (15X) strains and found that reduction or absence of WciZ-mediated O-acetylation did not affect capsular shielding from phagocytes, biofilm formation, adhesion to nasopharyngeal cells, desiccation tolerance, or murine colonization. Sera from PPV23-immunized persons opsonized serotype 15B significantly but only slightly better than serotypes 15C and 15X; thus, PPV23 may not result in expansion of serotype 15C. Copyright © 2017 American Society for Microbiology.
The CN/C15N isotopic ratio towards dark clouds
Hily-Blant, P.; Pineau des Forêts, G.; Faure, A.; Le Gal, R.; Padovani, M.
2013-09-01
Understanding the origin of the composition of solar system cosmomaterials is a central question, not only in the cosmochemistry and astrochemistry fields, and requires various approaches to be combined. Measurements of isotopic ratios in cometary materials provide strong constraints on the content of the protosolar nebula. Their relation with the composition of the parental dark clouds is, however, still very elusive. In this paper, we bring new constraints based on the isotopic composition of nitrogen in dark clouds, with the aim of understanding the chemical processes that are responsible for the observed isotopic ratios. We have observed and detected the fundamental rotational transition of C15N towards two starless dark clouds, L1544 and L1498. We were able to derive the column density ratio of C15N over 13CN towards the same clouds and obtain the CN/C15N isotopic ratios, which were found to be 500 ± 75 for both L1544 and L1498. These values are therefore marginally consistent with the protosolar value of 441. Moreover, this ratio is larger than the isotopic ratio of nitrogen measured in HCN. In addition, we present model calculations of the chemical fractionation of nitrogen in dark clouds, which make it possible to understand how CN can be deprived of 15N and HCN can simultaneously be enriched in heavy nitrogen. The non-fractionation of N2H+, however, remains an open issue, and we propose some chemical way of alleviating the discrepancy between model predictions and the observed ratios. Appendices are available in electronic form at http://www.aanda.orgThe reduced spectra (in FITS format) are available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (ftp://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/557/A65
Projected Changes in the Asian-Australian Monsoon Region in 1.5°C and 2.0°C Global-Warming Scenarios
Chevuturi, Amulya; Klingaman, Nicholas P.; Turner, Andrew G.; Hannah, Shaun
2018-03-01
In light of the Paris Agreement, it is essential to identify regional impacts of half a degree additional global warming to inform climate adaptation and mitigation strategies. We investigate the effects of 1.5°C and 2.0°C global warming above preindustrial conditions, relative to present day (2006-2015), over the Asian-Australian monsoon region (AAMR) using five models from the Half a degree Additional warming, Prognosis and Projected Impacts (HAPPI) project. There is considerable intermodel variability in projected changes to mean climate and extreme events in 2.0°C and 1.5°C scenarios. There is high confidence in projected increases to mean and extreme surface temperatures over AAMR, as well as more-frequent persistent daily temperature extremes over East Asia, Australia, and northern India with an additional 0.5°C warming, which are likely to occur. Mean and extreme monsoon precipitation amplify over AAMR, except over Australia at 1.5°C where there is uncertainty in the sign of the change. Persistent daily extreme precipitation events are likely to become more frequent over parts of East Asia and India with an additional 0.5°C warming. There is lower confidence in projections of precipitation change than in projections of surface temperature change. These results highlight the benefits of limiting the global-mean temperature change to 1.5°C above preindustrial, as the severity of the above effects increases with an extra 0.5°C warming.
Climate extremes, land-climate feedbacks and land-use forcing at 1.5°C.
Seneviratne, Sonia I; Wartenburger, Richard; Guillod, Benoit P; Hirsch, Annette L; Vogel, Martha M; Brovkin, Victor; van Vuuren, Detlef P; Schaller, Nathalie; Boysen, Lena; Calvin, Katherine V; Doelman, Jonathan; Greve, Peter; Havlik, Petr; Humpenöder, Florian; Krisztin, Tamas; Mitchell, Daniel; Popp, Alexander; Riahi, Keywan; Rogelj, Joeri; Schleussner, Carl-Friedrich; Sillmann, Jana; Stehfest, Elke
2018-05-13
This article investigates projected changes in temperature and water cycle extremes at 1.5°C of global warming, and highlights the role of land processes and land-use changes (LUCs) for these projections. We provide new comparisons of changes in climate at 1.5°C versus 2°C based on empirical sampling analyses of transient simulations versus simulations from the 'Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) multi-model experiment. The two approaches yield similar overall results regarding changes in climate extremes on land, and reveal a substantial difference in the occurrence of regional extremes at 1.5°C versus 2°C. Land processes mediated through soil moisture feedbacks and land-use forcing play a major role for projected changes in extremes at 1.5°C in most mid-latitude regions, including densely populated areas in North America, Europe and Asia. This has important implications for low-emissions scenarios derived from integrated assessment models (IAMs), which include major LUCs in ambitious mitigation pathways (e.g. associated with increased bioenergy use), but are also shown to differ in the simulated LUC patterns. Biogeophysical effects from LUCs are not considered in the development of IAM scenarios, but play an important role for projected regional changes in climate extremes, and are thus of high relevance for sustainable development pathways.This article is part of the theme issue 'The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'. © 2018 The Authors.
Climate extremes, land–climate feedbacks and land-use forcing at 1.5°C
Wartenburger, Richard; Guillod, Benoit P.; Hirsch, Annette L.; Vogel, Martha M.; Brovkin, Victor; van Vuuren, Detlef P.; Schaller, Nathalie; Boysen, Lena; Calvin, Katherine V.; Doelman, Jonathan; Greve, Peter; Havlik, Petr; Humpenöder, Florian; Krisztin, Tamas; Mitchell, Daniel; Popp, Alexander; Riahi, Keywan; Rogelj, Joeri; Schleussner, Carl-Friedrich; Sillmann, Jana; Stehfest, Elke
2018-01-01
This article investigates projected changes in temperature and water cycle extremes at 1.5°C of global warming, and highlights the role of land processes and land-use changes (LUCs) for these projections. We provide new comparisons of changes in climate at 1.5°C versus 2°C based on empirical sampling analyses of transient simulations versus simulations from the ‘Half a degree Additional warming, Prognosis and Projected Impacts’ (HAPPI) multi-model experiment. The two approaches yield similar overall results regarding changes in climate extremes on land, and reveal a substantial difference in the occurrence of regional extremes at 1.5°C versus 2°C. Land processes mediated through soil moisture feedbacks and land-use forcing play a major role for projected changes in extremes at 1.5°C in most mid-latitude regions, including densely populated areas in North America, Europe and Asia. This has important implications for low-emissions scenarios derived from integrated assessment models (IAMs), which include major LUCs in ambitious mitigation pathways (e.g. associated with increased bioenergy use), but are also shown to differ in the simulated LUC patterns. Biogeophysical effects from LUCs are not considered in the development of IAM scenarios, but play an important role for projected regional changes in climate extremes, and are thus of high relevance for sustainable development pathways. This article is part of the theme issue ‘The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'. PMID:29610382
Climate extremes, land-climate feedbacks and land-use forcing at 1.5°C
Seneviratne, Sonia I.; Wartenburger, Richard; Guillod, Benoit P.; Hirsch, Annette L.; Vogel, Martha M.; Brovkin, Victor; van Vuuren, Detlef P.; Schaller, Nathalie; Boysen, Lena; Calvin, Katherine V.; Doelman, Jonathan; Greve, Peter; Havlik, Petr; Humpenöder, Florian; Krisztin, Tamas; Mitchell, Daniel; Popp, Alexander; Riahi, Keywan; Rogelj, Joeri; Schleussner, Carl-Friedrich; Sillmann, Jana; Stehfest, Elke
2018-05-01
This article investigates projected changes in temperature and water cycle extremes at 1.5°C of global warming, and highlights the role of land processes and land-use changes (LUCs) for these projections. We provide new comparisons of changes in climate at 1.5°C versus 2°C based on empirical sampling analyses of transient simulations versus simulations from the `Half a degree Additional warming, Prognosis and Projected Impacts' (HAPPI) multi-model experiment. The two approaches yield similar overall results regarding changes in climate extremes on land, and reveal a substantial difference in the occurrence of regional extremes at 1.5°C versus 2°C. Land processes mediated through soil moisture feedbacks and land-use forcing play a major role for projected changes in extremes at 1.5°C in most mid-latitude regions, including densely populated areas in North America, Europe and Asia. This has important implications for low-emissions scenarios derived from integrated assessment models (IAMs), which include major LUCs in ambitious mitigation pathways (e.g. associated with increased bioenergy use), but are also shown to differ in the simulated LUC patterns. Biogeophysical effects from LUCs are not considered in the development of IAM scenarios, but play an important role for projected regional changes in climate extremes, and are thus of high relevance for sustainable development pathways. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'.
Cumulative carbon emissions budgets consistent with 1.5 °C global warming
Tokarska, Katarzyna B.; Gillett, Nathan P.
2018-04-01
The Paris Agreement1 commits ratifying parties to pursue efforts to limit the global temperature increase to 1.5 °C relative to pre-industrial levels. Carbon budgets2-5 consistent with remaining below 1.5 °C warming, reported in the IPCC Fifth Assessment Report (AR5)2,6,8, are directly based on Earth system model (Coupled Model Intercomparison Project Phase 5)7 responses, which, on average, warm more than observations in response to historical CO2 emissions and other forcings8,9. These models indicate a median remaining budget of 55 PgC (ref. 10, base period: year 1870) left to emit from January 2016, the equivalent to approximately five years of emissions at the 2015 rate11,12. Here we calculate warming and carbon budgets relative to the decade 2006-2015, which eliminates model-observation differences in the climate-carbon response over the historical period9, and increases the median remaining carbon budget to 208 PgC (33-66% range of 130-255 PgC) from January 2016 (with mean warming of 0.89 °C for 2006-2015 relative to 1861-188013-18). There is little sensitivity to the observational data set used to infer warming that has occurred, and no significant dependence on the choice of emissions scenario. Thus, although limiting median projected global warming to below 1.5 °C is undoubtedly challenging19-21, our results indicate it is not impossible, as might be inferred from the IPCC AR5 carbon budgets2,8.
Synthesis and piezoelectric properties of KxNa1-xNbO3 ceramic by molten salt method
International Nuclear Information System (INIS)
Li Yueming; Wang Jinsong; Liao Runhua; Huang Dan; Jiang Xiangping
2010-01-01
K x Na 1-x NbO 3 ceramic powder with perovskite structure was synthesized in molten salt with a Na 2 CO 3 /K 2 CO 3 molar ratio of 1:1, under different salt-to-oxide weight ratios of 1:10, 1:5, 1:3, 1:2.5 and 1:2 in the temperatures range of 650-900 o C. It is found that the synthesizing temperature and salt-to-oxide ratios had significant effects on the morphology of K x Na 1-x NbO 3 powder. The X-ray diffraction analysis indicated that a pure perovskite structure of K x Na 1-x NbO 3 powder could be synthesized at 650 o C. The microstructure observation revealed that the crystal morphology of K x Na 1-x NbO 3 powder changed from spheroid to cube, and then became irregular after further increasing temperature. The grain size of the synthesized powder increased by an increment of the molten salt content. The K x Na 1-x NbO 3 ceramics were prepared at x = 0.345 by adding 1.0 mol% ZnO as sintering aid, and the optimized dielectric and piezoelectric properties are obtained as following: d 33 = 120 pC/N, T c = 406 o C, Q m = 126 and k p = 0.302.
Energy Technology Data Exchange (ETDEWEB)
Poletaev, I F; Krasnenkova, L V
1975-08-01
Quaternary Na/sup +/, Rb/sup +///NO/sub 3/-, SO/sub 4//sup 2 -/-H/sub 2/O and Nsub(+), Cs/sup +///NO/sub 3/-, SO/sub 4//sup 2 -/-H/sub 2/O mutual systems have been studied isothermally. The following six fields of crystallization have been revealed in these systems at 25 deg C: Cs/sub 2/SO/sub 4/, Na/sub 2/SO/sub 4/, Na/sub 2/SO/sub 4/x10H/sub 2/O, NaNO/sub 3/xNa/sub 2/SO/sub 4/x2H/sub 2/O, NaNO/sub 3/, and CsNO/sub 3/.
Directory of Open Access Journals (Sweden)
Adriana Morales
2005-02-01
Full Text Available Há muito que se estudam métodos e materiais reparadores de córnea, em busca de uma melhor reposição tecidual e, principalmente, manutenção ou recuperação da visão. A pesquisa de novos biomateriais tem permitido produzir próteses capazes de desempenhar a função requerida, sem reação importante. Conhecendo-se os bons resultados obtidos com a utilização da poliuretana vegetal derivada de óleo de mamona (Ricinus communis L. em vários procedimentos, estudou-se sua implantação, em forma de membrana, na córnea, objetivando oferecer novo material para a reparação de lesões corneanas e a confecção de ceratopróteses biologicamente inertes. Utilizaram-se 28 coelhos, divididos em dois grupos (G1 e G2 e estes em subgrupos para avaliações de implantes lamelares e interlamelares aos 2, 7, 15, 30, 60 e 120 dias, e implantes penetrantes, aos 2, 7, 15, 30 e 60 dias de pós-operatório. Estudaram-se parâmetros como neovascularização, inflamação, transparência de córneas e implantes, bem como a aderência e viabilidade destes, através de exames oculares, e histopatológicos à microscopia óptica. Observou-se reação inflamatória branda em todos os períodos. Os implantes lamelares e penetrantes permitiram reparação da córnea e manutenção da integridade dos globos oculares, embora sofressem deiscência entre 5 e 28 dias de pós-operatório. Concluiu-se pela boa biocompatibilidade do material e pela possibilidade de empregar-se o polímero na reparação corneana e, possivelmente, em ceratopróteses.
International Nuclear Information System (INIS)
Saito, S.M.T.
1974-01-01
The effect of the forms 15 N H 4 and 15 N O 3 in presence or absence of organic matter and of the nitrification inhibitor AM (2-amino-4-chloro-6-methyl-pyrimidine) in dry matter weight and nitrogen content of the plant derived from soil and form fertilizer is studied. The experiment was carried out in greenhouse and the test plant was the hybrid Maize Centralmex . The fertilizers ( 15 N H 4 ) 2 S O 4 and Na 15 N O 3 , were added in two levels: 40 and 120 Kg N/ha, with 1,02% of N and 1,4% of 15 N in excess, respectively. Three soils of different physical and chemical characteristics were used; Regosol intergrade, Latosol Roxo and Podzolized de Lins e Marilia var. Marilia. (M.A.C.)
Keeping global warming within 1.5 °C constrains emergence of aridification
Park, Chang-Eui; Jeong, Su-Jong; Joshi, Manoj; Osborn, Timothy J.; Ho, Chang-Hoi; Piao, Shilong; Chen, Deliang; Liu, Junguo; Yang, Hong; Park, Hoonyoung; Kim, Baek-Min; Feng, Song
2018-01-01
Aridity—the ratio of atmospheric water supply (precipitation; P) to demand (potential evapotranspiration; PET)—is projected to decrease (that is, areas will become drier) as a consequence of anthropogenic climate change, exacerbating land degradation and desertification1-6. However, the timing of significant aridification relative to natural variability—defined here as the time of emergence for aridification (ToEA)—is unknown, despite its importance in designing and implementing mitigation policies7-10. Here we estimate ToEA from projections of 27 global climate models (GCMs) under representative concentration pathways (RCPs) RCP4.5 and RCP8.5, and in doing so, identify where emergence occurs before global mean warming reaches 1.5 °C and 2 °C above the pre-industrial level. On the basis of the ensemble median ToEA for each grid cell, aridification emerges over 32% (RCP4.5) and 24% (RCP8.5) of the total land surface before the ensemble median of global mean temperature change reaches 2 °C in each scenario. Moreover, ToEA is avoided in about two-thirds of the above regions if the maximum global warming level is limited to 1.5 °C. Early action for accomplishing the 1.5 °C temperature goal can therefore markedly reduce the likelihood that large regions will face substantial aridification and related impacts.
Density of states and T/sub c/ of disordered A15 compounds
International Nuclear Information System (INIS)
Ghosh, A.K.; Strongin, M.
1979-01-01
In this paper various data for the depression of T/sub c/ and N(O) are presented for a wide class of A15 materials. The question of disorder and the limits on T/sub c/ in these materials are discussed
Transformation of India's transport sector under Global Warming of 2oC and 1.5oC Scenario
DEFF Research Database (Denmark)
Dhar, Subash; Pathak, Minal; Shukla, P.R.
2018-01-01
The Paris agreement stresses on concerted efforts to limit global temperature increase to 2°C and make efforts towards achieving 1.5°C temperature stabilization. Countries announced actions under the Nationally Determined Contributions outlining domestic mitigation actions to achieve the global...
Mixed phosphates of the Na3PO4 - LnPO4 systems
International Nuclear Information System (INIS)
Slivko, T.A.; Smirnova, I.N.; Zimina, G.V.; Spiridonov, F.M.; Chudinova, N.N.
2002-01-01
The phase relationships in the systems Na 3 PO 4 - LnPO 4 (subsolidus 950 Deg C cross-sections), where Ln=Sm, Eu, Tb, Dy, Ho, Tm, Yb, Lu, were studied by X-ray analysis. Reactions of the components were deduced, formed phases were separated and identified. The Na 6 Ln 3 (PO 4 ) 5 (Ln=Dy, Ho, Tm), Na 3 Ln 2 (PO 4 ) 3 (Ln=Tm, Yb, Lu) compounds and phases of the unstable composition Na 6+x Ln 3-x/3 (PO 4 ) 5 (Ln=Yb, Lu, 0 ≤ x ≤ 1.5) were detected for the first time. In all systems the existence of the Na 3-x Ln x/3 PO 4 unstable composition phase on the basis of the high temperature modification of sodium phosphate (sp. gr. Fm3m) is established, suggesting that stabilization of this modification by rare earth ions is possible [ru
17 CFR 240.15c3-3 - Customer protection-reserves and custody of securities.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Customer protection-reserves... Markets § 240.15c3-3 Customer protection—reserves and custody of securities. (a) Definitions. For the... the dealer as to that collateral; (iii) The Securities Investor Protection Act of 1970 (15 U.S.C...
DEFF Research Database (Denmark)
Toustrup-Jensen, Mads Schak; Einholm, Anja P.; Schack, Vivien
The neurological disorders familial hemiplegic migraine type 2 (FHM2), alternating hemiplegia of childhood (AHC), and rapid-onset dystonia parkinsonism (RDP) are caused by mutations of Na+,K+-ATPase α2 and α3 isoforms, expressed in glial and neuronal cells, respectively. Although these disorders......, addressing the question to what extent they cause a change of the intracellular Na+ and K+ concentrations ([Na+]i and [K+]i) in COS cells. C-terminal extension mutants generally showed dramatically reduced Na+ affinity without disturbance of K+ binding, as did other RDP mutants. No phosphorylation from ATP...
Um monstro nas minas ilustradas: O diabo na livraria do cônego
Directory of Open Access Journals (Sweden)
Késia Rodrigues de Oliveira
2011-03-01
Full Text Available A figura mitológica do diabo é elemento recorrente tanto no imaginário popular quanto em personagens da literatura ocidental sendo atribuída a ele a representação da maldade. Entretanto, é no período colonial mineiro que tal figura aparecerá, para além da conjuntura religiosa, simbolizando na forma de livros, as ideias iluministas franceses. Este artigo pretende a partir de uma leitura crítica do ensaio "ʺO diabo na livraria do cônego"ʺ, de Eduardo Frieiro, e do conto "ʺ1789-1790"ʺ, de Maria José de Queiroz, analisar, sob o contexto histórico da Inconfidência Mineira, as referências aos livros e ao diabo, alegoria das ideias libertárias, e sua relação com o espaço da biblioteca.
Zhang, Qingmeng; Luo, Jun; Tang, Qun; Han, Dongfang; Zhou, Yi; Du, Jun
2012-11-01
Nanocomposite dielectrics in 6PbO-4BaO-20Na2O-40Nb2O5-30SiO2 system were prepared via melt-quenching followed by controlled crystallization. X-ray diffraction studies reveal that Pb2Nb2O7, Ba,NaNb5O15, NaNbO3 and PbNb2O6 phases are formed from the as-quenched glass annealed in temperature range from 700 degrees C to 850 degrees C. Ba2NaNb5O15, Pb2Nb2O7 crystallizes at 700 degrees C and then Pb2Nb2O7 disappears at 850 degrees C, while PbNb2O6 and NaNbO3 are formed at 850 degrees C. Microstructural observation shows that the crystallized particles are nanometer-sized and randomly distributed with glass matrix being often found at grain boundaries. The dielectric constant of the nanocomposites formed at different crystallization temperatures shows good frequency and electric field stability. The breakdown strength is slightly decreased when the glass-ceramics thickness is varied from 1 mm to 4 mm. The corresponding energy density could reach 2.96 J/cm3 with a breakdown strength of 58 kV/mm for thickness of 1 mm.
In situ AFM study on barite (0 0 1) surface dissolution in NaCl solutions at 30 °C
International Nuclear Information System (INIS)
Kuwahara, Yoshihiro; Makio, Masato
2014-01-01
Highlights: • We examined barite surface dissolution behavior in NaCl solutions by AFM. • Step retreat and step splitting behavior changed with the NaCl concentration. • Etch pit formation and development differed in each NaCl solution. • Step retreat and etch pit growth rates increased with the NaCl concentration. • We assessed the effects of temperature and NaCl concentration on these rates. - Abstract: This paper reports in situ observations on barite (0 0 1) surface dissolution behavior in 0.1–0.001 M NaCl solutions at 30 °C using atomic force microscopy (AFM). The step retreating on barite (0 0 1) surfaces changed with increasing NaCl solution concentrations. In solutions with a higher NaCl concentration (⩾0.01 M), many steps showed curved or irregular fronts during the later experimental stage, while almost all steps in solutions with a lower NaCl concentration exhibited straight or angular fronts, even during the late stage. The splitting phenomenon of the initial 〈h k 0〉 one-layer steps (7.2 Å) into two half-layer steps (3.6 Å) occurred in all NaCl solutions, while that of the initial [0 1 0] one-layer steps observed only in the 0.1 M NaCl solution. The step retreat rates increased with an increasing NaCl solution concentration. We observed triangular etch pit and deep etch pit formation in all NaCl solutions, which tended to form late in solutions with lower NaCl concentrations. The deep etch pit morphology changed with increasing NaCl solution concentrations. A hexagonal form elongated in the [0 1 0] direction was bounded by the {1 0 0}, {3 1 0}, and (0 0 1) faces in a 0.001 M NaCl solution, and a rhombic form was bounded by the {5 1 0} and (0 0 1) faces in 0.01 M and 0.1 M NaCl solutions. An intermediate form was observed in a 0.005 M NaCl solution, which was defined by {1 0 0}, a curved face tangent to the [0 1 0] direction, {3 1 0}, and (0 0 1) faces: the intermediate form appeared between the hexagonal and rhombic forms in
Pokam Mba, Wilfried; Longandjo, Georges-Noel T.; Moufouma-Okia, Wilfran; Bell, Jean-Pierre; James, Rachel; Vondou, Derbetini A.; Haensler, Andreas; Fotso-Nguemo, Thierry C.; Merlin Guenang, Guy; Djiotang Tchotchou, Angennes Lucie; Kamsu-Tamo, Pierre H.; Takong, Ridick R.; Nikulin, Grigory; Lennard, Christopher J.; Dosio, Alessandro
2018-05-01
Discriminating climate impacts between 1.5 °C and 2 °C warming levels is particularly important for Central Africa, a vulnerable region where multiple biophysical, political, and socioeconomic stresses interact to constrain the region’s adaptive capacity. This study uses an ensemble of 25 transient Regional Climate Model (RCM) simulations from the CORDEX initiative, forced with the Representative Concentration Pathway (RCP) 8.5, to investigate the potential temperature and precipitation changes in Central Africa corresponding to 1.5 °C and 2 °C global warming levels. Global climate model simulations from the Coupled Model Intercomparison Project phase 5 (CMIP5) are used to drive the RCMs and determine timing of the targeted global warming levels. The regional warming differs over Central Africa between 1.5 °C and 2 °C global warming levels. Whilst there are large uncertainties associated with projections at 1.5 °C and 2 °C, the 0.5 °C increase in global temperature is associated with larger regional warming response. Compared to changes in temperature, changes in precipitation are more heterogeneous and climate model simulations indicate a lack of consensus across the region, though there is a tendency towards decreasing seasonal precipitation in March–May, and a reduction of consecutive wet days. As a drought indicator, a significant increase in consecutive dry days was found. Consistent changes of maximum 5 day rainfall are also detected between 1.5 °C vs. 2 °C global warming levels.
Warren, R; Price, J; Graham, E; Forstenhaeusler, N; VanDerWal, J
2018-05-18
In the Paris Agreement on Climate Change, the United Nations is pursuing efforts to limit global warming to 1.5°C, whereas earlier aspirations focused on a 2°C limit. With current pledges, corresponding to ~3.2°C warming, climatically determined geographic range losses of >50% are projected in ~49% of insects, 44% of plants, and 26% of vertebrates. At 2°C, this falls to 18% of insects, 16% of plants, and 8% of vertebrates and at 1.5°C, to 6% of insects, 8% of plants, and 4% of vertebrates. When warming is limited to 1.5°C as compared with 2°C, numbers of species projected to lose >50% of their range are reduced by ~66% in insects and by ~50% in plants and vertebrates. Copyright © 2018 The Authors, some rights reserved; exclusive licensee American Association for the Advancement of Science. No claim to original U.S. Government Works.
Long-Range Effects of Na(+) Binding in Na,K-ATPase Reported by ATP.
Middleton, David A; Fedosova, Natalya U; Esmann, Mikael
2015-12-01
This paper addresses the question of long-range interactions between the intramembranous cation binding sites and the cytoplasmic nucleotide binding site of the ubiquitous ion-transporting Na,K-ATPase using (13)C cross-polarization magic-angle spinning (CP-MAS) solid-state nuclear magnetic resonance. High-affinity ATP binding is induced by the presence of Na(+) as well as of Na-like substances such as Tris(+), and these ions are equally efficient promoters of nucleotide binding. CP-MAS analysis of bound ATP with Na,K-ATPase purified from pig kidney membranes reveals subtle differences in the nucleotide interactions within the nucleotide site depending on whether Na(+) or Tris(+) is used to induce binding. Differences in chemical shifts for ATP atoms C1' and C5' observed in the presence of Na(+) or Tris(+) suggest alterations in the residues surrounding the bound nucleotide, hydrogen bonding, and/or conformation of the ribose ring. This is taken as evidence of a long-distance communication between the Na(+)-filled ion sites in the membrane interior and the nucleotide binding site in the cytoplasmic domain and reflects the first conformational change ultimately leading to phosphorylation of the enzyme. Stopped-flow fluorescence measurements with the nucleotide analogue eosin show that the dissociation rate constant for eosin is larger in Tris(+) than in Na(+), giving kinetic evidence of the difference in structural effects of Na(+) and Tris(+). According to the recent crystal structure of the E1·AlF4(-)·ADP·3Na(+) form, the coupling between the ion binding sites and the nucleotide side is mediated by, among others, the M5 helix.
Regulation of Epithelial Sodium Transport via Epithelial Na+ Channel
Marunaka, Yoshinori; Niisato, Naomi; Taruno, Akiyuki; Ohta, Mariko; Miyazaki, Hiroaki; Hosogi, Shigekuni; Nakajima, Ken-ichi; Kusuzaki, Katsuyuki; Ashihara, Eishi; Nishio, Kyosuke; Iwasaki, Yoshinobu; Nakahari, Takashi; Kubota, Takahiro
2011-01-01
Renal epithelial Na+ transport plays an important role in homeostasis of our body fluid content and blood pressure. Further, the Na+ transport in alveolar epithelial cells essentially controls the amount of alveolar fluid that should be kept at an appropriate level for normal gas exchange. The epithelial Na+ transport is generally mediated through two steps: (1) the entry step of Na+ via epithelial Na+ channel (ENaC) at the apical membrane and (2) the extrusion step of Na+ via the Na+, K+-ATPase at the basolateral membrane. In general, the Na+ entry via ENaC is the rate-limiting step. Therefore, the regulation of ENaC plays an essential role in control of blood pressure and normal gas exchange. In this paper, we discuss two major factors in ENaC regulation: (1) activity of individual ENaC and (2) number of ENaC located at the apical membrane. PMID:22028593
International Nuclear Information System (INIS)
Hou, Wei-xiao; Wang, Zhi
2015-01-01
Highlights: • NiMgCuZn ferrites were successfully prepared by low-temperature sintering. • NiMgCuZn ferrites have the advantages of both NiCuZn and MgCuZn ferrites. • NiMgCuZn ferrites exhibit high Curie temperature & high stability of permeability. - Abstract: The Ni 0.15 Mg 0.1 Cu 0.3 Zn 0.45 Fe 2 O 4 ferrite powders have been prepared by NaOH co-precipitation method and characterized by X-ray diffraction (XRD) and vibrating sample magnetometer (VSM). The XRD patterns confirm the single phase spinel structure of synthesized nanoparticles. The average crystallite size of the particles increases from 12 to 36 nm with calcining temperature (T a ) from 500 to 800 °C. The saturation magnetization (M s ) of the superparamagnetic particles was deduced by Langevin theory. Subsequently, the densification characteristics and magnetic properties of the low-temperature 950 °C-sintered ferrite bulk samples were also investigated. The magnetic measurement showed that the sintered bulk sample of T a = 600 °C has the highest initial permeability (μ i ), lowest coercivity (H c ), largest saturation magnetization (M s ) and satisfactory thermal stability of μ i . The microstructures of sintered samples were examined using field emission scanning electric microscope (FESEM). The T a has significant influence on the bulk density, initial permeability, saturation magnetization and coercivity of Ni 0.15 Mg 0.1 Cu 0.3 Zn 0.45 Fe 2 O 4 ferrite
Spin-exchange and spin-destruction rates for the 3He-Na system
International Nuclear Information System (INIS)
Borel, P.I.; Soegaard, L.V.; Svendsen, W.E.; Andersen, N.
2003-01-01
Optically pumped Na is used as a spin-exchange partner to polarize 3 He. Polarizations around 20% have routinely been achieved in sealed spherical glass cells containing 3 He, N 2 , and a few droplets of Na. An optical technique has been developed to determine the Na- 3 He spin-exchange rate coefficient. By monitoring the Na spin relaxation ''in the dark,'' the average Na-Na spin-destruction cross section at 330 degree sign C is estimated to be around 5x10 -19 cm 2 . This value is 2-5 (15-30) times smaller than the previously reported values for the K-K (Rb-Rb) spin-relaxation cross section. In the temperature range 310-355 degree sign C the spin-exchange rate coefficient is found to be (6.1±0.6)x10 -20 cm 3 /s with no detectable temperature dependence. This value is in good agreement with a previous theoretical estimate reported by Walker and it is only slightly lower than the corresponding Rb- 3 He spin-exchange rate coefficient. The total Na- 3 He spin-destruction rate coefficient is, within errors, found to be the same as the Na- 3 He spin-exchange rate coefficient, thereby indicating that the maximum possible photon efficiency may approach unity for the Na- 3 He system. A technique, in which a charge-coupled device camera is used to take images of faint unquenched fluorescence light, has been utilized to allow for an instantaneous determination of the sodium number densities during the rate coefficient measurements
Clegg, S L; Wexler, A S
2011-04-21
Calculations of the size and density of atmospheric aerosols are complicated by the fact that they can exist at concentrations highly supersaturated with respect to dissolved salts and supercooled with respect to ice. Densities and apparent molar volumes of solutes in aqueous solutions containing the solutes H(2)SO(4), HNO(3), HCl, Na(2)SO(4), NaNO(3), NaCl, (NH(4))(2)SO(4), NH(4)NO(3), and NH(4)Cl have been critically evaluated and represented using fitted equations from 0 to 50 °C or greater and from infinite dilution to concentrations saturated or supersaturated with respect to the dissolved salts. Using extrapolated densities of high-temperature solutions and melts, the relationship between density and concentration is extended to the hypothetical pure liquid solutes. Above a given reference concentration of a few mol kg(-1), it is observed that density increases almost linearly with decreasing temperature, and comparisons with available data below 0 °C suggest that the fitted equations for density can be extrapolated to very low temperatures. As concentration is decreased below the reference concentration, the variation of density with temperature tends to that of water (which decreases as temperature is reduced below 3.98 °C). In this region below the reference concentration, and below 0 °C, densities are calculated using extrapolated apparent molar volumes which are constrained to agree at the reference concentrations with an equation for the directly fitted density. Calculated volume properties agree well with available data at low temperatures, for both concentrated and dilute solutions. Comparisons are made with literature data for temperatures of maximum density. Apparent molar volumes at infinite dilution are consistent, on a single ion basis, to better than ±0.1 cm(3) mol(-1) from 0 to 50 °C. Volume properties of aqueous NaHSO(4), NaOH, and NH(3) have also been evaluated, at 25 °C only. In part 2 of this work (ref 1 ) an ion interaction (Pitzer
Pei, Ziwei; Bai, Ying; Wang, Yue; Wu, Feng; Wu, Chuan
2017-09-20
The lightweight compound material NaNH 2 -NaBH 4 is regarded as a promising hydrogen storage composite due to the high hydrogen density. Mechanical ball milling was employed to synthesize the composite NaNH 2 -NaBH 4 (2/1 molar ratio), and the samples were investigated utilizing thermogravimetric-differential thermal analysis-mass spectroscopy (TG-DTA-MS), X-ray diffraction (XRD), and Fourier transform infrared spectroscopy (FTIR) analyses. The full-spectrum test (range of the ratio of mass to charge: 0-200) shows that the released gaseous species contain H 2 , NH 3 , B 2 H 6 , and N 2 in the heating process from room temperature to 400 °C, and possibly the impurity gas B 6 H 12 also exists. The TG/DTA analyses show that the composite NaNH 2 -NaBH 4 (2/1 molar ratio) is conductive to generate hydrogen so that the dehydrogenation process can be finished before 400 °C. Moreover, the thermal decomposition process from 200 to 400 °C involves two-step dehydrogenation reactions: (1) Na 3 (NH 2 ) 2 BH 4 hydride decomposes into Na 3 BN 2 and H 2 (200-350 °C); (2) remaining Na 3 (NH 2 ) 2 BH 4 reacts with NaBH 4 and Na 3 BN 2 , generating Na, BN, NH 3 , N 2 , and H 2 (350-400 °C). The better mechanism understanding of the thermal decomposition pathway lays a foundation for tailoring the hydrogen storage performance of the composite complex hydrides system.
Pathways limiting warming to 1.5°C: a tale of turning around in no time?
Kriegler, Elmar; Luderer, Gunnar; Bauer, Nico; Baumstark, Lavinia; Fujimori, Shinichiro; Popp, Alexander; Rogelj, Joeri; Strefler, Jessica; van Vuuren, Detlef P
2018-05-13
We explore the feasibility of limiting global warming to 1.5°C without overshoot and without the deployment of carbon dioxide removal (CDR) technologies. For this purpose, we perform a sensitivity analysis of four generic emissions reduction measures to identify a lower bound on future CO 2 emissions from fossil fuel combustion and industrial processes. Final energy demand reductions and electrification of energy end uses as well as decarbonization of electricity and non-electric energy supply are all considered. We find the lower bound of cumulative fossil fuel and industry CO 2 emissions to be 570 GtCO 2 for the period 2016-2100, around 250 GtCO 2 lower than the lower end of available 1.5°C mitigation pathways generated with integrated assessment models. Estimates of 1.5°C-consistent CO 2 budgets are highly uncertain and range between 100 and 900 GtCO 2 from 2016 onwards. Based on our sensitivity analysis, limiting warming to 1.5°C will require CDR or terrestrial net carbon uptake if 1.5°C-consistent budgets are smaller than 650 GtCO 2 The earlier CDR is deployed, the more it neutralizes post-2020 emissions rather than producing net negative emissions. Nevertheless, if the 1.5°C budget is smaller than 550 GtCO 2 , temporary overshoot of the 1.5°C limit becomes unavoidable if CDR cannot be ramped up faster than to 4 GtCO 2 in 2040 and 10 GtCO 2 in 2050.This article is part of the theme issue 'The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'. © 2018 The Author(s).
Pathways limiting warming to 1.5°C: a tale of turning around in no time?
Kriegler, Elmar; Luderer, Gunnar; Bauer, Nico; Baumstark, Lavinia; Fujimori, Shinichiro; Popp, Alexander; Rogelj, Joeri; Strefler, Jessica; van Vuuren, Detlef P.
2018-05-01
We explore the feasibility of limiting global warming to 1.5°C without overshoot and without the deployment of carbon dioxide removal (CDR) technologies. For this purpose, we perform a sensitivity analysis of four generic emissions reduction measures to identify a lower bound on future CO2 emissions from fossil fuel combustion and industrial processes. Final energy demand reductions and electrification of energy end uses as well as decarbonization of electricity and non-electric energy supply are all considered. We find the lower bound of cumulative fossil fuel and industry CO2 emissions to be 570 GtCO2 for the period 2016-2100, around 250 GtCO2 lower than the lower end of available 1.5°C mitigation pathways generated with integrated assessment models. Estimates of 1.5°C-consistent CO2 budgets are highly uncertain and range between 100 and 900 GtCO2 from 2016 onwards. Based on our sensitivity analysis, limiting warming to 1.5°C will require CDR or terrestrial net carbon uptake if 1.5°C-consistent budgets are smaller than 650 GtCO2. The earlier CDR is deployed, the more it neutralizes post-2020 emissions rather than producing net negative emissions. Nevertheless, if the 1.5°C budget is smaller than 550 GtCO2, temporary overshoot of the 1.5°C limit becomes unavoidable if CDR cannot be ramped up faster than to 4 GtCO2 in 2040 and 10 GtCO2 in 2050. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'.
1H, 15N and 13C NMR Assignments of Mouse Methionine Sulfoxide Reductase B2
Breivik, Åshild S.; Aachmann, Finn L.; Sal, Lena S.; Kim, Hwa-Young; Del Conte, Rebecca; Gladyshev, Vadim N.; Dikiy, Alexander
2011-01-01
A recombinant mouse methionine-r-sulfoxide reductase 2 (MsrB2ΔS) isotopically labeled with 15N and 15N/13C was generated. We report here the 1H, 15N and 13C NMR assignments of the reduced form of this protein. PMID:19636904
Isolation and characterization of a specific endogenous Na+, K+-ATPase inhibitor from bovine adrenal
International Nuclear Information System (INIS)
Tamura, M.; Lam, T.T.; Inagami, T.
1988-01-01
In order to identify a specific endogenous Na + ,K + -ATPase inhibitor which could possibly be related to salt-dependent hypertension, the authors looked for substances in the methanol extract of bovine whole adrenal which show all of the following properties: (i) inhibitory activity for Na + ,K + -ATPase; (ii) competitive displacing activity against [ 3 H]ouabain binding to the enzyme; (iii) inhibitory activity for 86 Rb uptake into intact human erythrocytes; and (iv) cross-reactivity with sheep anti-digoxin-specific antibody. After stepwise fractionation of the methanol extract of bovine adrenal glands by chromatography on a C 18 open column, a 0-15% acetonitrile fraction was fractionated by high-performance liquid chromatography on a Zorbax octadecylsilane column. One of the most active fractions in 0-15% acetonitrile was found to exhibit all of the four types of the activities. It was soluble in water and was distinct from various substances which have been known to inhibit Na + ,K + -ATPase. These results strongly suggest that this water-soluble nonpeptidic Na + ,K + -ATPase inhibitor may be a specific endogenous regulator for the ATPase
Climate Impacts in Europe Under +1.5°C Global Warming
Jacob, Daniela; Kotova, Lola; Teichmann, Claas; Sobolowski, Stefan P.; Vautard, Robert; Donnelly, Chantal; Koutroulis, Aristeidis G.; Grillakis, Manolis G.; Tsanis, Ioannis K.; Damm, Andrea; Sakalli, Abdulla; van Vliet, Michelle T. H.
2018-02-01
The Paris Agreement of the United Nations Framework Convention on Climate Change aims not only at avoiding +2°C warming (and even limit the temperature increase further to +1.5°C), but also sets long-term goals to guide mitigation. Therefore, the best available science is required to inform policymakers on the importance of and the adaptation needs in a +1.5°C warmer world. Seven research institutes from Europe and Turkey integrated their competencies to provide a cross-sectoral assessment of the potential impacts at a pan-European scale. The initial findings of this initiative are presented and key messages communicated. The approach is to select periods based on global warming thresholds rather than the more typical approach of selecting time periods (e.g., end of century). The results indicate that the world is likely to pass the +1.5°C threshold in the coming decades. Cross-sectoral dimensions are taken into account to show the impacts of global warming that occur in parallel in more than one sector. Also, impacts differ across sectors and regions. Alongside the negative impacts for certain sectors and regions, some positive impacts are projected. Summer tourism in parts of Western Europe may be favored by climate change; electricity demand decreases outweigh increases over most of Europe and catchment yields in hydropower regions will increase. However, such positive findings should be interpreted carefully as we do not take into account exogenous factors that can and will influence Europe such as migration patterns, food production, and economic and political instability.
Redox-controlled backbone dynamics of human cytochrome c revealed by 15N NMR relaxation measurements
International Nuclear Information System (INIS)
Sakamoto, Koichi; Kamiya, Masakatsu; Uchida, Takeshi; Kawano, Keiichi; Ishimori, Koichiro
2010-01-01
Research highlights: → The dynamic parameters for the backbone dynamics in Cyt c were determined. → The backbone mobility of Cyt c is highly restricted due to the covalently bound heme. → The backbone mobility of Cyt c is more restricted upon the oxidation of the heme. → The redox-dependent dynamics are shown in the backbone of Cyt c. → The backbone dynamics of Cyt c would regulate the electron transfer from Cyt c. -- Abstract: Redox-controlled backbone dynamics in cytochrome c (Cyt c) were revealed by 2D 15 N NMR relaxation experiments. 15 N T 1 and T 2 values and 1 H- 15 N NOEs of uniformly 15 N-labeled reduced and oxidized Cyt c were measured, and the generalized order parameters (S 2 ), the effective correlation time for internal motion (τ e ), the 15 N exchange broadening contributions (R ex ) for each residue, and the overall correlation time (τ m ) were estimated by model-free dynamics formalism. These dynamic parameters clearly showed that the backbone dynamics of Cyt c are highly restricted due to the covalently bound heme that functions as the stable hydrophobic core. Upon oxidation of the heme iron in Cyt c, the average S 2 value was increased from 0.88 ± 0.01 to 0.92 ± 0.01, demonstrating that the mobility of the backbone is further restricted in the oxidized form. Such increases in the S 2 values were more prominent in the loop regions, including amino acid residues near the thioether bonds to the heme moiety and positively charged region around Lys87. Both of the regions are supposed to form the interaction site for cytochrome c oxidase (CcO) and the electron pathway from Cyt c to CcO. The redox-dependent mobility of the backbone in the interaction site for the electron transfer to CcO suggests an electron transfer mechanism regulated by the backbone dynamics in the Cyt c-CcO system.
International Nuclear Information System (INIS)
Gao, Zhen-Fei; Di, You-Ying; Liu, Su-Zhou; Lu, Dong-Fei; Dou, Jian-Min
2014-01-01
Graphical abstract: A novel coordination compound sodium pyruvate C 3 H 3 O 3 Na(s) is synthesised. Elemental analysis and X-ray crystallography are used to characterise the composition and crystal structure of the compound. The lattice potential energy and ionic volume of the anion are obtained from crystallographic data. The standard molar enthalpy of formation of the compound is calculated by an isoperibol solution-reaction calorimeter. Molar enthalpies of dissolution of the compound at various molalities are measured at T = 298.15 K. According to Pitzer’s theory, molar enthalpy of dissolution of the title compound at infinite dilution is calculated. The values of relative apparent molar enthalpies and relative partial molar enthalpies of the solvent and the compound at different concentrations m/(mol · kg −1 ) are derived. - Highlights: • The sodium pyruvate was synthesised and crystal structure was determined. • The enthalpy change of the synthesis reaction was obtained. • Standard molar enthalpy of formation was obtained. • Molar enthalpy of dissolution at infinite dilution was calculated. - Abstract: A novel coordination compound sodium pyruvate C 3 H 3 O 3 Na(s) is synthesised by a liquid phase reaction. The compound has an obvious bioactivity and can be used as the biological carbon source and the chemical identification of primary and secondary alcohols. It can be also used to determinate transaminase. Elemental analysis and X-ray crystallography are used to characterise the composition and crystal structure of the compound. Single crystal X-ray analysis reveals that the compound is formed by one CH 3 COCOO − anion and one Na + cation. An obvious feature of the crystal structure is the formation of the five-membered chelate ring by the coordination of O1 of carboxylate and O3 of keto form with Na + cation, and it is good for the stability of the compound in structure. The lattice potential energy and ionic volume of the anion are obtained
Energy Technology Data Exchange (ETDEWEB)
Chen, Qiuyun; Liu, Qing [Huazhong University of Science and Technology, State Key Laboratory of Materials Processing and Die and Mould Technology (China); Chu, Xiangcheng; Zhang, Yiling [Tsinghua University, State Key Laboratory of New Ceramic and Fine Processing (China); Yan, Youwei; Xue, Lihong, E-mail: xuelh@hust.edu.cn; Zhang, Wuxing, E-mail: zhangwx@hust.edu.cn [Huazhong University of Science and Technology, State Key Laboratory of Materials Processing and Die and Mould Technology (China)
2017-04-15
Solution combustion synthesis (SCS) is an effective and rapid method for synthesizing nanocrystalline materials. However, the control over size, morphology, and microstructure are rather limited in SCS. Here, we develop a novel ultrasonic-assisted solution combustion route to synthesize the porous and nano-sized Na{sub 3}V{sub 2}(PO{sub 4}){sub 3}/C composites, and reveal the effects of ultrasound on the structural evolution of NVP/C. Due to the cavitation effects generated from ultrasonic irradiation, the ultrasonic-assisted SCS can produce honeycomb precursor, which can be further transformed into porous Na{sub 3}V{sub 2}(PO{sub 4}){sub 3}/C with reticular and hollow structures after thermal treatment. When used as cathode material for Na-ion batteries, the porous Na{sub 3}V{sub 2}(PO{sub 4}){sub 3}/C delivers an initial discharge capacity of 118 mAh g{sup −1} at 0.1 C and an initial coulombic efficiency of 85%. It can retain 93.8% of the initial capacity after 120 cycles at 0.2 C. The results demonstrate that ultrasonic-assisted SCS can be a new strategy to design crystalline nanomaterials with tunable microstructures.
International Nuclear Information System (INIS)
Wang, Wenhui; Chen, Zhenyu; Zhang, Jiaolong; Dai, Changsong; Li, Jiajie; Ji, Dalong
2013-01-01
In order to synthesize pure derivative of rhombohedral Li 3 V 2 (PO 4 ) 3 (LVP), lithium-ion batteries materials Li 2.5 Na 0.5 V (2−2x/3) Ni x (PO 4 ) 3 /C (x = 0.03, 0.06, 0.09) and its control, monoclinic Li 3 V 2 (PO 4 ) 3 /C (LVP/C), were prepared by sol–gel method. The samples were investigated by X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD) spectroscopy, scanning electron microscopy (SEM), Raman spectroscopy, and electrochemical methods. The XRD patterns of Li 2.5 Na 0.5 V (2−2x/3) Ni x (PO 4 ) 3 /C are in good agreement with that of rhombohedral LVP, which indicates that the Na + –Ni 2+ composite doping can change the structure of monoclinic LVP. All the composite doping samples displayed a single flat plateau at 3.7 V in the charge/discharge voltage profile, which is caused by transformation of multi-phase mechanism to single-phase mechanism. For Li 2.5 Na 0.5 V 1.98 Ni 0.03 (PO 4 ) 3 /C, a specific discharge capacity of 108 mAh g −1 was achieved at a 0.5 C charge rate and a 1 C discharge rate, and a 99.0% retention rate of the initial capacity was obtained after 50 cycles
Mechanosynthesis of the ferroelectric materials Ba2ANb5O15 (A = K, Na, Li)
International Nuclear Information System (INIS)
Khachane, M.; Moure, A.; Elaatmani, M.; Zegzouti, A.; Daoud, M.; Castro, A.
2006-01-01
A novel mechanochemical activation route was applied in order to obtain the Ba 2 ANb 5 O 15 (A = K, Na, Li) ferroelectric materials. The evolution of the 4BaO 2 :A 2 CO 3 :5Nb 2 O 5 powder mixtures during mechanical treatment and subsequent annealings, was followed by X-ray powder diffraction (XRD), thermal analysis and scanning electron microscopy (SEM). The sought bronze-type phases were mechanosynthesized after 48 h of treatment in a planetary mill. Very crystalline phases can be obtained with very important decreases in the temperatures and reaction times as compared with the traditional ceramic method. Dense ceramics were processed from mechanosynthesized precursors at relative low temperature, by a conventional-sintering route, and their dielectric properties characterized
Crop productivity changes in 1.5 °C and 2 °C worlds under climate sensitivity uncertainty
Schleussner, Carl-Friedrich; Deryng, Delphine; Müller, Christoph; Elliott, Joshua; Saeed, Fahad; Folberth, Christian; Liu, Wenfeng; Wang, Xuhui; Pugh, Thomas A. M.; Thiery, Wim; Seneviratne, Sonia I.; Rogelj, Joeri
2018-06-01
Following the adoption of the Paris Agreement, there has been an increasing interest in quantifying impacts at discrete levels of global mean temperature (GMT) increase such as 1.5 °C and 2 °C above pre-industrial levels. Consequences of anthropogenic greenhouse gas emissions on agricultural productivity have direct and immediate relevance for human societies. Future crop yields will be affected by anthropogenic climate change as well as direct effects of emissions such as CO2 fertilization. At the same time, the climate sensitivity to future emissions is uncertain. Here we investigate the sensitivity of future crop yield projections with a set of global gridded crop models for four major staple crops at 1.5 °C and 2 °C warming above pre-industrial levels, as well as at different CO2 levels determined by similar probabilities to lead to 1.5 °C and 2 °C, using climate forcing data from the Half a degree Additional warming, Prognosis and Projected Impacts project. For the same CO2 forcing, we find consistent negative effects of half a degree warming on productivity in most world regions. Increasing CO2 concentrations consistent with these warming levels have potentially stronger but highly uncertain effects than 0.5 °C warming increments. Half a degree warming will also lead to more extreme low yields, in particular over tropical regions. Our results indicate that GMT change alone is insufficient to determine future impacts on crop productivity.
Verma, Anand Mohan; Kishore, Nanda
2017-02-01
The hydrolysis of cellulose fraction of biomass yields C6 glucose which further can be transformed into long-chain hydrocarbons by C-C coupling. In this study, C6 glucose is transformed into three chain alkanes, namely, C9, C12 and C15 using C-C coupling reactions under the gas and aqueous phase milieus. The geometry optimisation and vibrational frequency calculations are carried out at well-known hybrid-GGA functional, B3LYP with the basis set of 6-31+g(d,p) under the density functional theory framework. The single point energetics are calculated at M05-2X/6-311+g(3df,2p) level of theory. All thermochemical properties are calculated over a wide range of temperature between 300 and 900 K at an interval of 100 K. The thermochemistry suggested that the aqueous phase behaviour is suitable for the hydrolysis of sugar into long-chain alkanes compared to gas-phase environment. The hydrodeoxygenation reactions under each reaction pathway are found as most favourable reactions in both phases; however, aqueous phase dominates over gas phase in all discussed thermodynamic parameters.
Risks for the global freshwater system at 1.5 °C and 2 °C global warming
Döll, Petra; Trautmann, Tim; Gerten, Dieter; Müller Schmied, Hannes; Ostberg, Sebastian; Saaed, Fahad; Schleussner, Carl-Friedrich
2018-04-01
To support implementation of the Paris Agreement, the new HAPPI ensemble of 20 bias-corrected simulations of four climate models was used to drive two global hydrological models, WaterGAP and LPJmL, for assessing freshwater-related hazards and risks in worlds approximately 1.5 °C and 2 °C warmer than pre-industrial. Quasi-stationary HAPPI simulations are better suited than transient CMIP-like simulations for assessing hazards at the two targeted long-term global warming (GW) levels. We analyzed seven hydrological hazard indicators that characterize freshwater-related hazards for humans, freshwater biota and vegetation. Using a strict definition for significant differences, we identified for all but one indicator that areas with either significantly wetter or drier conditions (calculated as percent changes from 2006–2015) are smaller in the 1.5 °C world. For example, 7 day high flow is projected to increase significantly on 11% and 21% of the global land area at 1.5 °C and 2 °C, respectively. However, differences between hydrological hazards at the two GW levels are significant on less than 12% of the area. GW affects a larger area and more people by increases—rather than by decreases—of mean annual and 1-in-10 dry year streamflow, 7 day high flow, and groundwater recharge. The opposite is true for 7 day low flow, maximum snow storage, and soil moisture in the driest month of the growing period. Mean annual streamflow shows the lowest projected percent changes of all indicators. Among country groups, low income countries and lower middle income countries are most affected by decreased low flows and increased high flows, respectively, while high income countries are least affected by such changes. The incremental impact between 1.5 °C and 2 °C on high flows would be felt most by low income and lower middle income countries, the effect on soil moisture and low flows most by high income countries.
Estudios estructurales de la proteína mayoritaria de la cápsida de lentivirus
Yélamos López, María Belén
1998-01-01
Los Lentivirus son un grupo de virus, subfamilia de los Retrovirus. Incluyen virus de gran importancia tanto veterinaria, como el virus de la anemia infecciosa equina (EIAV) o el virus de la inmunodeficiencia felina (FIV), como clínica como el virus de la inmunodeficiencia humana (HIV). Nuestro sistema de estudio es la proteína mayoritaria de la cápsida de lentivirus. Las proteínas de las cápsidas lentivirales tienen una gran homología de secuencia. Este alto grado de similitud, junto con la ...
Projected changes of thermal growing season over Northern Eurasia in a 1.5 °C and 2 °C warming world
Zhou, Baiquan; Zhai, Panmao; Chen, Yang; Yu, Rong
2018-03-01
Projected changes of the thermal growing season (TGS) over Northern Eurasia at 1.5 °C and 2 °C global warming levels are investigated using 22 CMIP5 models under both RCP4.5 and RCP8.5 scenarios. The multi-model mean projections indicate Northern Eurasia will experience extended and intensified TGSs in a warmer world. The prolongation of TGSs under 1.5 °C and 2 °C warming is attributed to both earlier onset and later termination, with the latter factor playing a dominating role. Interestingly, earlier onset is of greater importance under RCP4.5 than under RCP8.5 in prolonging TGS as the world warms by an additional 0.5 °C. Under both RCPs, growing degree day sum (GDD) above 5 °C is anticipated to increase by 0 °C-450 °C days and 0 °C-650 °C days over Northern Eurasia at 1.5 °C and 2 °C warming, respectively. However, effective GDD (EGDD) which accumulates optimum temperature for the growth of wheat, exhibits a decline in the south of Central Asia under warmer climates. Therefore, for wheat production over Northern Eurasia, adverse effects incurred by scorching temperatures and resultant inadequacy in water availability may counteract benefits from lengthening and warming TGS. In response to a future 1.5 °C and 2 °C warmer world, proper management and scientifically-tailored adaptation are imperative to optimize local-regional agricultural production.
Where have all the Na+ channels gone? In search of functional ENaC in exocrine pancreas
DEFF Research Database (Denmark)
Novak, Ivana; Hansen, Mette R
2002-01-01
was to investigate if pancreatic ducts express functional ENaC. Membrane voltages (V) of ducts isolated from rat pancreas were measured with microelectrodes or whole-cell patch-clamp technique. Amiloride and benzamil given from bath or luminal sides did not hyperpolarize V. Lowering of extracellular Na...... with glucocorticoids had no effect on pancreatic fluid secretion evoked from ducts, or from acini. Hence, our study shows that pancreas especially pancreatic ducts do not express functional ENaC....
N-Mesityl-C-acylketenimines: 1,5-Sigmatropic Shifts and Electrocyclization to Quinolines.
Rao, V. V. Ramana; Fulloon, Belinda E.; Bernhardt, Paul V.; Koch, Rainer; Wentrup, Curt
1998-08-21
Flash vacuum thermolysis (FVT) of triazoles 6a-c generates alpha-oxoketenimines 10, the ester 10a being isolable. FVT of pyrroledione 8 generates the isomeric imidoylketene 9a. Ketenes 9 and ketenimines 10 undergo thermal interconversion by 1,3-shifts of methoxy and dimethylamino groups under mild FVT conditions (ca. 350-400 degrees C). Both 9 and 10 are directly observable by IR spectroscopy at either 77 K or on Ar matrix isolation at 12 K. On FVT at temperatures above ca. 400 degrees C, the ketenimines 10 undergo a 1,5-H shift to o-quinoid imines 12/13, followed by electrocyclization to dihydroquinolines 14 (unobserved) and 15 (observed by NMR). The latter are easily oxidized to alkylquinoline-3-carboxylates or quinoline-3-carboxamides 16 by atmospheric oxygen. Ab initio calculations on model compounds 18-23 predict an energy barrier of ca. 38 kcal mol(-)(1) (161 kJ mol(-)(1)) for the 1,5-H shift in N-(o-methylphenyl)ketenimines via the transition state TS19 followed by an electrocyclization barrier to dihydroquinoline 23a via TS22a of ca. 16 kcal mol(-)(1).
Scenarios towards limiting global mean temperature increase below 1.5 °C
Rogelj, Joeri; Popp, Alexander; Calvin, Katherine V.; Luderer, Gunnar; Emmerling, Johannes; Gernaat, David; Fujimori, Shinichiro; Strefler, Jessica; Hasegawa, Tomoko; Marangoni, Giacomo; Krey, Volker; Kriegler, Elmar; Riahi, Keywan; van Vuuren, Detlef P.; Doelman, Jonathan; Drouet, Laurent; Edmonds, Jae; Fricko, Oliver; Harmsen, Mathijs; Havlík, Petr; Humpenöder, Florian; Stehfest, Elke; Tavoni, Massimo
2018-04-01
The 2015 Paris Agreement calls for countries to pursue efforts to limit global-mean temperature rise to 1.5 °C. The transition pathways that can meet such a target have not, however, been extensively explored. Here we describe scenarios that limit end-of-century radiative forcing to 1.9 W m-2, and consequently restrict median warming in the year 2100 to below 1.5 °C. We use six integrated assessment models and a simple climate model, under different socio-economic, technological and resource assumptions from five Shared Socio-economic Pathways (SSPs). Some, but not all, SSPs are amenable to pathways to 1.5 °C. Successful 1.9 W m-2 scenarios are characterized by a rapid shift away from traditional fossil-fuel use towards large-scale low-carbon energy supplies, reduced energy use, and carbon-dioxide removal. However, 1.9 W m-2 scenarios could not be achieved in several models under SSPs with strong inequalities, high baseline fossil-fuel use, or scattered short-term climate policy. Further research can help policy-makers to understand the real-world implications of these scenarios.
Directory of Open Access Journals (Sweden)
Elias Terra Werner
2009-01-01
Full Text Available O objetivo desse trabalho foi prolongar o período de conservação e manter a qualidade de goiabas (Psidium guajava L. Cortibel, por meio da aplicação de diferentes concentrações de cloreto de cálcio. Os frutos foram separados em quatro lotes, o controle (sem cálcio e os tratamentos, que receberam a aplicação de CaCl2 a 1%, 2% e 3% (p/v por imersão durante 15 minutos para posterior análise de perda de massa fresca, pH, determinação de firmeza, sólidos solúveis totais, acidez total titulável, relação entre sólidos solúveis totais e acidez total titulável, quantidade de clorofilas a e b e carotenóides, teor de ácido ascórbico na casca e na polpa e atividade da pectinametilesterase. A concentração de 1% foi responsável pela menor perda de massa fresca, maior firmeza e menor atividade da pectinametilesterase, demonstrando que o cálcio é importante para conservação do fruto, uma vez que atua na regulação do seu amadurecimento. Essa concentração retardou a perda de coloração e manteve o maior teor de ácido ascórbico na casca sem, contudo, diferir estatisticamente das outras concentrações no teor de sólidos solúveis totais e pH. Além disso, verifica-se que maiores concentrações de cálcio não beneficiam as características pós-colheita de goiaba.The objective of this work was to extend the conservation period and maintain the quality of guavas (Psidium guajava L. Cortibel, through the application of different concentrations of calcium chloride. The fruits were divided into four lots, the control (without calcium and treatments, which received the application of CaCl2 to 1%, 2% and 3% (p/v by immersion for 15 minutes. The parameters evaluated were fresh weight loss, pH, determination of firmness, total soluble solids content, total titratable acidity, ratio total soluble solids and total titratable acidity, amount of chlorophyll a and b and carotenoid, ascorbic acid content in the rind and pulp and
Permafrost thaw strongly reduces allowable CO2 emissions for 1.5°C and 2°C
Kechiar, M.; Gasser, T.; Kleinen, T.; Ciais, P.; Huang, Y.; Burke, E.; Obersteiner, M.
2017-12-01
We quantify how the inclusion of carbon emission from permafrost thaw impacts the budgets of allowable anthropogenic CO2 emissions. We use the compact Earth system model OSCAR v2.2 which we expand with a permafrost module calibrated to emulate the behavior of the complex models JSBACH, ORCHIDEE and JULES. When using the "exceedance" method and with permafrost thaw turned off, we find budgets very close to the CMIP5 models' estimates reported by IPCC. With permafrost thaw turned on, the total budgets are reduced by 3-4%. This corresponds to a 33-45% reduction of the remaining budget for 1.5°C, and a 9-13% reduction for 2°C. When using the "avoidance" method, however, permafrost thaw reduces the total budget by 3-7%, which corresponds to reductions by 33-56% and 56-79% of the remaining budget for 1.5°C and 2°C, respectively. The avoidance method relies on many scenarios that actually peak below the target whereas the exceedance method overlooks the carbon emitted by thawed permafrost after the temperature target is reached, which explains the difference. If we use only the subset of scenarios in which there is no net negative emissions, the permafrost-induced reduction in total budgets rises to 6-15%. Permafrost thaw therefore makes the emission budgets strongly path-dependent. We also estimate budgets of needed carbon capture in scenarios overshooting the temperature targets. Permafrost thaw strongly increases these capture budgets: in the case of a 1.5°C target overshot by 0.5°C, which is in line with the Paris agreement, about 30% more carbon must be captured. Our conclusions are threefold. First, inclusion of permafrost thaw systematically reduces the emission budgets, and very strongly so if the temperature target is overshot. Second, the exceedance method, that is the only one that complex models can follow, only partially accounts for the effect of slow non-linear processes such as permafrost thaw, leading to overestimated budgets. Third, the newfound
Fate of [15N]glycine in peat as determined by 13C and 15N CP-MAS NMR spectroscopy
International Nuclear Information System (INIS)
Benzing-Purdie, L.M.; Cheshire, M.V.; Williams, B.L.; Sparling, G.P.; Ratcliffe, C.I.; Ripmeester, J.A.
1986-01-01
Peat samples, nonsterile, sterilized by γ irradiation or autoclaving, were incubated with [ 15 N]glycine for a period of 6 months. The 13 C NMR data showed the established trend of increased humification with decreasing particle size and that autoclaving had significantly disturbed the humification-particle size distribution. The 15 N CP-MAS NMR spectra showed the presence of [ 15 N]glycine in all fractions after incubation. 15 NH 4 + , a result of either biological or chemical deamination, was one of the main products in the nonsterile peat series. The 15 N spectra also showed resonances corresponding to amine, secondary amide, and pyrrole-type nitrogen and the presence of glycine derivatives and melanoidins. The results presented give the first spectroscopic evidence of the possible involvement of the Maillard reaction in the humification process
Osmotic and activity coefficients of aqueous NaTcO4 and NaReO4 solutions at 250C
International Nuclear Information System (INIS)
Boyd, G.E.
1978-01-01
Isopiestic vapor-pressure comparison experiments were performed with aqueous binary sodium perchlorate, pertechnetate, and perrhenate solutions to concentrations of approximately 8.5 m. Osmotic coefficients for these solutions and mean molal ionic activity coefficients for NaTcO 4 and NaReO 4 were derived from the isotonic molalities. Pitzer's treatment was applied to describe the concentration dependence of the osmotic coefficients of NaClO 4 , NaTcO 4 , and NaReO 4 , and the implications of the parameters derived from a least-squares fit are discussed in terms of solvent structure and interionic forces. 4 tables, 1 figure
Extreme Temperatures over India in the 1.5°C and 2°C warmer worlds
Thanigachalam, A.; Achutarao, K. M.
2017-12-01
n the summer of 2015 a heat wave claimed more than 2500 lives of southeastern India. Wehner et al., (2016) showed that the risk of this heat wave has increased due to anthropogenic forcings. Under the RCP 8.5 scenario, surface temperature over India shows a rate of increase of about 0.2°C/decade during the 21st Century (Basha et al., 2017). The extreme temperatures that have occurred in the recent past and further increases projected for the future have implications for human health and productivity. In light of the Paris accords, future stabilization of global mean temperature at the 1.5°C above pre-industrial aspirational target and the "not to be exceeded" 2°C target (still higher than current temperatures), the possibility of increases in extreme temperatures under these scenarios is very real. In this study we seek to understand the nature of extreme temperatures over India in the 1.5°C and 2°C worlds in comparison to the current climate. We make use of model output contributed under the Half a degree Additional warming, Prognosis and Projected Impacts project (HAPPI; Mitchell et al., 2017). The HAPPI database contains output from many atmospheric GCMs with multiple simulations ( 100 each) of historical (2005-2015), 1.5°C warmer decade, and 2°C warmer decade. The large number of ensembles provides an opportunity to study the extremes in temperature that occur over India and how they may change. In order to provide insights into the future comparable against current operational practices, we make use of definitions of "hot days", "heat waves", and "severe heat waves" used by the India Meteorological Department (IMD). We compare modelled data (and bias corrected model output where available) against observed daily temperatures from the IMD gridded (1°x1°) dataset available for 1951-2015 as also circulation features that lead to such events by comparing against reanalysis products. We also investigate the timing of such events in the future scenarios
Directory of Open Access Journals (Sweden)
Saleh Ibrahim El-Awady
2009-04-01
Full Text Available BACKGROUND: Bacterial translocation occurs in preseptic conditions such as intestinal obstruction through unclear mechanism. The C-reactive protein is an acute phase reactant and a marker of ischemia. METHODS: 45 albino male rats were divided into 3 groups each 15 rats. GI control, GII simple intestinal-obstruction and GIII strangulated obstruction. Outcome measures were: (1 Bacteriologic count and typing for intestinal contents, intestinal wall, liver, mesenteric lymph nodes and blood (cardiac and portal (2 Histopathologic: mucosal injury score, inflammatory cell infiltrate in the wall, MLN, liver, (3 Biochemical: serum CRP, IL-10, mucosal stress pattern (glutathione peroxidase-malonyldialdhyde tissue levels. RESULTS: (1 Intestinal obstruction associates with BT precursors (Bact-overgrowth, mucosal-acidosis, immuno-incomptence, (2 Bacterial translocation (frequency and density was found higher in strangulated I.O, that was mainly enteric (aerobic and anaerobic and mostly E.coli, (3 The pathogen commonality supports the gut origin hypothesis but the systemic inflammatory response goes with the cytokine generating one. (4 The CRP median values for GI, II, III were 0.5, 6.9, 8.5 mg/L, for BT +ve 8 mg/L and 0.75 mg/L for BT -ve rats. CONCLUSION: Bacterial translocation occurs bi-directional (systemic-portal in intestinal obstruction and the resultant inflammatory response pathogenesis is mostly 3 hit model. The CRP is a non selective marker of suspected I.O cases. However, it is a reliable marker of BT, BT density and vascular compromise during I.O.OBJETIVO: Translocação bacteriana ocorre em condições pré-sépticas como na obstrução intestinal por mecanismo não esclarecido. A proteína C-reativa é um marcador de ischemia em fase aguda. A proposição é investigar os possíveis efeitos da obstrução intestinal no equilíbrio ecológico microbiano. MÉTODOS: 45 ratos machos albinos foram distribuídos em três grupos de 15 ratos. GI
Oxide-Based Composite Electrolytes Using Na3Zr2Si2PO12/Na3PS4 Interfacial Ion Transfer.
Noi, Kousuke; Nagata, Yuka; Hakari, Takashi; Suzuki, Kenji; Yubuchi, So; Ito, Yusuke; Sakuda, Atsushi; Hayashi, Akitoshi; Tatsumisago, Masahiro
2018-05-31
All-solid-state sodium batteries using Na 3 Zr 2 Si 2 PO 12 (NASICON) solid electrolytes are promising candidates for safe and low-cost advanced rechargeable battery systems. Although NASICON electrolytes have intrinsically high sodium-ion conductivities, their high sintering temperatures interfere with the immediate development of high-performance batteries. In this work, sintering-free NASICON-based composites with Na 3 PS 4 (NPS) glass ceramics were prepared to combine the high grain-bulk conductivity of NASICON and the interfacial formation ability of NPS. Before the composite preparation, the NASICON/NPS interfacial resistance was investigated by modeling the interface between the NASICON sintered ceramic and the NPS glass thin film. The interfacial ion-transfer resistance was very small above room temperature; the area-specific resistances at 25 and 100 °C were 15.8 and 0.40 Ω cm 2 , respectively. On the basis of this smooth ion transfer, NASICON-rich (70-90 wt %) NASICON-NPS composite powders were prepared by ball-milling fine powders of each component. The composite powders were well-densified by pressing at room temperature. Scanning electron microscopy observation showed highly dispersed sub-micrometer NASICON grains in a dense NPS matrix to form closed interfaces between the oxide and sulfide solid electrolytes. The composite green (unfired) compacts with 70 and 80 wt % NASICON exhibited high total conductivities at 100 °C of 1.1 × 10 -3 and 6.8 × 10 -4 S cm -1 , respectively. An all-solid-state Na 15 Sn 4 /TiS 2 cell was constructed using the 70 wt % NASICON composite electrolyte by the uniaxial pressing of the powder materials, and its discharge properties were evaluated at 100 °C. The cell showed the reversible capacities of about 120 mAh g -1 under the current density of 640 μA cm -2 . The prepared oxide-based composite electrolytes were thus successfully applied in all-solid-state sodium rechargeable batteries without sintering.
Zhao, Baidan; Lin, Bo; Zhang, Sen; Deng, Chao
2015-11-01
Hollow micro/nano-arrays have attracted tremendous attention in the field of energy conversion and storage, but such structures usually compromise the volumetric energy density of the electrode materials. Frogspawn consists of a spawn core and a transparent jelly shell organized in a hierarchical porous array, which exhibits superior mechanical strength and high-efficiency oxygen permeability. It can be used as a model for designing a new high-performance electrode material, which has advantages such as a high surface area, fast mass transport and superior durability. Herein, we report a frogspawn-like NaTi2(PO4)3/C array prepared by a facile preform impregnation strategy. The framework is formed by a hollow carbon sphere connected by the NaTi2(PO4)3/C skeleton, and its hollow is filled with the NaTi2(PO4)3 nanospheres. The whole hierarchical porous three-dimensional array copies the structure of a frogspawn. This unique structure not only enables easy electrolyte percolation and fast electron/ion transport, but also enhances the reversible capacity and cycling durability. When it is applied as an anode of the aqueous sodium ion battery, it exhibits favorable high rate capability and superior cycling stability, and retains 89% of the initial capacity after two thousand cycles at 20 C. Moreover, the full cell using the frogspawn-inspired NaTi2(PO4)3-C as the anode and Na0.44MnO2 as the cathode is capable of ultralong cycling up to one thousand cycles at alternate 10 and 60 C, which is among the best of state-of-the-art aqueous sodium ion systems. Therefore, the frogspawn-inspired architecture provides a new strategy to the tailored design of polyanion materials for high-power applications.Hollow micro/nano-arrays have attracted tremendous attention in the field of energy conversion and storage, but such structures usually compromise the volumetric energy density of the electrode materials. Frogspawn consists of a spawn core and a transparent jelly shell organized in
Directory of Open Access Journals (Sweden)
Carlos León Torres
2010-01-01
Full Text Available El trabajo tuvo como objetivo evaluar diferentes concentraciones de etanol rectificado en la producción del “bioaroma” acetato de etilo y proteína unicelular por Candida utilis var.major . Se construyó un biorreactor de 16 cm de altura tipo tanque agitado con turbina Rushton. La preparación del inóculo fue realizada a partir de la cepa Candida utilis var.major C.E.C.T. 1430. El medio de cultivo fue formulado a partir de diluciones de etanol rectificado desde 10 hasta 35 g /L en intervalos de cada 5 unidades. El bioproceso se llevó a cabo a 25 ºC, pH de 4.5 – 5.5 y durante 60 horas. Se encontró que la biomasa y la productividad aumentan progresivamente, de 4.82 a 7.90 g/L y de 0.082 a 0.108 g/L - h respectivamente. Así mismo se determinó que a medida que aumenta la concentración (g/L de etanol rectificado, la producción y la productividad disminuyen. El rendimiento de acetato de etilo, fue máximo a la concentración de 15 g/L de etanol rectificado (5.7% y mínimo a 35 g/L y ( 1.97% respectivamente. Se concluye que el incremento de la concentración de etanol rectificado no influye aumentando la producción y rendimiento del “bioaroma” acetato de etilo y de la proteína unicelular de Candida utilis var. major .
International Nuclear Information System (INIS)
Djamali, Essmaiil; Cobble, James W.
2009-01-01
Standard state thermodynamic properties for fully ionized aqueous perrhenic acid at temperature in the range of (298.15 to 598.15) K and at p sat were determined by high dilution solution calorimetry (10 -4 m). A comparison of the standard state thermodynamic properties for fully ionized aqueous perrhenic acid, HReO 4 (aq), and sodium perrhenate, NaReO 4 (aq), establishes for the first time the quantitative values for the differences between H + (aq) and Na + (aq) from temperature of (298.15 to 598.15) K. Perrhenic acid is believed to be the first strong acid to be thermodynamically well characterized under standard state conditions to date from measurements down to 10 -4 m. The value of the Debye-Hueckel limiting slope for enthalpies of dilution at temperature of 596.30 K of 122 ± 6 kJ . mol -3/2 . kg 1/2 , obtained from the integral heats of solution measurement at various concentrations, is in good agreement with theoretical value in literature, 121 kJ . mol -3/2 . kg 1/2 . This agreement verifies that HReO 4 (aq) obeys the simple limiting law for strong electrolytes. Many thermodynamic properties of soluble sodium electrolytes can now be converted to the corresponding acid form.
International Nuclear Information System (INIS)
Meyer, G.J.; Schober, O.; Hundeshagen, H.
1983-01-01
A method was developed for the continuous infusion of 15 O-labeled water which allows the tomographic reconstruction of the total lung water (TLW). Subsequent inhalation of 11 C-labeled carbon-monoxide permits the reconstruction of the blood volume (BV). After normalization of intravascular activities the difference of TLW minus BV yields a quantitative value of regional extravascular lung water (rELW). 15 O-O 2 is converted on-line to 15 O-H 2 O and trapped in a 2 ml buffer reservoir which is fed by a pump with 0.9% NaCl. A precision pump is used to withdraw the labeled H 2 O and infuse it at a rate of 6 ml/min. The radioactivity level of the indusate (ca. 3.7 MBq/sec) is controlled and can be kept constant with a deviation of less than 5% over 40 min. The sterility and apyrogenicity of the system effluent is assured by frequent bacteriological, rabbit and limulus tests. A constant radioactivity level in the lung area is reached after 8-10 min. The infusion is continued for the tomographic reconstruction (Positron Camera System 4200, Cyclotron Corp.) which takes 15 min. A fast change of cyclotron parameters (MC-36, Scanditronix) and automated chemistry procedures allow a single breath administration of 11 C-CO (ca. 40 MBq) 15 min after the end of the 15 O-H 2 O infusion. Blood pool equilibrium is reached after 3-4 min, and the blood volume is reconstructed within 15 min also. Intravascular activites as determined from reconstructed slices in the region of the aortic arch correlate linearly with blood sample activities up to 100 kBq/ml. (orig.) [de
Directory of Open Access Journals (Sweden)
Gonzálo Correa Arango
2004-03-01
Full Text Available
El modelo de infección por el Virus de la Hepatitis C (VHC se ha convertido en el tópico de interés de numerosos equipos de investigación, considerando el alto porcentaje de infección persistente asociada al VHC. En efecto, del 50 al 80% de los pacientes con infección por el VHC, desarrollan infección persistente, que puede evolucionar a cirrosis y carcinoma hepatocelular (HCC. Este modelo presenta dos obstáculos mayores para su estudio: la ausencia de un sistema eficiente de replicación viral in vitro y el limitado número de modelos animales.
La proteína Core del VHC, además de ser la unidad estructural de la cápside viral, parece estar implicada en las estrategias virales de persistencia y oncogénesis; nuestro grupo ha planteado estrategias experimentales para estudiar algunas de sus propiedades, tales como su capacidad inmunonoduladora en cultivos de cálulas dendríticas humanas, su capacidad de modificar la expresión del ARNm en células HepG2 con expresión transitoria de Core y la presencia de esta proteína en tejido hepático proveniente de pacientes con diagnóstico de HCC; dichas estrategias experimentales han sido:
• Producción de la proteína Core del VHC en el sistema baculovirus y purificación en condiciones nativas para su evaluación en ensayos biológicos.
• Expresión transitoria de la proteína Core del VHC en la línea celular HepG2, mediante transducción con partículas recombinantes del Virus Semliki Forest (SFV.
• Estudio de la expresión de p53
Medical Surveillance Monthly Report (MSMR). Volume 15, Number 7, September 2008
2008-09-01
86.0 Leprosy 0 na na 3 2 66.7 1 0 0.0 4 3 75.0 Leptospirosis 2 2 100.0 19 14 73.7 2 2 100.0 28 8 28.6 Lyme disease 3 1 33.3 26 4 15.4 15 4 26.7 102 20...1 100.0 2 1 50.0 11 9 81.8 Leprosy 0 na na 0 na na 0 na na 1 0 0.0 Leptospirosis 1 0 0.0 12 4 33.3 3 1 33.3 28 3 10.7 Listeriosis 0 na na 1 0 0.0 0 na...33.3 0 na na 3 0 0.0 Leprosy 0 na na 0 na na 0 na na 1 1 100.0 Leptospirosis 0 na na 0 na na 0 na na 1 0 0.0 Lyme disease 0 na na 10 1 10.0 3 2 66.7
International Nuclear Information System (INIS)
Straus, Suzana K.; Bremi, Tobias; Ernst, Richard R.
1998-01-01
High-resolution heteronuclear NMR correlation experiments and strategies are proposed for the assignment of fully 13 C/ 15 N-labelled polypeptides in the solid state. By the combination of intra-residue and inter-residue 13 C- 15 N correlation experiments with 13 C- 13 C spin-diffusion studies, it becomes feasible to partially assign backbone and side-chain resonances in solid proteins. The performance of sequences using 15 N instead of 13 C detection is evaluated regarding sensitivity and resolution for a labelled dipeptide (L-Val-L-Phe). The techniques are used for a partial assignment of the 15 N and 13 C resonances in human ubiquitin
Energy Technology Data Exchange (ETDEWEB)
Petrov, Vladimir G. [Lomonosov Moscow State Univ. (Russian Federation). Dept. of Chemistry; Fellhauer, David; Gaona, Xavier; Dardenne, Kathy; Rothe, Joerg; Altmaier, Marcus [Karlsruhe Institute of Technology (Germany). Inst. for Nuclear Waste Disposal; Kalmykov, Stepan N. [Lomonosov Moscow State Univ. (Russian Federation). Dept. of Chemistry; NRC Kurchatov Institute, Moscow (Russian Federation)
2017-03-01
The solubility of Np(V) was investigated at T=22±2 C in alkaline NaCl solutions of different ionic strength (0.1-5.0 M). The solid phases controlling the solubility at different -log{sub 10} m{sub H{sup +}}(pH{sub m}) and NaCl concentration were characterized by XRD, quantitative chemical analysis, SEM-EDS and XAFS (both XANES and EXAFS). Aqueous phases in equilibrium with Np(V) solids were investigated for selected samples within 8.9≤pH{sub m}≤10.3 by UV-vis/NIR absorption spectroscopy. In 0.1 M NaCl, the experimental solubility of the initial greenish NpO{sub 2}OH(am) solid phase is in good agreement with previous results obtained in NaClO{sub 4} solutions, and is consistent with model calculations for fresh NpO{sub 2}OH(am) using the thermodynamic data selection in NEA-TDB. Below pH{sub m}∝11.5 and for all NaCl concentrations studied, Np concentration in equilibrium with the solid phase remained constant during the timeframe of this study (∝2 years). This observation is in contrast to the aging of the initial NpO{sub 2}OH(am) into a more crystalline modification with the same stoichiometry, NpO{sub 2}OH(am, aged), as reported in previous studies for concentrated NaClO{sub 4} and NaCl. Instead, the greenish NpO{sub 2}OH(am) transforms into a white solid phase in those systems with [NaCl]≥1.0 M and pH{sub m}≥11.5, and into two different pinkish phases above pH{sub m}∝13.2. The solid phase transformation is accompanied by a drop in Np solubility of 0.5-2 log{sub 10}-units (depending upon NaCl concentration). XANES analyses of green, white and pink phases confirm the predominance of Np(V) in all cases. Quantitative chemical analysis shows the incorporation of Na{sup +} in the original NpO{sub 2}OH(am) material, with Na:Np ≤ 0.3 for the greenish solids and 0.8 ≤ Na:Np ≤ 1.6 for the white and pinkish phases. XRD data confirms the amorphous character of the greenish phase, whereas white and pink solids show well-defined but discrepant XRD patterns
Synthesis, Crystal Structure, and Topology-Symmetry Analysis of a New Modification of NaIn[IO3]4
Belokoneva, E. L.; Karamysheva, A. S.; Dimitrova, O. V.; Volkov, A. S.
2018-01-01
Crystals of new iodate NaIn[IO3]4 were prepared by the hydrothermal synthesis. The unit cell parameters are a = 7.2672(2) Å, b = 15.2572(6) Å, c = 15.0208(6) Å, β = 101.517(3)°, sp. gr. P21/ c. The formula was determined during the structure determination and refinement of a twinned crystal based on a set of reflections from the atomic planes of the major individual. The refinement with anisotropic displacement parameters was performed for both twin components to the final R factor of 0.050. The In and Na atoms are in octahedral coordination formed by oxygen atoms. The oxygen octahedra are arranged into columns by sharing edges, and the columns are connected by isolated umbrella-like [IO3]- groups to form layers. The new structure is most similar to the isoformular iodate NaIn[IO3]4, which crystallizes in the same sp. gr. P21/ c and is structurally similar, but has a twice smaller unit cell and is characterized by another direction of the monoclinic axis. The structural similarity and difference between the two phases were studied by topologysymmetry analysis. The formation of these phases is related to different combinations of identical one-dimensional infinite chains of octahedra.
Implications of geoengineering under the 1.5 °C target: Analysis and policy suggestions
Directory of Open Access Journals (Sweden)
Ying Chen
2017-06-01
Full Text Available The Paris Agreement introduced a 1.5 °C target to control the rise in global temperature, but clear arrangements for feasible implementation pathways were not made. Achieving the 1.5 °C target imposes high requirements on global emission reduction. Nationally Determined Contributions of all Parties are far from the 1.5 °C target, and conventional emission reduction technologies and policies will also have difficulty in fulfilling this task. In this context, geoengineering is gaining interest in the international arena. The Paris Agreement includes afforestation, carbon capture, utilization and storage, and negative emission technologies such as bio-energy with carbon capture and store. All of these techniques are CO2 removal technologies that belong to geoengineering. Solar radiation management, which is highly controversial, has also attracted increased attention in recent years. Although the outline of the IPCC Special Report on 1.5 °C does not include a specific section on geoengineering issues yet, geoengineering is an unconventional technical option that cannot be avoided in research and discussions on impact assessment, technical options, ethics, and international governance under the 1.5 °C target. On the basis of analyzing and discussing abovementioned issues, this paper proposes several policy suggestions for China to strengthen research on and response to geoengineering.
Directory of Open Access Journals (Sweden)
Roni Fernandes Guareschi
2014-08-01
Full Text Available A conversão do cerrado nativo em sistemas agropecuários pode alterar com o passar dos anos de cultivo os teores de C e N, bem como o sinal isotópico do δ13C e δ15N do solo. Desta forma, o objetivo deste trabalho foi avaliar os teores de C, N e abundância natural de δ13C e δ15N no perfil do solo em uma cronossequência de agricultura sob sistema plantio direto (SPD no cerrado goiano. Para isso, em Montividiu, GO, foram selecionadas áreas sob SPD com diferentes tempos de implantação: SPD com três anos de implantação (SPD3, SPD com 15 anos de implantação (SPD15 e SPD com 20 anos de implantação (SPD20, as quais foram comparadas com áreas de cerrado nativo (CE e pastagem (PA. Foram coletadas amostras de solo nas profundidades de 0,00-0,05; 0,05-0,10; 0,10-0,20; 0,20-0,30; 0,30-0,40; 0,40-0,50; 0,50-0,60; 0,60-0,80; e 0,80-1,00 m. O solo das áreas de estudo foi classificado como Latossolo Vermelho distroférrico. O manejo do solo sob SPD após 20 anos aumentou os teores de C e N na camada superficial do solo (0,00-0,05 m, em relação às outras áreas avaliadas. Nas demais profundidades avaliadas, observou-se que está ocorrendo aumento nos teores C e N com o passar dos anos de adoção do SPD (três para 15 anos; no entanto, tais áreas ainda não foram capazes de recuperar os teores desses elementos em relação à vegetação nativa de CE. Por meio dos resultados de δ13C, pôde-se constatar que a origem da MOS nas áreas de SPD é referente à plantas do ciclo fotossintético C4. Verificou-se que até os 0,30 m do perfil do solo os resultados de δ13C estão reduzindo com o passar dos anos de adoção do SPD. Os menores e maiores valores de δ15N foram encontrados nas áreas de CE e PA, SPD3, enquanto SPD15 e SPD20 apresentaram valores intermediários de δ15N, em relação às demais áreas avaliadas.
Electric conductivity of solid solutions of the Na3-2xMxPO4 (M=Cd, Pb) systems
International Nuclear Information System (INIS)
Shekhtman, G.Sh.; Burmakin, E.I.; Smirnov, N.B.; Esina, N.O.
2002-01-01
Electric conductivity, phase composition and conductivity character in the system Na 3-2x Cd x PO 4 in the temperature range of 300-750 deg C were studied by the methods of conductometry, X-ray phase and thermal analyses. It was ascertained that maximum values of electric conductivity (6.25x10 -3 S/cm at 300 deg C) are observed near upper concentration boundaries (x ≅ 0.4) of monophase regions in γ-solid solutions. Conductivity of the solid electrolytes studied is of cocationic character. The values of activation energies of Na + and Cd 2+ cation jumping over in solid electrolytes Na 2.7 Cd 0.15 PO 4 are 38.7 and 43.6 kJ/mol respectively according to the NMR data [ru
Directory of Open Access Journals (Sweden)
Bożena BABIARZ
Full Text Available Celem niniejszej pracy jest przeprowadzenie analizy instalacji słonecznych pod kątem eksploatacyjnym. Zasadniczą część opracowania stanowi analiza istniejącej od 2005 r. instalacji słonecznej pracującej dla potrzeb przygotowania ciepłej wody użytkowej dla mieszkańców budynku wielorodzinnego. W pracy wykorzystano rzeczywiste dane eksploatacyjne z dziesięciu lat działania instalacji, udostępnione przez Spółdzielnię Mieszkaniową „ZODIAK” w Rzeszowie. Przeanalizowano koszty przygotowania ciepłej wody użytkowej oraz koszty serwisowe instalacji. Na koszty eksploatacyjne instalacji słonecznych składają się m.in.: koszty zużycia i przygotowania c.w.u., koszty zużycia energii elektrycznej przez pompy obiegowe instalacji słonecznych, oraz koszty serwisowania instalacji. Na podstawie niniejszej analizy można wysnuć szereg wniosków możliwych do wykorzystania w analizach techniczno-finansowych na etapie projektowania inwestycji w odnawialne źródła energii. Przeprowadzona analiza wykazała, iż instalacja słoneczna w znacznym stopniu obniża koszty przygotowania ciepłej wody użytkowej. Koszt przygotowania 1 m3 ciepłej wody użytkowej w analizowanym budynku wielorodzinnym w 2015 r. przy udziale instalacji słonecznej stanowił 67% kosztów podgrzewu ciepłej wody w budynku o podobnej kubaturze wykorzystującym ciepło z miejskiej sieci ciepłowniczej. Pompy obiegowe zastosowane w instalacjach słonecznych charakteryzują się stosunkowo małym zużyciem energii elektrycznej. Koszty serwisowe instalacji są niewielkie i zależą od wielkości instalacji, jej lokalizacji oraz budowy.
Heat wave exposure in India in current, 1.5 °C, and 2.0 °C worlds
Mishra, Vimal; Mukherjee, Sourav; Kumar, Rohini; Stone, Dáithí A.
2017-12-01
Heatwaves with large impacts have increased in the recent past and will continue to increase under future warming. However, the implication for population exposure to severe heatwaves remains unexplored. Here, we characterize maximum potential human exposure (without passive/active reduction measures) to severe heatwaves in India. We show that if the global mean temperature is limited to 2.0 °C above pre-industrial conditions, the frequency of severe heatwaves will rise by 30 times the current climate by the end-21st century. In contrast, the frequency is projected to be about 2.5 times more (than the low-warming scenario of 2 °C) under conditions expected if the RCP8.5 ‘business-as-usual’ emissions scenario is followed. Under the 2.0 °C low-warming target, population exposure to severe heatwaves is projected to increase by about 15 and 92 times the current level by the mid and end-21st century respectively. Strategies to reduce population growth in India during the 21st century may provide only limited mitigation of heatwave exposure mostly late in the century. Limiting global temperatures to 1.5 °C above preindustrial would reduce the exposure by half relative to RCP8.5 by the mid-21st century. If global temperatures are to exceed 1.5 °C then substantial measures will be required to offset the large increase in exposure to severe heatwaves in India.
Yahya, Zarina; Abdullah, Mohd Mustafa Al Bakri; Hussin, Kamarudin; Ismail, Khairul Nizar; Abd Razak, Rafiza; Sandu, Andrei Victor
2015-01-01
This paper investigates the effect of the solids-to-liquids (S/L) and Na2SiO3/NaOH ratios on the production of palm oil boiler ash (POBA) based geopolymer. Sodium silicate and sodium hydroxide (NaOH) solution were used as alkaline activator with a NaOH concentration of 14 M. The geopolymer samples were prepared with different S/L ratios (0.5, 1.0, 1.25, 1.5, and 1.75) and Na2SiO3/NaOH ratios (0.5, 1.0, 1.5, 2.0, 2.5, and 3.0). The main evaluation techniques in this study were compressive strength, X-Ray Diffraction (XRD), Fourier Transform Infrared Spectroscopy (FTIR), and Scanning Electron Microscope (SEM). The results showed that the maximum compressive strength (11.9 MPa) was obtained at a S/L ratio and Na2SiO3/NaOH ratio of 1.5 and 2.5 at seven days of testing.
International Nuclear Information System (INIS)
Raaphorst, G.P.; Dewey, W.C.
1979-01-01
The effect of 0.05 M and 1.5 M NaCl treatments on CHO cells during and after irradiation has been examined. Treatment with either hypotonic or hypertonic salt solutions during and after irradiation resulted in the fixation of radiation damage which would otherwise not be expressed. The half time for fixation was 4 to 5 min, and the increased expression of the potentially lethal damage by anisotonic solutions was mainly characterized by large decreases in the shoulder of the survival curve, as well as by decreases in Dsub(o). Fixation of radiation damage at 37 0 C occurred to a much greater extent for the hypertonic treatment than for the hypotonic treatment and was greater at 37 0 C than at 20 0 C. Although both the hypotonic and hypertonic treatments during and after irradiation reduced or eliminated the repair of sublethal and potentially lethal damage, treatment during irradiation only, radiosensitized the cells when the treatment was hypotonic, and radioprotected the cells when the treatment was hypertonic. These observations are discussed in relation to salt treatments and different temperatures altering competition between repair and fixation of potentially lethal lesions, the number of which depends on the particular salt treatment at the time of irradiation. (author)
Andre Gustavo de Oliveira
2012-01-01
A litíase epididimária é uma anomalia caracterizada pela presença de cálculos ricos em cálcio na região epididimária de galos. Esta disfunção causa redução na fertilidade, tendo impacto negativo na avicultura. A causa da litíase não é conhecida, mas sabe-se que a formação de cálculos acomete principalmente os dúctulos eferentes, responsáveis pela reabsorção do fluido testicular e de cálcio. O transporte transepitelial de cálcio ocorre em etapas distintas que envolvem a entrada de cálcio na cé...
Plant Defensins NaD1 and NaD2 Induce Different Stress Response Pathways in Fungi
Directory of Open Access Journals (Sweden)
Peter M. Dracatos
2016-09-01
Full Text Available Nicotiana alata defensins 1 and 2 (NaD1 and NaD2 are plant defensins from the ornamental tobacco that have antifungal activity against a variety of fungal pathogens. Some plant defensins interact with fungal cell wall O-glycosylated proteins. Therefore, we investigated if this was the case for NaD1 and NaD2, by assessing the sensitivity of the three Aspergillus nidulans (An O-mannosyltransferase (pmt knockout (KO mutants (An∆pmtA, An∆pmtB, and An∆pmtC. An∆pmtA was resistant to both defensins, while An∆pmtC was resistant to NaD2 only, suggesting NaD1 and NaD2 are unlikely to have a general interaction with O-linked side chains. Further evidence of this difference in the antifungal mechanism was provided by the dissimilarity of the NaD1 and NaD2 sensitivities of the Fusarium oxysporum f. sp. lycopersici (Fol signalling knockout mutants from the cell wall integrity (CWI and high osmolarity glycerol (HOG mitogen-activated protein kinase (MAPK pathways. HOG pathway mutants were sensitive to both NaD1 and NaD2, while CWI pathway mutants only displayed sensitivity to NaD2.
1.5 °C carbon budget dependent on carbon cycle uncertainty and future non-CO2 forcing.
Mengis, Nadine; Partanen, Antti-Ilari; Jalbert, Jonathan; Matthews, H Damon
2018-04-11
Estimates of the 1.5 °C carbon budget vary widely among recent studies, emphasizing the need to better understand and quantify key sources of uncertainty. Here we quantify the impact of carbon cycle uncertainty and non-CO 2 forcing on the 1.5 °C carbon budget in the context of a prescribed 1.5 °C temperature stabilization scenario. We use Bayes theorem to weight members of a perturbed parameter ensemble with varying land and ocean carbon uptake, to derive an estimate for the fossil fuel (FF) carbon budget of 469 PgC since 1850, with a 95% likelihood range of (411,528) PgC. CO 2 emissions from land-use change (LUC) add about 230 PgC. Our best estimate of the total (FF + LUC) carbon budget for 1.5 °C is therefore 699 PgC, which corresponds to about 11 years of current emissions. Non-CO 2 greenhouse gas and aerosol emissions represent equivalent cumulative CO 2 emissions of about 510 PgC and -180 PgC for 1.5 °C, respectively. The increased LUC, high non-CO 2 emissions and decreased aerosols in our scenario, cause the long-term FF carbon budget to decrease following temperature stabilization. In this scenario, negative emissions would be required to compensate not only for the increasing non-CO 2 climate forcing, but also for the declining natural carbon sinks.
17 CFR 240.15c2-7 - Identification of quotations.
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Identification of quotations... quotations. (a) It shall constitute an attempt to induce the purchase or sale of a security by making a “fictitious quotation” within the meaning of section 15(c)(2) of the Act, for any broker or dealer to furnish...
International Nuclear Information System (INIS)
Vasile, M.; Bleyen, N.; Valcke, E.; Bruggeman, C.; Marien, A.
2012-01-01
solutions and of nitrous oxide in the gas space above the solutions. Microbiological analyses (MPN tests) were performed as well and the oxidation degree of DOM was determined by measuring its redox capacity before and after exposure to nitrate or nitrite. Samplings were performed at different time intervals over a period of 1.5 years. The redox capacity of DOM in RBCW was determined, to assess the degree of oxidation of DOM, using two different oxidants: potassium ferricyanide and ferric citrate. Nitrate or nitrite reducing prokaryotes were found in the biotic tests, both in the tests with nitrate and nitrite, which indicates that a microbially mediated reduction of nitrate and nitrite took place, leading to some microbial oxidation of the dissolved organic matter under the biotic conditions. In case of nitrate containing samples, formation of nitrite was mainly observed, while in case of nitrite containing samples, N 2 O gas was detected. However, N 2 O formation was found in both, biotic and abiotic tests with nitrite, probably in the abiotic tests resulting from the reaction of nitrite with azide. Based on the amount of reduction products formed in the biotic tests (nitrite and N 2 O), a decrease in the redox capacity of ∼1.5 meq/g C should be observed. Using ferricyanide we obtained a redox capacity of (5.5 ± 1.3) meq/g C for all samples, with or without 0.1 M NaNO 3 or 0.05 NaNO 2 . Thus, for this oxidant the small difference of ∼1.5 meq/g C is covered by the experimental uncertainty on the redox capacity measurement. On the other hand, using ferric citrate, a redox capacity of (1.5 ± 0.3) meq/g C and (0.4 ± 0.1) meq/g C was measured for samples without and with 0.1 M NaNO 3 , respectively. Hence, a decrease of (1.1 ± 0.3) meq/g C was observed after exposure to nitrate. This indicates that using ferric citrate as oxidant allows to detect the expected decrease in redox capacity of Boom Clay DOM induced by the exposure to nitrate for 1.5 years. In case of
Effect of ciguatoxin 3C on voltage-gated Na+ and K+ currents in mouse taste cells.
Ghiaroni, Valeria; Fuwa, Haruhiko; Inoue, Masayuki; Sasaki, Makoto; Miyazaki, Keisuke; Hirama, Masahiro; Yasumoto, Takeshi; Rossini, Gian Paolo; Scalera, Giuseppe; Bigiani, Albertino
2006-09-01
The marine dinoflagellate Gambierdiscus toxicus produces highly lipophilic, polycyclic ether toxins that cause a seafood poisoning called ciguatera. Ciguatoxins (CTXs) and gambierol represent the two major causative agents of ciguatera intoxication, which include taste alterations (dysgeusiae). However, information on the mode of action of ciguatera toxins in taste cells is scarce. Here, we have studied the effect of synthetic CTX3C (a CTX congener) on mouse taste cells. By using the patch-clamp technique to monitor membrane ion currents, we found that CTX3C markedly affected the operation of voltage-gated Na(+) channels but was ineffective on voltage-gated K(+) channels. This result was the exact opposite of what we obtained earlier with gambierol, which inhibits K(+) channels but not Na(+) channels. Thus, CTXs and gambierol affect with high potency the operation of separate classes of voltage-gated ion channels in taste cells. Our data suggest that taste disturbances reported in ciguatera poisoning might be due to the ability of ciguatera toxins to interfere with ion channels in taste buds.
The relation between aging, aortic NaF avidity and coronary artery NaF avidity: A NaF PET CT study
DEFF Research Database (Denmark)
Blomberg, Björn; Thomassen, Anders; Hildebrandt, Malene
2013-01-01
volunteers without traditional cardiovascular risk factors were prospectively assessed by Sodium 18-Fluoride (Na-18F) PET CT imaging. Global aortic uptake of Na-18F was determined by calculating the average aortic blood pool subtracted maximum standardized uptake value (cSUV) [maximum SUVaorta - mean...
DEFF Research Database (Denmark)
Rasmussen, Jim; Kusliene, Gedrime; Jacobsen, Ole Stig
2013-01-01
that 15N also had a heterogeneous distribution (up to two orders of magnitude). Conclusion Bicarbonate can efficiently be used to introduce 14C or 13C into plant via the leaf-labeling method. Both 14C and 15N showed heterogeneous distribution in the plant, although the distribution of 15N was more even......Aims: Application of carbon (C) and nitrogen (N) isotopes is an essential tool to study C and N flows in plant-soil-microorganisms systems. When targeting single plants in a community the tracers need to be added via e.g., leaf-labeling or stem-feeding approaches. In this study we: (i) investigated...... if bicarbonate can be used to introduce 14C (or 13C) into white clover and ryegrass, and (ii) compared the patterns of 14C and 15N allocation in white clover and ryegrass to evaluate the homogeneity of tracer distribution after two alternative labeling approaches. Methods Perennial ryegrass and white clover were...
Correlation of the Na2SiO3 to NaOH Ratios and Solid to Liquid Ratios to the Kedah’s Soil Strength
Directory of Open Access Journals (Sweden)
Nur Hamzah Hazamaah
2016-01-01
Full Text Available Geopolymer was used for the soil stabilization of Kedah’s soil at different ratios of solid to liquid and Na2SiO3 to NaOH in order to achieve the desired compressive strength. The geopolymerization process which produces an aluminosilicate gel was occurred due to the mixing of Kedah’s soil and fly ash with Na2SiO3 and NaOH. Soil stabilization by geopolymer was synthesized by the activation of fly ash and Kedah’s soil with Na2SiO3 and NaOH at different ratios of solid to liquid (1.5, 2.0, 2.5 and 3.0 and Na2SiO3 to NaOH (0.5, 1.0, 1.5, 2.0, 2.5 and 3.0 at a specific constant concentration of NaOH solution of 6M. The compressive strength up to 5.12 MPa was obtained at 3.0 of solid to liquid ratio and 2.5 of Na2SiO3 to NaOH ratio in 7 days curing at room temperature.
Albayati, Talib M.; Doyle, Aidan M.
2015-02-01
Alkali metals and their hydroxides, Na, NaOH, Li, and LiOH, were encapsulated onto SBA-15 nanoporous material as highly active catalysts for the production of biodiesel fuel from sunflower oil. The incipient wetness impregnation method was adopted for the prepared catalysts. The characterization properties of the catalysts and unmodified SBA-15 were determined using X-ray diffraction, scanning electron microscopy, EDAX, nitrogen adsorption-desorption porosimetry (Brunauer-Emmett-Teller), Fourier-transform infrared spectroscopy, and transmission electron microscopy. Transesterification was conducted in a batch reactor at atmospheric pressure and 65 °C. The catalysts were highly active with yields of fatty acid methyl ester (FAME) in the range 96-99 %. Na/SBA-15 catalyst was reused for seven consecutive cycles under the same reaction conditions; the yield to FAME on the final cycle was 96 %. This study shows that the alkali metals and their hydroxides supported on SBA-15-based catalyst are excellent catalysts for the biodiesel reaction.
Energy Technology Data Exchange (ETDEWEB)
Albayati, Talib M., E-mail: talib-albyati@yahoo.com [University of Technology, Department of Chemical Engineering (Iraq); Doyle, Aidan M., E-mail: a.m.doyle@mmu.ac.uk [Manchester Metropolitan University, Division of Chemistry and Environmental Science (United Kingdom)
2015-02-15
Alkali metals and their hydroxides, Na, NaOH, Li, and LiOH, were encapsulated onto SBA-15 nanoporous material as highly active catalysts for the production of biodiesel fuel from sunflower oil. The incipient wetness impregnation method was adopted for the prepared catalysts. The characterization properties of the catalysts and unmodified SBA-15 were determined using X-ray diffraction, scanning electron microscopy, EDAX, nitrogen adsorption–desorption porosimetry (Brunauer–Emmett–Teller), Fourier-transform infrared spectroscopy, and transmission electron microscopy. Transesterification was conducted in a batch reactor at atmospheric pressure and 65 °C. The catalysts were highly active with yields of fatty acid methyl ester (FAME) in the range 96–99 %. Na/SBA-15 catalyst was reused for seven consecutive cycles under the same reaction conditions; the yield to FAME on the final cycle was 96 %. This study shows that the alkali metals and their hydroxides supported on SBA-15-based catalyst are excellent catalysts for the biodiesel reaction.
International Nuclear Information System (INIS)
Albayati, Talib M.; Doyle, Aidan M.
2015-01-01
Alkali metals and their hydroxides, Na, NaOH, Li, and LiOH, were encapsulated onto SBA-15 nanoporous material as highly active catalysts for the production of biodiesel fuel from sunflower oil. The incipient wetness impregnation method was adopted for the prepared catalysts. The characterization properties of the catalysts and unmodified SBA-15 were determined using X-ray diffraction, scanning electron microscopy, EDAX, nitrogen adsorption–desorption porosimetry (Brunauer–Emmett–Teller), Fourier-transform infrared spectroscopy, and transmission electron microscopy. Transesterification was conducted in a batch reactor at atmospheric pressure and 65 °C. The catalysts were highly active with yields of fatty acid methyl ester (FAME) in the range 96–99 %. Na/SBA-15 catalyst was reused for seven consecutive cycles under the same reaction conditions; the yield to FAME on the final cycle was 96 %. This study shows that the alkali metals and their hydroxides supported on SBA-15-based catalyst are excellent catalysts for the biodiesel reaction
Directory of Open Access Journals (Sweden)
Martin Beran
2011-07-01
Full Text Available The ternary chloride Na3MoCl6 is obtained as red crystals from a disproportionation reaction of molybdenum dichloride, {Mo6}Cl12, in an acidic NaCl/AlCl3 melt at 350 °C. The crystal structure (trigonal, P-31c, a = 687.1(1, c = 1225.3(2 pm, Z = 2, V = 501,0(1 106 pm3 is that of Na3CrCl6: within a hexagonal closest-packing of chloride ions two thirds of the octahedral voids are filled between the AB double layers with Na+/Mo3+, and between the BA layers with Na+.
Interaction of low-expansion NZP ceramics with Na{sub 2}SO{sub 4} at 1000{degrees}C
Energy Technology Data Exchange (ETDEWEB)
Lee, W.Y.; Cooley, K.M.; Stinton, D.P.; Joslin, D.L. [Oak Ridge National Lab., TN (United States)
1996-08-01
The interaction between several low-expansion NZP materials and Na{sub 2}SO{sub 4} at 1000{degrees}C in pure O{sub 2} was studied. Ba{sub 1.25}Zr{sub 4}P{sub 5.5}Si{sub 0.5}O{sub 24} experienced extensive cracking and delamination upon reaction with Na{sub 2}SO{sub 4}. On the other hand, Ca{sub 0.5}Sr{sub 0.5}Zr{sub 4}P{sub 6}O{sub 24} remained intact in terms of visual appearance, and had no significant weight loss or gain. However, the ion exchange between Na{sup +} ions and Ca{sup +2} ions was observed to be sufficiently rapid to allow the penetration of the Na{sup +} ions into the test specimens in 100h. The segregation of Ca to the specimen surface was observed due to the ion exchange. Ca{sub 0.6}Mg{sub 0.4}Zr{sub 4}P{sub 6}O{sub 24} was also tested, but its stability could not properly be assessed because the as-received specimens contained a significant amount of MgZr{sub 4}P{sub 6}O{sub 24} as an impurity phase.
On the nitrogen isotope dilution analysis by means of the automated NA-5A type 15N-analyzer
International Nuclear Information System (INIS)
Faust, H.; Mueller, G.; Stoerl, H.J.
1976-01-01
The analytical conditions are investigated under which quantitative nitrogen determination through isotope dilution analysis is possible using the NA-5A type 15 N-analyzer. Calculation of the nitrogen quantity, estimation of the maximum error and the evaluation technique are considered in detail. Test analyses performed on ammonia, urea, and amino acid nitrogen model solutions labelled in different ways yielded good correspondence with preset values. This technique was applied to determine the nitrogen content of biomedical materials. A working scheme for direct quantitative determination of ammonia-N, urea-N, and total-N in urine is presented. (author)
Evaluation of moderately cooled pure NaI as a scintillator for position-sensitive PET detectors
International Nuclear Information System (INIS)
Wear, J.A.; Karp, J.S.; Haigh, A.T.; Freifelder, R.
1996-01-01
A new evaluation of pure NaI has been performed to determine if moderate cooling would lead to better performance than that of existing, activated NaI(Tl) position-sensitive detectors, particularly at high countrates. Using a freezer, an initial effort was performed to cool the crystal assembly to -90 C (183 K). At this temperature, pure NaI has a decay constant of 35 nsec, a light output which is about 20% that of room temperature NaI(Tl), and an energy resolution of 15%. For the PET applications the signal of room temperature (25 C) NaI(Tl) is normally pulse clipped, reducing the light output to 40% of the unclipped signal and yielding an energy resolution of 10.5%. Since the long decay of NaI(Tl) causes it to suffer more significantly than pure NaI from pre-pulse pileup, the difference in energy resolution between the two crystals at high countrates will be reduced. Also, a significantly shorter trigger deadtime with pure NaI will lead to a reduction in coincidence deadtime losses in PET. Computer simulations of large-area crystals operating at high countrates have been performed to quantify their trigger deadtime behavior and position resolution as a function of light output and pulse decay time. Having gained experience with the practical issues of cooling large crystals, measurements of position resolution have been performed with a NaI bar detector of similar geometry to the NaI(Tl) detectors in use in the PENN-PET scanner
Lu, Fang-Min; Hilgemann, Donald W
2017-07-03
Decades ago, it was proposed that Na transport in cardiac myocytes is modulated by large changes in cytoplasmic Na concentration within restricted subsarcolemmal spaces. Here, we probe this hypothesis for Na/K pumps by generating constitutive transsarcolemmal Na flux with the Na channel opener veratridine in whole-cell patch-clamp recordings. Using 25 mM Na in the patch pipette, pump currents decay strongly during continuous activation by extracellular K (τ, ∼2 s). In contradiction to depletion hypotheses, the decay becomes stronger when pump currents are decreased by hyperpolarization. Na channel currents are nearly unchanged by pump activity in these conditions, and conversely, continuous Na currents up to 0.5 nA in magnitude have negligible effects on pump currents. These outcomes are even more pronounced using 50 mM Li as a cytoplasmic Na congener. Thus, the Na/K pump current decay reflects mostly an inactivation mechanism that immobilizes Na/K pump charge movements, not cytoplasmic Na depletion. When channel currents are increased beyond 1 nA, models with unrestricted subsarcolemmal diffusion accurately predict current decay (τ ∼15 s) and reversal potential shifts observed for Na, Li, and K currents through Na channels opened by veratridine, as well as for Na, K, Cs, Li, and Cl currents recorded in nystatin-permeabilized myocytes. Ion concentrations in the pipette tip (i.e., access conductance) track without appreciable delay the current changes caused by sarcolemmal ion flux. Importantly, cytoplasmic mixing volumes, calculated from current decay kinetics, increase and decrease as expected with osmolarity changes (τ >30 s). Na/K pump current run-down over 20 min reflects a failure of pumps to recover from inactivation. Simulations reveal that pump inactivation coupled with Na-activated recovery enhances the rapidity and effectivity of Na homeostasis in cardiac myocytes. In conclusion, an autoregulatory mechanism enhances cardiac Na/K pump activity when
International Nuclear Information System (INIS)
Shiro, Yoshitsugu; Iizuka, Tetsutaro; Makino, Ryu; Ishimura, Yuzuru; Morishima, Isao
1989-01-01
The cyanide (C 15 N - ) complex of Pseudomonas putida cytochrome P-450 (P-450 cam ) exhibited well-resolved and hyperfine-shifted 15 N NMR resonances arising from the iron-bound C 15 N - at 423 and 500 ppm in the absence and presence of the substrate, d-camphor, respectively. The values were smaller than those for cyanide complexes of myoglobin and hemoglobin (∼ 1000 ppm) but fell into the same range as those for the cyanide complexes of peroxidases (∼ 500 ppm). The 15 N shift values of P-450 cam were not incompatible with the existence of anionic ligand, such as cysteinyl thiolate anion, at the fifth coordination site of heme iron. The difference in the 15 N chemical shift values between camphor-free and bound enzymes was inferred by the increase in the steric constraint to the Fe-C-N bond upon substrate binding
POTASSIUM DETECTION AND LITHIUM DEPLETION IN COMETS C/2011 L4 (PANSTARRS) AND C/1965 S1 (IKEYA-SEKI)
Energy Technology Data Exchange (ETDEWEB)
Fulle, M.; Molaro, P. [INAF-Osservatorio Astronomico, Via Tiepolo 11, I-34143 Trieste (Italy); Buzzi, L.; Valisa, P., E-mail: fulle@oats.inaf.it [Societa Astronomica Schiaparelli, Via Beato Angelico 1, Varese (Italy)
2013-07-10
On 2013 March 21, high-resolution slit spectrographs of the comet C/2011 L4 (Panstarrs), at a heliocentric distance r = 0.46 AU, were obtained at the Osservatorio Astronomico Campo dei Fiori, Italy. Emission lines of sodium were the strongest in the spectrum as is common in comets, but potassium lines were also detected. These have rarely been observed in comets since the apparition of the brightest comet C/1965 S1 (Ikeya-Seki). Lithium was not detected and stringent upper limits of its abundance compared to other alkali were derived. We obtain the abundance ratios Na/K = 54 {+-} 14 and Na/Li {>=}810{sup 3}. In addition to Mercury's exosphere (Leblanc and Doressoundiram), we show that photoionization at the beginning of the alkali tails may increase the solar ratio Na/K = 15.5 (Asplund et al.) by a factor three, close to that required to match the observed value. In the same tail position, the Na/Li ratio increases only by a factor two, very far from the factor {>=}8 required to match an original meteoritic ratio. We apply the same model to similar alkali data (Preston) of the comet C/1965 S1 (Ikeya-Seki) and obtain consistent results. An original solar Na/K ratio fits the observed value at the beginning of the alkali tails within the slit size, whereas Li is depleted by a factor {>=}8.
Directory of Open Access Journals (Sweden)
Luiz Augusto Souza
2011-08-01
Full Text Available http://dx.doi.org/10.5007/2175-7925.2011v24n4p103 Verificou-se a atividade da fosfatase alcalina sérica em resposta ao reparo de defeitos osteocondrais em vinte e quatro coelhos da raça Nova Zelândia. Distribuídos em três grupos, o controle (GC, o tratado com células mononucleares da medula óssea (GCM e o que recebeu células mononucleares autólogas com proteína morfogenética óssea (GCM+BMP. Após exposição do sulco troclear da articulação fêmoro-tíbio-patelar esquerda removeu-se um segmento em forma de cunha. O local foi preenchido com enxerto osteocondral alógeno conservado em glicerina a 98%. No GC foi realizada a enxertia óssea, no GCM além do enxerto foi inoculado 2x106 células mononucleares e no GCM+BMP foi administrada intra-articularmente células associadas á 1 μg de proteína morfogenética óssea. A resposta osteoblástica foi mensurada por meio da análise sérica de fosfatase alcalina no dia 0 (pré-operatório 3, 15, 30, 45 após cirurgia, além do acompanhamento por exames radiográficos. Procedeu-se a análise de variância em blocos ao acaso, esquema fatorial e teste de Tukey (p=0,05. A média geral do GCM foi superior quando comparada aos outros grupos e as maiores taxas estiveram entre o 15° e 45° dias de pós-operatório. A discrepância dos valores entre os indivíduos do mesmo grupo proporcionam dúvidas na veracidade do teste. Palavras chave: Células-tronco, Consolidação de fraturas, Marcador ósseo
Coordinating AgMIP data and models across global and regional scales for 1.5°C and 2.0°C assessments
Rosenzweig, Cynthia; Ruane, Alex C.; Antle, John; Elliott, Joshua; Ashfaq, Muhammad; Chatta, Ashfaq Ahmad; Ewert, Frank; Folberth, Christian; Hathie, Ibrahima; Havlik, Petr; Hoogenboom, Gerrit; Lotze-Campen, Hermann; MacCarthy, Dilys S.; Mason-D'Croz, Daniel; Contreras, Erik Mencos; Müller, Christoph; Perez-Dominguez, Ignacio; Phillips, Meridel; Porter, Cheryl; Raymundo, Rubi M.; Sands, Ronald D.; Schleussner, Carl-Friedrich; Valdivia, Roberto O.; Valin, Hugo; Wiebe, Keith
2018-05-01
The Agricultural Model Intercomparison and Improvement Project (AgMIP) has developed novel methods for Coordinated Global and Regional Assessments (CGRA) of agriculture and food security in a changing world. The present study aims to perform a proof of concept of the CGRA to demonstrate advantages and challenges of the proposed framework. This effort responds to the request by the UN Framework Convention on Climate Change (UNFCCC) for the implications of limiting global temperature increases to 1.5°C and 2.0°C above pre-industrial conditions. The protocols for the 1.5°C/2.0°C assessment establish explicit and testable linkages across disciplines and scales, connecting outputs and inputs from the Shared Socio-economic Pathways (SSPs), Representative Agricultural Pathways (RAPs), Half a degree Additional warming, Prognosis and Projected Impacts (HAPPI) and Coupled Model Intercomparison Project Phase 5 (CMIP5) ensemble scenarios, global gridded crop models, global agricultural economics models, site-based crop models and within-country regional economics models. The CGRA consistently links disciplines, models and scales in order to track the complex chain of climate impacts and identify key vulnerabilities, feedbacks and uncertainties in managing future risk. CGRA proof-of-concept results show that, at the global scale, there are mixed areas of positive and negative simulated wheat and maize yield changes, with declines in some breadbasket regions, at both 1.5°C and 2.0°C. Declines are especially evident in simulations that do not take into account direct CO2 effects on crops. These projected global yield changes mostly resulted in increases in prices and areas of wheat and maize in two global economics models. Regional simulations for 1.5°C and 2.0°C using site-based crop models had mixed results depending on the region and the crop. In conjunction with price changes from the global economics models, productivity declines in the Punjab, Pakistan, resulted in
Rosenzweig, Cynthia; Ruane, Alex C; Antle, John; Elliott, Joshua; Ashfaq, Muhammad; Chatta, Ashfaq Ahmad; Ewert, Frank; Folberth, Christian; Hathie, Ibrahima; Havlik, Petr; Hoogenboom, Gerrit; Lotze-Campen, Hermann; MacCarthy, Dilys S; Mason-D'Croz, Daniel; Contreras, Erik Mencos; Müller, Christoph; Perez-Dominguez, Ignacio; Phillips, Meridel; Porter, Cheryl; Raymundo, Rubi M; Sands, Ronald D; Schleussner, Carl-Friedrich; Valdivia, Roberto O; Valin, Hugo; Wiebe, Keith
2018-05-13
The Agricultural Model Intercomparison and Improvement Project (AgMIP) has developed novel methods for Coordinated Global and Regional Assessments (CGRA) of agriculture and food security in a changing world. The present study aims to perform a proof of concept of the CGRA to demonstrate advantages and challenges of the proposed framework. This effort responds to the request by the UN Framework Convention on Climate Change (UNFCCC) for the implications of limiting global temperature increases to 1.5°C and 2.0°C above pre-industrial conditions. The protocols for the 1.5°C/2.0°C assessment establish explicit and testable linkages across disciplines and scales, connecting outputs and inputs from the Shared Socio-economic Pathways (SSPs), Representative Agricultural Pathways (RAPs), Half a degree Additional warming, Prognosis and Projected Impacts (HAPPI) and Coupled Model Intercomparison Project Phase 5 (CMIP5) ensemble scenarios, global gridded crop models, global agricultural economics models, site-based crop models and within-country regional economics models. The CGRA consistently links disciplines, models and scales in order to track the complex chain of climate impacts and identify key vulnerabilities, feedbacks and uncertainties in managing future risk. CGRA proof-of-concept results show that, at the global scale, there are mixed areas of positive and negative simulated wheat and maize yield changes, with declines in some breadbasket regions, at both 1.5°C and 2.0°C. Declines are especially evident in simulations that do not take into account direct CO 2 effects on crops. These projected global yield changes mostly resulted in increases in prices and areas of wheat and maize in two global economics models. Regional simulations for 1.5°C and 2.0°C using site-based crop models had mixed results depending on the region and the crop. In conjunction with price changes from the global economics models, productivity declines in the Punjab, Pakistan, resulted in
Shen, Wei; Wang, Cong; Liu, Haimei; Yang, Wensheng
2013-10-18
A porous Na3 V2 (PO4 )3 cathode material coated uniformly with a layer of approximately 6 nm carbon has been synthesized by the sol-gel method combined with a freeze-drying process. The special porous morphology and structure significantly increases the specific surface area of the material, which greatly enlarges the contact area between the electrode and electrolyte, and consequently supplies more active sites for sodium ions. When employed as a cathode material of sodium-ion batteries, this porous Na3 V2 (PO4 )3 /C exhibits excellent rate performance and cycling stability; for instance, it shows quite a flat potential plateau at 3.4 V in the potential window of 2.7-4.0 V versus Na(+) /Na and delivers an initial capacity as high as 118.9 and 98.0 mA h g(-1) at current rates of 0.05 and 0.5 C, respectively, and after 50 cycles, a good capacity retention of 92.7 and 93.6 % are maintained. Moreover, even when the discharge current density is increased to 5 C (590 mA g(-1) ), an initial capacity of 97.6 mA h g(-1) can still be achieved, and an exciting capacity retention of 88.6 % is obtained after 100 cycles. The good cycle performance, excellent rate capability, and moreover, the low cost of Na3 V2 (PO4 )3 /C suggest that this material is a promising cathode for large-scale sodium-ion rechargeable batteries. Copyright © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Reaction π-p→ωn in the (15/40) GeV/c momentum range
International Nuclear Information System (INIS)
Apel, W.D.; Augenstein, K.H.; Krueger, M.; Mueller, H.; Schneider, H.; Sigurdsson, G.; Donskov, S.V.; Inyakin, A.V.; Kachanov, V.A.; Krasnokutsky, R.N.; Lednev, A.A.; Mikhailov, Yu.V.; Prokoshkin, Yu.D.; Shuvalov, R.S.; Leder, G.
1979-01-01
A high statistics measurement of the reaction π - p→ωn with ω→π 0 γ has been performed at the 70 GeV Serpukhov accelerator for 15, 20.2, 25, 30 and 40 GeV/c incident pion momentum, using the NICE set-up with its associated 648-channel γ-ray spectrometer. Values of the density matrix elements, differential and integral cross sections are reported. Already at 15 GeV/c, the unnatural parity exchange contribution to ω production in helicity 1 state is negligible. After a maximum around /t/ approximately equal to 0.12 (GeV/c) 2 , the differential cross section decreases exponentially up to /t/ approximately equal to 0.7 (GeV/c) 2 , where a break is seen in its slope. (author)
Lifescience Database Archive (English)
Full Text Available evipalpis DNA, complete genome. 34 0.015 17 CV091260 |CV091260.1 NA1759 cDNA non acclimated Bluecrop library... Vaccinium corymbosum cDNA 5', mRNA sequence. 46 0.036 2 CV091166 |CV091166.1 NA1661 cDNA non acclimated Blu
Hallaq, Haifa; Wang, Dao W; Kunic, Jennifer D; George, Alfred L; Wells, K Sam; Murray, Katherine T
2012-02-01
Na(+) current derived from expression of the cardiac isoform SCN5A is reduced by receptor-mediated or direct activation of protein kinase C (PKC). Previous work has suggested a possible role for loss of Na(+) channels at the plasma membrane in this effect, but the results are controversial. In this study, we tested the hypothesis that PKC activation acutely modulates the intracellular distribution of SCN5A channels and that this effect can be visualized in living cells. In human embryonic kidney cells that stably expressed SCN5A with green fluorescent protein (GFP) fused to the channel COOH-terminus (SCN5A-GFP), Na(+) currents were suppressed by an exposure to PKC activation. Using confocal microscopy, colocalization of SCN5A-GFP channels with the plasma membrane under control and stimulated conditions was quantified. A separate population of SCN5A channels containing an extracellular epitope was immunolabeled to permit temporally stable labeling of the plasma membrane. Our results demonstrated that Na(+) channels were preferentially trafficked away from the plasma membrane by PKC activation, with a major contribution by Ca(2+)-sensitive or conventional PKC isoforms, whereas stimulation of protein kinase A (PKA) had the opposite effect. Removal of the conserved PKC site Ser(1503) or exposure to the NADPH oxidase inhibitor apocynin eliminated the PKC-mediated effect to alter channel trafficking, indicating that both channel phosphorylation and ROS were required. Experiments using fluorescence recovery after photobleaching demonstrated that both PKC and PKA also modified channel mobility in a manner consistent with the dynamics of channel distribution. These results demonstrate that the activation of protein kinases can acutely regulate the intracellular distribution and molecular mobility of cardiac Na(+) channels in living cells.
International Nuclear Information System (INIS)
Rana, J.; Robins, D.J.
1985-01-01
The labelling patterns in (+)-lupanine, (+)-13-hydroxylupanine, and (+)-angustifoline derived biosynthetically from [1-amino- 15 N,1- 13 C]-1,5-diaminopentane (cadaverine) have been established by 13 C n.m.r. spectroscopy. Three cadaverine units are incorporated to about the same extent into each of these three alkaloids. The presence of two doublets due to 13 C- 15 N coupling in the 13 C brace 1 H brace n.m.r. spectra associated with C-2 and C-15 of lupanine and 13-hydroxylupanine, and one 13 C- 15 N doublet at C-2 of angustifoline, indicate that two of the cadaverine units are converted into the outer rings of the tetracyclic quinolizidine alkaloids in a specific fashion. (author)
Alcohol consumption reduces HbA1c and glycated albumin concentrations but not 1,5-anhydroglucitol.
Inada, Shinya; Koga, Masafumi
2017-11-01
Background The effect of alcohol consumption on glycaemic control indicators is not well known. In this study, we studied the effect of alcohol consumption on the plasma glucose and glycaemic control indicators in non-diabetic men. Methods The study enrolled 300 non-diabetic men who received a complete medical checkup (age: 52.8 ± 6.5 years, body mass index: 24.4 ± 2.8 kg/m 2 ). The subjects were divided into four groups by the amount of alcohol consumed, and the plasma glucose, HbA1c, glycated albumin (GA) and 1,5-anhydroglucitol (1,5-AG) concentrations of the groups were compared. Results As the level of alcohol consumption increased, significantly high concentrations of fasting plasma glucose (FPG) were observed, and the oral glucose tolerance test 2-h plasma glucose concentrations tended to rise. While no significant effect of alcohol consumption on HbA1c, 1,5-AG, and the 1,5-AG/FPG ratio was observed, the HbA1c/FPG ratio, GA and the GA/FPG ratio exhibited significantly low values as the level of alcohol consumption increased. In stepwise multivariate regression analysis, alcohol consumption was a significant negative independent variable for HbA1c and GA, but not for 1,5-AG. Conclusions As the level of alcohol consumption increased, the plasma glucose concentrations rose, but the HbA1c and GA concentrations were lower compared with the plasma glucose concentrations. These findings suggest that alcohol consumption may reduce HbA1c and GA concentrations, but not 1,5-AG.
Energy Technology Data Exchange (ETDEWEB)
Smetana, Volodymyr; Corbett, John D., E-mail: jcorbett@iastate.edu; Miller, Gordon J.
2013-11-15
The Na-rich part (∼30% Na) of the Na–Au–Ga system between NaAu{sub 2}, NaGa{sub 4}, and Na{sub 22}Ga{sub 39} has been found to contain the ternary phases Na{sub 8}Au{sub 9.8(4)}Ga{sub 7.2} (I) and Na{sub 17}Au{sub 5.87(2)}Ga{sub 46.63} (II), according to the results of single crystal X-ray diffraction measurements. I is orthorhombic, Cmcm, a=5.3040(1), b=24.519(5), c=14.573(3) Å, and contains a network of clusters with local 5-fold symmetry along the a-axis. Such clusters are frequent building units in decagonal quasicrystals and their approximants. II is rhombohedral, R3{sup ¯}m, a=16.325(2), c=35.242(7) Å, and contains building blocks that are structurally identical to the Bergman-type clusters as well as fused icosahedral units known with active metals, triels and late transition elements. II also contains a polycationic network with elements of the clathrate V type structure. Tight-binding electronic structure calculations using linear muffin–tin-orbital (LMTO) methods on idealized models of I and II indicate that both compounds are metallic with evident pseudogaps at the corresponding Fermi levels. The overall Hamilton bond populations are generally dominated by Au–Ga and Au–Au bonds in I and by Ga–Ga bonds in II; moreover, the Na–Au and Na–Ga contributions in I are unexpectedly large, ∼20% of the total. A similar involvement of sodium in covalent bonding has also been found in the electron-richer i-Na{sub 13}Au{sub 12}Ga{sub 15} quasicrystal approximant. - Graphical abstract: Multiply-endohedral Bergman-related clusters in the structure of Na{sub 17}Au{sub 5.9(1)}Ga{sub 46.6.} Display Omitted - Highlights: • Two new compounds with the local 5-fold symmetry have been investigated. • Na{sub 8}Au{sub 9.8(4)}Ga{sub 7.2} is an orthorhombic approximant of the Na{sub 13}Au{sub 12}Ga{sub 15} quasicrystal. • Na{sub 17}Au{sub 5.87(2)}Ga{sub 46.63} represents a rhombohedral distortion of the Bergman-type phases.
Changes in the corneal Na-K ATPase levels in eyes stored in moist chamber at 4°C
Directory of Open Access Journals (Sweden)
Devi B
1996-01-01
Full Text Available This report deals with a chronological measurement of Na-K ATPase enzyme activity in human and bovine corneas stored in a moist chamber at 4°C. Paired human and bovine eyes were sterilized by the standard eye bank procedure and stored up to 6 days. At the desired time, the corneal endothelium was assayed for Na-K ATPase activity. The protein content of each tissue sample was also determined. In a parallel set of experiments, the viability of identical stored corneas was determined by trypan blue and alizarin red staining technique, and morphometric analysis was done to quantify the extent of the corneal endothelial damage. The human corneas showed that there was a significant progressive decrease in the Na-K ATPase activity as the storage time increased. The decrease was related to morphological endothelial damage.
Synthesis of zeolites Na-A and Na-X from tablet compressed and calcinated coal fly ash
Hu, Tao; Gao, Wenyan; Liu, Xin; Zhang, Yifu; Meng, Changgong
2017-10-01
Zeolites Na-A and Na-X are important synthetic zeolites widely used for separation and adsorption in industry. It is of great significance to develop energy-efficient routines that can synthesize zeolites Na-A and Na-X from low-cost raw materials. Coal fly ash (CFA) is the major residue from the combustion of coal and biomass containing more than 85% SiO2 and Al2O3, which can readily replace the conventionally used sodium silicate and aluminate for zeolite synthesis. We used Na2CO3 to replace the expensive NaOH used for the calcination of CFA and showed that tablet compression can enhance the contact with Na2CO3 for the activation of CFA through calcination for the synthesis of zeolites Na-A and Na-X under mild conditions. We optimized the control variables for zeolite synthesis and showed that phase-pure zeolite Na-A can be synthesized with CFA at reactant molar ratio, hydrothermal reaction temperature and reaction time of 1.3Na2O: 0.6Al2O3: 1SiO2: 38H2O at 80°C for 6 h, respectively, while phase-pure zeolite Na-X can be synthesized at 2.2Na2O: 0.2Al2O3: 1SiO2: 88H2O at 100°C for 8 h, respectively. The composition, morphology, specific surface area, vibration spectrum and thermogravimetry of synthesized Na-A and Na-X were further characterized.
Fotografia na Imprensa: conflitos na câmara escura
Directory of Open Access Journals (Sweden)
José Lúcio da Silva Menezes
2014-07-01
Full Text Available Este artigo recupera o teor ideológico do discurso que a Revista Veja elaborou sobre a classe trabalhadora que emergiu no cenário brasileiro, no final da década de 1970. O destaque dado aos trabalhadores como temática central resgatada, deve-se aos movimentos grevistas por eles encetados, após anos de ocultamento de sua resistência sob a repressão da ditadura civil-militar (1964-1985. Com a rebeldia operária, as matérias a respeito deste grupo, na Revista,foram se tornando mais constantes e visíveis, pois já não era mais possível, para a Revista Veja, ignorar a existência da classe operária que, com a força insurgente das greves, ocupava as ruas do Brasil.
Large old trees influence patterns of delta13C and delta15N in forests.
Weber, Pascale; Bol, Roland; Dixon, Liz; Bardgett, Richard D
2008-06-01
Large old trees are the dominant primary producers of native pine forest, but their influence on spatial patterns of soil properties and potential feedback to tree regeneration in their neighbourhood is poorly understood. We measured stable isotopes of carbon (delta(13)C) and nitrogen (delta(15)N) in soil and litter taken from three zones of influence (inner, middle and outer zone) around the trunk of freestanding old Scots pine (Pinus sylvestris L.) trees, to determine the trees' influence on below-ground properties. We also measured delta(15)N and delta(13)C in wood cores extracted from the old trees and from regenerating trees growing within their three zones of influence. We found a significant and positive gradient in soil delta(15)N from the inner zone, nearest to the tree centre, to the outer zone beyond the tree crown. This was probably caused by the higher input of (15)N-depleted litter below the tree crown. In contrast, the soil delta(13)C did not change along the gradient of tree influence. Distance-related trends, although weak, were visible in the wood delta(15)N and delta(13)C of regenerating trees. Moreover, the wood delta(15)N of small trees showed a weak negative relationship with soil N content in the relevant zone of influence. Our results indicate that large old trees control below-ground conditions in their immediate surroundings, and that stable isotopes might act as markers for the spatial and temporal extent of these below-ground effects. John Wiley & Sons, Ltd
A intervenção da célula epitelial na asma
Directory of Open Access Journals (Sweden)
Anabela Mota Pinto
2009-05-01
Full Text Available Resumo: Faz-se uma revisão da intervenção da célula epitelial brônquica na fisiopatologia da asma. O epitélio que reveste as vias respiratórias actua como uma barreira fÃsica, separando o meio externo do meio interno pulmonar, controla a permeabilidade intercelular e transcelular, e, deste modo, a acessibilidade dos agressores inalantes à s células apresentadoras de antigénio envolvidas na resposta imunoinflamatória. As células epiteliais unidas por tight junctions contribuem para a integridade das vias aéreas e expressam poliovirus receptorâ related protein (PRR, toll like receptors (TLR e protease-activated receptors (PAR, que reconhecem agentes bacterianos e alergénios. A sua disfunção transforma-as em fonte de mediadores intervenientes na inflamação.A interacção bidireccional entre, por um lado, o epitélio e os elementos constitutivos do brônquio e por outro, as partÃculas inaladas, tem subjacente a formação de uma unidade, com identidade própria designada EMTU â epithelial mesenchymal trophic unit.Esta extensa intervenção coloca a célula epitelial no centro de acção da cronicidade e remodelação do processo asmático.As doenças infecciosas e o stress ambiental são capazes de induzir alterações a nÃvel da célula epitelial susceptÃveis de modificar a sua resposta a estimulações futuras, nomeadamente a ampliar a resposta a outras agressões infecciosas por acção sinérgica das vias de sinalização.O epitélio brônquico tem assim funções de barreira que lhe permite exercer uma permeabilidade selectiva, a nÃvel intracelular e transcelular, é ainda metabolicamente activo pelas capacidade de produzir mediadores quimiotácticos e citocinas envolvidos no recrutamento e na activação celular, com repercussão na broncomotricidade e na remodelação da parede br
FTIR spectra of the solid solutions (Na0.88K0.12)VO3, (Na0.5K0.5)VO3, and Na(V0.66P0.34)O3
de Waal, D.; Heyns, A. M.
1992-03-01
It is known that three different solid solutions, (Na0.88K0.12)VO3, (Na0.5K0.5)VO3 and Na(V0.66P0.34)O3, form in the (Na,K)(V,P)O3 system. These compounds all have monoclinic crystal structures similar to the pure alkali metal metavanadates containing small cations, e.g. Li+ and Na+ (Space group C2/c). Metavanadates with large cations like K+, Rb+, C+s and NH+4 form orthorhombic crystals, space group Pbcm. All those are structurally related to the silicate pyroxenes. Na(V0.66P0.34)O3 and (Na0.88K0.12)VO3 have the same modified diopside structure as (alpha) - NaVO3 while (Na0.5K0.5)VO3 adopts the true diopside structure. The infrared spectra of the three solid solutions are reported here in comparison with those of (alpha) -NaVO3 and KVO3. The results are also correlated with those obtained in two independent high pressure Raman studies of NH4VO3 and RbVO3 as the introduction of a larger cation like K+ should increase the pressure in the structure.
Furukawa, T
2002-01-01
In order to contribute the investigation into corrosion mechanism of the structural materials by leakage sodium, thermodynamic study of Na-Fe complex oxides formed by the reactions was carried out. Na sub 5 FeO sub 4 and Na sub 3 FeO sub 3 were used as the sample. Its high temperature properties (i.e. melting, solidification and transformation) were observed by Differential Scanning Calorimetry, DSC. Moreover, the original test named 'melting point confirmation test' was performed for the observation of traces of melting and solidification after the tests. Following contents have been obtained by this study. (1) Na sub 5 FeO sub 4 was stably as the solid without phase transformation and melting until 800degC. However, the compound was showing a tendency to change into Na sub 4 FeO sub 3 with temperature increasing under the low oxygen potential. (2) The stability of Na sub 3 FeO sub 3 is the same as that of Na sub 5 FeO sub 4 until 700degC. Over the temperature, the compound was changed differential compound ...
Global drought and severe drought-affected populations in 1.5 and 2 °C warmer worlds
Liu, Wenbin; Sun, Fubao; Lim, Wee Ho; Zhang, Jie; Wang, Hong; Shiogama, Hideo; Zhang, Yuqing
2018-03-01
The 2015 Paris Agreement proposed a more ambitious climate change mitigation target on limiting global warming to 1.5 °C instead of 2 °C above preindustrial levels. Scientific investigations on environmental risks associated with these warming targets are necessary to inform climate policymaking. Based on the Coupled Model Intercomparison Project phase 5 (CMIP5) climate models, we present the first risk-based assessment of changes in global drought and the impact of severe drought on populations from additional 1.5 and 2 °C warming conditions. Our results highlight the risk of drought on a global scale and in several hotspot regions such as the Amazon, northeastern Brazil, southern Africa and Central Europe at both 1.5 and 2 °C global warming relative to the historical period, showing increases in drought durations from 2.9 to 3.2 months. Correspondingly, more total and urban populations would be exposed to severe droughts globally (+132.5 ± 216.2 million and +194.5 ± 276.5 million total population and +350.2 ± 158.8 million and +410.7 ± 213.5 million urban populations in 1.5 and 2 °C warmer worlds) and regionally (e.g., East Africa, West Africa and South Asia). Less rural populations (-217.7 ± 79.2 million and -216.2 ± 82.4 million rural populations in 1.5 and 2 °C warmer worlds) would be exposed to severe drought globally under climate warming, population growth and especially the urbanization-induced population migration. By keeping global warming at 1.5 °C above the preindustrial levels instead of 2 °C, there is a decrease in drought risks (i.e., less drought duration, less drought intensity and severity but relatively more frequent drought) and the affected total, urban and rural populations would decrease globally and in most regions. While challenging for both East Africa and South Asia, the benefits of limiting warming to below 1.5 °C in terms of global drought risk and impact reduction are significant.
Metabolismo do cálcio na fenilcetonúria Calcium metabolism in phenilke
Directory of Open Access Journals (Sweden)
Fabiana Ferreira Martins
2009-06-01
Full Text Available A Fenilcetonúria é um erro inato do metabolismo do aminoácido fenilalanina. O tratamento é essencialmente dietético e envolve uma restrição severa no consumo de alimentos contendo aminoácido fenilalanina. Embora a alimentação seja complementada com fórmulas a fim de suprir as necessidades de vitaminas, minerais e aminoácidos essenciais, carências nutricionais ainda ocorrem. Isto se deve, principalmente, à restrição de fontes protéicas, que acarreta deficiência na ingestão de diversos nutrientes, dentre eles o cálcio. O cálcio possui importante relação com a formação mineral óssea. Estudos recentes demonstram que portadores de fenilcetonúria apresentam freqüentemente osteopenia e fraturas, sendo a maior incidência em crianças acima de 8 anos de idade. O rápido aumento da estatura, a dieta deficiente em cálcio e níveis de aminoácido fenilalanina elevados têm sido descritos como os principais fatores para a aquisição de massa óssea inadequada. A suplementação de cálcio em crianças saudáveis mostrou um efeito positivo sobre a aquisição de massa óssea na fase da pré-puberdade. Assim, torna-se relevante compreender a necessidade da suplementação de cálcio em pacientes fenilcetonúria, a fim de favorecer o desenvolvimento ósseo esperado.Phenylketonuria is an inborn error of the metabolism of the amino acid phenylalanine. The treatment is essentially dietetic and involves a severe restriction in the consumption of foods containing aminoacid phenylalanine. Although the diet is complemented with supplements in order to meet the vitamin, mineral and essential amino acid requirements, nutritional deficiencies still occur. This is mainly due to restricting the consumption of protein sources, which results in low intake of several nutrients, including calcium. Calcium is strongly related to bone mineral formation. Recent studies have demonstrated that patients with phenylketonuria often present osteopenia and
Microstructure of a SiC/Ti-15-3 composite
Lerch, B. A.; Hull, D. R.; Leonhardt, T. A.
1990-01-01
A continuous SiC-fiber-reinforced titanium (Ti-15V-3Cr-3Sn-3A1) composite was metallographically examined. Several methods for examining composite materials were investigated and documented. Polishing techniques for this material are described. An interference layering method was developed to reveal the structure of the fiber, the reaction zone, and various phases within the matrix. Microprobe and TEM analyses were performed on the fiber-matrix interface. Detailed descriptions of the fiber distribution and the microstructure of the fiber and matrix are presented.
Directory of Open Access Journals (Sweden)
Isis Tande da Silva
2010-05-01
Full Text Available FUNDAMENTO: Vários estudos sugerem que a proteína-C reativa (PCR se correlaciona com doença arterial coronariana em adultos. Entretanto, essa associação ainda é pouco explorada em adolescentes. OBJETIVO: Avaliar a associação entre a PCR e os fatores de risco cardiovascular em adolescentes obesos. MÉTODOS: Oitenta e quatro adolescentes (12,6 ± 1,3 anos, ambos os sexos, foram distribuídos nos grupos Eutrófico (n = 28, Sobrepeso (n = 28 e Obeso (n = 28, segundo o índice de massa corpórea (IMC. A concentração de PCR (ELISA ultrassensível, o perfil lipídico e o conteúdo de anticorpos anti-LDLox (ELISA foram determinados após jejum de 12h. RESULTADOS: Os grupos foram semelhantes quanto a idade (p = 0,13 e sexo (p = 0,83. Colesterol total, HDL-C, CT/HDL-C e LDL-C/HDL-C apresentaram diferenças significativas entre os grupos Eutrófico e Obeso. Não houve variação significativa no conteúdo de anticorpos anti-LDLox. Os valores de PCR foram diferentes entre os três grupos (p FUNDAMENTO: Diversos estudios sugieren que la proteína-C reactiva (PCR se correlaciona con la enfermedad arterial coronaria en adultos. Sin embargo, esta asociación es todavía poco explorada en adolescentes. OBJETIVO: Evaluar la asociación entre la PCR y los factores de riesgo cardiovascular en adolescentes obesos. MÉTODOS: Ochenta y cuatro adolescentes (12,6 ± 1,3 años, de ambos sexos, se distribuyeron en los grupos Eutrófico (n=28, Sobrepeso (n=28 y Obeso (n=28, según el IMC. La concentración de PCR (ELISA ultrasensible, el perfil lipídico y el contenido de anticuerpos anti-LDLox (ELISA fueron determinados tras ayuno de 12h. RESULTADOS: Los grupos se hallaron semejantes en cuanto a la edad (p=0,13 y sexo (p=0,83. Colesterol total, HDL-C, CT/HDL-C y LDL-C/HDL-C expresaron diferencias significativas entre los grupos Eutrófico y Obeso. No hubo variación significativa en el contenido de anticuerpos anti-LDLox. Los valores de PCR fueron diferentes
International Nuclear Information System (INIS)
Gao Feng; Liu Liangliang; Xu Bei; Cao Xiao; Deng Zhenqi; Tian Changsheng
2011-01-01
Highlights: → The evolution of the crystal structure for the new phase K 3 Li 2 Nb 5 O 15 was described. → The dielectric relaxor behavior would be strengthened by increasing plate-like NN. → k p and d 33 decrease with increasing amount of plate-like NN. → 0.01-0.03 mol of plate-like NN is a proper content for texturing ceramics by RTGG. - Abstract: Plate-like NaNbO 3 (NN) particles were used as the raw material to fabricate (1 - x)[0.93 K 0.48 Na 0.52 Nb O 3 -0.07Li(Ta 0.5 Nb 0.5 )O 3 ]-xNaNbO 3 lead-free piezoelectric ceramics using a conventional ceramic process. The effects of NN on the crystal structure and piezoelectric properties of the ceramics were investigated. The results of X-ray diffraction suggest that the perovskite phase coexists with the K 3 Li 2 Nb 5 O 15 phase, and the tilting of the oxygen octahedron is probably responsible for the evolution of the tungsten-bronze-typed K 3 Li 2 Nb 5 O 15 phase. The Curie temperature (T C ) is shifted to lower temperature with increasing NN content. (1 - x)[0.93 K 0.48 Na 0.52 NbO 3 -0.07Li(Ta 0.5 Nb 0.5 )O 3 ]-xNaNbO 3 ceramics show obvious dielectric relaxor characteristics for x > 0.03, and the relaxor behavior of ceramics is strengthened by increasing NN content. Both the electromechanical coupling factor (k p ) and the piezoelectric constant (d 33 ) decrease with increasing amounts of NN. 0.01-0.03 mol of plate-like NaNbO 3 in 0.93 K 0.48 Na 0.52 NbO 3 -0.07Li(Ta 0.5 Nb 0.5 )O 3 gives the optimum content for preparing textured ceramics by the RTGG method.
Limmer, Franziska; Schinner, Elisabeth; Castrop, Hayo; Vitzthum, Helga; Hofmann, Franz; Schlossmann, Jens
2015-10-01
Sodium chloride reabsorption in the thick ascending limb of the loop of Henle is mediated by the Na(+)-K(+)-2Cl(-) cotransporter (NKCC2). The loop diuretic furosemide is a potent inhibitor of NKCC2. However, less is known about the mechanism regulating the electrolyte transporter. Considering the well-established effects of nitric oxide on NKCC2 activity, cGMP is likely involved in this regulation. cGMP-dependent protein kinase I (cGKI; PKGI) is a cGMP target protein that phosphorylates different substrates after activation through cGMP. We investigated the potential correlation between the cGMP/cGKI pathway and NKCC2 regulation. We treated wild-type (wt) and cGKIα-rescue mice with furosemide. cGKIα-rescue mice expressed cGKIα only under the control of the smooth muscle-specific transgelin (SM22) promoter in a cGKI deficient background. Furosemide treatment increased the urine excretion of sodium and chloride in cGKIα-rescue mice compared to that in wt mice. We analyzed the phosphorylation of NKCC2 by western blotting and immunostaining using the phosphospecific antibody R5. The administration of furosemide significantly increased the phosphorylated NKCC2 signal in wt but not in cGKIα-rescue mice. NKCC2 activation led to its phosphorylation and membrane translocation. To examine whether cGKI was involved in this process, we analyzed vasodilator-stimulated phosphoprotein, which is phosphorylated by cGKI. Furosemide injection resulted in increased vasodilator-stimulated phosphoprotein phosphorylation in wt mice. We hypothesize that furosemide administration activated cGKI, leading to NKCC2 phosphorylation and membrane translocation. This cGKI-mediated pathway could be a mechanism to compensate for the inhibitory effect of furosemide on NKCC2. © 2015 FEBS.
Liu, Nan; Nittler, Larry R.; Pignatari, Marco; O'D. Alexander, Conel M.; Wang, Jianhua
2017-06-01
We report C, N, and Si isotopic data for 59 highly 13C-enriched presolar submicron- to micron-sized SiC grains from the Murchison meteorite, including eight putative nova grains (PNGs) and 29 15N-rich (14N/15N ≤ solar) AB grains, and their Mg-Al, S, and Ca-Ti isotope data when available. These 37 grains are enriched in 13C, 15N, and 26Al with the PNGs showing more extreme enhancements. The 15N-rich AB grains show systematically higher 26Al and 30Si excesses than the 14N-rich AB grains. Thus, we propose to divide the AB grains into groups 1 (14N/15N PNG and found 32S and/or 50Ti enhancements. Interestingly, one AB1 grain had the largest 32S and 50Ti excesses, strongly suggesting a neutron-capture nucleosynthetic origin of the 32S excess and thus the initial presence of radiogenic 32Si (t 1/2 = 153 years). More importantly, we found that the 15N and 26Al excesses of AB1 grains form a trend that extends to the region in the N-Al isotope plot occupied by C2 grains, strongly indicating a common stellar origin for both AB1 and C2 grains. Comparison of supernova models with the AB1 and C2 grain data indicates that these grains came from supernovae that experienced H ingestion into the He/C zones of their progenitors.
OXITOCINA NO SÊMEN SUÍNO HETEROSPÉRMICO RESFRIADO A 15 oC
Directory of Open Access Journals (Sweden)
Silvio Luiz de Oliveira
2006-10-01
Full Text Available O objetivo deste trabalho foi avaliar o efeito da oxitocina sobre a qualidade do sêmen suíno heterospérmico diluído em BTS e armazenado a 15 °C. Foram utilizadas três misturas de dois ejaculados, coletados de quatro animais mestiços. As doses contendo o sêmen foram armazenadas em geladeira, em garrafas plásticas, sem oxitocina (T1 e outra com adição de oxitocina (T2 na concentração de 2,5 UI/ dose. Amostras de sêmen foram retiradas nos tempos zero, 24 e 48 horas para avaliações de fertilidade. Os valores médios encontrados para motilidade, vigor, percentagem de espermatozóides vivos e integridade de acrossoma foram respectivamente de 63,0%, 2,9, 90,0% e 98,0% no tempo 24 h e 55,0%, 2,7, 90,6% e 97,2% no tempo 48 h de armazenamento. E para o sêmen tratado com oxitocina (T2 os valores médios encontrados foram: 63,0%, 3,0, 90,7% e 97%,1 no tempo 24 h e 58,0%, 2,8, 88,6% e 97,1% no tempo 48 h. As análises estatísticas mostraram que houve diferenças significativas apenas para o vigor espermático, mas que a oxitocina pode ser utilizada como meio de aumentar a taxa de concepção dos animais. PALAVRAS-CHAVE: Inseminação artificial, suínos, sêmen heterospérmico.
International Nuclear Information System (INIS)
Hawke, D.J.; Clark, J.M.
2010-01-01
Seabird burrows provide a soil environment for processing discards such as feathers and guano, hence constituting a primary interface between the sea and the land. This study involved collection and culturing of soil invertebrates from three blue penguin (Eudyptula minor) burrows, and examined their 13 C/ 12 C and 15 N/ 14 N isotopic composition in relation to potential burrow resources (terrestrial plant litter, burrow soil, guano, blue penguin feathers). Two taxa (cerylonid beetles and small tineid moth larvae) had a depleted 13 C/ 12 C indicative of a level of dependence on C from terrestrial soil. Tineid moth larvae (Monopis crocicapitella and (or) M. ethelella) substantially increased their 13 C/ 12 C enrichment during development, implying increasing dependence on marine C. Remaining taxa, both decomposers and predators, had 13 C/ 12 C intermediate between guano and feathers. Larval and emergent fleas had the most enriched 13 C/ 12 C , indicative of a greater dependence on feather C and the likelihood of co-processing with guano. Pseudoscorpions and histerid beetles had overlapping isotopic enrichments implying competition for prey, but were spatially separated in burrow soil. With their highly enriched 15 N/ 14 N and marine 13 C/ 12 C, larvae and protonymphs of the histiostomatid mite Myianoetus antipodus stood alone. Blue penguin burrows therefore support a diverse invertebrate fauna that incorporates terrestrial soil as well as varying proportions of the various blue penguin discards. (author). 45 refs., 1 fig., 1 tab.
Halogenated Terpenes and a C15-Acetogenin from the Marine Red Alga Laurencia saitoi
Directory of Open Access Journals (Sweden)
Xiao-Ming Li
2008-11-01
Full Text Available Seven parguerane diterpenes: 15-bromo-2,7,19-triacetoxyparguer-9(11-en-16-ol (1, 15-bromo-2,7,16,19-tetraacetoxyparguer-9(11-ene (2, 15-bromo-2,19-diacetoxyparguer-9(11-en-7,16-diol (3, 15-bromo-2,16,19-triacetoxyparguer-9(11-en-7-ol (4, 15-bromo-2,16-diacetoxyparguer-9(11-en-7-ol (5, 15-bromoparguer-9(11-en-16-ol (6, 15-bromoparguer-7-en-16-ol (7, two polyether triterpenes: thyrsiferol (8 and thyrsiferyl 23-acetate (9, and one C15-acetogenin, neolaurallene (10, were isolated from a sample of marine red alga Laurencia saitoi collected off the coast of Yantai. Their structures were established by detailed NMR spectroscopic analysis and comparison with literature data.
Directory of Open Access Journals (Sweden)
Bárbara Zini Ramos
2013-08-01
Full Text Available O desbalanço entre Ca2+, Mg2+ e K+ no solo como consequência das aplicações elevadas de gesso deve-se às relações de tamanho (raio iônico e densidades de cargas (relação carga/raio de cada espécie iônica. Quanto maior a densidade de carga, mais intensa será a ligação iônica do cátion com íons de cargas opostas como OH- e SO4-2. Dessa maneira, o uso excessivo de gesso agrícola, sem considerar o balanço de cargas das partículas do solo; o equilíbrio iônico; e a CTC podem resultar em expressiva lixiviação ao longo do perfil do solo. O objetivo deste estudo foi avaliar o efeito de elevadas doses de gesso (0, 7 e 56 t ha-1 nos teores de Ca2+, Mg2+, K+ e pH na solução de um Latossolo Vermelho distrófico cultivado com cafeeiro, obtida pelo método adaptado do extrato aquoso. O solo foi amostrado nas profundidades de 0,15-0,25; 0,35-0,45; 0,75-0,85; 1,15-1,25 e 2,35-2,45 m na linha de plantio, em quatro tratamentos: G-0 - gesso no preparo (aplicação ocorreu em setembro de 2008, distribuído a lanço, na quantidade de 2 t ha-1 e sem gesso na linha de plantio; G-7 - gesso adicionado durante a preparação do solo (2 t ha-1, na mesma condição do G-0 e 7,0 t ha-1 de gesso na linha de plantio; G-56 - gesso adicionado durante a preparação do solo (2 t ha-1, na mesma condição do G-0 e 56 t ha-1 de gesso na linha de plantio (nessas parcelas experimentais as entrelinhas de plantio foram cobertas com braquiária; e CV-7: ausência de braquiária na entrelinha, com gesso no preparo e 7 t ha-1 de gesso na linha, com três repetições distribuídas em blocos ao acaso, totalizando 60 amostras. Após 16 meses da adição de gesso, observou-se redução do pH na solução do solo nas profundidades de 0,15-0,25; 0,35-0,45 e 0,75-0,85 m. A aplicação de gesso agrícola foi eficiente na melhoria do ambiente radicular no subsolo, aumentou a concentração de Mg2+ e Ca2+ na solução do solo, mas reduziu o K+ em profundidade, a partir
Comparison of 15N- and 13C-determined parameters of mobility in melittin
International Nuclear Information System (INIS)
Zhu Lingyang; Prendergast, Franklyn G.; Kemple, Marvin D.
1998-01-01
Backbone and tryptophan side-chain mobilities in the 26-residue, cytolytic peptide melittin (MLT) were investigated by 15 N and 13 C NMR. Specifically, inverse-detected 15 N T 1 and steady-state NOE measurements were made at 30 and 51 MHz on MLT at 22 deg. C enriched with 15 N at six amide positions and in the Trp 19 side chain. Both the disordered MLT monomer (1.2 mM peptide at pH 3.6 in neat water) and α-helical MLT tetramer (4.0 mM peptide at pH 5.2 in 150 mM phosphate buffer) were examined. The relaxation data were analyzed in terms of the Lipari and Szabo model-free formalism with three parameters: τ m , the correlation time for the overall rotation; S 2 , a site-specific order parameter which is a measure of the amplitude of the internal motion; and τ e , a local, effective correlation time of the internal motion. A comparison was made of motional parameters from the 15 N measurements and from 13 C measurements on MLT, the latter having been made here and previously [Kemple et al. (1997) Biochemistry, 36, 1678-1688]. τ m and τ e values were consistent from data on the two nuclei. In the MLT monomer, S 2 values for the backbone N-H and Cα-H vectors in the same residue were similar in value but in the tetramer the N-H order parameters were about 0.2 units larger than the Cα-H order parameters. The Trp side-chain N-H and C-H order parameters, and τ e values were generally similar in both the monomer and tetramer. Implications of these results regarding the dynamics of MLT are examined
International Nuclear Information System (INIS)
Liu, Nan; Nittler, Larry R.; Alexander, Conel M. O’D.; Wang, Jianhua; Pignatari, Marco
2017-01-01
We report C, N, and Si isotopic data for 59 highly 13 C-enriched presolar submicron- to micron-sized SiC grains from the Murchison meteorite, including eight putative nova grains (PNGs) and 29 15 N-rich ( 14 N/ 15 N ≤ solar) AB grains, and their Mg–Al, S, and Ca–Ti isotope data when available. These 37 grains are enriched in 13 C, 15 N, and 26 Al with the PNGs showing more extreme enhancements. The 15 N-rich AB grains show systematically higher 26 Al and 30 Si excesses than the 14 N-rich AB grains. Thus, we propose to divide the AB grains into groups 1 ( 14 N/ 15 N < solar) and 2 ( 14 N/ 15 N ≥ solar). For the first time, we have obtained both S and Ti isotopic data for five AB1 grains and one PNG and found 32 S and/or 50 Ti enhancements. Interestingly, one AB1 grain had the largest 32 S and 50 Ti excesses, strongly suggesting a neutron-capture nucleosynthetic origin of the 32 S excess and thus the initial presence of radiogenic 32 Si ( t 1/2 = 153 years). More importantly, we found that the 15 N and 26 Al excesses of AB1 grains form a trend that extends to the region in the N–Al isotope plot occupied by C2 grains, strongly indicating a common stellar origin for both AB1 and C2 grains. Comparison of supernova models with the AB1 and C2 grain data indicates that these grains came from supernovae that experienced H ingestion into the He/C zones of their progenitors.
Sharma, Kaustubh; Haque, Masudul; Guidry, Richard; Ueta, Yoichi; Teruyama, Ryoichi
2017-09-01
A growing body of evidence suggests that epithelial Na + channels (ENaCs) in the brain play a significant role in the regulation of blood pressure; however, the brain structures that mediate the effect are not well understood. Because vasopressin (VP) neurons play a pivotal role in coordinating neuroendocrine and autonomic responses to maintain cardiovascular homeostasis, a basic understanding of the regulation and activity of ENaC in VP neurons is of great interest. We show that high dietary salt intake caused an increase in the expression and activity of ENaC which resulted in the steady state depolarization of VP neurons. The results help us understand one of the mechanisms underlying how dietary salt intake affects the activity of VP neurons via ENaC activity. All three epithelial Na + channel (ENaC) subunits (α, β and γ) are located in vasopressin (VP) magnocellular neurons in the hypothalamic supraoptic (SON) and paraventricular nuclei. Our previous study demonstrated that ENaC mediates a Na + leak current that affects the steady state membrane potential in VP neurons. In the present study, we evaluated the effect of dietary salt intake on ENaC regulation and activity in VP neurons. High dietary salt intake for 7 days caused an increase in expression of β- and γENaC subunits in the SON and the translocation of αENaC immunoreactivity towards the plasma membrane. Patch clamp experiments on hypothalamic slices showed that the mean amplitude of the putative ENaC currents was significantly greater in VP neurons from animals that were fed a high salt diet compared with controls. The enhanced ENaC current contributed to the more depolarized basal membrane potential observed in VP neurons in the high salt diet group. These findings indicate that high dietary NaCl intake enhances the expression and activity of ENaCs, which augments synaptic drive by depolarizing the basal membrane potential close to the action potential threshold during hormonal demand. However
Electronic structure and molecular dynamics of Na2Li
Malcolm, Nathaniel O. J.; McDouall, Joseph J. W.
Following the first report (Mile, B., Sillman, P. D., Yacob, A. R. and Howard, J. A., 1996, J. chem. Soc. Dalton Trans , 653) of the EPR spectrum of the mixed alkali-metal trimer Na2Li a detailed study has been made of the electronic structure and structural dynamics of this species. Two isomeric forms have been found: one of the type, Na-Li-Na, of C , symmetry and another, Li-Na-Na, of C symmetry. Also, there are two linear saddle points which correspond to 'inversion' transition structures, and a saddle point of C symmetry which connects the two minima. A molecular dynamics investigation of these species shows that, at the temperature of the reported experiments (170 K), the C minimum is not 'static', but undergoes quite rapid inversion. At higher temperatures the C minimum converts to the C form, but by a mechanism very different from that suggested by minimum energy path considerations. 2 2v s s 2v 2v s
Ruusunen, Marjo; Surakka, Anu; Korkeala, Hannu; Lindström, Miia
2012-10-01
Outgrowth from Clostridium tyrobutyricum spores in milk can lead to butyric acid fermentation in cheeses, causing spoilage and economical loss to the dairy industry. The aim of this study was to investigate the growth of 10 C. tyrobutyricum strains at different NaCl, pH, and temperature conditions. Up to 7.5-fold differences among the maximum growth rates of different strains in the presence of 2.0% NaCl were observed. Five of 10 strains were able to grow in the presence of 3.0% NaCl, while a NaCl concentration of 3.5% was completely inhibitory to all strains. Seven of 10 strains were able to grow at pH 5.0, and up to 4- and 12.5-fold differences were observed among the maximum growth rates of different strains at pH 5.5 and 7.5, respectively. The maximum growth temperatures varied from 40.2 to 43.3°C. The temperature of 10°C inhibited the growth of all strains, while 8 of 10 strains grew at 12 and 15°C. Despite showing no growth, all strains were able to survive at 10°C. In conclusion, wide variation was observed among different C. tyrobutyricum strains in their ability to grow at different stressful conditions. Understanding the physiological diversity among the strains is important when designing food control measures and predictive models for the growth of spoilage organisms in cheese.
Reprodução na juventude: perfis sociodemográficos, comportamentais e reprodutivos na PNDS 2006
Directory of Open Access Journals (Sweden)
Elza Berquó
2012-08-01
Full Text Available OBJETIVO: Analisar características sociodemográficas e do comportamento sexual e reprodutivo de mulheres jovens. MÉTODOS: Estudo populacional transversal com representatividade nacional sobre o comportamento sexual, contraceptivo e reprodutivo de 2.991 mulheres de 15 a 20 anos na Pesquisa Nacional de Demografia e Saúde da Criança e da Mulher 2006. As jovens foram classificadas em três grupos: iniciaram a vida sexual e engravidaram antes dos 20 anos (grupo A; iniciaram a vida sexual e não engravidaram antes dos 20 (grupo B e não iniciaram a vida sexual (grupo C. Mulheres de até 25 anos foram consideradas para o estudo das razões da gravidez e de suas implicações na vida. As análises estatísticas consideraram os pesos e o planejamento amostral complexo. A associação entre duas variáveis categóricas foi avaliada pelo teste tipo qui-quadrado. Quanto às comportamentais, utilizou-se modelo linear global. RESULTADOS: Mulheres do grupo A eram principalmente negras, mais pobres e com menor escolaridade. Tiveram a primeira relação sexual mais precocemente, comportamento contraceptivo mais desprotegido e menor conhecimento da fisiologia da reprodução em relação ao grupo B; as jovens do grupo C caracterizaram-se por maior frequência à escola e a preservação da virgindade para o casamento foi alegada por um 1/3 desse grupo. Para as mulheres com até 25 anos, a gravidez antes dos 20 foi percebida como tendo implicações mais positivas que negativas na vida amorosa, conjugal, social e autoestima. CONCLUSÕES: Há associação significativa entre gravidez antes dos 20 anos com maior pobreza e menor escolaridade. Na ausência de melhores condições de vida e de oportunidades, a gravidez, embora não prevista, configura-se como "projeto de vida" e não sua mera ausência.
International Nuclear Information System (INIS)
Kunitomo, T.; Shafey, H.M.
1980-01-01
The analysis has been carried out for the radiative heat transfer in the Na mist dispersion enclosed between the hot surface of liquid Na at temperature Tsub(n) and the cold surface of Na deposit at Tsub(c). The model selected for the present study represents the Na mist formed in a sodium cooled fast breeder reactor in which the condensed liquid particles are dispersed in the mixture of the Ar cover gas and the Na vapor. The analysis is based on replacing the inhomogeneous dispersing medium by three discrete homogeneous layers, and formulating the transfer equation for the monochromatic radiation in each layer according to the Chandrasekhar theory. The numerical calculations of the radiative qsub(r) and convective qsub(c) heat transfers have been performed for the wave length range lambda=1.6-30 μm and are compared. The qsub(r) has the same order of magnitude as the qsub(c) for all conditions of the mist dispersions. Both qsub(r) and qsub(c) increase by nearly equal rates with the increase of Tsub(H) and decrease by different rates with increasing Tsub(c). Variations of the particle diameter of the Na mist do not change substantially the qsub(r). Both qsub(r) and qsub(c) decrease slightly with the increase in the total thickness of the Na mist dispersion
Directory of Open Access Journals (Sweden)
Julieta Rodini Engrácia de Moraes
2000-01-01
Full Text Available Este estudo teve por escopo comparar a influência do nó de sutura em três diferentes localizações na recuperação morfofuncional do tendão flexor digital profundo (TFDP do cão. Foram utilizados 20 cães divididos em três grupos de oito, sete e cinco animais. Os TFDP do segundo e quinto dedos do membro torácico esquerdo foram seccionados e suturados pela técnica de Kessler modificada, alterando-se a localização do nó e o tipo de sutura no epitendíneo. No grupo um, o nó da sutura ficou localizado na região ventral do tendão e no grupo dois na face dorsal. Em ambos os grupos, o epitendão foi suturado com pontos simples separados. No grupo três, o nó da sutura ficou interno ao endotendíneo e o epitendíneo foi suturado com ponto simples contínuo. Após a cirurgia, foi realizada diariamente a movimentação passiva controlada do membro do primeiro ao 15º dia. No 7º e no 15º dia os animais foram sacrificados por anestesia profunda e os tendões foram colhidos para avaliação macroscópica do processo de reparo tendíneo. O critério de comparação utilizou como parâmetros para avaliar a recuperação morfofuncional a ruptura do tendão, o afastamento dos cotos e a coaptação completa dos cotos tendíneos. O grupo que apresentou melhor resultado com relação aos parâmetros avaliados foi o terceiro, com ausência de ruptura e índice de afastamento de apenas 2,5% dos cotos tendíneos. Os resultados encontrados permitem concluir que a localização do nó de sutura na tenorrafia do TFDP interfere na resposta reparadora e biomecânica.
Pressure effect on the Raman and photoluminescence spectra of Eu3+-doped Na2Ti6O13 nanorods
Zeng, Q. G.; Yang, G. T.; Chen, F.; Luo, J. Y.; Zhang, Z. M.; Leung, C. W.; Ding, Z. J.; Sheng, Y. Q.
2013-12-01
Eu3+-doped Na2Ti6O13 (Na2Ti6O13:Eu) nanorods with diameters of 30 nm and lengths 400 nm were synthesized by hydrothermal and heat treatment methods. Raman spectra at ambient conditions indicated a pure monoclinic phase (space group C2/m) of the nanorods. The relations between structural and optical properties of Na2Ti6O13:Eu nanorods under high pressures were obtained by photoluminescence and Raman spectra. Two structural transition points at 1.39 and 15.48 GPa were observed when the samples were pressurized. The first transition point was attributed to the crystalline structural distortion. The later transition point was the result of pressure-induced amorphization, and the high-density amorphous (HDA) phase formed after 15.48 GPa was structurally related to the monoclinic baddeleyite structured TiO2 (P21/c). However, the site symmetry of the local environment around the Eu3+ ions in Na2Ti6O13 increased with the rising pressure. These above results indicate the occurrence of short-range order for the local asymmetry around the Eu3+ ions and long-range disorder for the crystalline structure of Na2Ti6O13:Eu nanorods by applying pressure. After releasing the pressure from 22.74 GPa, the HDA phase is transformed to low-density amorphous form, which is attributed to be structurally related to the α-PbO2-type TiO2.
Improvement in reduced-mode (REM) diodes enable 315 W from 105-μm 0.15-NA fiber-coupled modules
Kanskar, M.; Bao, L.; Chen, Z.; Dawson, D.; DeVito, M.; Dong, W.; Grimshaw, M.; Guan, X.; Hemenway, M.; Martinsen, R.; Urbanek, W.; Zhang, S.
2018-02-01
High-power, high-brightness diode lasers have been pursued for many applications including fiber laser pumping, materials processing, solid-state laser pumping, and consumer electronics manufacturing. In particular, 915 nm - and 976 nm diodes are of interest as diode pumps for the kilowatt CW fiber lasers. As a result, there have been many technical thrusts for driving the diode lasers to have both high power and high brightness to achieve high-performance and reduced manufacturing costs. This paper presents our continued progress in the development of high brightness fiber-coupled product platform, nLIGHT element®. In the past decade, the power coupled into a single 105 μm and 0.15 NA fiber has increased by over a factor of ten through improved diode laser brightness and the development of techniques for efficiently coupling multiple emitters. In this paper, we demonstrate further brightness improvement and power-scaling enabled by both the rise in chip brightness/power and the increase in number of chips coupled into a given numerical aperture. We report a new chip technology using x-REM design with brightness as high as 4.3 W/mm-mrad at a BPP of 3 mm-mrad. We also report record 315 W output from a 2×12 nLIGHT element with 105 μm diameter fiber using x-REM diodes and these diodes will allow next generation of fiber-coupled product capable of 250W output power from 105 μm/0.15 NA beam at 915 nm.
Song, Hee Jo; Kim, Jae-Chan; Dar, Mushtaq Ahmad; Kim, Dong-Wan
2018-02-01
With the increasing demand for high energy density in energy-storage systems, a high-voltage cathode is essential in rechargeable Li-ion and Na-ion batteries. The operating voltage of a triclinic-polymorph Na2CoP2O7, also known as the rose form, is above 4.0 V (vs. Na/Na+), which is relatively high compared to that of other cathode materials. Thus, it can be employed as a potential high-voltage cathode material in Na-ion batteries. However, it is difficult to synthesize a pure rose phase because of its low phase stability, thus limiting its use in high-voltage applications. Herein, compositional-engineered, rose-phase Na2-2xCo1+xP2O7/C (x = 0, 0.1 and 0.2) nanopowder are prepared using a wet-chemical method. The Na2-2xCo1+xP2O7/C cathode shows high electrochemical reactivity with Na ions at 4.0 V, delivering high capacity and high energy density.
Thermal behaviour of the thermoluminescent dosemeter CaSO4: Dy + NaCl
International Nuclear Information System (INIS)
Antonio Filho, J.
1988-01-01
Thermoluminescent materials are widely applied in radiation dosimetry. Nevertheless to obtain a good degree of reliability, it is necessary to subject the materials to an adequate thermal treatment, before and after irradiation, conveniently controlling temperature, heating time and cooling rate. It has been observed that the TLD CaSO 4 : Dy + NaCl loses 10% of its sensivity after each utilization cycle with the thermal treatment usually recomended. This fact establishes a severe limitation in works requiring a good measurement precision. Several alternative procedures, which overcome this limitation, have been studied. Two of the procedures yielded excellent results, with a coefficient of variation of 1 to 1.3%. One of them consist of two heating cycles at 300 0 C during 15 and three hours respectively, before irradiation, followed by a heating cycle at 100 0 C during 15 minutes, after irradiation. In a second procedure the material is heated at 300 0 C during three hours, pre-irradiation, followed by a heating cycle at 100 0 C. during 15 minutes, after irradiation. In all cases the heating cycle are followed by fast cooling periods. (author) [pt
Potential impact of 1.5 °C and 2 °C global warming on consecutive dry and wet days over West Africa
Ama Browne Klutse, Nana; Ajayi, Vincent O.; Olabode Gbobaniyi, Emiola; Egbebiyi, Temitope S.; Kouadio, Kouakou; Nkrumah, Francis; Akumenyi Quagraine, Kwesi; Olusegun, Christiana; Diasso, Ulrich; Abiodun, Babatunde J.; Lawal, Kamoru; Nikulin, Grigory; Lennard, Christopher; Dosio, Alessandro
2018-05-01
We examine the impact of +1.5 °C and +2 °C global warming levels above pre-industrial levels on consecutive dry days (CDD) and consecutive wet days (CWD), two key indicators for extreme precipitation and seasonal drought. This is done using climate projections from a multi-model ensemble of 25 regional climate model (RCM) simulations. The RCMs take boundary conditions from ten global climate models (GCMs) under the RCP8.5 scenario. We define CDD as the maximum number of consecutive days with rainfall amount less than 1 mm and CWD as the maximum number of consecutive days with rainfall amount more than 1 mm. The differences in model representations of the change in CDD and CWD, at 1.5 °C and 2 °C global warming, and based on the control period 1971‑2000 are reported. The models agree on a noticeable response to both 1.5 °C and 2 °C warming for each index. Enhanced warming results in a reduction in mean rainfall across the region. More than 80% of ensemble members agree that CDD will increase over the Guinea Coast, in tandem with a projected decrease in CWD at both 1.5 °C and 2 °C global warming levels. These projected changes may influence already fragile ecosystems and agriculture in the region, both of which are strongly affected by mean rainfall and the length of wet and dry periods.
Energy Technology Data Exchange (ETDEWEB)
Tamura, M.; Lam, T.T.; Inagami, T.
1988-06-14
In order to identify a specific endogenous Na/sup +/,K/sup +/-ATPase inhibitor which could possibly be related to salt-dependent hypertension, the authors looked for substances in the methanol extract of bovine whole adrenal which show all of the following properties: (i) inhibitory activity for Na/sup +/,K/sup +/-ATPase; (ii) competitive displacing activity against (/sup 3/H)ouabain binding to the enzyme; (iii) inhibitory activity for /sup 86/Rb uptake into intact human erythrocytes; and (iv) cross-reactivity with sheep anti-digoxin-specific antibody. After stepwise fractionation of the methanol extract of bovine adrenal glands by chromatography on a C/sub 18/ open column, a 0-15% acetonitrile fraction was fractionated by high-performance liquid chromatography on a Zorbax octadecylsilane column. One of the most active fractions in 0-15% acetonitrile was found to exhibit all of the four types of the activities. It was soluble in water and was distinct from various substances which have been known to inhibit Na/sup +/,K/sup +/-ATPase. These results strongly suggest that this water-soluble nonpeptidic Na/sup +/,K/sup +/-ATPase inhibitor may be a specific endogenous regulator for the ATPase.
Dodrill, Michael W; Fedan, Jeffrey S
2010-10-01
Earlier, we found that systemic administration of lipopolysaccharide (LPS; 4 mg/kg) hyperpolarized the transepithelial potential difference (V(t)) of tracheal epithelium in the isolated, perfused trachea (IPT) of the guinea pig 18 h after injection. As well, LPS increased the hyperpolarization component of the response to basolateral methacholine, and potentiated the epithelium-derived relaxing factor-mediated relaxation responses to hyperosmolar solutions applied to the apical membrane. We hypothesized that LPS stimulates the transepithelial movement of Na(+) via the epithelial sodium channel (ENaC)/Na(+)-K(+) pump axis, leading to hyperpolarization of V(t). LPS increased the V(t)-depolarizing response to amiloride (10 μM), i.e., offset the effect of LPS, indicating that Na(+) transport activity was increased. The functional activity of ENaC was measured in the IPT after short-circuiting the Na(+)-K(+) pump with basolateral amphotericin B (7.5 μM). LPS had no effect on the hyperpolarization response to apical trypsin (100 U/ml) in the Ussing chamber, indicating that channel-activating proteases are not involved in the LPS-induced activation of ENaC. To assess Na(+)-K(+) pump activity in the IPT, ENaC was short-circuited with apical amphotericin B. The greater V(t) in the presence of amphotericin B in tracheas from LPS-treated animals compared with controls revealed that LPS increased Na(+)-K(+) pump activity. This finding was confirmed in the Ussing chamber by inhibiting the Na(+)-K(+) pump via extracellular K(+) removal, loading the epithelium with Na(+), and observing a greater hyperpolarization response to K(+) restoration. Together, the findings of this study reveal that LPS hyperpolarizes the airway epithelium by increasing the activities of ENaC and the Na(+)-K(+) pump.
Passivation kinetics of Mg-Nd-Gd-Zn-Zr (EV31A and Mg-Y-Nd-Gd-Zr (WE43C in NaOH solutions
Directory of Open Access Journals (Sweden)
Jakraphan Ninlachart
2017-09-01
Full Text Available Passivation kinetics of two Mg-RE alloys, such as Mg-Nd-Gd-Zn-Zr (EV31A, and Mg-Y-Nd-Gd-Zr (WE43C were investigated in two different heat treated conditions (solution treated and overaged in 0.01 - 1.0 M NaOH solutions under potentiostatic conditions. Negative reaction order was observed in dilute NaOH which transitioned to positive values as the passivation time increased and in the 1 M NaOH as well. The passive layers showed platelet morphology and the size of the platelets decreased with increase in the NaOH concentration. The hydrogen evolution reaction (HER kinetics was not improved on the passive layer covered surface of the Mg-RE alloys in contrast to the improvements reported on the hydroxide covered pure magnesium. The electrochemical impedance increased with increase in the NaOH concentration in the solution treated condition of both Mg-RE alloys, whereas the overaged EV31A alloy showed a reverse trend. The passive layer of EV31A showed almost 100% higher charge carrier density than the film formed on the WE43C in the overaged condition. A better passivation behavior was observed in the solution treated condition than that in the overaged condition which could be attributed to the uniform distribution of the RE elements in the solution treated specimens. The WE43C alloy revealed better corrosion resistance in the alkaline solution than the EV31A alloy.
Klein, Amanda H; Vyshnevska, Alina; Hartke, Timothy V; De Col, Roberto; Mankowski, Joseph L; Turnquist, Brian; Bosmans, Frank; Reeh, Peter W; Schmelz, Martin; Carr, Richard W; Ringkamp, Matthias
2017-05-17
Voltage-gated sodium (Na V ) channels are responsible for the initiation and conduction of action potentials within primary afferents. The nine Na V channel isoforms recognized in mammals are often functionally divided into tetrodotoxin (TTX)-sensitive (TTX-s) channels (Na V 1.1-Na V 1.4, Na V 1.6-Na V 1.7) that are blocked by nanomolar concentrations and TTX-resistant (TTX-r) channels (Na V 1.8 and Na V 1.9) inhibited by millimolar concentrations, with Na V 1.5 having an intermediate toxin sensitivity. For small-diameter primary afferent neurons, it is unclear to what extent different Na V channel isoforms are distributed along the peripheral and central branches of their bifurcated axons. To determine the relative contribution of TTX-s and TTX-r channels to action potential conduction in different axonal compartments, we investigated the effects of TTX on C-fiber-mediated compound action potentials (C-CAPs) of proximal and distal peripheral nerve segments and dorsal roots from mice and pigtail monkeys ( Macaca nemestrina ). In the dorsal roots and proximal peripheral nerves of mice and nonhuman primates, TTX reduced the C-CAP amplitude to 16% of the baseline. In contrast, >30% of the C-CAP was resistant to TTX in distal peripheral branches of monkeys and WT and Na V 1.9 -/- mice. In nerves from Na V 1.8 -/- mice, TTX-r C-CAPs could not be detected. These data indicate that Na V 1.8 is the primary isoform underlying TTX-r conduction in distal axons of somatosensory C-fibers. Furthermore, there is a differential spatial distribution of Na V 1.8 within C-fiber axons, being functionally more prominent in the most distal axons and terminal regions. The enrichment of Na V 1.8 in distal axons may provide a useful target in the treatment of pain of peripheral origin. SIGNIFICANCE STATEMENT It is unclear whether individual sodium channel isoforms exert differential roles in action potential conduction along the axonal membrane of nociceptive, unmyelinated peripheral nerve
Energy Technology Data Exchange (ETDEWEB)
Reckeweg, Olaf; DiSalvo, Francis J. [Cornell Univ., Ithaca, NY (United States). Baker Lab.; Schulz, Armin [Max-Planck-Institut fuer Festkoerperforschung, Stuttgart (Germany)
2016-07-01
Transparent colorless crystals of NaA{sub 5}[C{sub 6}N{sub 9}]{sub 2} . 4 H{sub 2}O (A = Rb, Cs) were obtained by blending aqueous solutions of Na{sub 3}[C{sub 6}N{sub 9}] and RbF or CsF, respectively, and subsequent evaporation of the water under ambient conditions. Both compounds crystallize in the space group P2{sub 1}/m (no. 11) with the cell parameters a = 815.56(16), b = 1637.7(4) and c = 1036.4(3) pm, and β = 110.738(12) for NaRb{sub 5}[C{sub 6}N{sub 9}]{sub 2} . 4 H{sub 2}O and a = 843.32(6), b = 1708.47(11) and c = 1052.42(7) pm, and β = 112.034(2) for NaCs{sub 5}[C{sub 6}N{sub 9}]{sub 2} . 4 H{sub 2}O, respectively. Raman spectra of the title compounds complement our results.
Metabolite analysis of [11C]Ro15-4513 in mice, rats, monkeys and humans
International Nuclear Information System (INIS)
Kida, T.; Noguchi, J.; Zhang, M.-R.; Suhara, T.; Suzuki, K.
2003-01-01
We performed in vitro and in vivo assays of the metabolism of [ 11 C]Ro15-4513 over time in the plasma of mice, rats, monkeys and humans, using a radio-HPLC equipped with a sensitive positron detector, in order to compare the metabolic rates of the radiopharmaceutical agent among the different animal species and to establish a highly sensitive analytical method for the radiotracer agent. We also examined the metabolism of [ 11 C]Ro15-4513 in the brain tissue of mice and rats. The analytical method used in this study permitted detection of even extremely low levels of radioactivity (approximately 5,000 dpm). In vitro experiments revealed that [ 11 C]Ro15-4513 in the blood was metabolized to hydrolysate [ 11 C]A. The species were classified in descending order of the metabolic rate of the radiotracer in vitro as follows; mice, rats, and monkeys/humans. In the in vitro experiment, the percentage of the unchanged drug in the plasma at 60 minutes postdose was 9% in mice, 70% in rats, 97% in monkeys, and 98% in humans. In vivo metabolite analysis in the blood showed the presence of two radioactive metabolites, consisting of one hydrolysate [ 11 C]A and another unidentified substance. The species were classified in descending order of the metabolic rate of the radiotracer in vivo as follows; mice, rats/humans, and monkeys. The percentage of the unchanged drug in the plasma was 6% in mice, 21% in rats, 26% in humans, and 40% in monkeys. Furthermore, the in vitro and in vivo experiments conducted to analyze the metabolism of [ 11 C]Ro15-4513 in the brain tissue of mice and rats revealed that the radiotracer was metabolized to some extent in the brain tissue of these animals. In the in vivo experiment, the percentage of the unchanged drug at 60 min postdose was 86% in the brain tissue of mice and 88% in the brain tissue of rats, while in the in vitro experiment, the corresponding percentage was 93% in mice, and 91% in rats
Hatou, Shin; Yamada, Masakazu; Mochizuki, Hiroshi; Nishida, Teruo
2009-05-01
Na+- and K+-dependent ATPase (Na,K-ATPase) plays an important role in the pump function of the corneal endothelium. We investigated the possible role of protein kinase C (PKC) in regulation of Na,K-ATPase activity and pump function in corneal endothelial cells. Confluent monolayers of mouse corneal endothelial cells were exposed to phorbol 12,13-dibutyrate (PDBu) to induce activation of PKC. ATPase activity of the cells was evaluated by using ammonium molybdate in spectrophotometric measurement of phosphate released from ATP, with Na,K-ATPase activity being defined as the portion of total ATPase activity sensitive to ouabain. Pump function of the cells was measured with a Ussing chamber, with the pump function attributable to Na,K-ATPase activity being defined as the portion of the total short-circuit current sensitive to ouabain. PDBu (10(-7) M) increased the Na,K-ATPase activity and pump function of the cultured cells. These effects of PDBu were potentiated by the cyclooxygenase inhibitor indomethacin and the cytochrome P(450) inhibitor resorufin and were blocked by okadaic acid, an inhibitor of protein phosphatases 1 and 2A. Our results suggest that PKC bidirectionally regulates Na,K-ATPase activity in mouse corneal endothelial cells: it inhibits Na,K-ATPase activity in a cyclooxygenase- and cytochrome P(450)-dependent manner, whereas it stimulates such activity by activating protein phosphatases 1 or 2A.
Highly conductive porous Na-embedded carbon nanowalls for high-performance capacitive deionization
Chang, Liang; Hu, Yun Hang
2018-05-01
Highly conductive porous Na-embedded carbon nanowalls (Na@C), which were recently invented, have exhibited excellent performance for dye-sensitized solar cells and electric double-layer capacitors. In this work, Na@C was demonstrated as an excellent electrode material for capacitive deionization (CDI). In a three-electrode configuration system, the specific capacity of the Na@C electrodes can achieve 306.4 F/g at current density of 0.2 A/g in 1 M NaCl, which is higher than that (235.2 F/g) of activated carbon (AC) electrodes. Furthermore, a high electrosorption capacity of 8.75 mg g-1 in 100 mg/L NaCl was obtained with the Na@C electrodes in a batch-mode capacitive deionization cell. It exceeds the electrosorption capacity (4.08 mg g-1) of AC electrodes. The Na@C electrode also showed a promising cycle stability. The excellent performance of Na@C electrode for capacitive deionization (CDI) can be attributed to its high electrical conductivity and large accessible surface area.
Mérawa, M.; Dargelos, A.
1998-07-01
The present paper gives an account of investigations of the polarizability of the alkali atoms Li, Na, diatomics homonuclear and heteronuclear Li2, Na2 and NaLi at SCF (Self Consistent Field) level of approximation and at correlated level, using a time Time-Dependent Gauge Invariant method (TDGI). Our static polarizability values agree with the best experimental and theoretical determinations. The Van der Waals C6 coefficients for the atom-atom, atom-dimer and dimer-dimer interactions have been evaluated. Les polarisabilités des atomes alcalins Li, Na, et des molécules diatomiques homonucléaires et hétéronucléaire Li2, Na2 et NaLi, ont été calculées au niveau SCF (Self Consistent Field) et au niveau corrélé à partir d'une méthode invariante de jauge dépendante du temps(TDGI). Nos valeurs des polarisabilités statiques sont en accord avec les meilleurs déterminations expérimentales et théoriques. Les coefficients C6 de Van de Waals pour les interactions atome-atome, atome-dimère et dimère-dimère ont également été évalués.
Effects of Na/K-ATPase and its ligands on bone marrow stromal cell differentiation
Directory of Open Access Journals (Sweden)
Moustafa Sayed
2014-07-01
Full Text Available Endogenous ligands of Na/K-ATPase have been demonstrated to increase in kidney dysfunction and heart failure. It is also reported that Na/K-ATPase signaling function effects stem cell differentiation. This study evaluated whether Na/K-ATPase activation through its ligands and associated signaling functions affect bone marrow stromal cells (BMSCs, also known as bone marrow-derived mesenchymal stem cells differentiation capacity. BMSCs were isolated from male Sprague–Dawley rats and cultured in minimal essential medium alpha (MEM-α supplemented with 15% Fetal Bovine serum (FBS. The results showed that marinobufagenin (MBG, a specific Na/K-ATPase ligand, potentiated rosiglitazone-induced adipogenesis in these BMSCs. Meanwhile, it attenuated BMSC osteogenesis. Mechanistically, MBG increased CCAAT/enhancer binding protein alpha (C/EBPα protein expression through activation of an extracellular regulated kinase (ERK signaling pathway, which leads to enhanced rosiglitazone-induced adipogenesis. Inhibition of ERK activation by U0126 blocks the effect of MBG on C/EBPα expression and on rosiglitazone-induced adipogenesis. Reciprocally, MBG reduced runt-related transcription factor 2 (RunX2 expression, which resulted in the inhibition of osteogenesis induced by β-glycerophosphate/ascorbic acid. MBG also potentiated rosiglitazone-induced adipogenesis in 3T3-L1 cells and in mouse BMSCs. These results suggest that Na/K-ATPase and its signaling functions are involved in the regulation of BMSCs differentiation.
Species specific and environment induced variation of δ13C and δ15N in alpine plants
Directory of Open Access Journals (Sweden)
Yang eYang
2015-06-01
Full Text Available Stable carbon and nitrogen isotope signals in plant tissues integrate plant-environment interactions over long periods. In this study, we hypothesized that humid alpine life conditions are narrowing the scope for significant deviations from common carbon, water and nitrogen relations as captured by stable isotope signals. We explored the variation in δ13C and δ15N in 32 plant species from tissue type to ecosystem scale across a suite of locations at c. 2500 m elevation in the Swiss Alps. Foliar δ13C and δ15N varied among species by about 3-4 ‰ and 7-8 ‰ respectively. However, there was no overall difference in means of δ13C and δ15N for species sampled in different plant communities or when bulk plant dry matter harvests of different plant communities were compared. δ13C was found to be highly species specific, so that the ranking among species was mostly maintained across 11 habitats. However, δ15N varied significantly from place to place in all species (a range of 2.7 ‰ except in Fabaceae (Trifolium alpinum and Juncaceae (Luzula lutea. There was also a substantial variation among individuals of the same species collected next to each other. No difference was found in foliar δ15N of non-legumes, which were either collected next to or away from the most common legume, T. alpinum. δ15N data place Cyperaceae and Juncaceae, just like Fabaceae, in a low discrimination category, well separated from other families. Soil δ15N was higher than in plants and increased with soil depth. The results indicate a high functional diversity in alpine plants that is similar to that reported for low elevation plants. We conclude that the surprisingly high variation in δ13C and δ15N signals in the studied high elevation plants is largely species specific (genetic and insensitive to obvious environmental cues.
Bindal, Shruti; Gupta, Rani
2017-02-07
Microbial γ-glutamyl transpeptidases (GGTs) have been exploited in biotechnological, pharmaceutical, and food sectors for the synthesis of various γ-glutamyl compounds. But, till date, no bacterial GGTs are commercially available in the market because of lower levels of production from various sources. In the current study, production of GGT from Bacillus licheniformis ER15 was investigated to achieve high GGT titers. Hyperproduction of GGT from B. licheniformis ER15 was achieved with 6.4-fold enhancement (7921.2 ± 198.7 U/L) by optimization of culture medium following one-variable-at-a-time strategy and statistical approaches. Medium consisting of Na 2 HPO 4 : 0.32% (w/v); KH 2 PO 4 : 0.15% (w/v); starch: 0.1% (w/v); soybean meal: 0.5% (w/v); NaCl: 4.0% (w/v), and MgCl 2 : 5 mM was found to be optimal for maximum GGT titers. Maximum GGT titers were obtained, in the optimized medium at 37°C and 200 rpm, after 40 h. It was noteworthy that GGT production was a linear function of sodium chloride concentration, as observed during response surface methodology. While investigating the role of NaCl on GGT production, it was found that NaCl drastically decreased subtilisin concentration and indirectly increasing GGT recovery. B. licheniformis ER15 is proved to be a potential candidate for large-scale production of GGT enzyme and its commercialization.
Alterations in in-vivo benzodiazepine-receptor binding of C-11-Ro15-1788 (flumazepil)
International Nuclear Information System (INIS)
Yamasaki, T.; Inoue, O.; Shinoto, H.; Ito, T.; Hashimoto, K.; Suzuki, K.; Tateno, Y.
1985-01-01
Alterations of the central benzodiazepine - receptor function caused by the change of physiological or psychological conditions, were recognized in both animal and human studies. Before the human study, animal experiments using tritiated Ro15-1788 were carried out. The stress was produced by forcing the mice to swim in a water-basin at 16 0 C for 5 min. Within 3 min after the forced swimming, the tracer was injected. Brain radioactivities in stress-loaded mice increased over a period of 15 min after the intra-venous injection of tracers, while brain activities of carrier-added tracer decreased. In human study, approximately 5 mCi of C-11-Ro15-1788, which specific activity is 0.3-1.0 Ci/μmol, were intravenously injected to each case. Measurements of the brain activity were performed using positron-CT, with blood sample collection. 31 human studies were performed on. Cerebral cortex time activity curves in several volunteers in nervous and stressful state, showed the same pattern to that in the stress-loaded animal experiment. It is important that the significant different time course of cerebral activity after the injection of labelled Ro15-1788, was observed in stressful state, compared with control, in both human and animal study. From these results, it will be concluded the positron CT study using /sup 11/C-Ro15-1788 will become a new technic to detect the change of psychological conditions in human brain and to diagnose some kind of neuropsychiatric disease
Yaragatupalli, Siddhartha; Olivera, J Fernando; Gatto, Craig; Artigas, Pablo
2009-09-08
The Na/K pump actively exports 3 Na(+) in exchange for 2 K(+) across the plasmalemma of animal cells. As in other P-type ATPases, pump function is more effective when the relative affinity for transported ions is altered as the ion binding sites alternate between opposite sides of the membrane. Deletion of the five C-terminal residues from the alpha-subunit diminishes internal Na(+) (Na(i)(+)) affinity approximately 25-fold [Morth et al. (2007) Nature 450:1043-1049]. Because external Na(+) (Na(o)(+)) binding is voltage-dependent, we studied the reactions involving this process by using two-electrode and inside-out patch voltage clamp in normal and truncated (DeltaKESYY) Xenopus-alpha1 pumps expressed in oocytes. We observed that DeltaKESYY (i) decreased both Na(o)(+) and Na(i)(+) apparent affinities in the absence of K(o)(+), and (ii) did not affect apparent Na(o)(+) affinity at high K(o)(+). These results support a model of strict sequential external release of Na(+) ions, where the Na(+)-exclusive site releases Na(+) before the sites shared with K(+) and the DeltaKESYY deletion only reduces Na(o)(+) affinity at the shared sites. Moreover, at nonsaturating K(o)(+), DeltaKESYY induced an inward flow of Na(+) through Na/K pumps at negative potentials. Guanidinium(+) can also permeate truncated pumps, whereas N-methyl-D-glucamine cannot. Because guanidinium(o)(+) can also traverse normal Na/K pumps in the absence of both Na(o)(+) and K(o)(+) and can also inhibit Na/K pump currents in a Na(+)-like voltage-dependent manner, we conclude that the normal pathway transited by the first externally released Na(+) is large enough to accommodate guanidinium(+).
π-p→ωn reaction at momenta from 15 to 40 GeV/c
International Nuclear Information System (INIS)
Apel, W.D.; Augenstein, K.H.; Bertolucci, E.; Vincelli, M.L.; Donskov, S.V.; Inyakin, A.; Kachanov, V.A.; Quaglia, M.; Krasnokutsky, R.N.; Krueger, M.; Leder, G.; Lednev, A.A.; Mannelli, I.; Mikhailov, Y.V.; Mueller, H.; Prokoshkin, Y.D.; Pierazzini, G.M.; Sergiampietri, F.; Sigurdsson, G.; Scribano, A.; Schneider, H.; Shuvalov, R.S.
1980-01-01
Cross sections for the reaction π - p→ωn, ω→π 0 γ have been measured with good statistics at incident-pion momenta of 15, 20, 25, 30, and 40 GeV/c. The experiments were performed at the 70-GeV IHEP accelerator, using the NICE 648-channel hodoscopic spectrometer. The density matrix elements and the differential and integrated cross sections for the reaction have been determined. The unnatural-parity exchange contribution to the production of ω mesons in the state with helicity 1 is already insignificant at 15 GeV/c. With increasing Vertical BartVertical Bar the differential cross sections pass through a maximum at Vertical BartVertical Barapprox. =0.12 (GeV/c) 2 and then fall exponentially until Vertical BartVertical Barapprox. =0.7 (GeV/c) 2 ; at that point the curve bends sharply, the cross section falling off much less rapidly for larger values of Vertical BartVertical Bar
Indirect measurement of the 15N(p,α)12C reaction cross section through the THM
International Nuclear Information System (INIS)
Romano, S.; La Cognata, M.; Spitaleri, C.; Cherubini, S.; Gulino, M.; Lamia, L.; Musumarra, A.; Tribble, R.; Trache, C.L.; Fu, C.
2005-01-01
Among the reactions of the stellar CNO cycle, the 15 N(p,α) 12 C plays a crucial role. In particular its reaction rate is important for understanding the CNOI escape towards CNOII. Thus it is important to study its bare nucleus cross section at the energies typical of such astrophysical environments, i.e. few tens of keV. At these energies such a measurement is hard to perform in a direct way because of the electron screening effect as pointed out for several cases. A possibility is then given by indirect methods and in particular the Trojan Horse Method (THM) has been applied in this case. The preliminary validity test for the study of 15 N(p,α) 12 C via the 15 N(d,α 12 C)n three body reaction is reported in this work. A 15 N beam was provided by the cyclotron at Texas A and M University with energy 60 MeV/c and delivered onto a CD 2 target. A ΔE/E telescope (PSD + ionization chamber) and a pair of PSD's were mounted in a coplanar geometry. Coincidences between the detectors were considered and the 15 N-p quasi-free contribution to the overall three-body cross-section was selected. Data analysis and preliminary results will be discussed and compared with direct data. (author)
Directory of Open Access Journals (Sweden)
Angela Gordo
2007-06-01
Full Text Available Em perdas auditivas de grau moderado a severo nas freqüências altas, a lesão coclear pode estar relacionada a "zonas mortas", regiões onde as células ciliadas internas e/ou neurônios adjacentes não são funcionais. OBJETIVO: Avaliar o reconhecimento de fala em pacientes com e sem zonas mortas na cóclea em freqüências altas. MATERIAL e MÉTODO: Estudo clínico e experimental de 30 indivíduos adultos, distribuídos em dois grupos: grupo 1 - 15 indivíduos sem zonas mortas, e grupo 2 - 15 com zonas mortas na cóclea. Os pacientes foram submetidos à pesquisa do índice de reconhecimento de fala, limiar de reconhecimento de sentenças, sem e com ruído competitivo. Os testes de fala foram realizados sem prótese, com próteses auditivas amplificando a faixa de freqüências de 100 a 8000 Hz (programa 1 e com amplificação restrita, 100 a 2560 Hz (programa 2. RESULTADOS: O grupo 1 apresentou melhor desempenho utilizando as próteses auditivas no programa 1. Já o grupo 2 obteve melhor desempenho com o programa 2. CONCLUSÕES: Pacientes sem zonas mortas na cóclea obtêm maior benefício com a amplificação em freqüências altas. Na presença de zonas mortas em freqüências altas, o melhor desempenho é obtido com a amplificação restrita nestas freqüências.In patients with moderate to severe high-frequency hearing loss, cochlear damage may include "dead regions" where there are no functional inner hair cells and/or associated neurons. AIM: This study examines speech recognition in sensorineural impaired hearing patients with and without cochlear dead regions at high frequencies. METHODS: a clinical and experimental study was made of thirty patients with sensorineural hearing loss that were classified into two groups: group 1 - included 15 subjects with hearing loss and no dead regions; and group 2 - included 15 subjects with dead regions in the cochlea at high frequencies. Patients undertook word recognition score and speech
Directory of Open Access Journals (Sweden)
Rodrigo Mannarino
2014-02-01
Full Text Available Os efeitos hemodinâmicos da anestesia total intravenosa com propofol ou propofol associado à lidocaína foram estudados em 12 cães. No grupo P (n=6, os animais receberam bolus de 6mg kg-1 de propofol e infusão contínua de 1,25mg kg-1 min-1. No grupo PL (n=6, os animais receberam bolus de 6mg kg-1 de propofol e 1,5mg kg-1 de lidocaína, seguido de infusão de 1,0mg kg-1 min-1 e 0,25mg kg-1 min-1, dos mesmos fármacos, respectivamente. Os animais foram instrumentados para mensuração das variáveis hemodinâmicas e do índice bispectral (BIS, aos 75, 90, 105 e 120 minutos de anestesia. Foram observados valores menores de índice cardíaco, índice sistólico, pressões arteriais sistólica, diastólica e média no grupo P do que no grupo PL (P<0,05. Não foram observadas diferenças entre os grupos na frequência cardíaca, índice de resistência vascular sistêmica e BIS. As concentrações plasmáticas de propofol foram menores no grupo PL do que no grupo P (medianas de 5,7 a 6,1µg mL-1 no grupo P versus 3,1 a 3,7µg mL-1 no grupo PL. As concentrações plasmáticas de lidocaína (medianas de 2,27 a 2,51µg mL-1 mensuradas encontram-se na faixa que resulta em analgesia e abaixo de valores que resultam em toxicidade em cães. Os valores de BIS obtidos nos dois grupos foram compatíveis com plano profundo de anestesia (médias de 43 a 46 e 45 a 49 nos grupos P e PL, respectivamente. A manutenção da anestesia em plano profundo com lidocaína-propofol causa menor depressão cardiovascular do que a anestesia com dose equipotente de propofol isoladamente.
The Injection of Sodium into Liquid Stainless Steel: A Report of the Second Experimental Na - SS/1
International Nuclear Information System (INIS)
Abbey, M.J.; Asher, R.C.; Bradshaw, L.; Davies, D.; Sangwinw, S.J.
1976-01-01
A second experiment in which liquid sodium was injected beneath the surface of molten steel has been carried out using an experimental technique based on that described in AERE - M 2770 but incorporating several improvements particularly in the instrumentation. The sodium (∼1.5 g) was at 400-450 deg. C and the steel (stainless steel in this instance) was at 1750-1800 deg. C. A vapour explosion occurred after a measured dwell time and two force pulses >100 N and 60 N, separated by an interval of ∼1 ms were transmitted to the base of the crucible containing the molten steel. Most of the sodium vapourised' but only a minor part of the steel was converted into small particles. In conclusion: A vapour explosion occurred when ∼1.5 g of sodium at 400-450 deg. C was injected 1.5 cm beneath the surface of molten stainless steel at 1750-1800 deg. C. The explosion occurred 100 N and the second one ∼60 N compared with one pulse of ∼600 N measured in Na/CS/1. Both pulses had a base width of ∼1 ms and the second one a pulse width of ∼500 μs. There was no indication of the prolonged series of pulses observed in Na-CS/1 and which may have been a feature of the equipment used. Virtually all the sodium was vaporised whereas in the previous experiment much of the sodium was recovered as droplets. The steel temperature was > 200 deg. C higher. The steel was on the whole not so finely dispersed; only ∼2% was less than ∼0.5 mm diameter compared with ∼10% in Na-CS/1. Future experiments of this type could be further instrumented; in particular it would be desirable to measure the exact injection rate for each sodium injection and to measure pressure pulses at other points of the equipment
Energy Technology Data Exchange (ETDEWEB)
Luo, D.; Yi, P.; Liu, J.; Chen, A. [Xiangtan Polytechnic University, Xiangtan (China). Dept. of Chemical Enginering
2001-12-01
Catalytic oxidation method for the treatment of distilled ammonia waste water from coke plant was investigated using activated carbon as catalyst and NaClO as oxidant. The influences of main factors, such as NaClO, activated carbon, pH and reactionary time were discussed. The results showed that under the conditions of 25{degree}C, NaClO/CODO=1.5, carbon/NaClO=0.6 and pH=3.0, the reaction completed within 120 minutes with 99.5% of phenol removal and 75.8% of COD removal when the distilled ammonia waste water from coke plant which containing phenol 510 mg/L and CODO 8420 mg/L was treated. 13 refs., 4 figs.
Li, Donghuan; Zhou, Tianjun; Zou, Liwei; Zhang, Wenxia; Zhang, Lixia
2018-02-01
Extreme high-temperature events have large socioeconomic and human health impacts. East Asia (EA) is a populous region, and it is crucial to assess the changes in extreme high-temperature events in this region under different climate change scenarios. The Community Earth System Model low-warming experiment data were applied to investigate the changes in the mean and extreme high temperatures in EA under 1.5°C and 2°C warming conditions above preindustrial levels. The results show that the magnitude of warming in EA is approximately 0.2°C higher than the global mean. Most populous subregions, including eastern China, the Korean Peninsula, and Japan, will see more intense, more frequent, and longer-lasting extreme temperature events under 1.5°C and 2°C warming. The 0.5°C lower warming will help avoid 35%-46% of the increases in extreme high-temperature events in terms of intensity, frequency, and duration in EA with maximal avoidance values (37%-49%) occurring in Mongolia. Thus, it is beneficial for EA to limit the warming target to 1.5°C rather than 2°C.
Directory of Open Access Journals (Sweden)
Ronaldo Ferreira do Nascimento
2003-08-01
Full Text Available Neste trabalho foi estudado o efeito do processo de tratamento térmico na qualidade e composição química da bebida cajuína quando submetida ao cozimento sob temperatura constante de 100ºC durante 1:00, 1:30, 2:00, 2:30, 3:00 e 4:00 horas. Alíquotas foram coletadas em cada tempo de aquecimento e analisadas por cromatografia líquida de alta eficiência (CLAE em relação aos ácidos (cítrico e ascórbico, aldeídos furânicos (5-hidroximetilfurfural e furfural e açúcares (frutose, glicose e frutose. Os resultados foram reprodutíveis e indicaram que as cajuínas comerciais do estado do Ceará apresentam uma grande diversidade quanto ao processo de cozimento e ao teor de vitamina C, causados principalmente por processos térmicos inadequados. O tempo mais adequado sugerido para o "cozimento" da cajuína está em torno de 2:00h. O trabalho também aponta a combinação das análises de 5-HMF, furfural, ácido ascórbico e teor de ácido ascórbico/ácido cítrico como uma metodologia alternativa para a avaliação da qualidade da cajuína.In this work the effect of the thermal process on the quality and chemical composition of the beverage cajuína was studied. Cajuína is basically clarified cashew juice. Samples of cajuína were submitted to thermal processes, of constant heating (100ºC for 1:00, 1:30, 2:00, 2:30, 3:00 and 4:00 hours. The samples were subsequently analyzed by HPLC for glucose, fructose, citric acid, ascorbic acid, hydroxymethylfurfural (5-HMF and furfural. The results showed that the commercial cajuína beverage of Ceará State presented a great diversity in process standardization and vitamin C content, caused by inadequate thermal processing. The process is more efficient with a time period of 2:00hs. The work also indicates a combination of the analyses of 5-HMF, furfural and ascorbic acid and the ratio ascorbic acid/citric acid, as an alternative methodology for the evaluation of cajuína quality.
International Nuclear Information System (INIS)
Popelis, Yu.Yu.; Liepin'sh, E.E.; Lukevits, E.Ya.
1986-01-01
The 1 H, 13 C, and 15 N NMR spectra of 15 N-enriched 5-substituted furfural oximes were investigated. It was shown that the chemical shifts of the ring atoms and the oxime group correlate satisfactorily with the F and R substituent constants, whereas their sensitivity to the effect of the substituents is lower than in monosubstituted furan derivatives. The constants of spin-spin coupling between the ring protons and the oxime group were determined. An analysis of the 1 H- 1 H spin-spin coupling constants (SSCC) on the basis of their stereospecificity indicates that the E isomers have primarily an s-trans conformation in polar dimethyl sulfoxide, whereas the Z isomers, on the other hand, have an s-cis conformation. The signs of the direct and geminal 13 C- 15 N SSCC were determined for 5-trimethylsilylfurfural oxime
Epitaxial growth and control of the sodium content in Na{sub x}CoO{sub 2} thin films
Energy Technology Data Exchange (ETDEWEB)
Hildebrandt, Sandra; Komissinskiy, Philipp [Institute for Materials Science, Technische Universität Darmstadt, 64287 Darmstadt (Germany); Major, Marton [Institute for Materials Science, Technische Universität Darmstadt, 64287 Darmstadt (Germany); WIGNER RCP, RMKI, H-1525 Budapest, P.O.B. 49 (Hungary); Donner, Wolfgang [Institute for Materials Science, Technische Universität Darmstadt, 64287 Darmstadt (Germany); Alff, Lambert, E-mail: alff@oxide.tu-darmstadt.de [Institute for Materials Science, Technische Universität Darmstadt, 64287 Darmstadt (Germany)
2013-10-31
Single-phase c-axis oriented Na{sub x}CoO{sub 2} thin films were grown on (001) SrTiO{sub 3} single-crystal substrates, using pulsed laser deposition. X-ray diffraction analysis indicates the epitaxial growth of Na{sub x}CoO{sub 2} thin films in two domains, rotated in-plane by 15 and 45 degrees relative to [100] SrTiO{sub 3}. The sodium stoichiometry x of the films can be controlled in a range of 0.38 < x < 0.84 by in-situ post-deposition annealing the Na{sub x}CoO{sub 2} films at 720 – 760 °C in oxygen for 10 – 30 min. γ - Na{sub x}CoO{sub 2} films are obtained with a full width at half maximum of the (002) Na{sub x}CoO{sub 2} rocking curve below 0.2 degrees. The post-deposition annealing can substitute commonly used chemical deintercalation of Na which is typically associated with a loss in crystallinity. - Highlights: • Single phase Na{sub x}CoO{sub 2} thin films grown by pulsed laser deposition • Epitaxial relations of Na{sub x}CoO{sub 2} thin films on (001) SrTiO{sub 3} substrates • Multi-domain thin films • Control of sodium content by in-situ annealing of Na{sub x}CoO{sub 2} thin films.
International Nuclear Information System (INIS)
Cao, Hong-yu; Zhou, Huan; Bai, Xiao-qin; Ma, Ruo-xin; Tan, Li-na; Wang, Jun-min
2016-01-01
Graphical abstract: Solubility diagram of the (Ca(H 2 PO 2 ) 2 + NaH 2 PO 2 + H 2 O) system at T = (323.15 and 298.15) K. - Highlights: • Phase diagrams of Ca 2+ -H 2 PO 2 − -Cl − -H 2 O, Ca 2+ -Na + -H 2 PO 2 − -H 2 O at 323.15 K were obtained. • Incompatible double salt of NaCa(H 2 PO 2 ) 3 in Ca 2+ -Na + -H 2 PO 2 − -H 2 O system was determined. • Density diagram of the corresponding liquid were simultaneously measured. - Abstract: Calcium hypophosphite has been widely used as an anti-corrosive agent, flame retardant, fertilizer, assistant for Ni electroless plating, and animal nutritional supplement. High purity calcium hypophosphite can be synthesized via the replacement reaction of sodium hypophosphite and calcium chloride. In this work, the (solid + liquid) phase equilibria of (Ca(H 2 PO 2 ) 2 + CaCl 2 + H 2 O) and (Ca(H 2 PO 2 ) 2 + NaH 2 PO 2 + H 2 O) ternary systems at T = 323.15 K were studied experimentally via the classical isothermal solubility equilibrium method, and the phase diagrams for these two systems were obtained. It was found that two solid salts of CaCl 2 ·2H 2 O and Ca(H 2 PO 2 ) 2 exist in the (Ca(H 2 PO 2 ) 2 + CaCl 2 + H 2 O) system, and three salts of Ca(H 2 PO 2 ) 2 , NaH 2 PO 2 ·H 2 O and one incompatible double salt, NaCa(H 2 PO 2 ) 3 occur in the (Ca(H 2 PO 2 ) 2 + NaH 2 PO 2 + H 2 O) system.
Pirão, Tânia Sofia Quitério
2018-01-01
Os parasitas intestinais podem ser agentes zoonóticos, pelo qual deve-se apostar na prevenção utilizando antiparasitários cujos princípios ativos sejam eficazes e adequados a cada tipo de infeção parasitária e o tratamento estabelecido de acordo com protocolos baseados em diagnósticos clínicos, laboratoriais ou consoante o grau de risco de cada animal. O presente trabalho teve como objetivo avaliar a prevalência de parasitas intestinais em cães na cidade de Amora considerando alguns fatore...
Directory of Open Access Journals (Sweden)
Edno Magalhães
2004-04-01
Full Text Available OBJETIVO: A bupivacaína racêmica, utilizada largamente em anestesia peribulbar devido à boa qualidade de bloqueio motor, apresenta menor margem de segurança para cardiotoxicidade em relação a ropivacaína e bupivacaína levógira. O objetivo deste estudo foi comparar o grau de bloqueio motor e alteração da pressão intra-ocular (PIO em anestesia peribulbar produzida pela bupivacaína racêmica, levobupivacaína e ropivacaína. MÉTODOS: Noventa e sete pacientes, estado físico I e II da classificação da Sociedade Americana de Anestesiologistas, submetidos a anestesia peribulbar, foram divididos em três grupos: grupo A-(n=16 bupivacaína racêmica 0,75% com adrenalina 1:200.000; grupo B -(n=16 bupivacaína levógira 0,75% com adrenalina 1:200.000; grupo C -(n=15 ropivacaína 0,75%. Utilizou-se 7ml da solução anestésica com 280 UI de hialuronidase, em punção única no rebordo orbital inferior. Foram registrados a PIO e grau de bloqueio motor 5 minutos antes da punção e 1, 2, 3, 4, 5 e 10 minutos após a punção. O bloqueio motor foi avaliado pela escala de Nicoll. Para a análise estatística, foram utilizados os testes de Wilcoxon, análise de freqüência simples e t de Student. Foi considerado significativo pBACKGROUND AND OBJECTIVE: Racemic bupivacaine, used in peribulbar anesthesia owing to its high potential to promote motor blockade, presents a smaller safety margin for cardiotoxicity in relation to ropivacaine and levobupivacaine. The objective of this study was to compare the degree of motor blockade and alteration of intraocular pressure (IOP produced by racemic bupivacaine, levobupivacaine and ropivacaine in peribulbar block. METHOD: Ninety seven patients, ASA physical status I and II, submitted to peribulbar anesthesia, were randomly allocated into three groups: group A-(n=16 receiving racemic bupivacaine 0.75% with epinephrine 1:200.000; group B -(n=16 levobupivacaine 0.75% with epinephrine 1:200.000; group C -(n=15
Thermophysical properties of Na2Th (MoO4)3 (s) and Na4Th (MoO4)4 (s)
International Nuclear Information System (INIS)
Dash, Smruti; Rakshit, S.K.; Singh, Ziley; Keskar, Meera; Dahale, N.D.
2009-01-01
The heat capacity of Na 2 Th (MoO 4 ) 3 (s) and Na 4 Th (MoO 4 ) 4 (s) have been measured by differential scanning calorimeter in the temperature range 318 to 845 K. The corresponding values are: C p,m (Na 2 Th (MoO 4 ) 3 ,s,T) (JK-1 mol-1) 368.710+ 1.0 10-1 (T/K) - 4950267 (K/T)2 (318 ≤ T (K) ≤ 845). C p,m (Na 4 Th (MoO 4 ) 4 ,s,T) (JK-1 mol-1) = 638.761+ 5.12 10-3 (T/K) - 12691691 (K/T)-2 (318 ≤ T (K) ≤ 845). Experimental heat capacity values for Na 2 Th (MoO 4 ) 3 (s) match reasonably well with that of additive oxide values. But C p,m (T) values of Na 4 Th (MoO 4 ) 4 (s) deviates substantially from the additive oxide values above 700 K. The uncertainty of the measurements reported in this study is calculated to be within 1 to 3 % . (author)
Rasmussen, D.; Buchanan, M. K.; Kopp, R. E.; Oppenheimer, M.
2017-12-01
Sea-level rise (SLR) is magnifying the frequency and severity of flooding in coastal regions. The rate and amount of global-mean SLR is a function of the trajectory of the global mean surface temperature (GMST). Therefore, temperature stabilization targets (e.g., 1.5°C or 2°C, as from the Paris Agreement) have important implications for regulating coastal flood risk. Quantifying the differences in the impact from SLR between these and other GMST stabilization targets is necessary for assessing the benefits and harms of mitigation goals. Low-lying small island nations are particularly vulnerable to inundation and coastal flooding from SLR because building protective and resilient infrastructure may not be physically or economically feasible. For small island nations, keeping GMST below a specified threshold may be the only option for maintaining habitability. Here, we assess differences in the return levels of coastal floods for small island nations between 1.5°C, 2.0°C, and 2.5°C GMST stabilization. We employ probabilistic, localized SLR projections and long-term hourly tide gauge records to construct estimates of local flood risk. We then estimate the number of small island nations' inhabitants at risk for permanent inundation under different GMST stabilization targets.
Quality of Life in Patients With Brain Metastases Using the EORTC QLQ-BN20+2 and QLQ-C15-PAL
International Nuclear Information System (INIS)
Caissie, Amanda; Nguyen, Janet; Chen, Emily; Zhang Liying; Sahgal, Arjun; Clemons, Mark; Kerba, Marc; Arnalot, Palmira Foro; Danjoux, Cyril; Tsao, May; Barnes, Elizabeth; Holden, Lori; Danielson, Brita; Chow, Edward
2012-01-01
Purpose: The 20-item European Organisation for Research and Treatment of Cancer Quality of Life Questionnaire–Brain Neoplasm (QLQ-BN20) is a validated quality-of-life (QOL) questionnaire for patients with primary brain tumors. The European Organisation for Research and Treatment of Cancer Quality of Life Questionnaire–Core 15 Palliative (QLQ-C15-PAL) core palliative questionnaire is a 15-item version of the core 30-item QLQ-C30 and was developed to decrease the burden on patients with advanced cancer. The combination of the QLQ-BN20 and QLQ-C30 to assess QOL may be too burdensome for patients. The primary aim of this study was to assess QOL in patients before and after treatment for brain metastases using the QLQ-BN20+2 and QLQ-C15-PAL, a version of the QLQ-BN20 questionnaire with 2 additional questions assessing cognitive functioning that were not addressed in the QLQ-C15-PAL. Methods and Materials: Patients with brain metastases completed the QLQ-C15-PAL and QLQ-BN20+2 questionnaires to assess QOL before and 1 month after radiation. Linear regression analysis was used to assess changes in QOL scores over time, as well as to explore associations between the QLQ-BN20+2 and QLQ-C15-PAL scales, patient demographics, and clinical variables. Spearman correlation assessed associations between the QLQ-BN20+2 and QLQ-C15-PAL scales. Results: Among 108 patients, the majority (55%) received whole-brain radiotherapy only, with 65% of patients completing follow-up at 1 month after treatment. The most prominent symptoms at baseline were future uncertainty (QLQ-BN20+2) and fatigue (QLQ-C15-PAL). After treatment, significant improvement was seen for the QLQ-C15-PAL insomnia scale, as well as the QLQ-BN20+2 scales of future uncertainty, visual disorder, and concentration difficulty. Baseline Karnofsky Performance Status was negatively correlated to QLQ-BN20+2 motor dysfunction but positively related to QLQ-C15-PAL physical functioning and QLQ-BN20+2 cognitive functioning at
Quality of Life in Patients With Brain Metastases Using the EORTC QLQ-BN20+2 and QLQ-C15-PAL
Energy Technology Data Exchange (ETDEWEB)
Caissie, Amanda; Nguyen, Janet; Chen, Emily; Zhang Liying [Rapid Response Radiotherapy Program, Odette Cancer Centre, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); Sahgal, Arjun [Rapid Response Radiotherapy Program, Odette Cancer Centre, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); Department of Radiation Oncology, Princess Margaret Hospital, University of Toronto, Toronto, Ontario (Canada); Clemons, Mark [Department of Medical Oncology, Ottawa Hospital Cancer Centre, Ottawa, Ontario (Canada); Kerba, Marc [Department of Radiation Oncology, Tom Baker Cancer Centre, Calgary, Alberta (Canada); Arnalot, Palmira Foro [Parc de Salut Mar Hospital de l' Esperanca, Barcelona (Spain); Danjoux, Cyril; Tsao, May; Barnes, Elizabeth; Holden, Lori [Rapid Response Radiotherapy Program, Odette Cancer Centre, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada); Danielson, Brita [Department of Radiation Oncology, Cross Cancer Institute, Edmonton, Alberta (Canada); Chow, Edward, E-mail: edward.chow@sunnybrook.ca [Rapid Response Radiotherapy Program, Odette Cancer Centre, Sunnybrook Health Sciences Centre, University of Toronto, Toronto, Ontario (Canada)
2012-07-15
Purpose: The 20-item European Organisation for Research and Treatment of Cancer Quality of Life Questionnaire-Brain Neoplasm (QLQ-BN20) is a validated quality-of-life (QOL) questionnaire for patients with primary brain tumors. The European Organisation for Research and Treatment of Cancer Quality of Life Questionnaire-Core 15 Palliative (QLQ-C15-PAL) core palliative questionnaire is a 15-item version of the core 30-item QLQ-C30 and was developed to decrease the burden on patients with advanced cancer. The combination of the QLQ-BN20 and QLQ-C30 to assess QOL may be too burdensome for patients. The primary aim of this study was to assess QOL in patients before and after treatment for brain metastases using the QLQ-BN20+2 and QLQ-C15-PAL, a version of the QLQ-BN20 questionnaire with 2 additional questions assessing cognitive functioning that were not addressed in the QLQ-C15-PAL. Methods and Materials: Patients with brain metastases completed the QLQ-C15-PAL and QLQ-BN20+2 questionnaires to assess QOL before and 1 month after radiation. Linear regression analysis was used to assess changes in QOL scores over time, as well as to explore associations between the QLQ-BN20+2 and QLQ-C15-PAL scales, patient demographics, and clinical variables. Spearman correlation assessed associations between the QLQ-BN20+2 and QLQ-C15-PAL scales. Results: Among 108 patients, the majority (55%) received whole-brain radiotherapy only, with 65% of patients completing follow-up at 1 month after treatment. The most prominent symptoms at baseline were future uncertainty (QLQ-BN20+2) and fatigue (QLQ-C15-PAL). After treatment, significant improvement was seen for the QLQ-C15-PAL insomnia scale, as well as the QLQ-BN20+2 scales of future uncertainty, visual disorder, and concentration difficulty. Baseline Karnofsky Performance Status was negatively correlated to QLQ-BN20+2 motor dysfunction but positively related to QLQ-C15-PAL physical functioning and QLQ-BN20+2 cognitive functioning at
Directory of Open Access Journals (Sweden)
Teresa NUNES
2017-08-01
Full Text Available RESUMO Este artigo analisa a diplomacia comercial portuguesa face à Espanha, no decurso da segunda metade do séc. XIX. Pretende, especialmente, acompanhar as várias negociações comerciais desenvolvidas entre os países ibéricos, nas décadas de 1860, 70, 80 e 90, as quais culminaram na celebração do tratado de comércio e navegação de 1893. Procura, igualmente, avaliar as tendências políticas nacionais sobre os aspectos positivos e negativos associados ao fortalecimento das ligações econômicas com a Espanha. Neste exercício, é possível identificar um papel renovado da Espanha na geopolítica portuguesa, como nas perspectivas de crescimento econômico subsequentes ao Ultimatum (1890 e à denúncia dos tratados de comércio e navegação celebrados com a Inglaterra (1842/1878.
Synergistic inhibition of the APC/C by the removal of APC15 in HCT116 cells lacking UBE2C
DEFF Research Database (Denmark)
Garvanska, Dimitriya H; Larsen, Marie Sofie Yoo; Nilsson, Jakob
2016-01-01
that has been shown to depend on the APC/C E2 enzymes, UBE2C and UBE2S. Here we investigate the in vivo role of the APC/C E2 enzymes in SAC silencing using CRISPR/Cas9 genetically engineered HCT116 UBE2C or UBE2S null cell lines. Using live cell assays, we show that UBE2C and UBE2S make a minor...... contribution to SAC silencing in HCT116 cells. Strikingly in cells specifically lacking UBE2C, we observe a strong synergistic inhibition of mitotic progression when we stabilize the MCC on the APC/C by depleting APC15, potentially reflecting increased competition between the MCC and the remaining initiating E...
Magnetic upconverting fluorescent NaGdF4:Ln3+ and iron-oxide@NaGdF4:Ln3+ nanoparticles
Shrivastava, Navadeep; Rocha, Uéslen; Muraca, Diego; Jacinto, Carlos; Moreno, Sergio; Vargas, J. M.; Sharma, S. K.
2018-05-01
Microwave assisted solvothermal method has been employed to synthesize multifunctional upconverting β-NaGdF4:Ln3+ and magnetic-upconverting Fe3O4/γ-Fe2O3@NaGdF4:Ln3+ (Ln = Yb and Er) nanoparticles. The powder x-ray diffraction data confirms the hexagonal structure of NaGdF4:Ln3+ and high resolution transmission electron microscopy shows the formation of rod shaped NaGdF4:Ln3+ (˜ 20 nm) and ovoid shaped Fe3O4/γ-Fe2O3@NaGdF4:Ln3+ (˜ 15 nm) nanoparticles. The magnetic hysteresis at 300 K for β-NaGdF4:Ln3+ demonstrates paramagnetic features, whereas iron-oxide@β-NaGdF4:Ln3+ exhibits superparamagnetic behavior along with a linear component at large applied field due to paramagnetic NaGdF4 matrix. Both nanoparticle samples provide an excellent green emitting [(2H11/2, 4S3/2)→4I15/2 (˜ 540 nm)] upconversion luminescence emission under excitation at 980 nm. The energy migration between Yb and Er in NaGdF4 matrix has been explored from 300-800 nm. Intensity variation of blue, green and red lines and the observed luminescence quenching due to the presence of Fe3O4/γ-Fe2O3 in the composite has been proposed. These kinds of materials contain magnetic and luminescence characteristics into single nanoparticle open new possibility for bioimaging applications.
Qi, Haiping; Coplen, Tyler B.; Geilmann, Heike; Brand, Willi A.; Böhlke, J.K.
2003-01-01
Analytical grade L-glutamic acid is chemically stable and has a C/N mole ratio of 5, which is close to that of many of natural biological materials, such as blood and animal tissue. Two L-glutamic acid reference materials with substantially different 13C and 15N abundances have been prepared for use as organic reference materials for C and N isotopic measurements. USGS40 is analytical grade L-glutamic acid and has a δ13C value of −26.24‰ relative to VPDB and a δ15N value of −4.52‰ relative to N2 in air. USGS41 was prepared by dissolving analytical grade L-glutamic acid with L-glutamic acid enriched in 13C and 15N. USGS41 has a δ13C value of +37.76‰ and a δ15N value of +47.57‰. The δ13C and δ15N values of both materials were measured against the international reference materials NBS 19 calcium carbonate (δ13C = +1.95‰), L-SVEC lithium carbonate (δ13C = −46.48‰), IAEA-N-1 ammonium sulfate (δ15N = 0.43‰), and USGS32 potassium nitrate (δ15N = 180‰) by on-line combustion continuous-flow and off-line dual-inlet isotope-ratio mass spectrometry. Both USGS40 and USGS41 are isotopically homogeneous; reproducibility of δ13C is better than 0.13‰, and that of δ15N is better than 0.13‰ in 100-μg amounts. These two isotopic reference materials can be used for (i) calibrating local laboratory reference materials, and (ii) quantifying drift with time, mass-dependent fractionations, and isotope-ratio-scale contraction in the isotopic analysis of various biological materials. Isotopic results presented in this paper yield a δ13C value for NBS 22 oil of −29.91‰, in contrast to the commonly accepted value of −29.78‰ for which off-line blank corrections probably have not been quantified satisfactorily.
International Nuclear Information System (INIS)
Kurdali, F.
2007-06-01
A field experiment on dhaincha C 3 (Sesbania aculeata Pers), sunflower C 3 (Helianthus annuus L.) and sorghum C 4 (Sorghum bicolor L.) plants grown in monocropping and intercropping systems was conducted to evaluate seed yield, dry matter production, total N yield, land equivalent ratio (LER), intraspecific competition for soil N uptake, water use efficiency (WUE) and N 2 -fixation using the 15 N natural abundance technique (δ 15 N ). Moreover, carbon isotope discrimination (Δ13 C ) was determined to assess factors responsible for crop performance variability in the different cropping systems. Intercropping of sesbania/sorghum showed greater efficiency over monocropping in producing dry matter, during the entire growth period, as indicated by the LERs (>1); whereas, the efficiency of producing dry matter in the sesbania /sunflower intercropping was similar to that in the monocropping system (LER=1). Moreover, sorghum plants (C 4 ) was more competitive than sesbania (C 3 ) for soil N uptake; whereas, sesbania seemed to be more competitive than its associated sunflower (C 3 ). N uptake in the mixed stand of sesbania/sorghum was improved due to the increase in soil N uptake by the component sorghum and the higher root nodule activity of component sesbania without affecting the amount of N 2 fixed. In both cropping systems, sesbania plants fixed almost the same amount of N 2 (an average of 105 kg N/ha) although the number of rows in the mixed stand was 2/3 of that in the pure stand. This gives an advantage of the intercropping over sole cropping system with regards to N 2 -fixation. 13 C discrimination in plant materials was found to be affected by plant species and the cropping system. Factors affected Δ13 C in plants grown in the mixed stand relative to solely grown crops are discussed.(author)
Directory of Open Access Journals (Sweden)
Vanderlei Rodrigues da Silva
2006-06-01
Full Text Available A temperatura do solo é uma propriedade que afeta diretamente o crescimento das plantas e é influenciada pelo balanço de energia na superfície do solo. Dessa maneira, os sistemas de manejo do solo têm efeito na temperatura, visto que alteram as condições da superfície do solo. O objetivo deste estudo foi determinar o efeito de três sistemas de manejo na temperatura do solo durante todo o ciclo do feijoeiro. O delineamento experimental foi de blocos ao acaso, com os seguintes preparos do solo: plantio direto há sete anos (PD; plantio direto revolvido por uma aração e uma gradagem (PDar e plantio direto revolvido por escarificador (PDesc, distribuídos em quatro blocos. O solo do experimento é classificado como Argissolo Vermelho-Amarelo distrófico arênico. A temperatura do solo foi determinada durante todo o ciclo do feijoeiro, realizando-se leituras a cada 10 min, em um sistema automatizado de coleta de dados, com sensores do tipo termopar (cobre-constantan, instalados na profundidade de 0,025 m e a 0,10 m. Foram determinadas a densidade do solo e a produtividade do feijoeiro. Durante todo o ciclo do feijoeiro, o PD apresentou a menor temperatura máxima e a menor amplitude diária entre os sistemas de manejo. Na profundidade de 0,025 m, o PDar apresentou temperatura máxima de 42,2 °C, o PDesc de 43,7 °C e o PD de 36,1 °C. A variação diária da temperatura do solo num dia com 12 h de sol, no início do desenvolvimento das plantas (02/12/2002, indicou que a maior temperatura ocorreu próximo às 15 h, com valores de 40 ºC, no PDar, e 30 ºC, no PD, na profundidade de 0,025 m. Quando as plantas sombreavam o solo, não houve diferenças na temperatura do solo entre os sistemas de manejo. As diferenças na temperatura do solo não provocaram diferenças na produtividade de grãos do feijoeiro, haja vista que os maiores efeitos da temperatura do solo ocorrem na germinação e emergência das plântulas.Soil temperature is a
Synthesis and characterization of novel Na15 (SO4 )5 F4 Cl:Ce3+ halosulfate phosphors.
Bhake, A M; Nair, Govind B; Zade, G D; Dhoble, S J
2016-12-01
A series of Na 15 (SO 4 ) 5 F 4 Cl phosphors doped with Ce 3+ ions was prepared using the wet chemical method. X-Ray diffraction studies were used to determine their phase formation and purity. Fourier transform infrared spectroscopy effectively identified the chemical bonds present in the molecule. The photoluminescence properties of the as-prepared phosphors were investigated and the Ce 3+ ions in these hosts were found to give broadband emission in the UV range. For the thermoluminescence study, phosphors were irradiated with a 5 Gy dose of γ-rays from a 60 Co source. Chen's half-width method was employed to calculate the trapping parameters from the thermoluminescence glow curve. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
Qualidade de uva ‘Isabel’ tratada na pré-colheita com CaCl2 e elicitor à base de biomassa cítrica
Directory of Open Access Journals (Sweden)
Leonardo da Silva Santos
2017-10-01
Full Text Available O alto índice de degrana e podridão das bagas reduzem a qualidade e elevam as perdas pós-colheita em uvas ‘Isabel’, demandando técnicas de manejo na pré e pós-colheita acessíveis ao pequeno produtor, que mantenham a qualidade e ampliem a vida útil pós-colheita dos cachos. Assim, este trabalho teve por objetivo avaliar o efeito da aplicação na pré-colheita de CaCl2 e elicitor à base de biomassa cítrica em uvas ‘Isabel’ na manutenção da qualidade durante o armazenamento na condição ambiente sob atmosferas ambiente e modificada. O experimento foi conduzido em blocos casualizados a campo, no município de São Vicente Férrer-PE com 8 repetições. Videiras ‘Isabel’ foram tratadas, 28 dias antes da colheita, com: elicitor de Biomassa Cítrica (BC, elicitor de Biomassa Cítrica + CaCl2 (BC+C, CaCl2 (C e Testemunha (T - sem aplicação. Cachos colhidos na maturação comercial foram armazenados em arranjo fatorial 4×2×7, sendo 4 tratamentos (aplicados no campo, 2 condições de armazenamento, atmosferas ambiente (AA e modificada (AM, sob condição ambiente (25±2°C e 75±2% de UR e 7 períodos de avaliação em quatro repetições. A aplicação de CaCl2 e do elicitor BC reduziu o índice de degrana (55 e 75%, respectivamente, a podridão e a perda de massa dos cachos de uva ‘Isabel’. Estes tratamentos, associados ou não, aumentaram a eficiência da AM em manter a qualidade dos cachos. O índice de degrana de uva ‘Isabel’ foi influenciado diretamente pela relação SS/AT, pH e índice de podridão das bagas.
Takada, Makoto; Fujimaki, Kayo; Hokari, Shigeru
2008-11-01
Adult frog skin transports Na(+) from the apical to the basolateral side across the skin. Antidiuretic hormone (ADH) is involved in the regulation of Na(+) transport in both mammals and amphibians. We investigated the effect of arginine vasotocin (AVT), the ADH of amphibians, on the short-circuit current (SCC) across intact skin and on the basolateral Na(+)/K(+)-pump current across apically nystatin-permeabilized skin of the tree frog, Hyla japonica, in which the V(2)-type ADH receptor is expressed in vitro. In intact skin, 1 pM AVT had no effect on the SCC, but 10 nM AVT was sufficient to stimulate the SCC since 10 nM and 1 microM of AVT increased the SCC 3.2- and 3.4-fold, respectively (P > 0.9). However, in permeabilized skin, AVT (1 microM) decreased the Na(+)/K(+)-pump current to 0.79 times vehicle control. Similarly, 500 microM of 8Br-cAMP increased the SCC 3.2-fold, yet 1 mM of 8Br-cAMP decreased the Na(+)/K(+)-pump current to 0.76 times vehicle control. Arachidonic acid (10(-5) M) tended to decrease the Na(+)/K(+)-pump current. To judge from these in vitro experiments, AVT has the potential to inhibit the basolateral Na(+)/K(+)-pump current via the V(2)-type receptor/cAMP pathway in the skin of the tree frog.
Hadron production in nuclear collisions from the NA49 experiment at 158 GeV/c.A
Bächler, J; Barnby, L S; Bartke, Jerzy; Barton, R A; Betev, L; Bialkowska, H; Billmeier, A; Blume, C; Blyth, C O; Boimska, B; Bracinik, J; Brady, F P; Brun, R; Buncic, P; Carr, L; Cebra, D; Cooper, G E; Cramer, J G; Csató, P; Eckardt, V; Eckhardt, F; Ferenc, D; Fischer, H G; Fodor, Z; Foka, P Y; Freund, P; Friese, V; Ftácnik, J; Gál, J; Ganz, R E; Gazdzicki, M; Gladysz-Dziadus, E; Grebieszkow, J; Harris, J W; Hegyi, S; Hlinka, V; Höhne, C; Igo, G; Ivanov, M; Jacobs, P; Janik, R; Jones, P G; Kadija, K; Kolesnikov, V I; Kowalski, M; Lasiuk, B; Lednicky, R; Lévai, Peter; Malakhov, A I; Margetis, S; Markert, C; Mayes, B W; Melkumov, G L; Molnár, J; Nelson, J M; Odyniec, Grazyna Janina; Oldenburg, M; Pálla, G; Panagiotou, A D; Petridis, A; Pikna, M; Pinsky, L; Poskanzer, A M; Prindle, D J; Pühlhofer, F; Reid, J G; Renfordt, R E; Retyk, W; Ritter, H G; Röhrich, D; Roland, C; Roland, G; Rybicki, A; Sammer, T; Sandoval, A; Sann, H; Semenov, A Yu; Schäfer, E; Schmitz, N; Seyboth, P; Siklér, F; Sitár, B; Skrzypczak, E; Snellings, R; Squier, G T A; Stock, Reinhard; Strmen, P; Ströbele, H; Susa, T; Szarka, I; Szentpétery, I; Sziklai, J; Toy, M; Trainor, T A; Trentalange, S; Ullrich, T S; Varga, D; Vassiliou, Maria; Veres, G I; Vesztergombi, G; Voloshin, S A; Vranic, D; Wang, F; Weerasundara, D D; Wenig, S; Whitten, C; Xu, N; Yates, T A; Yoo, I K; Zimányi, J
1999-01-01
With its large acceptance and particle identification coverage the NA49 experiment can study hadron production in a wide range of high energy reactions. Originally aimed at examining central Pb+Pb collisions for signatures of quark-gluon plasma formation, the scope of the experiment has been enhanced with the systematic study of impact parameter and projectile size dependence, as well as the inclusion of the more elementary p+p and p+A interactions. The question is: are predicted signals of the quark-gluon plasma observed and are there discontinuities which would support the concept of hadronic phase transition?. (15 refs).
Effect of body size and body mass on δ 13 C and δ 15 N in coastal fishes and cephalopods
Vinagre, C.; Máguas, C.; Cabral, H. N.; Costa, M. J.
2011-11-01
Carbon and nitrogen isotopes have been widely used in the investigation of trophic relations, energy pathways, trophic levels and migrations, under the assumption that δ 13C is independent of body size and that variation in δ 15N occurs exclusively due to ontogenetic changes in diet and not body size increase per se. However, several studies have shown that these assumptions are uncertain. Data from food-webs containing an important number of species lack theoretical support on these assumptions because very few species have been tested for δ 13C and δ 15N variation in captivity. However, if sampling comprises a wide range of body sizes from various species, the variation of δ 13C and δ 15N with body size can be investigated. While correlation between body size and δ 13C and δ 15N can be due to ontogenetic diet shifts, stability in such values throughout the size spectrum can be considered an indication that δ 13C and δ 15N in muscle tissues of such species is independent of body size within that size range, and thus the basic assumptions can be applied in the interpretation of such food webs. The present study investigated the variation in muscle δ 13C and δ 15N with body size and body mass of coastal fishes and cephalopods. It was concluded that muscle δ 13C and δ 15N did not vary with body size or mass for all bony fishes with only one exception, the dragonet Callionymus lyra. Muscle δ 13C and δ 15N also did not vary with body size or mass in cartilaginous fishes and cephalopods, meaning that body size/mass per se have no effect on δ 13C or δ 15N, for most species analysed and within the size ranges sampled. The assumption that δ 13C is independent of body size and that variation in δ 15N is not affected by body size increase per se was upheld for most organisms and can be applied to the coastal food web studied taking into account that C. lyra is an exception.
Energy Technology Data Exchange (ETDEWEB)
Zhao, Liang; Hu, Yong-Sheng; Li, Hong; Armand, Michel; Chen, Liquan [Key Laboratory for Renewable Energy, Beijing Key Laboratory for New, Energy Materials and Devices, Beijing National Laboratory for Condensed Matter Physics, Institute of Physics, Chinese Academy of Sciences, Beijing (China); Zhao, Junmei [Key Laboratory of Green Process and Engineering, Institute of Process Engineering, Chinese Academy of Sciences, Beijing (China); Zhou, Zhibin [School of Chemistry and Chemical Engineering, Huazhong University of Science and Technology, Wuhan (China)
2012-08-15
In this contribution, a cheap organic material, disodium terephthalate, Na{sub 2}C{sub 8}H{sub 4}O{sub 4}, has been firstly evaluated as a novel anode for room-temperature Na-ion batteries. The material exhibits a high reversible capacity of 250 mAh/g with excellent cycleability. The average Na storage voltage is approximately 0.43 V vs. Na{sup +}/Na. A thin layer of Al{sub 2}O{sub 3} coating on the electrode surface derived from the atomic layer deposition technique is effective in further enhancing Na storage performance. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
International Nuclear Information System (INIS)
Wada, E.
1987-01-01
Distributions of δ 15 N and δ 13 C for biogenic substances in the Antarctic Ocean and in the Otsuchi River estuary in Japan were investigated to construct isotope biogeochemical framework for assessing marine ecosystems. The isotopic compositions of phytoplankton were particularly low in the Antarctic Ocean. High nitrate and CO 2 concentrations in the surface sea waters, and the low light intensity seem to enhance the kinetic isotope fractionations that preferred the depletion of 15 N and 13 C in the algal body. A clear-cut linear relationship between animal δ 15 N and its trophic level was obtained in the Antarctic system. In the estuary, the variation of isotope ratios were principally governed by the mixing of land-derived organic matter, marine phytoplankton, and seagrasses. A food-chain effect of 15 N enrichment was also confirmed. An isotopically ordered structure was presented for a marine estuarine ecosystem. The isotopic abundances in a food network vary mainly because of the variation in 15 N and 13 C contents of primary producers grown under different environmental conditions and because of the enrichment of 15 N along food chains. (author)
Stress corrosion cracking in 17-4PH and 17-7PH stainless steels in NaCl and NaOH (20%) a 90 deg C
International Nuclear Information System (INIS)
Gaona-Tiburcio, C.; Almeraya-Calderon, F.; Martinez-Villafane, A.
2000-01-01
One of the problems that affects to the electric industry is the not programmed stoppages in the power plants, due to the failure of any main component: boiler, turbine and generator. In the turbine, the combined action of a corrosive agent (humid polluted vapor) and a mechanical effort, generally will result in Stress Corrosion Cracking (SCC). In this work the SCC susceptibility of the precipitation hardening stainless steels 17-4PH and 17-17PH, thoroughly used in steam turbine blades of power stations is analyzed. The specimens were tested in the presence of NaCl and NaOH(20%) to 90 deg C and different pH. The CERT test (Constant Extension Rate Test) was used, at 10''-6 s''-1, supplementing it with electrochemical noise, the aim was to identify the conditions of maximum susceptibility and the performance of the studied materials. The fractographic analysis revealed ductile and brittle fracture. Intergranular cracking, characteristic of the anodic dissolution mechanisms of the materials was observed. Nevertheless, the main mechanism responsible the failure was hydrogen embrittlement. (Author) 6 refs
Sun, Hemin; Wang, Anqian; Zhai, Jianqing; Huang, Jinlong; Wang, Yanjun; Wen, Shanshan; Zeng, Xiaofan; Su, Buda
2018-05-01
Regional precipitation patterns may change in a warmer climate, thereby increasing flood and drought risks. In this paper, annual, annual maximum, intense, heavy, moderate, light, and trace precipitation are employed as indicators to assess changes in precipitation patterns under two scenarios in which the global mean temperature increases by 1.5 °C and 2.0 °C relative to pre-industrial levels using the regional climate model COSMO-CLM (CCLM). The results show that annual precipitation in China will be approximately 2.5% higher under 1.5 °C warming relative to the present-day baseline (1980-2009), although it will decrease by approximately 4.0% under an additional 0.5 °C increase in global mean temperature. This trend is spatially consistent for regions with annual precipitation of 400-800 mm, which has experienced a drying trend during the past half century; thus, limiting global warming to 1.5 °C may mitigate these drying conditions. The annual maximum precipitation continues to increase from present day levels to the 2.0 °C warming scenario. Relative to the baseline period, the frequency of trace and light precipitation days exhibits a negative trend, while that of moderate, heavy, and intense precipitation days has a positive trend under the 1.5 °C warming scenario. For the 2.0 °C warming world, the frequency of days is projected to decrease for all precipitation categories, although the intensity of intense precipitation increases. Spatially, a decrease in the number of precipitation days is expected to continue in central and northern China, where a drying trend has persisted over the past half century. Southeastern China, which already suffers greatly from flooding, is expected to face more heavy and intense precipitation with an additional 0.5 °C increase in global mean temperature. Meanwhile, the intensity of intense precipitation is expected to increase in northern China, and the contribution of light and moderate precipitation to the annual
Applications of stable isotopes of 2H, 13C and 15N to clinical problems
International Nuclear Information System (INIS)
Klein, P.D.; Szczepanik, P.A.; Hachey, D.L.
1974-01-01
The function of the Argonne Program is to provide synthetic, analytical instrumental capability in a core facility for the clinical investigator who needs to use 2 H, 13 C, or 15 N labelled compounds for metabolic or clinical research on pregnant women, newborn infants, young children, or for mass screening. To carry out such application development, there were six stages which were recurrent steps in every application. Five fundamental strategies should be adopted to establish the use of stable isotopes in clinical work. The instrument required for measurements was a combined gas chromatograph-mass spectrometer, and its use was schematically illustrated. Some of the successful experiences with compounds labelled by stable isotopes, such as deuterium labelled chenodeoxycholic acid, and respective 13 C and 15 N-labelled glycine were described. Deutrium labelled bile acid enabled easy and safe determination of the size of the bile acid pool and the replacement rate, providing clearer diagnoses for cholestatic liver disease and gallstones. 13 C and 15 N labelled compounds were used in clinical studies, of children with genetic disorders of amino acid metabolism, i.e., non ketotic hyperflycinemia, B 12 -responsive methyl malonic acidemia, and Lesch-Nyhan syndrome. 15 N-labelled glycine was also studied in a child with Lesch-Nyhan syndrome. (Mukohata, S.)
Merchandising social e os códigos da imagem televisiva: a construção de significados na Telenovela
Directory of Open Access Journals (Sweden)
Plábio Marcos Martins Desidério
2010-10-01
Full Text Available O objetivo deste artigo é analisar como a imagem televisiva desempenha um papel importante na construção do merchandising social nas telenovelas contemporâneas. Com isso, será utilizada a perspectiva de Martine Joly, fundamentada em Roland Barthes, as discussões proposta pro John Fisk, cujo estudioso ressalta a televisão como um discurso e a abordagem de Stuart Hall sobre codificação e decodificação. Perceber como o merchandising social está presente na imagem televisiva e essa constituída por códigos contribui para aproximar a prática do merchandising social e o público.
International Nuclear Information System (INIS)
Narayan, R.; Chang, C-j.
1982-01-01
[2- 13 C, 2- 14 C]2-Aminoethanol hydrochloride was prepared in good yield from Na*CN in a two step sequence by first converting the Na*CN to OHCH 2 *CN and then reducing the nitrile directly with a solution of borane-tetrahydrofuran complex. The reaction procedure was simple and the pure product could be obtained readily. Using this specifically labelled precursor, the synthesis of [1- 13 C, 1- 14 C]2-chloroethylamine hydrochloride, N-([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(CNU) and N,N'-bis([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(BCNU) in good yield without isotope scrambling was also reported. (author)
Avoided economic impacts of energy demand changes by 1.5 and 2 °C climate stabilization
Park, Chan; Fujimori, Shinichiro; Hasegawa, Tomoko; Takakura, Jun’ya; Takahashi, Kiyoshi; Hijioka, Yasuaki
2018-04-01
Energy demand associated with space heating and cooling is expected to be affected by climate change. There are several global projections of space heating and cooling use that take into consideration climate change, but a comprehensive uncertainty of socioeconomic and climate conditions, including a 1.5 °C global mean temperature change, has never been assessed. This paper shows the economic impact of changes in energy demand for space heating and cooling under multiple socioeconomic and climatic conditions. We use three shared socioeconomic pathways as socioeconomic conditions. For climate conditions, we use two representative concentration pathways that correspond to 4.0 °C and 2.0 °C scenarios, and a 1.5 °C scenario driven from the 2.0 °C scenario with assumption in conjunction with five general circulation models. We find that the economic impacts of climate change are largely affected by socioeconomic assumptions, and global GDP change rates range from +0.21% to ‑2.01% in 2100 under the 4.0 °C scenario, depending on the socioeconomic condition. Sensitivity analysis that differentiates the thresholds of heating and cooling degree days clarifies that the threshold is a strong factor that generates these differences. Meanwhile, the impact of the 1.5 °C is small regardless of socioeconomic assumptions (‑0.02% to ‑0.06%). The economic loss caused by differences in socioeconomic assumption under the 1.5 °C scenario is much smaller than that under the 2 °C scenario, which implies that stringent climate mitigation can work as a risk hedge to socioeconomic development diversity.
Salinity is an important environmental factor limiting growth and productivity of plants, and affects almost every aspect of the plant physiology and biochemistry. The objective of this study was to apply cDNA-AFLP and to identify differentially expressed genes in response to NaCl stress vs. no-stre...
Zatížení větrem na chladící věž
Ehrlich, Tomáš
2015-01-01
Práce se zabývá studiem proudění vzduchu a stanovením účinků na tenkostěnný plášť chladící věže. Jsou prezentovány dva výpočetní modely pro mechaniku tekutin – osamělá chladící věž a skupina čtyř chladících věží. Součástí práce je i strukturální model chladící věže doplněný metodikou pro přenos tlakového zatížení z CFD výpočtu. Thesis is concerned with modeling fluid dynamics and computing wind load on thin-walled structure of cooling tower. Two models for computational fluid dynamics are ...
Energy Technology Data Exchange (ETDEWEB)
Liu, Nan; Nittler, Larry R.; Alexander, Conel M. O’D.; Wang, Jianhua [Department of Terrestrial Magnetism, Carnegie Institution for Science, Washington, DC 20015 (United States); Pignatari, Marco [E. A. Milne Centre for Astrophysics, Department of Physics and Mathematics, University of Hull, Hull HU6 7RX (United Kingdom)
2017-06-10
We report C, N, and Si isotopic data for 59 highly {sup 13}C-enriched presolar submicron- to micron-sized SiC grains from the Murchison meteorite, including eight putative nova grains (PNGs) and 29 {sup 15}N-rich ({sup 14}N/{sup 15}N ≤ solar) AB grains, and their Mg–Al, S, and Ca–Ti isotope data when available. These 37 grains are enriched in {sup 13}C, {sup 15}N, and {sup 26}Al with the PNGs showing more extreme enhancements. The {sup 15}N-rich AB grains show systematically higher {sup 26}Al and {sup 30}Si excesses than the {sup 14}N-rich AB grains. Thus, we propose to divide the AB grains into groups 1 ({sup 14}N/{sup 15}N < solar) and 2 ({sup 14}N/{sup 15}N ≥ solar). For the first time, we have obtained both S and Ti isotopic data for five AB1 grains and one PNG and found {sup 32}S and/or {sup 50}Ti enhancements. Interestingly, one AB1 grain had the largest {sup 32}S and {sup 50}Ti excesses, strongly suggesting a neutron-capture nucleosynthetic origin of the {sup 32}S excess and thus the initial presence of radiogenic {sup 32}Si ( t {sub 1/2} = 153 years). More importantly, we found that the {sup 15}N and {sup 26}Al excesses of AB1 grains form a trend that extends to the region in the N–Al isotope plot occupied by C2 grains, strongly indicating a common stellar origin for both AB1 and C2 grains. Comparison of supernova models with the AB1 and C2 grain data indicates that these grains came from supernovae that experienced H ingestion into the He/C zones of their progenitors.
LiVO/sub 3/-Li/sub 2/Mo(W)O/sub 4/ and NaVO/sub 3/-Na/sub 2/Cr(Mo)O/sub 4/ systems
Energy Technology Data Exchange (ETDEWEB)
Belyaev, I N; Lupeiko, T G; Vyalikova, V I [Rostovskij-na-Donu Gosudarstvennyj Univ. (USSR)
1975-09-01
The systems LiVO/sub 3/-Li/sub 2/MoO/sub 4/, LiVO/sub 3/-Li/sub 2/WO/sub 4/, NaNO/sub 3/-Na/sub 2/CrO/sub 4/, NaNO/sub 3/-Na/sub 2/MoO/sub 4/ were studied with thermographic and partially visual polythermal methods of physical and chemical analyses. Except NaVO/sub 3/-Na/sub 2/MoO/sub 4/ all investigated systems are eutectic ones with limited solid solutions on the basis of some component; the eutectics melt at 542, 544, 550/sup 0/C and contain 25, 20 and 26% of Li/sub 2/MoO/sub 4/, Li/sub 2/WO/sub 4/ and Na/sub 2/CrO/sub 4/ respectively. The system NaNO/sub 3/-Na/sub 2/MoO/sub 4/ contains compound 18 NaVO/sub 3/.11Na/sub 2/MoO/sub 4/ congruently melting at 570/sup 0/C. Two eutectics of the system have melting points at 542 and 548/sup 0/C and contain 47 and 67% of Na/sub 2/MoO/sub 4/.
The local structure of CaNa pyroxenes. I. XANES study at the Na K-edge
International Nuclear Information System (INIS)
Mottana, Annibale; Murata, T.; Wu, Ziyu; Marcelli, Augusto; Paris, E.
1996-07-01
X-ray absorption Na K-edge spectra have been recorded on synthetic end member jadeite and on a series of natural Ca-Na pyroxenes compositionally straddling the Jd-Di. The disordered C2/c members of the series are systematically different from the ordered P2/n members. These differences can be interpreted and explained by comparing the experimental spectra with theoretical spectra. These have been calculated by the multiple-scattering formalism from the atomic positional parameters determined by single-crystal X-ray diffraction structure refinement on the same samples. In the full multiple scattering region of the spectrum (1075 to 1095 eV) C-pyroxenes exhibit three features which reflect the 6-2 configuration of the O back-scattering atoms around the Na absorber located at the center of the cluster (site M2 of the jadeite structure). P-pyroxenes show more complicated spectra in which at least four features can be recognized; they reflect the two types of the configuration (6-2 and 4-2-2) of the oxygens around Na in the two independent M2 and M21 eight-fold coordinated sites of the omphacite structure. A weak, sometimes poorly resolved peak at 1079 eV diagnostic and discriminates C- from P-pyroxenes. The Garnet Ridge C2/c impure jadeite exhibits a spectrum which is intermediate between those of jadeite and omphacite. The Hedin-Lundqist potential proves best for these insulating materials and allows multiple-scattering calculations agreeing well with experiments. The assessment of the local electronic properties of compositionally and structurally complex minerals such as clinopyroxenes is thus enhanced
Explosive phenomena in heavily irradiated NaCl
denHartog, HW; Vainshtein, DI; Matthews, GE; Williams, RT
1997-01-01
In heavily irradiated NaCl crystals explosive phenomena can be initiated during irradiation or afterwards when samples are heated to temperatures between 100 and 250 degrees C. During irradiation of NaCl Na and Cl-2 precipitates and void structures are produced along with the accumulation of stored
Ionic responses rapidly elicited by activation of protein kinase C in quiescent Swiss 3T3 cells
International Nuclear Information System (INIS)
Vara, F.; Schneider, J.A.; Rozengurt, E.
1985-01-01
Diacylglycerol and phorbol esters activate protein kinase C in intact cells. The authors report here that addition of the synthetic diacylglycerol 1-oleoyl-2-acetylglycerol (OAG) to quiescent cultures of Swiss 3T3 cells caused a marked increase in the rate of ouabain-sensitive 86 Rb + uptake, a measure of the activity of the Na + /K + pump. The effect was dose-dependent and could be detected after 1 min of exposure to the diacylglycerol. OAG stimulated Na + influx via an amiloride-sensitive pathway and increased intracellular pH by 0.15 pH unit. Phorbol 12,13-dibutyrate (PBt 2 ) also enhanced ouabain sensitive 86 Rb + uptake and amiloride-sensitive 22 Na + influx. Prolonged treatment (40 hr) of 3T3 cells with PBt 2 at a saturating dose, which reduces the number of PBt 2 binding sites and protein kinase C activity, abolished the ionic response of the cells to a subsequent addition of either OAG or PBt 2 . They suggest that activation of protein kinase C elicits, either directly or indirectly, enhanced Na + /H + antiport activity, which, in turn, leads to Na + influx, intracellular pH modulation, and stimulation of the Na + /K + pump
Neutron scattering from 12C between 15.6 and 17.3 MeV
International Nuclear Information System (INIS)
Chen, Z.M.; Baird, K.; Howell, C.R.; Roberts, M.L.; Tornow, W.; Walter, R.L.
1993-01-01
The differential cross section σ(θ) for neutron elastic scattering from 12 C and for inelastic scattering from the 4.44 MeV state was measured at 15.57, 16.75 and 17.29 MeV. The σ(θ) data, together with published analysing power A y (θ) data, were analysed in the framework of the spherical optical model and in the coupled-channels formalism. It was concluded that the present 12 C(n,n) 12 C data and published data at higher energies appear to be well suited for determining properties of valence single-particle excitations in 11 C via an iterative-moment approach or a dispersive optical-model analysis. (author)
Energy Technology Data Exchange (ETDEWEB)
Cheng, Erjian, E-mail: ejcheng6@gmail.com [Department of Materials Physics, Zhejiang Normal University, Jinhua, Zhejiang 321004 (China); Zhou, Shiqi; Li, Mohua [Institute of Physical Chemistry, Zhejiang Normal University, Jinhua, Zhejiang 321004 (China); Li, Zhengquan, E-mail: zqli@zjnu.edu.cn [Department of Materials Physics, Zhejiang Normal University, Jinhua, Zhejiang 321004 (China); Institute of Physical Chemistry, Zhejiang Normal University, Jinhua, Zhejiang 321004 (China)
2017-07-15
Highlights: • The g-C{sub 3}N{sub 4}-based NaYF{sub 4}:Yb,Tm@TiO{sub 2} nanocomposite was fabricated by a facile approach. • The as-prepared composites exhibit enhanced activities under Vis and/or NIR lights. • Upconversion and semiconductor heterojunction lie behind the improved photocatalysis. • Photocatalytic working mechanism of this ternary nanocomposite was proposed. - Abstract: Upconversion (UC) NaYF{sub 4}:Yb,Tm nanocrystals (NCs) are capable of converting low-energy near-infrared (NIR) photons to high-energy ultraviolet (UV) and visible (Vis) photons. Integration of NaYF{sub 4}:Yb,Tm with graphitic carbon nitride (g-C{sub 3}N{sub 4}) can extend the spectral response of g-C{sub 3}N{sub 4} to the NIR range. However, photocatalytic activity of NaYF{sub 4}:Yb,Tm/g-C{sub 3}N{sub 4} is still severely limited by the high recombination rate of photo-generated (PG) electrons and holes (e{sup –}/h{sup +}) in the g-C{sub 3}N{sub 4}. Herein, we report a facile approach to fabricate a ternary nanocomposite consisting of NaYF{sub 4}:Yb,Tm, TiO{sub 2} and g-C{sub 3}N{sub 4}. When NaYF{sub 4}:Yb,Tm NCs were coated with a TiO{sub 2} shell and sequentially assembled with g-C{sub 3}N{sub 4} nanosheets (NSs), a semiconductor heterojunction can be fabricated on the UC particles. The as-prepared nanocomposites possess an enhanced photocatalytic activity under Vis and/or NIR lights due to the formation of heterojunction and UC effect. The ternary nanocomposites have been characterized in detail and their photocatalytic mechanism is proposed. Such kind of ternary nanocomposites may provide a new scenario for the design and synthesis of composite photocatalysts for efficiently utilizing the Vis/NIR lights in environmental remedy.
Hydrophilic C terminus of Salicornia europaea vacuolar Na /H ...
Indian Academy of Sciences (India)
2014-08-08
Aug 8, 2014 ... Soil salinity caused, particularly by NaCl, is a major abi- otic stress worldwide. ... sodium, plants have developed several adaptive mechanisms including accumulation of ..... and pH-dependent manner. Proc. Natl. Acad. Sci.
Directory of Open Access Journals (Sweden)
Dalton de Oliveira Fontes
2005-02-01
Full Text Available Foram utilizadas 50 leitoas híbridas, com alto potencial genético para deposição de carne magra na carcaça e peso inicial e final de 15,39 ± 0,59 e 30,93 ± 1,72 kg, respectivamente, para avaliar diferentes níveis de lisina. O delineamento experimental foi o de blocos ao acaso, com cinco tratamentos, cinco repetições e dois animais por unidade experimental. Os tratamentos corresponderam a uma ração basal com 19% de proteína bruta, suplementada com cinco níveis de L-lisina HCl, resultando em rações com 0,95; 1,05; 1,15; 1,25; e 1,35% de lisina total. Observou-se que o ganho de peso e o consumo de lisina diário elevaram-se de forma linear com o aumento do nível de lisina da ração. Houve efeito quadrático dos níveis de lisina sobre o consumo de ração diário e a conversão alimentar, que melhorou até o nível de 1,26% de lisina total (0,365%/Mcal de ED ou 1,13% (0,328%/Mcal de ED de lisina digestível, correspondendo a um consumo estimado de lisina total e digestível de 14,62 g/dia e 13,12 g/dia, respectivamente. Não se observou efeito dos tratamentos sobre a porcentagem de proteína e de água na carcaça e os níveis de uréia no soro sangüíneo, entretanto, houve efeito quadrático sobre a porcentagem de gordura e a taxa de deposição de gordura na carcaça, que diminuíram até o nível de 1,25 e 1,18% de lisina, respectivamente. Observou-se que a taxa de deposição de proteína elevou de forma linear com o aumento do nível de lisina na ração. Os níveis de lisina total que proporcionaram os melhores resultados de desempenho e qualidade de carcaça situaram-se entre 1,18 e 1,35%. Portanto, concluiu-se que a exigência de lisina total de leitoas dos 15 aos 30 kg é de 1,26% ou de 1,13% de lisina digestível, correspondendo a consumo estimado de lisina total e digestível de 14,6 e 13,1 g/dia, respectivamente.Fifty hybrid gilts, with high genetic potential for lean gain and initial and final weight of 15.39 ± 0
Influência da temperatura e da duração do molhamento foliar na severidade do míldio da cebola
Directory of Open Access Journals (Sweden)
Leandro Luiz Marcuzzo
Full Text Available RESUMO No presente trabalho foram estudadas, em condições controladas para o desenvolvimento de um modelo climático baseado na influência da temperatura (10, 15, 20 e 25°C e da duração do molhamento foliar (6, 12, 24 e 48 horas na severidade do míldio da cebola incitado por Peronospora destructor. A densidade relativa de lesões foi influenciada pela temperatura e pela duração do molhamento foliar (P<0,05. A doença foi mais severa na temperatura de 15°C. Os dados foram submetidos à análise de regressão não linear. A função beta generalizada foi usada para ajuste dos dados de severidade e temperatura, enquanto uma função logística foi escolhida para representar o efeito do molhamento foliar na severidade do míldio da cebola. A superfície de resposta obtida pelo produto das duas funções foi expressa por SE = 0,1506 * (((x-80,0614 * ((30-x0,1419 * (0,71642/(1+0,56954 * exp (-0,04460*y, onde SE, representa o valor da severidade estimada (0,1; x, a temperatura (ºC e y, o molhamento foliar (horas. Este modelo climático deverá ser validado em condições de campo para aferir o seu emprego como um sistema de previsão computacional para o míldio da cebola
Directory of Open Access Journals (Sweden)
Tunjung Nugraheni
2012-07-01
Full Text Available Latar belakang. Salah satu tahap penting perawatan saluran akar yaitu preparasi saluran akar. Pada preparasi saluran akar digunakan bahan Irigasi sodium hipoklorit (NaOCI, dengan konsentrasi 0,5%-5.25%. Penggunaan NaOCL berpengaruh pada struktur permukaan dentin saluran akar, yang selanjutnya mempengaruhi perlekatan dentin saluran akar dengan bahan pengisi saluran akar. Penelitian ini bertujuan untuk mengetahui pengaruh konsentrasi dan lama aplikasi NaOCI terhadap kekuatan geser perlekatan siler berbahan dasar resin pada dentin saluran akar. Metode Penelitian. Tiga puluh gigi premolar dipotong arah bukolingual, jaringan pulpa dibersihkan dan permukaan dentin saluran akar diratakan. Gigi difiksasi resin akrilik, sisi dentin saluran akar menghadap ke atas. Sampel dibagi menjadi 2 kelompok masing-masing 15 gigi, kelompok 1 di rendam dalam 6ml NaOCI 2,5%. Kelompok II direndam dalam 6 ml NaOCI 5%. Kelompok I dan II dibagi menjadi 3 sub kelompok lama perendaman, yaitu sub kelompok a direndam selama 5 menit, sub kelompok diremdam selama 10 menit, sub kelompok direndam selama 15 menit. Cetakan siler difiksasi pada akar gigi, dilakukan insersi siler ke dalam cetakan kemudian dimasukkan inkubaror pada suhu 370 C selama 72 jam. Pengujian kekuatan geser perlekatan menggunakan Universal Testing Machine. Hasil penelitian. Hasil uji statistik AVANA dua jalur menunjukkan kekuatan geser perlekatan siler berbahan dasar resin pada dentin saluran akar setelah diirigasi dengan konsentrasi NaOCI dan lama irigasi yang berbeda terdapat perbedaan yang bermakna (p=0,007. Uji LSD menunjukkan bahwa kekuatan geser perlekatan siler berbahan dasar resin berbeda bermakna pada kelompok yang diirigasi NaOCI 2,5% selama 5 menit dengan 15 menit,, pada kelompok yang diirigasi NaOCI 2,5% selama 10 menit dengan 15 menit, pada kelompok yang diirigasi NaOCI 5% selama 15 menit dengan kelompok yang diirigasi NaOCI 2,5% selama 15 menit serta pada kelompok yang diirigasi NaOCI 5% selama 5
Variation in hair δ13C and δ15N values in long-tailed macaques (Macaca fascicularis) from Singapore
Schillaci, Michael A.; Castellini, J. Margaret; Stricker, Craig A.; Jones-Engel, Lisa; Lee, Benjamin P.Y.-H.
2014-01-01
Much of the primatology literature on stable isotope ratios of carbon (δ13C) and nitrogen (δ15N) has focused on African and New World species, with comparatively little research published on Asian primates. Here we present hair δ13C and δ15N isotope values for a sample of 33 long-tailed macaques from Singapore. We evaluate the suggestion by a previous researcher that forest degradation and biodiversity loss in Singapore have led to a decline in macaque trophic level. The results of our analysis indicated significant spatial variability in δ13C but not δ15N. The range of variation in δ13C was consistent with a diet based on C3 resources, with one group exhibiting low values consistent with a closed canopy environment. Relative to other macaque species from Europe and Asia, the macaques from Singapore exhibited a low mean δ13C value but mid-range mean δ15N value. Previous research suggesting a decline in macaque trophic level is not supported by the results of our study.
Towards the IPCC Special Report on Global Warming of 1.5°C
Masson-Delmotte, Valérie
2017-04-01
The Intergovernemental Panel on Climate Change (IPCC) has accepted the invitation from the Paris Agreement to prepare a special report on the impacts of global warming of 1.5 °C above pre-industrial levels and related global greenhouse gas emission pathways, in the context of strengthening the global response to the threat of climate change, sustainable development, and efforts to eradicate poverty. This special report is prepared under the scientific leadership of the co-chairs of the IPCC Working Groups I, II and III, and with operational support from the Technical Support Unit of Working Group I. It will consist of 5 chapters, providing (i) framing and context, (ii) exploring mitigation pathways compatible with 1.5°C in the context of sustainable development, (iii) assessing impacts of 1.5°C global warming on natural and human systems, and (iv) options for strengthening and implementing the global response to the threat of climate change, with a final chapter on sustainable development, poverty eradication and reducing inequalities. The timeline of preparation of the report is extremely short, with four lead author meetings taking place from March 2017 to April 2018, and an approval session scheduled in September 2018. It is crucial that new knowledge is being produced and submitted / published in the literature in time for contributing new material to be assessed by the authors of the report (with deadlines in late fall 2017 and spring 2018). With respect to the additional impacts expected for 1.5°C warming compared to present-day, and impacts avoided with respect to larger warming, new research is expected to build on existing CMIP5 projections, including new information on regional change, methods to provide knowledge for the most vulnerable ecosystems and regions, but also information from ongoing projects aiming to produce large ensembles of simulations, and new simulations driven by low carbon pathways. This is important for identifying climate change
Directory of Open Access Journals (Sweden)
Simone Salata Gasparini
2007-04-01
Full Text Available Este estudo investigou o efeito da ropivacaína, da lidocaína e da associação de lidocaína e xilazina na anestesia epidural de cães. Trinta cães foram tranqüilizados com acepromazina intravenosa, distribuídos em três grupos e submetidos à anestesia epidural no espaço lombo-sacro, com lidocaína 2% com vasoconstrictor (GL, ropivacaína 1% (GR ou com xilazina associada à lidocaína (GXL. Mensuraram-se as freqüências cardíaca (FC e respiratória (f, a pressão arterial sistólica (PAS, a concentração final expirada de CO2 (EtCO2, o volume minuto (VM e a temperatura retal (T. Para avaliação da analgesia somática, utilizou-se o teste do panículo e o teste térmico a 55°C. Os protocolos produziram anestesia da região retro-umbilical, sendo que a associação XL produziu bloqueio anestésico mais cranial, porém causou bradicardia moderada. A duração da anestesia foi mais prolongada nos animais dos grupos GXL (240 min e GR (250 min, quando comparada as do grupo GL (120 min.This study was aimed at investigating the effects of ropivacaine, lidocaine or lidocaine combined with xylazine for epidural anaesthesia in dogs. Thirty dogs were sedated with acepromazine IV, divided in to three groups and submitted to lumbosacral epidural anaesthesia using 2% lidocaine with adrenaline (L or 1% ropivacaine (R or xylazine combined with lidocaine (XL. Heart and respiratory rates, systolic arterial blood pressure, EtCO2, minute volume and temperature were measured. Cutaneous anaesthesia was investigated using a forceps and thermic stimulus. All protocols produced retroumbilical anaesthesia. The combination of XL produced a more cranial anaesthetic block, with moderate bradycardia. The duration of the anaesthesia was more prolonged in animals treated with XL (240min and R (250min, when compared to L alone (120min.
Efeito idade-periodo-coorte na mortalidade por cancer do colo uterino
Directory of Open Access Journals (Sweden)
Karina Cardoso Meira
2013-06-01
Full Text Available OBJETIVO: Estimar o efeito da idade, período e coorte de nascimento na mortalidade por câncer do colo do útero. MÉTODOS: Foram analisados dados de mortalidade por câncer do colo do útero em mulheres ≥ 30 anos nos municípios do Rio de Janeiro, RJ, e São Paulo, SP, de 1980 a 2009. Os dados foram extraídos do Sistema de Informação Sobre Mortalidade. A variação percentual anual estimada foi calculada para os períodos de 1980-1994 e 1995-2009. O efeito da idade, período e coorte de nascimento foi calculado pelo modelo de regressão de Poisson, utilizando funções estimáveis: desvios, curvaturas e drift , por meio da biblioteca Epi do programa estatístico R versão 2.7.2. RESULTADOS: A taxa de mortalidade média do período por 100.000 mulheres foi 15,90 no Rio de Janeiro e 15,87 em São Paulo. Houve redução significativa na mortalidade por câncer do colo do útero nos dois períodos: no Rio de Janeiro, -1,20% (IC95% -2,20;-0,09 e -1,46% (IC95% -2,30;-0,61, e em São Paulo, -2,58% (IC95% -3,41;-1,76 e -3,30% (IC95% -4,30;-2,29. A análise da curvatura dos efeitos indicou tendência de redução do risco de morte nas sucessivas coortes (RR < 1 nas mulheres nascidas após a década de 1960. Observou-se redução acentuada no risco relativo (RR a partir dos anos 2000. CONCLUSÕES: O estudo evidenciou efeito de período na redução das taxas de mortalidade por câncer do colo do útero no período analisado, tendo em vista que houve efeito de proteção (RR < 1 a partir dos anos 2000 e nas mulheres nascidas após a década de 1960.
Fong, Wai-Ying; Ho, Chi-Chun; Poon, Wing-Tat
2017-05-12
Thiopurine intolerance and treatment-related toxicity, such as fatal myelosuppression, is related to non-function genetic variants encoding thiopurine S-methyltransferase (TPMT) and Nudix hydrolase 15 (NUDT15). Genetic testing of the common variants NUDT15:NM_018283.2:c.415C>T (Arg139Cys, dbSNP rs116855232 T allele) and TPMT: NM_000367.4:c.719A>G (TPMT*3C, dbSNP rs1142345 G allele) in East Asians including Chinese can potentially prevent treatment-related complications. Two complementary genotyping approaches, real-time PCR-high resolution melt (PCR-HRM) and PCR-restriction fragment length morphism (PCR-RFLP) analysis were evaluated using conventional PCR and Sanger sequencing genotyping as the gold standard. Sixty patient samples were tested, revealing seven patients (11.7%) heterozygous for NUDT15 c.415C>T, one patient homozygous for the variant and one patient heterozygous for the TPMT*3C non-function allele. No patient was found to harbor both variants. In total, nine out of 60 (15%) patients tested had genotypic evidence of thiopurine intolerance, which may require dosage adjustment or alternative medication should they be started on azathioprine, mercaptopurine or thioguanine. The two newly developed assays were more efficient and showed complete concordance (60/60, 100%) compared to the Sanger sequencing results. Accurate and cost-effective genotyping assays by real-time PCR-HRM and PCR-RFLP for NUDT15 c.415C>T and TPMT*3C were successfully developed. Further studies may establish their roles in genotype-informed clinical decision-making in the prevention of morbidity and mortality due to thiopurine intolerance.
Effect of chloride substitution on the order–disorder transition in NaBH4 and Na11BD4
International Nuclear Information System (INIS)
Olsen, Jørn Eirik; Karen, Pavel; Sørby, Magnus H.; Hauback, Bjørn C.
2014-01-01
Graphical abstract: Interactions that order the BD 4 - tetrahedra below the order–disorder transition became increasingly frustrated by the solute in the Na( 11 BD 4 ) 1−x Cl x solid solutions, and the order disappears at x = 0.158. Highlights: • The order–disorder transition temperature for Na(BH 4 ) 1−x Cl x and Na( 11 BD 4 ) 1−x Cl x is highly dependent on the Cl-content, x. • The transition is characterized by DSC for Na( 11 BD 4 ) 1−x Cl x for x = 0, 0.10 and 0.15. • No transition is observed for x ⩾ 0.20 on cooling to 8 K. • The crystal structures are reported for Na 11 BD 4 at room temperature and 8 K and Na( 11 BD 4 ) 1−x Cl x (x = 0.10, 0.15, 0.20 and 0.25) at 8 K from powder neutron diffraction. -- Abstract: Phase transition associated with anion disordering over two orientations in Na 11 BD 4 (NaBH 4 ) and its solid solutions with NaCl, Na( 11 BD 4 ) 1−x Cl x , is investigated with powder diffraction (neutron and synchrotron radiation), differential scanning calorimetry and Raman spectroscopy. Upon heating, the transition temperature extrapolated to zero rate of heating is 192.2 K for Na 11 BD 4 , ΔS = 4.41 J/mol K, hysteresis 1.7 K and the volume increase 0.43%. Thermal parameters of the transition in Na( 11 BD 4 ) 1−x Cl x follow a colligative-property model of an ideal solution, with x = 0.158(1) as the critical concentration at which the ordering interactions and the transition itself are eliminated. On approaching this limit, the tetragonal distortion of the ordered structure decreases somewhat towards the cubic average, and this is associated with a partial disorder of the tetrahedral anions seen by diffraction methods. In fact, a 3% disorder is already present in the pure solvent of the solid solution (Na 11 BD 4 ) at 8 K
Baumann, A; Yalçıntaş, E; Gaona, X; Polly, R; Dardenne, K; Prüßmann, T; Rothe, J; Altmaier, M; Geckeis, H
2018-03-28
The solubility of 99 Tc(iv) was investigated in dilute to concentrated carbonate solutions (0.01 M ≤ C tot ≤ 1.0 M, with C tot = [HCO 3 - ] + [CO 3 2- ]) under systematic variation of ionic strength (I = 0.3-5.0 M NaHCO 3 -Na 2 CO 3 -NaCl-NaOH) and pH m (-log[H + ] = 8.5-14.5). Strongly reducing conditions (pe + pH m ≈ 2) were set with Sn(ii). Carbonate enhances the solubility of Tc(iv) in alkaline conditions by up to 3.5 log 10 -units compared to carbonate-free systems. Solvent extraction and XANES confirmed that Tc was kept as +IV during the timeframe of the experiments (≤ 650 days). Solid phase characterization performed by XAFS, XRD, SEM-EDS, chemical analysis and TG-DTA confirmed that TcO 2 ·0.6H 2 O(am) controls the solubility of Tc(iv) under the conditions investigated. Slope analysis of the solubility data in combination with solid/aqueous phase characterization and DFT calculations indicate the predominance of the species Tc(OH) 3 CO 3 - at pH m ≤ 11 and C tot ≥ 0.01 M, for which thermodynamic and activity models are derived. Solubility data obtained above pH m ≈ 11 indicates the formation of previously unreported Tc(iv)-carbonate species, possibly Tc(OH) 4 CO 3 2- , although the likely formation of additional complexes prevents deriving a thermodynamic model valid for this pH m -region. This work provides the most comprehensive thermodynamic dataset available for the system Tc 4+ -Na + -Cl - -OH - -HCO 3 - -CO 3 2- -H 2 O(l) valid under a range of conditions relevant for nuclear waste disposal.
International Nuclear Information System (INIS)
Somera, L.; Cruz Z, E.; Roman L, J.; Hernandez A, J. M.; Murrieta S, H.
2015-10-01
Alkali halides crystals doped with rare earths or transition metals have been widely studied due to the luminescence properties. In particular, NaCl and KCl single crystals present thermally stimulated luminescence (Tl) after gamma irradiation. The NaCl and the NaCl KCl mixed crystal doped with manganese (MnCl 2 ) impurity were grown by using the Czochralski method. The emission characteristic of Mn 2+ was observed at 543 nm. The crystals were exposed between 0.02 and 10 kGy gamma dose from 60 Co irradiator. Optical absorption at room temperature shows the peaked band at 452 nm corresponding to the manganese impurity. The F bands, was ascribed to the electron trapped in the anion vacancy in the lattice, were obtained at 452 nm and 455 nm belonging to NaCl:Mn and NaCl KCl:Mn, respectively. The F band increases as the doses increase and it was bleaching by the UV light at 470 nm. The glow curves of the samples show the first glow peak between 92-103 degrees C, while the second main peak was observed at 183 degrees C for the undoped NaCl and at 148 and 165 degrees C for the NaCl:Mn and NaCl-KCl:Mn, respectively. The main peak was slowly bleaching when the irradiated sample was illuminated with F (470 nm) light. Optical bleaching confirms that the F center has an important participation in the thermoluminescent response. The glow curves structure from the thermal bleaching suggests the participation of different kind of traps. Also, the kinetics parameters such as activation energy (E), frequency factor (s) and the kinetic order (b) were investigated. (Author)
Energy Technology Data Exchange (ETDEWEB)
Somera, L.; Cruz Z, E.; Roman L, J. [UNAM, Instituto de Ciencias Nucleares, Circuito Exterior, Ciudad Universitaria, 04510 Mexico D. F. (Mexico); Hernandez A, J. M.; Murrieta S, H., E-mail: ecruz@nucleares.unam.mx [UNAM, Instituto de Fisica, Circuito Exterior, Ciudad Universitaria, 04510 Mexico D. F. (Mexico)
2015-10-15
Alkali halides crystals doped with rare earths or transition metals have been widely studied due to the luminescence properties. In particular, NaCl and KCl single crystals present thermally stimulated luminescence (Tl) after gamma irradiation. The NaCl and the NaCl KCl mixed crystal doped with manganese (MnCl{sub 2}) impurity were grown by using the Czochralski method. The emission characteristic of Mn{sup 2+} was observed at 543 nm. The crystals were exposed between 0.02 and 10 kGy gamma dose from {sup 60}Co irradiator. Optical absorption at room temperature shows the peaked band at 452 nm corresponding to the manganese impurity. The F bands, was ascribed to the electron trapped in the anion vacancy in the lattice, were obtained at 452 nm and 455 nm belonging to NaCl:Mn and NaCl KCl:Mn, respectively. The F band increases as the doses increase and it was bleaching by the UV light at 470 nm. The glow curves of the samples show the first glow peak between 92-103 degrees C, while the second main peak was observed at 183 degrees C for the undoped NaCl and at 148 and 165 degrees C for the NaCl:Mn and NaCl-KCl:Mn, respectively. The main peak was slowly bleaching when the irradiated sample was illuminated with F (470 nm) light. Optical bleaching confirms that the F center has an important participation in the thermoluminescent response. The glow curves structure from the thermal bleaching suggests the participation of different kind of traps. Also, the kinetics parameters such as activation energy (E), frequency factor (s) and the kinetic order (b) were investigated. (Author)
Escova dental e dedeira na remoção da placa bacteriana dental em cães
Lima,Tânia Berbert Ferreira; Eurides,Duvaldo; Rezende,Renata Junqueira; Milken,Vanessa Martins Fayad; Silva,Luiz Antonio Franco da; Fioravanti,Maria Clorinda Soares
2004-01-01
A placa bacteriana é fator primário na formação de gengivite, cálculo dentário, halitose e doença periodontal. Objetivou-se avaliar a quantidade de placa bacteriana dental removida pela escova dental e dedeira. Foram utilizados 60 cães machos e fêmeas de diferentes raças, idade e peso, divididos em dois grupos. O índice Logan & Boyce foi utilizados para quantificar a placa bacteriana antes e após a escovação. Observou-se diferença estatística (p0,05) entre a utilização da escova dental e ...
Ner protein of phage Mu: Assignments using {sup 13}C/{sup 15}N-labeled protein
Energy Technology Data Exchange (ETDEWEB)
Strzelecka, T.; Gronenborn, A.M.; Clore, G.M. [National Institutes of Health, Bethesda, MD (United States)
1994-12-01
The Ner protein is a small (74-amino acid) DNA-binding protein that regulates a switch between the lysogenic and lytic stages of phage Mu. It inhibits expression of the C repressor gene and down-regulates its own expression. Two-dimensional NMR experiments on uniformly {sup 15}N-labeled protein provided most of the backbone and some of the sidechain proton assignments. The secondary structure determination using two-dimensional NOESY experiments showed that Ner consists of five {alpha}-helices. However, because most of the sidechain protons could not be assigned, the full structure was not determined. Using uniformly {sup 13}C/{sup 15}N-labeled Ner and a set of three-dimensional experiments, we were able to assign all of the backbone and 98% of the sidechain protons. In particular, the CBCANH and CBCA(CO)NH experiments were used to sequentially assign the C{alpha} and C{beta} resonances; the HCCH-CTOCSY and HCCH-COSY were used to assign sidechain carbon and proton resonances.
Thammapat, Pornpisanu; Meeso, Naret; Siriamornpun, Sirithon
2015-05-15
Soaking is one of the important steps of the parboiling process. In this study, we investigated the effect of changes in different sodium chloride (NaCl) content (0%, 1.5% and 3.0% NaCl, w/v) of soaking media and soaking temperatures (30°C, 45°C and 60°C) on the phenolic compounds (α-tocopherol, γ-oryzanol) and on the fatty acids of glutinous rice, compared with unsoaked samples. Overall, the total phenolic content, total phenolic acids, γ-oryzanol, saturated fatty acid and mono-unsaturated fatty acid of the glutinous rice showed an increasing trend as NaCl content and soaking temperature increased, while α-tocopherol and polyunsaturated fatty acids decreased. Soaking at 3.0% NaCl provided the highest total phenolic content, total phenolic acids and γ-oryzanol (0.2mg GAE/g, 63.61 μg/g and 139.76 mg/100g, respectively) for the soaking treatments tested. Nevertheless, the amount of α-tocopherol and polyunsaturated fatty acid were found to be the highest (18.30/100g and 39.74%, respectively) in unsoaked rice. Copyright © 2014 Elsevier Ltd. All rights reserved.
Double molybdates in Li2MoO4 - Na2MoO4 - H2O system at 25 grad C
International Nuclear Information System (INIS)
Karov, Z.G.; Mirzoev, R.S.; Makitova, D.D.; Zhilova, S.B.; Podnek, A.G.; Urusova, R.Kh.
1989-01-01
Solubility in Li 2 MoO 4 - Na 2 MoO 4 - H 2 O system at 25 deg C is first stuied. Formation of two Li 2 MoO 4 · Na 2 MoO 4 · 4H 2 O and Li 2 MoO 4 · 3Na 2 MoO 4 · 12H 2 O compounds in a system is ascertained. Density, refractive index, viscosity, surface tension, electric conductivity and pH of saturated solutions are determined. Isothermes of mole volume, equivalent and reduced electric conductivity and seeming mole volume of salts sum in solutions are calculated. All these properties adequtely confirm the character of components interaction in a system determined by solubility method. Crystallhydrates of binary molybdates are separated, indentified and studied
Perrin-Terrin, Mathieu
2015-01-01
The GigaTracker is an hybrid silicon pixel detector built for the NA62 experiment aiming at measuring the branching fraction of the ultra-rare kaon decay K + ! p + n ̄ n at the CERN SPS. The detector has to track particles in a beam with a flux reaching 1.3 MHz/mm 2 and provide single-hit timing with 200ps RMS resolution for a total material budget of less than 1.5 X 0 . The tracker comprises three 60.8mm 27mm stations installed in vacuum ( 10$^{-6}$ mbar) and cooled with liquid C 6 F 14 circulating through micro-channels etched inside few hundred of microns thick silicon plates. Each station is composed of a 200 m m thick silicon sensor readout by 2 x 5 cus- tom 100 m m thick ASIC, called TDCPix. Each chip contains 40 x 45 asynchronous pixels, each 300 m m x 300 m m and is instrumented with 100ps bin time-to-digital converters. In order to cope with the high rate, the TDCPix is equipped with four 3.2Gb/s serialisers sending out the data. We will describe the detector and the results from the 2014 NA62 ru...
Energy Technology Data Exchange (ETDEWEB)
Wu, Junjun; Zhang, Qian; Yang, Fan; Lei, Yao; Zhang, Quanfa; Cheng, Xiaoli, E-mail: xlcheng@fudan.edu.cn
2016-10-15
We investigated soil microbial biomass and its natural abundance of δ{sup 13}C and δ{sup 15}N in aggregates (> 2000 μm, 250–2000 μm, 53–250 μm and < 53 μm) of afforested (implementing woodland and shrubland plantations) soils, adjacent croplands and open area (i.e., control) in the Danjiangkou Reservoir area of central China. The afforested soils averaged higher microbial biomass carbon (MBC) and nitrogen (MBN) levels in all aggregates than in open area and cropland, with higher microbial biomass in micro-aggregates (< 250 μm) than in macro-aggregates (> 2000 μm). The δ{sup 13}C of soil microbial biomass was more enriched in woodland soils than in other land use types, while δ{sup 15}N of soil microbial biomass was more enriched compared with that of organic soil in all land use types. The δ{sup 13}C and δ{sup 15}N of microbial biomass were positively correlated with the δ{sup 13}C and δ{sup 15}N of organic soil across aggregates and land use types, whereas the {sup 13}C and {sup 15}N enrichment of microbial biomass exhibited linear decreases with the corresponding C:N ratio of organic soil. Our results suggest that shifts in the natural {sup 13}C and {sup 15}N abundance of microbial biomass reflect changes in the stabilization and turnover of soil organic matter (SOM) and thereby imply that afforestation can greatly impact SOM accumulation over the long-term. - Highlights: • Afforested soils averaged higher microbial biomass in all aggregates than cropland. • Microbial biomass was higher in micro-aggregates than in macro-aggregates. • δ{sup 13}C and δ{sup 15}N of microbe positively correlated with δ{sup 13}C and δ{sup 15}N of organic soil. • {sup 13}C and {sup 15}N enrichment of microbe was negatively related to with soil C:N ratio.
Directory of Open Access Journals (Sweden)
Luiz Tadeu Moraes Figueiredo
1990-03-01
Full Text Available Colônias de células de mosquito Aedes albopictus C6/36 foram infectadas com 23 arbovirus, sendo 19 destes existentes no Brasil, pertencentes às famílias Togaviridae, Flaviviridae, Bunyaviridae e Rhabdoviridae. A Replicação virai foi detectada por imunofluorescência indireta com todos os vírus estudados enquanto que o efeito citopático foi observado durante a infecção por alguns destes. No teste de imunofluorescência indireta utilizou-se fluidos ascíticos imunes de camundongos, específicos para os vírus estudados. A replicação virai caracterizada por grande produção de antígeno recomenda a utilização de células C6/36 na propagação e em tentativas de isolamento desses arbovirus. A técnica de imunofluorescência ofereceu importantes subsídios na classificação e identificação de vírus que replicam nestas células.
International Nuclear Information System (INIS)
Wierzbicka-Wieczorek, Maria; Goeckeritz, Martin; Kolitsch, Uwe; Lenz, Christoph; Giester, Gerald
2015-01-01
The silicate Cs 1.86 K 1.14 DySi 6 O 15 represents a mixed tetrahedral-octahedral framework structure type based on roughly circular Si 6 O 15 rings and isolated DyO 6 octahedra. The silicate Cs 1.6 K 1.4 SmSi 6 O 15 has a layered atomic arrangement built from corrugated Si 6 O 15 layers containing four-, six- and eight-membered rings. The layers are connected by isolated SmO 6 octahedra to form a mixed tetrahedral-octahedral framework. This structure shows a close structural relationship to β-K 3 NdSi 6 O 15 and a less close one to dehydrated elpidite (Na 2 ZrSi 6 O 15 ). In both structures, Cs/K atoms occupy large voids. The silicates were obtained through high-temperature flux syntheses. Their crystal structures have been determined from single-crystal X-ray diffraction data. Cs 1.86 K 1.14 DySi 6 O 15 crystallises in R32 (no. 155) with a = 13.896(2), c = 35.623(7) Aa and V = 5957.2(17) Aa 3 , whereas Cs 1.6 K 1.4 SmSi 6 O 15 crystallises in Cmca (no. 64) with a = 14.474(3), b = 14.718(3), c = 15.231(3) Aa and V = 3244.7(11) Aa 3 . The Dy 3+ and Sm 3+ cations present in the silicates cause PL emission bands in the visible yellow-to-orange spectral range. (Copyright copyright 2015 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Directory of Open Access Journals (Sweden)
Marcelo José Milagres de Almeida
2008-05-01
Full Text Available Um experimento foi conduzido para avaliar a influência de diferentes níveis de energia metabolizável (EM e proteína bruta (PB em rações formuladas segundo o conceito de proteína ideal com suplementação de fitase sobre o desempenho e as características de carcaça de leitões dos 15 aos 35 kg. Foram utilizados 84 leitões híbridos comerciais (Agroceres × MS60 com peso médio inicial de 15,3 kg, distribuídos em delineamento de blocos casualizados, em esquema fatorial 3 × 2 + 1, composto de três níveis de energia metabolizável (3.080, 3.230 e 3.380 kcal/kg, dois de proteína bruta (14% e 16% e da suplementação com aminoácidos sintéticos e fitase (1.000 uft/kg de ração, por meio da redução do teor de cálcio em 25% e o de fósforo em 30%. A ração controle com 18% de PB foi formulada segundo o conceito de proteína bruta e sem adição de fitase, visando atender às exigências nutricionais de leitões, totalizando sete tratamentos, cada um com seis repetições e dois animais por unidade experimental. As rações não influenciaram o ganho de peso, a conversão alimentar, o consumo de energia metabolizável e os pesos dos órgãos (tanto absoluto como relativo dos leitões. O consumo de ração foi maior e a taxa de deposição de gordura foi menor nos leitões alimentados com rações contendo 3.080 kcal EM/kg. Verificaram-se redução no consumo de nitrogênio, aumento na eficiência de utilização de nitrogênio para ganho e menor teor de uréia sanguínea nos leitões alimentados com as rações com 14% PB em comparação àquelas com 18%. A redução dos níveis de EM, PB, fósforo disponível (Pd e cálcio (Ca para 3.080 kcal/kg, 14; 0,54 e 0,28%, respectivamente, em rações para leitões, formuladas segundo o conceito de proteína ideal e fitase, não prejudica o desempenho de leitões dos 15 aos 35 kg.A total of 84 barrows and females from a commercial hybrid (Agroceres × MS60, averaging 15.3 kg, was raised from
2010-04-01
... newspapers, shopping news, or magazines. 31.3306(c)(15)-1 Section 31.3306(c)(15)-1 Internal Revenue INTERNAL..., shopping news, or magazines. (a) Services of individuals under age 18. Services performed by an employee... magazines to ultimate consumers under an arrangement under which the newspapers or magazines are to be sold...
2010-04-01
... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Misrepresentation by brokers...-The-Counter Markets § 240.15c1-3 Misrepresentation by brokers, dealers and municipal securities..., as used in section 15(c)(1) of the Act, is hereby defined to include any representation by a broker...
Global drought and severe drought-affected populations in 1.5 and 2 °C warmer worlds
Directory of Open Access Journals (Sweden)
W. Liu
2018-03-01
Full Text Available The 2015 Paris Agreement proposed a more ambitious climate change mitigation target on limiting global warming to 1.5 °C instead of 2 °C above preindustrial levels. Scientific investigations on environmental risks associated with these warming targets are necessary to inform climate policymaking. Based on the Coupled Model Intercomparison Project phase 5 (CMIP5 climate models, we present the first risk-based assessment of changes in global drought and the impact of severe drought on populations from additional 1.5 and 2 °C warming conditions. Our results highlight the risk of drought on a global scale and in several hotspot regions such as the Amazon, northeastern Brazil, southern Africa and Central Europe at both 1.5 and 2 °C global warming relative to the historical period, showing increases in drought durations from 2.9 to 3.2 months. Correspondingly, more total and urban populations would be exposed to severe droughts globally (+132.5 ± 216.2 million and +194.5 ± 276.5 million total population and +350.2 ± 158.8 million and +410.7 ± 213.5 million urban populations in 1.5 and 2 °C warmer worlds and regionally (e.g., East Africa, West Africa and South Asia. Less rural populations (−217.7 ± 79.2 million and −216.2 ± 82.4 million rural populations in 1.5 and 2 °C warmer worlds would be exposed to severe drought globally under climate warming, population growth and especially the urbanization-induced population migration. By keeping global warming at 1.5 °C above the preindustrial levels instead of 2 °C, there is a decrease in drought risks (i.e., less drought duration, less drought intensity and severity but relatively more frequent drought and the affected total, urban and rural populations would decrease globally and in most regions. While challenging for both East Africa and South Asia, the benefits of limiting warming to below 1.5 °C in terms of global drought risk
Rasmussen, D. J.; Bittermann, Klaus; Buchanan, Maya K.; Kulp, Scott; Strauss, Benjamin H.; Kopp, Robert E.; Oppenheimer, Michael
2018-03-01
Sea-level rise (SLR) is magnifying the frequency and severity of extreme sea levels (ESLs) that can cause coastal flooding. The rate and amount of global mean sea-level (GMSL) rise is a function of the trajectory of global mean surface temperature (GMST). Therefore, temperature stabilization targets (e.g. 1.5 °C and 2.0 °C of warming above pre-industrial levels, as from the Paris Agreement) have important implications for coastal flood risk. Here, we assess, in a global network of tide gauges, the differences in the expected frequencies of ESLs between scenarios that stabilize GMST warming at 1.5 °C, 2.0 °C, and 2.5 °C above pre-industrial levels. We employ probabilistic, localized SLR projections and long-term hourly tide gauge records to estimate the expected frequencies of historical and future ESLs for the 21st and 22nd centuries. By 2100, under 1.5 °C, 2.0 °C, and 2.5 °C GMST stabilization, the median GMSL is projected to rise 48 cm (90% probability of 28-82 cm), 56 cm (28-96 cm), and 58 cm (37-93 cm), respectively. As an independent comparison, a semi-empirical sea level model calibrated to temperature and GMSL over the past two millennia estimates median GMSL rise within 7-8 cm of these projections. By 2150, relative to the 2.0 °C scenario and based on median sea level projections, GMST stabilization of 1.5 °C spares the inundation of lands currently home to about 5 million people, including 60 000 individuals currently residing in Small Island Developing States. We quantify projected changes to the expected frequency of historical 10-, 100-, and 500-year ESL events using frequency amplification factors that incorporate uncertainty in both local SLR and historical return periods of ESLs. By 2150, relative to a 2.0 °C scenario, the reduction in the frequency amplification of the historical 100 year ESL event arising from a 1.5 °C GMST stabilization is greatest in the eastern United States, with ESL event
Directory of Open Access Journals (Sweden)
Fernando Manzur
2011-10-01
Full Text Available La proteína C-reactiva (PCR, un marcador sensible de inflamación, es un predictor independiente de enfermedad cardiovascular futura (ECV, que es una de las principales causas de muerte en todo el mundo. El papel de la inflamación en esta entidad ha sido bien documentado en la última década, y se ha demostrado inflamación en todas las fases de la aterosclerosis, desde el inicio y el crecimiento, hasta la ruptura de la placa. La PCR es una proteína de fase aguda, altamente sensible como marcador de inflamación general. En estudios experimentales, se ha determinado la presencia de PCR en arterias que presentan lesiones ateroscleróticas. También se ha demostrado que, en forma directa, la PCR induce la producción de otras células inflamatorias y que disminuye la expresión de la óxido nítrico sintetasa. Es decir, desde el punto de vista biológico, la PCR participa en el proceso aterogénico. En adultos, la PCR, detectada con técnicas ultrasensibles (PCRus, se asocia con los factores de riesgo tradicionales y su concentración predice eventos cardiovasculares.C-reactive protein (CRP, a sensitive marker of inflammation is an independent predictor of future cardiovascular disease (CVD, which is one of the main causes of death worldwide. The role of inflammation in cardiovascular disease has been well documented in the last decade, and inflammation has been demonstrated in all stages of atherosclerosis, from its beginning and growth to the plaque rupture. CRP is an acute phase protein, highly sensitive as a marker of general inflammation. The presence of CRP has been determined in experimental studies in arteries with atherosclerotic lesions. It has been demonstrated as well that CRP induces directly the production of other inflammatory cells and decreases the expression of nitric oxide synthase. This means that from the biological standpoint CRP takes part in the atherogenic process. In adults, CRP detected through high sensitive CRP
Kerma factors and reaction cross sections for n + 12C between 15 and 18 MeV
International Nuclear Information System (INIS)
Tornow, W.; Chen, Z.M.; Baird, K.; Walter, R.L.
1988-01-01
Differential elastic and inelastic (4.44 MeV) neutron scattering cross sections from 12 C are presented at 15.6, 16.8 and 17.3 MeV. The existing 18.2 MeV differential cross-section data were combined with newly measured analysing power data to parametrise neutron scattering at this energy. The 12 C recoil kerma factors were calculated and reaction cross sections were obtained from a phase-shift analysis and coupled channel analyses in the 15.6-18.2 MeV energy range. (author)
The impact of aerosol emissions on the 1.5 °C pathways
Hienola, Anca; Partanen, Antti-Ilari; Pietikäinen, Joni-Pekka; O’Donnell, Declan; Korhonen, Hannele; Damon Matthews, H.; Laaksonen, Ari
2018-04-01
To assess the impact of anthropogenic aerosol emission reduction on limiting global temperature increase to 1.5 °C or 2 °C above pre-industrial levels, two climate modeling approaches have been used (MAGICC6, and a combination of ECHAM-HAMMOZ and the UVic ESCM), with two aerosol control pathways under two greenhouse gas (GHG) reduction scenarios. We found that aerosol emission reductions associated with CO2 co-emissions had a significant warming effect during the first half of the century and that the near-term warming is dependent on the pace of aerosol emission reduction. The modeling results show that these aerosol emission reductions account for about 0.5 °C warming relative to 2015, on top of the 1 °C above pre-industrial levels that were already reached in 2015. We found also that the decreases in aerosol emissions lead to different decreases in the magnitude of the aerosol radiative forcing in the two models. By 2100, the aerosol forcing is projected by ECHAM–UVic to diminish in magnitude by 0.96 W m‑2 and by MAGICC6 by 0.76 W m‑2 relative to 2000. Despite this discrepancy, the climate responses in terms of temperature are similar. Aggressive aerosol control due to air quality legislation affects the peak temperature, which is 0.2 °C–0.3 °C above the 1.5 °C limit even within the most ambitious CO2/GHG reduction scenario. At the end of the century, the temperature differences between aerosol reduction scenarios in the context of ambitious CO2 mitigation are negligible.
Directory of Open Access Journals (Sweden)
Délio Marques Conde
2012-12-01
Full Text Available OBJECTIVE: The values of bone mineral density (BMD were compared in postmenopausal women with and without breast cancer. METHODS: A cross-sectional study was conducted, including 51 breast cancer survivors (BCS and 71 women without breast cancer, who were non-users of hormone therapy, tamoxifen, or aromatase inhibitors. BMD T-scores and measurements in grams per centimeter squared (g/cm² were obtained at the femoral neck, trochanter, Ward's triangle, and lumbar spine. Osteopenia and osteoporosis were grouped and categorized as abnormal BMD. Unconditional logistic regression analysis was used to estimate the odds ratios (OR of abnormal BMD values as measures of association, with 95% confidence intervals (CIs, adjusting for age, years since menopause, parity, and body mass index (BMI. RESULTS: The mean age of the women with and without breast cancer was 54.7 ± 5.8 years and 58.2 ± 4.8 years (p OBJETIVO: Comparar a densidade mineral óssea (DMO de mulheres na pós-menopausa com e sem câncer de mama. MÉTODOS: Conduziu-se estudo de corte transversal, incluindo 51 mulheres com câncer de mama e 71 mulheres sem câncer de mama, não usuárias de terapia hormonal, tamoxifeno ou de inibidores da aromatase. Avaliou-se a DMO, em T-score e em gramas por centímetro quadrado (g/cm², no colo do fêmur, trocânter, triângulo de Wards e na coluna lombar. Osteopenia e osteoporose foram agrupadas e categorizadas como DMO alterada. Utilizou-se a análise de regressão logística não condicional para estimar o odds ratios (OR de DMO alterada como medida de associação, com intervalo de confiança de 95% (IC 95%, ajustando-se por idade, anos de menopausa, paridade e índice de massa corpórea (IMC. RESULTADOS: A média de idade de mulheres com e sem câncer de mama foi 54,7 ± 5,8 anos e 58,2 ± 4,8 anos (p < 0,01, respectivamente. Após ajustar por idade, paridade e IMC, DMO alterada no colo do fêmur (OR ajustado: 4,8; IC 95%: 1,5-15,4, trocânter (OR
Energy Technology Data Exchange (ETDEWEB)
Li, W.-L. [Department of Mechanical Engineering, National Kaohsiung University of Applied Sciences, 415 Chien-Kung Road, Kaohsiung 80782, Taiwan (China); Institute of Nanotechnology and Microsystems Engineering, National Cheng Kung University, 1 Ta-Hsueh Road, Tainan 70101, Taiwan (China); Chen, Y.-R.; Chang, K.-M. [Department of Mechanical Engineering, National Kaohsiung University of Applied Sciences, 415 Chien-Kung Road, Kaohsiung 80782, Taiwan (China); Liu, C.-Y.; Hon, M.-H. [Department of Materials Science and Engineering, National Cheng Kung University, 1 Ta-Hsueh Road, Tainan 70101, Taiwan (China); Wang, M.-C. [Faculty of Fragrance and Cosmetics, Kaohsiung Medical University, 100 Shihchuan 1st Road, Kaohsiung 80728, Taiwan (China)], E-mail: mcwang@kmu.edu.tw
2008-08-11
The microstructure and adhesion strength of the Sn-9Zn-1.5Ag-xBi (x = 0 wt% and 2 wt%)/Cu interface after electrochemical polarization have been studied by X-ray diffraction (XRD), scanning electron microscopy (SEM) and pull-off testing. The equilibrium potentials of Sn-9Zn-1.5Ag/Cu and Sn-9Zn-1.5Ag-2Bi/Cu are -1.31 V{sub sce} and -1.22 V{sub sce}, respectively, indicating that Sn-9Zn-1.5Ag-2Bi/Cu has a better corrosion resistance than that of Sn-9Zn-1.5Ag/Cu. The intermetallic compounds of Cu{sub 6}Sn{sub 5}, Cu{sub 5}Zn{sub 8} and Ag{sub 3}Sn are formed at the soldered interface between the Sn-9Zn-1.5Ag-xBi solder alloy and the Cu substrate. The scallop-shaped Cu{sub 6}Sn{sub 5} is close to the Cu substrate and the scallop-shaped Cu{sub 5}Zn{sub 8} is found at the interface in the solder matrix after soldering at 250 deg. C for 10 s. The corrosion products are ZnCl{sub 2}, SnCl{sub 2} and ZnO. On the other hand, pits are also formed on the surface of both solder alloys. The interfacial adhesion strength of the Sn-9Zn-1.5Ag/Cu and Sn-9Zn-1.5Ag-2Bi/Cu decreases from 8.27 {+-} 0.56 MPa and 12.67 {+-} 0.45 MPa to 4.78 {+-} 0.45 MPa and 8.14 {+-} 0.38 MPa, respectively, after electrochemical polarization in a 3.5 wt% NaCl solution. The fracture path of the Sn-9Zn-1.5Ag-2Bi/Cu is along the solder alloy/ZnO and solder/Cu{sub 6}Sn{sub 5} interfaces.
Stable isotope analysis (δ (13)C and δ (15)N) of soil nematodes from four feeding groups.
Melody, Carol; Griffiths, Bryan; Dyckmans, Jens; Schmidt, Olaf
2016-01-01
Soil nematode feeding groups are a long-established trophic categorisation largely based on morphology and are used in ecological indices to monitor and analyse the biological state of soils. Stable isotope ratio analysis ((13)C/(12)C and (15)N/(14)N, expressed as δ (13)C and δ (15)N) has provided verification of, and novel insights into, the feeding ecology of soil animals such as earthworms and mites. However, isotopic studies of soil nematodes have been limited to date as conventional stable isotope ratio analysis needs impractically large numbers of nematodes (up to 1,000) to achieve required minimum sample weights (typically >100 µg C and N). Here, micro-sample near-conventional elemental analysis-isotopic ratio mass spectrometry (μEA-IRMS) of C and N using microgram samples (typically 20 µg dry weight), was employed to compare the trophic position of selected soil nematode taxa from four feeding groups: predators (Anatonchus and Mononchus), bacterial feeders (Plectus and Rhabditis), omnivores (Aporcelaimidae and Qudsianematidae) and plant feeder (Rotylenchus). Free-living nematodes were collected from conventionally and organically managed arable soils. As few as 15 nematodes, for omnivores and predators, were sufficient to reach the 20 µg dry weight target. There was no significant difference in δ (15)N (p = 0.290) or δ (13)C (p = 0.706) between conventional and organic agronomic treatments but, within treatments, there was a significant difference in N and C stable isotope ratios between the plant feeder, Rotylenchus (δ (15)N = 1.08 to 3.22 mUr‰, δ (13)C = -29.58 to -27.87 mUr) and all other groups. There was an average difference of 9.62 mUr in δ (15)N between the plant feeder and the predator group (δ (15)N = 9.89 to 12.79 mUr, δ (13)C = -27.04 to -25.51 mUr). Isotopic niche widths were calculated as Bayesian derived standard ellipse areas and were smallest for the plant feeder (1.37 mUr(2)) and the predators (1.73 mUr(2)), but largest for
Stable isotope analysis (δ13C and δ15N of soil nematodes from four feeding groups
Directory of Open Access Journals (Sweden)
Carol Melody
2016-09-01
Full Text Available Soil nematode feeding groups are a long-established trophic categorisation largely based on morphology and are used in ecological indices to monitor and analyse the biological state of soils. Stable isotope ratio analysis (13C/12C and 15N/14N, expressed as δ13C and δ15N has provided verification of, and novel insights into, the feeding ecology of soil animals such as earthworms and mites. However, isotopic studies of soil nematodes have been limited to date as conventional stable isotope ratio analysis needs impractically large numbers of nematodes (up to 1,000 to achieve required minimum sample weights (typically >100 µg C and N. Here, micro-sample near-conventional elemental analysis–isotopic ratio mass spectrometry (μEA–IRMS of C and N using microgram samples (typically 20 µg dry weight, was employed to compare the trophic position of selected soil nematode taxa from four feeding groups: predators (Anatonchus and Mononchus, bacterial feeders (Plectus and Rhabditis, omnivores (Aporcelaimidae and Qudsianematidae and plant feeder (Rotylenchus. Free-living nematodes were collected from conventionally and organically managed arable soils. As few as 15 nematodes, for omnivores and predators, were sufficient to reach the 20 µg dry weight target. There was no significant difference in δ15N (p = 0.290 or δ13C (p = 0.706 between conventional and organic agronomic treatments but, within treatments, there was a significant difference in N and C stable isotope ratios between the plant feeder, Rotylenchus (δ15N = 1.08 to 3.22 mUr‰, δ13C = –29.58 to –27.87 mUr and all other groups. There was an average difference of 9.62 mUr in δ15N between the plant feeder and the predator group (δ15N = 9.89 to 12.79 mUr, δ13C = –27.04 to –25.51 mUr. Isotopic niche widths were calculated as Bayesian derived standard ellipse areas and were smallest for the plant feeder (1.37 mUr2 and the predators (1.73 mUr2, but largest for omnivores (3.83 mUr2
Measurement of resonance production in pion-carbon interactions at 158 and 350 GeV/c with NA61/SHINE
Energy Technology Data Exchange (ETDEWEB)
Herve, Alexander [KIT, Karlsruhe (Germany); Collaboration: NA61/SHINE-Collaboration
2016-07-01
The interpretation of extensive air shower measurements, produced by ultra-high energy cosmic rays, relies on the correct modelling of the hadron-air interactions that occur during the shower development. The majority of hadronic particles is produced at equivalent beam energies below the TeV range. NA61/SHINE is a fixed target experiment at the CERN Super Proton Synchrotron, studying hadron production in hadron-nucleus and nucleus-nucleus collisions to provide valuable contributions to a number of subjects, from neutrino through cosmic-ray to heavy-ion physics. Pion-Carbon interactions have been performed, at 158 and 350 GeV/c, to give precise particle production measurements for the most numerous projectile in air showers, the π meson. The ability to measure the production of resonances, such as the ρ{sup 0} and ω mesons, is particularly important to predict the number of muons produced in air showers. In this contribution we present updated results of resonance spectra at 158 and 350 GeV/c measured by NA61/SHINE.
A intervenção da célula epitelial na asma The role of the epithelial cell in asthma
Directory of Open Access Journals (Sweden)
Anabela Mota Pinto
2009-05-01
Full Text Available Faz -se uma revisão da intervenção da célula epitelial brônquica na fisiopatologia da asma. O epitelio que reveste as vias respiratórias actua como uma barreira física, separando o meio externo do meio interno pulmonar, controla a permeabilidade intercelular e transcelular, e, deste modo, a acessibilidade dos agressores inalantes as células apresentadoras de antigenio envolvidas na resposta imunoinflamatoria. As células epiteliais unidas por tight junctions contribuem para a integridade das vias aéreas e expressam poliovirus receptor-related protein (PRR, toll like receptors (TLR e protease -activated receptors (PAR, que reconhecem agentes bacterianos e alergenios. A sua disfuncao transforma -as em fonte de mediadores intervenientes na inflamação. A interacção bidireccional entre, por um lado, o epitelio e os elementos constitutivos do brônquio e por outro, as partículas inaladas, tem subjacente a formação de uma unidade, com identidade propria designada EMTU - epithelial mesenchymal trophic unit. Esta extensa intervencao coloca a célula epitelial no centro de accao da cronicidade e remodelacao do processo asmático. As doenças infecciosas e o stress ambiental sao capazes de induzir alterações a nível da célula epitelial susceptíveis de modificar a sua resposta a estimulações futuras, nomeadamente a ampliar a resposta a outras agressões infecciosas por acção sinérgica das vias de sinalização. O epitelio brônquico tem assim funções de barreira que lhe permite exercer uma permeabilidade selectiva, a nível intracelular e transcelular, e ainda metabolicamente activo pelas capacidade de produzir mediadores quimiotacticos e citocinas envolvidos no recrutamento e na activação celular, com repercussão na broncomotricidade e na remodelação da parede brônquica.It is done a review of the intervention of the epithelial bronchial cell in the pathophysiology of asthma. The respiratory epithelium acts as a physical
Mohammad, Mehedi Bin; Brooks, Geoffrey Alan; Rhamdhani, Muhammad Akbar
2018-02-01
A simultaneous thermal analyzer (STA) was used to observe the transition and degradation events of LiNO3, NaNO3, KNO3, and binary NaNO3-KNO3 salts for potential use as phase change materials (PCMs) and heat transfer fluid (HTF). Samples were heated from 50 °C to 800 °C at 10 °C/min scanning rate in three atmospheres (argon, air, and oxygen) using an STA to observe decomposition behavior. Thermal stability increased for all salts at high partial pressure of O2 ( P_{{{O}2 }} = 1.0) compared to inert argon ( P_{{{O}2 }} = 0). O2, N2, NO, N2O, and NO2 were main evolved gases during nitrate decomposition. NO and O2 started to evolve at approximately the same temperature after melting, indicating that primary and secondary decomposition reactions were concurrent and overlapping. The solid-solid transition, liquidus and solidus temperatures, heat of transition, heat of melting, and heat of solidification were obtained at various heating-cooling rates (1, 2, 4, 5, 6, 8, 10, and 15 °C/min) using an STA. At all heating-cooling rates, a small gap exists between liquidus and solidus temperatures for all samples due to the salts exhibiting supercooling phenomena. This study showed that the degradation point depends on the blanket atmosphere top of the molten salts and that heating rates have a minor effect on transition events (peaks height, peaks width, and transition enthalpies).
Mohammad, Mehedi Bin; Brooks, Geoffrey Alan; Rhamdhani, Muhammad Akbar
2018-06-01
A simultaneous thermal analyzer (STA) was used to observe the transition and degradation events of LiNO3, NaNO3, KNO3, and binary NaNO3-KNO3 salts for potential use as phase change materials (PCMs) and heat transfer fluid (HTF). Samples were heated from 50 °C to 800 °C at 10 °C/min scanning rate in three atmospheres (argon, air, and oxygen) using an STA to observe decomposition behavior. Thermal stability increased for all salts at high partial pressure of O2 ( P_{{{O}2 }} = 1.0) compared to inert argon ( P_{{{O}2 }} = 0). O2, N2, NO, N2O, and NO2 were main evolved gases during nitrate decomposition. NO and O2 started to evolve at approximately the same temperature after melting, indicating that primary and secondary decomposition reactions were concurrent and overlapping. The solid-solid transition, liquidus and solidus temperatures, heat of transition, heat of melting, and heat of solidification were obtained at various heating-cooling rates (1, 2, 4, 5, 6, 8, 10, and 15 °C/min) using an STA. At all heating-cooling rates, a small gap exists between liquidus and solidus temperatures for all samples due to the salts exhibiting supercooling phenomena. This study showed that the degradation point depends on the blanket atmosphere top of the molten salts and that heating rates have a minor effect on transition events (peaks height, peaks width, and transition enthalpies).
Down-Regulation of the Na+-Coupled Phosphate Transporter NaPi-IIa by AMP-Activated Protein Kinase
Directory of Open Access Journals (Sweden)
Miribane Dërmaku-Sopjani
2013-11-01
Full Text Available Background/Aims: The Na+-coupled phosphate transporter NaPi-IIa is the main carrier accomplishing renal tubular phosphate reabsorption. It is driven by the electrochemical Na+ gradient across the apical cell membrane, which is maintained by Na+ extrusion across the basolateral cell membrane through the Na+/K+ ATPase. The operation of NaPi-IIa thus requires energy in order to avoid cellular Na+ accumulation and K+ loss with eventual decrease of cell membrane potential, Cl- entry and cell swelling. Upon energy depletion, early inhibition of Na+-coupled transport processes may delay cell swelling and thus foster cell survival. Energy depletion is sensed by the AMP-activated protein kinase (AMPK, a serine/threonine kinase stimulating several cellular mechanisms increasing energy production and limiting energy utilization. The present study explored whether AMPK influences the activity of NAPi-IIa. Methods: cRNA encoding NAPi-IIa was injected into Xenopus oocytes with or without additional expression of wild-type AMPK (AMPKα1-HA+AMPKβ1-Flag+AMPKγ1-HA, of inactive AMPKαK45R (AMPKα1K45R+AMPKβ1-Flag+AMPKγ1-HA or of constitutively active AMPKγR70Q (AMPKα1-HA+AMPKβ1-Flag+AMPKγ1R70Q. NaPi-IIa activity was estimated from phosphate-induced current in dual electrode voltage clamp experiments. Results: In NaPi-IIa-expressing, but not in water-injected Xenopus oocytes, the addition of phosphate (1 mM to the extracellular bath solution generated a current (Ip, which was significantly decreased by coexpression of wild-type AMPK and of AMPKγR70Q but not of AMPKαK45R. The phosphate-induced current in NaPi-IIa- and AMPK-expressing Xenopus ooocytes was significantly increased by AMPK inhibitor Compound C (20 µM. Kinetic analysis revealed that AMPK significantly decreased the maximal transport rate. Conclusion: The AMP-activated protein kinase AMPK is a powerful regulator of NaPi-IIa and thus of renal tubular phosphate transport.
Influência do hipoclorito de sódio como fungicida na absorção de cálcio e silício pela soja
Resende, Anselmo; Souza, Jurandir Rodrigues de; Souza, Plínio Itamar de Mello de; Blum, Luiz Eduardo Bassay
2009-01-01
O objetivo da pesquisa foi verificar a ação do hipoclorito de sódio (NaOCl) no combate ao oídio na soja, quando aplicado só ou associado ao uso de fungicida, e a possível influência na absorção de cálcio e silício pela soja. Foram realizadas oito aplicações de NaOCl em parcelas que receberam apenas o sanitizante, com concentrações de 0,2%, 0,4% e 0,6%, parcelas que receberam essas mesmas concentrações e duas aplicações de fungicida e uma parcela controle. Não foram observadas diferenças es...
Sanna, Aimaro; Steel, Luc; Maroto-Valer, M Mercedes
2017-03-15
The use of NaHSO 4 to leach out Mg fromlizardite-rich serpentinite (in form of MgSO 4 ) and the carbonation of CO 2 (captured in form of Na 2 CO 3 using NaOH) to form MgCO 3 and Na 2 SO 4 was investigated. Unlike ammonium sulphate, sodium sulphate can be separated via precipitation during the recycling step avoiding energy intensive evaporation process required in NH 4 -based processes. To determine the effectiveness of the NaHSO 4 /NaOH process when applied to lizardite, the optimisation of the dissolution and carbonation steps were performed using a UK lizardite-rich serpentine. Temperature, solid/liquid ratio, particle size, concentration and molar ratio were evaluated. An optimal dissolution efficiency of 69.6% was achieved over 3 h at 100 °C using 1.4 M sodium bisulphate and 50 g/l serpentine with particle size 75-150 μm. An optimal carbonation efficiency of 95.4% was achieved over 30 min at 90 °C and 1:1 magnesium:sodium carbonate molar ratio using non-synthesised solution. The CO 2 sequestration capacity was 223.6 g carbon dioxide/kg serpentine (66.4% in terms of Mg bonded to hydromagnesite), which is comparable with those obtained using ammonium based processes. Therefore, lizardite-rich serpentinites represent a valuable resource for the NaHSO 4 /NaOH based pH swing mineralisation process. Copyright © 2016 Elsevier Ltd. All rights reserved.
Tanaka, Katsumasa; O'Neill, Brian C.
2018-04-01
The Paris Agreement stipulates that global warming be stabilized at well below 2 °C above pre-industrial levels, with aims to further constrain this warming to 1.5 °C. However, it also calls for reducing net anthropogenic greenhouse gas (GHG) emissions to zero during the second half of this century. Here, we use a reduced-form integrated assessment model to examine the consistency between temperature- and emission-based targets. We find that net zero GHG emissions are not necessarily required to remain below 1.5 °C or 2 °C, assuming either target can be achieved without overshoot. With overshoot, however, the emissions goal is consistent with the temperature targets, and substantial negative emissions are associated with reducing warming after it peaks. Temperature targets are put at risk by late achievement of emissions goals and the use of some GHG emission metrics. Refinement of Paris Agreement emissions goals should include a focus on net zero CO2—not GHG—emissions, achieved early in the second half of the century.
Crystal structure of polyphosphates NaCd(PO3)3 and NaMn(PO3)3
International Nuclear Information System (INIS)
Murashova, E.V.; Chudinova, N.N.
1997-01-01
Crystal structure of NaCd(PO 3 ) 3 (1) and NaMn(PO 3 ) 3 (2) isostructural polyphosphates was determined for twin samples. Rhombic lattice parameters of (1): a = 14.678, b = 14.669, c = 14.705 A, sp. gr. P2 1 2 1 2 1 , Z = 16. The structure of compounds is of frame type. Polyphosphate chain with repetition period of 24 PO 4 tetrahedrons contacts with NaO 6 and M 2 O 6 octahedrons by means of common oxygen vertices. Similarities and differences in structure of mentioned polyphosphates and earlier analyzed NaMg(PO 3 ) 3 polyphosphate are noted [ru
Directory of Open Access Journals (Sweden)
Leme Marcelo Betim Paes
2002-01-01
Full Text Available OBJETIVO: Estudar os efeitos da colostomia proximal terminal na cicatrização de anastomoses colo-cólicas em ratos. MÉTODOS: 36 ratas foram divididas em 2 grupos: grupo controle (C com 12 animais submetidos à ressecção cólica segmentar seguida de anastomose colo-cólica primária, e grupo colostomizado (CZ com 24 animais submetidos ao mesmo procedimento do grupo C complementado com uma colostomia proximal. A cicatrização anastomótica foi avaliada em dois períodos distintos, 2º e 7º dias de pós-operatório (PO, em relação à deiscência anastomótica, aderências, epitelização mucosa, pressão de ruptura e variáveis histológicas. Os resultados foram submetidos a estudo estatístico considerando-se como significante valores de p<0,05. RESULTADOS: A deiscência, principal variável analisada nessa pesquisa, não ocorreu em ambos os grupos estudados. As aderências foram significantemente mais intensas no grupo C no 7º PO. Nos dois grupos, a ruptura intestinal sempre ocorreu ao nível da anastomose no 2º PO; no 7º PO, a maior parte das rupturas aconteceram na alça cólica fora da zona anastomótica (100% do grupo C e 70% do grupo CZ. A análise das demais variáveis demonstrou equivalência entre os dois grupos. CONCLUSÃO: Os resultados dessa pesquisa não demonstraram diferença significante entre anastomoses colo-cólicas em ratos associados ou não à colostomia proximal.
Bittner, Beate; González, Roberto Carlos Bravo; Walter, Isabelle; Kapps, Martin; Huwyler, Jörg
2003-05-01
In the current investigation, the alkaloid colchicine was administered intravenously to male Wistar rats both as a solution in isotonic sodium chloride (NaCl 0.9%, control group) and in NaCl 0.9%:Solutol HS 15 (95:5) at 1.5 mg/kg. At predetermined time points, plasma and urine were collected from the animals and analysed for colchicine and its demethylated metabolites by LC/MS-MS. In the presence of Solutol HS 15, colchicine clearance (CI) was significantly decreased and its maximum plasma concentration (c(max)) was significantly increased as compared to the control group (CI: 15.6+/-7.0 ml/min/kg vs 34.3+/-2.3 ml/min/kg; c(max) 3055.1+/-587.4 h vs 1260.1+/-223.7 h; pSolutol HS 15 treated group (41.50+/-3.23 vs 1.17+/-0.41% of total dose; pSolutol HS 15 compared with surfactant-free incubations (overall means: 72.25+/-0.50% for FF, 0.80+/-0.02 for lambda, 0.46+/-0.04 for K(e)). In vitro, in rat hepatocytes, the clearance of colchicine was significantly reduced at 0.003% Solutol HS 15 present in the incubation medium (0.86+/-0.15 microl/min/10(-6) cells vs 1.46+/-0.06 microl/min/10(-6) cells). As colchicine exhibits a comparatively high aqueous solubility, an impact of Solutol HS 15 on the solubility of the alkaloid is very unlikely to be a reason for the observed effect. Therefore, our results indicate that the most likely reasons for the changed pharmacokinetic behaviour of colchicine in the presence of Solutol HS 15 are alterations of metabolism and/or transport as well as distribution and elimination processes. Copyright 2003 John Wiley & Sons, Ltd.
The loss of Na and Cl during the pyrolysis of a NaCl-loaded brown coal sample
Energy Technology Data Exchange (ETDEWEB)
Mody, D.; Li, C.Z.
1999-07-01
A Victorian brown coal was physically loaded with NaCl and pyrolyzed in a quartz fluidized-bed reactor. The fluidized-bed reactor was equipped with a quartz frit in the freeboard zone to enable the total devolatilization of the coal particles. The introduction of NaCl into the coal has caused only minor reductions in the weight loss. A significant amount of chlorine was volatilized during pyrolysis at temperatures as low as 200 C. At temperatures around 400--500 C where the loss of sodium was not very significant, about 70% of chlorine was volatilized from the coal particles. With the volatilization of chlorine at this temperature level, sodium must have been bonded to the char matrix. With increasing temperature, the volatilization of chlorine decreased and then increased again, whereas the volatilization of sodium increased monotonically with increasing temperature. Almost all the Na in coal could be volatilized at temperatures higher than about 800 C. These experimental results clearly indicate that chlorine and Na interacted strongly with coal/char at high temperatures. Na and Cl in the coal did not volatilize as NaCl molecules. Significant amounts of species containing a COO-group such as acetate, formate and oxalate were observed in the pyrolysis products although the exact forms of these species (i.e., as acids, salts or esters) in the pyrolysis product remain unknown. The yields of the species containing a COO-group decreased with increasing temperature, possibly due to the intensified thermal cracking reactions at high temperatures.
Directory of Open Access Journals (Sweden)
O. V. Bevza
2013-04-01
Full Text Available The inhibition of the Na+,K+-АТРase activity of the myometrium cell plasma membranes with calixarene С-107 (5,17-diamino(2-pyridylmethylphosphono-11,23-di-tret-butyl-26,28-dihydroxy-25,27-dipropoxycalix[4]arene was investigated. It has been shown that calixarene С-107 reduced the Na+,K+-АТРase activity more efficiently than ouabain did, while it did not practically influence the “basal” Mg2+-АТРase activity of the same membrane. The magnitude of the cofficient of inhibition I0.5 was 33 ± 4 nМ, Hill coefficient was 0.38 ± 0.06. The model calixarene C-150 – the calixarene “scaffold” (26,28-dihydroxy-25,27-dipropoxycalix[4]arene, and the model compound М-3 (4-hydroxyaniline(2-pyridinemethylphosphonic acid – a fragment of the calixarene С-107, had practically no influence on the enzymatic activity of Na+,K+-АТРase and Mg2+-АТРаse. We carried out the computer simulation of interaction of calixarenes C-107 and the mentioned model compound with ligand binding sites of the Na+,K+-АТРase of plasma membrane and structure foundation of their intermolecular interaction was found out. The participation of hydrogen, hydrophobic, electrostatic and π-π (stacking interaction between calixarene and enzyme aminoacid residues, some of which are located near the active center of Na+,K+-АТРase, was discussed.
International Nuclear Information System (INIS)
Weihmann, Jenny; Mansfeldt, Tim; Schulte, Ulrike
2007-01-01
The occurrence of iron-cyanide complexes in the environment is of concern, since they are potentially hazardous. In order to determine the source of iron-cyanide complexes in contaminated soils and wastes, we developed a method based on the stable isotope ratios 13 C/ 12 C and 15 N/ 14 N of the complexed cyanide-ion (CN - ). The method was tested on three pure chemicals and two industrials wastes: blast-furnace sludge (BFS) and gas-purifier waste (GPW). The iron-cyanide complexes were converted into the solid cupric ferrocyanide, Cu 2 [Fe(China) 6 ].7H 2 O, followed by combustion and determination of the isotope-ratios by continuous flow isotope ratio mass spectrometry. Cupric ferrocyanide was obtained from the materials by (i) an alkaline extraction with 1 M NaOH and (ii) a distillate digestion. The [Fe(China) 6 ] 4- of the alkaline extraction was precipitated after adding Cu 2+ . The CN - of the distillate digestion was at first complexed with Fe 2+ under inert conditions and then precipitated after adding Cu 2+ . The δ 13 C-values obtained by the two methods differed slightly up to 1-3 per mille for standards and BFS. The difference was larger for alkaline-extracted GPW (4-7 per mille ), since non-cyanide C was co-extracted and co-precipitated. Therefore the distillate digestion technique is recommended when determining the C isotope ratios in samples rich in organic carbon. Since the δ 13 C-values of BFS are in the range of -30 to -24 per mille and of -17 to -5 per mille for GPW, carbon seems to be a suitable tracer for identifying the source of cyanide in both wastes. However, the δ 15 N-values overlapped for BFS and GPW, making nitrogen unsuitable as a tracer
DEFF Research Database (Denmark)
Meinild, A K; Loo, D D; Hirayama, B A
2001-01-01
. The affinity for Na(+) was unchanged compared to that of hSGLT1, whereas the sugar affinity was reduced and sugar specificity was altered. There was a reduction in the turnover rate of the transporter, and in contrast to that of hSGLT1, the turnover rate depended on the sugar molecule. Exposure of A166C......We mutated residue 166, located in the putative Na(+) transport pathway between transmembrane segments 4 and 5 of human Na(+)/glucose cotransporter (hSGLT1), from alanine to cysteine (A166C). A166C was expressed in Xenopus laevis oocytes, and electrophysiological methods were used to assay function...... to MTSEA and MTSET, but not MTSES, abolished sugar transport. Accessibility of A166C to alkylating reagents was independent of protein conformation, indicating that the residue is always accessible from the extracellular surface. Sugar and phlorizin did not protect the residue from being alkylated...
Directory of Open Access Journals (Sweden)
Avila G
2016-12-01
Full Text Available The aim of this study was to evaluate if the addition of L-carnitine and pyruvate to two semen transport extenders (Kenney and Kenney modified by Tyrodes is able to maintain sperm parameters for 24 h at 5 ºC and 15 ºC. Semen was obtained from 3 stallions (n=3; r=2 and at time 0 and after 24 h of cooling, the following parameters evaluated: total and progressive motility (CASA, viability and acrosome status (FITC-PNA-PI, membrane function (HOS, and DNA with Toluidine Blue stain (TB and the Sperm Chromatin Dispersion assay (SCD. Each temperature was individually analyzed using a factorial design with a 5% significance level. No interactions were observed. For the moment, the Kenney extender with the addition of L-carnitine and pyruvate showed the best results for maintaining most sperm parameters for 24 h at both 5 ºC and 15 ºC.
Proteína C reactiva plasmática en el segundo trimestre para predicción de parto pretérmino
Directory of Open Access Journals (Sweden)
I. Suarez-Torres
2016-06-01
Conclusión: Las concentraciones plasmáticas de proteína C reactiva en el segundo trimestre están elevadas en las embarazadas que posteriormente presentan parto pretérmino, pero no son útiles en la predicción de este.
Directory of Open Access Journals (Sweden)
A. Suryanto
2015-07-01
Full Text Available The purpose of this research was to study the effect of reaction time and NaOH catalyst in transesterification of coconut oil enhanced by microwave and to obtain a biodiesel. Reaction was conducted in batch reactor which equipped by microwave. Coconut oil contains saturated fatty acids about 70% with medium chain (C8-C14, especially lauric acid and myristic acid. The reaction was initiated by mixing oil and methanol with oil to methanol mole ratios of 1:3, 1:6, 1:9 and 1:12, catalyst concentration of 0.1, 0.15, 0.2, 0.25 and 0.3 wt.%, as well as setting electrical power at 100, 264 and 400 W. The reaction times were of 0.5, 1, 1.5, 2, 2.5, 3 and 3.5 min. The result showed that microwave could be employed as an energy source and was able to accelerate the transesterification process to produce biodiesel using NaOH catalyst. The biodiesel yields increase with increasing microwave power. The highest yield of biodiesel obtained was of 97.37% with reaction conditions set at 0.2 wt.% catalyst, a reaction time of 2 min, molar ratio of methanol to oil 1:9 and microwave power of 400 watt. © 2015 BCREC UNDIP. All rights reservedReceived: 15th January 2015; Revised: 10th March 2015; Accepted: 15th March 2015How to Cite: Suryanto, A., Suprapto, S., Mahfud, M. (2015. Production Biodiesel from Coconut Oil Using Microwave: Effect of Reaction Time on Transesterification Reaction by NaOH Catalyst. Bulletin of Chemical Reaction Engineering & Catalysis, 10 (2: 162-168. (doi:10.9767/bcrec.10.2.8080.162-168 Permalink/DOI: http://dx.doi.org/10.9767/bcrec.10.2.8080.162-168
Stabilization of global temperature at 1.5°C and 2.0°C: implications for coastal areas.
Nicholls, Robert J; Brown, Sally; Goodwin, Philip; Wahl, Thomas; Lowe, Jason; Solan, Martin; Godbold, Jasmin A; Haigh, Ivan D; Lincke, Daniel; Hinkel, Jochen; Wolff, Claudia; Merkens, Jan-Ludolf
2018-05-13
The effectiveness of stringent climate stabilization scenarios for coastal areas in terms of reduction of impacts/adaptation needs and wider policy implications has received little attention. Here we use the Warming Acidification and Sea Level Projector Earth systems model to calculate large ensembles of global sea-level rise (SLR) and ocean pH projections to 2300 for 1.5°C and 2.0°C stabilization scenarios, and a reference unmitigated RCP8.5 scenario. The potential consequences of these projections are then considered for global coastal flooding, small islands, deltas, coastal cities and coastal ecology. Under both stabilization scenarios, global mean ocean pH (and temperature) stabilize within a century. This implies significant ecosystem impacts are avoided, but detailed quantification is lacking, reflecting scientific uncertainty. By contrast, SLR is only slowed and continues to 2300 (and beyond). Hence, while coastal impacts due to SLR are reduced significantly by climate stabilization, especially after 2100, potential impacts continue to grow for centuries. SLR in 2300 under both stabilization scenarios exceeds unmitigated SLR in 2100. Therefore, adaptation remains essential in densely populated and economically important coastal areas under climate stabilization. Given the multiple adaptation steps that this will require, an adaptation pathways approach has merits for coastal areas.This article is part of the theme issue 'The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'. © 2018 The Authors.
Stabilization of global temperature at 1.5°C and 2.0°C: implications for coastal areas
Nicholls, Robert J.; Brown, Sally; Goodwin, Philip; Wahl, Thomas; Lowe, Jason; Solan, Martin; Godbold, Jasmin A.; Haigh, Ivan D.; Lincke, Daniel; Hinkel, Jochen; Wolff, Claudia; Merkens, Jan-Ludolf
2018-05-01
The effectiveness of stringent climate stabilization scenarios for coastal areas in terms of reduction of impacts/adaptation needs and wider policy implications has received little attention. Here we use the Warming Acidification and Sea Level Projector Earth systems model to calculate large ensembles of global sea-level rise (SLR) and ocean pH projections to 2300 for 1.5°C and 2.0°C stabilization scenarios, and a reference unmitigated RCP8.5 scenario. The potential consequences of these projections are then considered for global coastal flooding, small islands, deltas, coastal cities and coastal ecology. Under both stabilization scenarios, global mean ocean pH (and temperature) stabilize within a century. This implies significant ecosystem impacts are avoided, but detailed quantification is lacking, reflecting scientific uncertainty. By contrast, SLR is only slowed and continues to 2300 (and beyond). Hence, while coastal impacts due to SLR are reduced significantly by climate stabilization, especially after 2100, potential impacts continue to grow for centuries. SLR in 2300 under both stabilization scenarios exceeds unmitigated SLR in 2100. Therefore, adaptation remains essential in densely populated and economically important coastal areas under climate stabilization. Given the multiple adaptation steps that this will require, an adaptation pathways approach has merits for coastal areas. This article is part of the theme issue `The Paris Agreement: understanding the physical and social challenges for a warming world of 1.5°C above pre-industrial levels'.
Directory of Open Access Journals (Sweden)
AHW Bruns
2009-01-01
Full Text Available A pneumonia adquirida na comunidade (PAC é a principal causa de morte devido a doença infecciosa no mundo ocidental, sendo responsável por um número superior a 20 hospitalizações/ano por mil habitantes. As guidelines internacionais preconizam a antibioterapia combinada, como seja a associação de um â-lactâmico e de um macrólido no tratamento inaugural da PAC grave. Tal facto implica a utilização de cuidados de saúde oneroso e o consumo elevado de antibióticos, contribuindo, assim, para o aparecimento de resistências bacterianas. Nos EUA, os custos do tratamento da PAC excedem os doze biliões de dólares e, em muitos países desenvolvidos, observa-se um aumento da resistência aos macrólidos. Uma vez determinada a etiologia da PAC, a antibioterapia direccionada para o agente patogénico em causa pode ser iniciada. No entanto, até agora, não foi encontrada um biomarcador suficientemente sensível e específico para orientar a terapêutica inaugural, devendo ser criados protocolos com essa finalidade. Os autores do presente trabalho estudaram a relevância da determinação consecutiva da proteína C reactiva (PCR no follow-up de doentes com PAC, avaliando o valor preditivo da normalização tardia dos níveis séricos da PCR relativamente ao risco de administração de antibioterapia inapropriada e a um prognóstico desfavorável. Trata-se de um estudo prospectivo multicêntrico controlado conduzido em cinco hospitais universitários holandeses, entre Junho de 2000 e Julho de 2003, sobre a eficácia clínica da instituição empírica de terapêutica antibiótica intravenosa ou oral na PAC. A PAC foi definida pela presença de, pelo menos, dois sintomas de infecção respiratória baixa aguda antes da admissão hospitalar e de um infiltrado pulmonar “de novo” ou em progressão na radiografia do tórax. A classificação como grave está relacionada com um scoreno índice de gravidade PSI - Pneumonia severity index >90 ou de
Directory of Open Access Journals (Sweden)
M.S. Li
2004-03-01
Full Text Available Composite coatings (Ti,AlN with different Al content were deposited on a wrought martensite steel 1Cr11Ni2W2MoV by reactive multi-arc ion plating. With the addition of Al to the coatings, the crystallographic structure of them changed from B1 NaCl to B4 ZnS, the relevant hardness and adhesive strength firstly increased then decreased and their oxidation-resistance was also dramatically improved. It was indicated that the introduction of Al was beneficial to (Ti,AlN coatings against corrosion induced by NaCl(s in wet oxygen at 600 °C as well as wet corrosion in NaCl solution at ambient temperature.
Kirchheim, A. P.
2011-02-21
This study details the differences in real-time hydration between pure tricalcium aluminate (cubic C3A or 3CaO·Al2O 3) and Na-doped tricalcium aluminate (orthorhombic C3A or Na2Ca8Al6O18), in aqueous solutions containing sulfate ions. Pure phases were synthesized in the laboratory to develop an independent benchmark for the reactions, meaning that their reactions during hydration in a simulated early age cement pore solution (saturated with respect to gypsum and lime) were able to be isolated. Because the rate of this reaction is extremely rapid, most microscopy methods are not adequate to study the early phases of the reactions in the early stages. Here, a high-resolution full-field soft X-ray imaging technique operating in the X-ray water window, combined with solution analysis by 27Al nuclear magnetic resonance (NMR) spectroscopy, was used to capture information regarding the mechanism of C3A hydration during the early stages. There are differences in the hydration mechanism between the two types of C3A, which are also dependent on the concentration of sulfate ions in the solution. The reactions with cubic C3A (pure) seem to be more influenced by higher concentrations of sulfate ions, forming smaller ettringite needles at a slower pace than the orthorhombic C3A (Na-doped) sample. The rate of release of aluminate species into the solution phase is also accelerated by Na doping. © 2011 American Chemical Society.
Steinitz, Ronnie; Lemm, Jeffrey M; Pasachnik, Stesha A; Kurle, Carolyn M
2016-01-15
Stable isotope analysis is a powerful tool for reconstructing trophic interactions to better understand drivers of community ecology. Taxon-specific stable isotope discrimination factors contribute to the best use of this tool. We determined the first Δ(13)C and Δ(15)N values for Rock Iguanas (Cyclura spp.) to better understand isotopic fractionation and estimate wild reptile foraging ecology. The Δ(13)C and Δ(15)N values between diet and skin, blood, and scat were determined from juvenile and adult iguanas held for 1 year on a known diet. We measured relationships between iguana discrimination factors and size/age and quantified effects of lipid extraction and acid treatment on stable isotope values from iguana tissues. Isotopic and elemental compositions were determined by Dumas combustion using an elemental analyzer coupled to an isotope ratio mass spectrometer using standards of known composition. The Δ(13)C and Δ(15)N values ranged from -2.5 to +6.5‰ and +2.2 to +7.5‰, respectively, with some differences among tissues and between juveniles and adults. The Δ(13)C values from blood and skin differed among species, but not the Δ(15)N values. The Δ(13)C values from blood and skin and Δ(15)N values from blood were positively correlated with size/age. The Δ(13)C values from scat were negatively correlated with size (not age). Treatment with HCl (scat) and lipid extraction (skin) did not affect the isotope values. These results should aid in the understanding of processes driving stable carbon and nitrogen isotope discrimination factors in reptiles. We provide estimates of Δ(13)C and Δ(15)N values and linear relationships between iguana size/age and discrimination factors for the best interpretation of wild reptile foraging ecology. Copyright © 2015 John Wiley & Sons, Ltd.
Enhancement of Biogas Production from Rice Husk by NaOH and Enzyme Pretreatment
Directory of Open Access Journals (Sweden)
Syafrudin
2018-01-01
Full Text Available Biogas is a renewable energy source that can be used as an alternative fuel to replace fossil fuel such as oil and natural gas. This research aims to analyze the impact of NaOH (Sodium hydroxide and enzyme usage on the production of rice husk biogas using Solid State Anaerobic Digestion (SS-AD. Generally, SS-AD occurs at solid concentrations higher than 15%. The waste of rice husk are used as substrate with a C/N ratio of 25% and the total of solid that are used is 21%. Rice husk contains high lignin, therefore it is handled with chemical and biological treatment. The chemical preliminary treatment was using NaOH with various concentrations from 3%, 6% and 9% while the biological preliminary treatment was using enzyme with various concentration from 5%, 8%, and 11%. The biogas that is produced then measured every two days during 60 days of research with the biogas volume as a parameter observed. The result of the research shows that preliminary treatment with NaOH and enzyme can increase the production of biogas. The highest biogas production was obtained by the NaOH pretreatment using 6% NaOH which was 497 ml and by enzyme pretreatment using 11% enzyme which was 667,5 ml.
Enhancement of Biogas Production from Rice Husk by NaOH and Enzyme Pretreatment
Syafrudin; Nugraha, Winardi Dwi; Agnesia, Shandy Sarima; Matin, Hashfi Hawali Abdul; Budiyono
2018-02-01
Biogas is a renewable energy source that can be used as an alternative fuel to replace fossil fuel such as oil and natural gas. This research aims to analyze the impact of NaOH (Sodium hydroxide) and enzyme usage on the production of rice husk biogas using Solid State Anaerobic Digestion (SS-AD). Generally, SS-AD occurs at solid concentrations higher than 15%. The waste of rice husk are used as substrate with a C/N ratio of 25% and the total of solid that are used is 21%. Rice husk contains high lignin, therefore it is handled with chemical and biological treatment. The chemical preliminary treatment was using NaOH with various concentrations from 3%, 6% and 9% while the biological preliminary treatment was using enzyme with various concentration from 5%, 8%, and 11%. The biogas that is produced then measured every two days during 60 days of research with the biogas volume as a parameter observed. The result of the research shows that preliminary treatment with NaOH and enzyme can increase the production of biogas. The highest biogas production was obtained by the NaOH pretreatment using 6% NaOH which was 497 ml and by enzyme pretreatment using 11% enzyme which was 667,5 ml.
120W, NA_0.15 fiber coupled LD module with 125-μm clad/NA 0.22 fiber by spatial coupling method
Ishige, Yuta; Kaji, Eisaku; Katayama, Etsuji; Ohki, Yutaka; Gajdátsy, Gábor; Cserteg, András.
2018-02-01
We have fabricated a fiber coupled semiconductor laser diode module by means of spatial beam combining of single emitter broad area semiconductor laser diode chips in the 9xx nm band. In the spatial beam multiplexing method, the numerical aperture of the output light from the optical fiber increases by increasing the number of laser diodes coupled into the fiber. To reduce it, we have tried the approach to improving assembly process technology. As a result, we could fabricate laser diode modules having a light output power of 120W or more and 95% power within NA of 0.15 or less from a single optical fiber with 125-μm cladding diameter. Furthermore, we have obtained that the laser diode module maintaining high coupling efficiency can be realized even around the fill factor of 0.95. This has been achieved by improving the optical alignment method regarding the fast axis stack pitch of the laser diodes in the laser diode module. Therefore, without using techniques such as polarization combining and wavelength combining, high output power was realized while keeping small numerical aperture. This contributes to a reduction in unit price per light output power of the pumping laser diode module.
Lithium Insertion in LiCr3O8, NaCr3O8, and KCr3O8 at Room Temperature and at 125°C
DEFF Research Database (Denmark)
Koksbang, R.; Fauteux, D.; Norby, P.
1989-01-01
Lithium insertion and deinsertion reactions have been carried out with LiCr3O8, NaCr3O8, and KCr3O8 chemically andelectrochemically at room temperature and at 125°C. The electrochemical experiments were performed with a nonaqueousliquid electrolyte at room temperature and with a polymer electroly...... is close to 4Li/NaCr3O8 and 1.3Li/KCr3O8.Lithium ion diffusion coefficients are similar for the two compounds in the comparable composition range.Thermally, the fully lithiated compounds appear to be as stable as the pristine materials.......Lithium insertion and deinsertion reactions have been carried out with LiCr3O8, NaCr3O8, and KCr3O8 chemically andelectrochemically at room temperature and at 125°C. The electrochemical experiments were performed with a nonaqueousliquid electrolyte at room temperature and with a polymer electrolyte....... At elevated temperatures, the isostructural compounds NaCr3O8 and KCr3O8 are able to accommodate morethan 4Li/MCr3O8. During this process, minor structural changes are observed. At room temperature, NaCr3O8 and KCr3O8also accommodate Li topotactically, but the maximum number of Li inserted per formula...
International Nuclear Information System (INIS)
Ashburn, D.A.; Garcia, K.; Hanners, J.L.; Silks, L.A. III; Unkefer, C.J.
1994-01-01
Currently, there is a great emphasis on elucidating the structure, function, and dynamics of DNA. Much of the research involved in this study utilizes nuclear magnetic resonance (NMR) spectroscopy. Effective use of NMR spectroscopy (more than 10,000 mw) in this arena requires stable isotope enrichment. Herein, the authors present strategies for the site-specific isotopic labeling of the purine bases adenosine and guanosine and the biosynthesis of [U- 13 C, 15 N] DNA from methylotrophic bacteria. With commercially available 6-chloropurine, an effective 2-step route leads to [6- 15 N]-2'-deoxadenosine (dA). The resulting [6- 15 N]-dA is used in a series of reactions to synthesize [2- 13 C, 1,2'- 15 N 2 ]-2'-deoxyguanosine or any combination thereof. An improved biosynthesis of labeled DNA has been accomplished using Methylobacterium extorquens AS1. Each liter of growth medium contains 4g of methanol to yield 1 gram of lyophilized cells. As much as 200 mg of RNA per liter of culture has been obtained. The authors are currently developing large scale isolation protocols. General synthetic pathways to oligomeric DNA are presented
Characteristics of Al Alloy as a Material for Hydrolysis Reactor of NaBH4
International Nuclear Information System (INIS)
Jung, Hyeon-Seong; Oh, Sung-June; Jeong, Jae-Jin; Na, Il-Chai; Chu, Cheun-Ho; Park, Kwon-Pil; Chu, Cheun-Ho
2015-01-01
Aluminum alloy was examined as a material of low weight reactor for hydrolysis of NaBH 4 . Aluminum is dissolved with alkali, but there is NaOH as a stabilizer in NaBH 4 solution. To decrease corrosion rate of aluminum, decrease NaOH concentration and this result in loss of NaBH 4 during storage of NaBH 4 solution. Therefore stability of NaBH 4 and corrosion of aluminum should be considered in determining the optimum NaOH concentration. NaBH 4 stability and corrosion rate of aluminum were measured by hydrogen evolution rate. NaBH 4 stability was tested at 20-50 .deg. C and aluminum corrosion was measured at 60-90 .deg. C. The optimum concentration of NaOH was 0.3 wt%, considering both NaBH 4 stability and aluminun corrosion. NaBH 4 hydrolysis reaction continued 200min in aluminum No 6061 alloy reactor with 0.3 wt% NaOH at 80-90 .deg. C.
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Definitions. 15.23 Section 15.23 Commerce and Foreign Trade Office of the Secretary of Commerce LEGAL PROCEEDINGS Involuntary Child and... approved under part D of title IV of the Social Security Act (42 U.S.C. 651-664), who has the duty or...
Directory of Open Access Journals (Sweden)
Ricardo Obalski de Mello
2012-04-01
Full Text Available INTRODUCTION: Sepsis is a complex syndrome caused by an uncontrolled systemic inflammatory response. Inflammatory cytokines play a pivotal role in septic shock pathogenesis. Therapeutic strategies have been tested in order to modulate the excessive generation or function of sepsis mediators. OBJECTIVE: The objective of the present study was to investigate the therapeutic effect of N-acetylcysteine (NAC and its association with fructose-1,6-bisphosphate (FBP on T-lymphocytes proliferation, interleukin-1β (IL-1β and monocyte chemotactic protein-1 (MCP-1 levels. MATERIAL AND METHODS: Peripheral blood mononuclear cell samples were isolated from healthy individuals. T-lymphocytes were stimulated with phytohemagglutinin for 96 hours and submitted to different concentrations of NAC or NAC associated with FBP. RESULTS: NAC (10 and 15 mM and NAC (15 mM associated with FBP reduced T-lymphocytes proliferation. IL-1β levels rose in the presence of both NAC (15 mM and NAC with FBP (1.25 mM. MCP-1 levels were reduced only by NAC (15 mM associated with FBP (1.25 mM. CONCLUSION: The results suggest that both NAC itself and NAC associated with FBP inhibit cellular proliferation, acting as potent immunomodulatory agents, which corroborates its use in the treatment of inflammatory diseases.INTRODUÇÃO: A sepse é uma síndrome complexa causada pela resposta inflamatória sistêmica descontrolada. As citocinas inflamatórias representam papel central na patogênese do choque séptico. Têm sido testadas estratégias terapêuticas a fim de modular a geração ou a função excessiva de mediadores na sepse. OBJETIVO: O objetivo deste estudo foi investigar o efeito terapêutico da N-acetilcisteína (NAC e sua associação com a frutose-1,6-bisfosfato (FBP sobre a proliferação de linfócitos T e a geração de interleucina-1β (IL-1β e proteína quimiotática de monócitos 1 (MCP-1 em cultura celular. MATERIAL E MÉTODOS: Foram isoladas células mononucleares de
Directory of Open Access Journals (Sweden)
Maria Rita de Cassia Costa Monteiro
2004-01-01
Full Text Available Este trabalho objetivou investigar a prevalência de infecção pelo vírus da hepatite C e identificar possíveis fatores de risco para sua transmissão, em 406 indivíduos portadores do vírus da imunodeficiência humana, maiores de dezoito anos de idade, atendidos na rede pública de saúde da cidade de Belém, Pará, situada na Amazônia brasileira. Os exames referentes ao anti-VHC foram realizados pelo método de Elisa e a pesquisa do VHC RNA através da reação de polimerase em cadeia. A prevalência de infecção, atual ou pregressa, pelo vírus da hepatite C foi de 16% (IC: 12,4 - 19,6. A análise multivariada mostrou associação do vírus C com as variáveis idade, cujo risco significante recaiu no grupo com cinqüenta ou mais anos (OR=9,75, antecedente de transfusão de sangue (OR=4,74 e uso de droga ilícita injetável (OR=149,28. A prevalência do vírus da hepatite C entre os usuários de drogas injetáveis foi de 83,7% e de 22,1% na população de transfundidos. Estes resultados indicam a efetiva transmissão do vírus C através da exposição percutânea e reafirmam o grande potencial de risco para hepatite C contido no uso injetável de drogas ilícitas.
Elisa Maria Perina
2010-01-01
Resumo: Com o surgimento de novos recursos diagnósticos e terapêuticos, o tratamento das crianças e adolescentes com câncer resultou em significativo aumento da sobrevida. Os efeitos tardios relacionados a doença e ao tratamento causam impacto na saúde e na qualidade de vida dos jovens recuperados de câncer, abrindo a discussão dos limites da cura frente a toxicidade e qualidade. Com o objetivo de avaliar a qualidade de vida relacionada a saúde de adolescentes sobreviventes de câncer na infân...
Natália Rivera Hoyos
2015-01-01
Em diálogo com um debate que questiona a fortaleza do Estado de direito e o lugar da ordem legal na construção de um regime democrático, esta pesquisa analisa o fundamento e o funcionamento da Lei de Cultura Cívica da Cidade do México. A Lei de Cultura Cívica é uma lei que, desde 2004, regula o uso do espaço público (práticas, atividades, comportamentos) na capital mexicana, enquanto o juzgado cívico é a instituição na qual se processam e se determinam as conciliações, responsabilidades, infr...
Influence of hexavanadates on Na+/K+- ATPase activity
Directory of Open Access Journals (Sweden)
Zdravković Aleksandra
2016-01-01
Full Text Available Introduction: There is a great interest in use of polioximetalates in clinical medicine, primary as antibacterial, antiviral and antitumoral agents. Considering the key role of Na+/ K+- ATPase in normal functioning of most animal cells, as well as pivotal roles in cancer cell migration, the aim of this paper was to examine the influence of new synthesized hexavandates [V6-CH3][Na]2, [V6-NO2][TBA]2, [V6-C3][H]2, [V6-C5d][TBA]2 on Na+/K+- ATPase activity. Material and methods: The enzymatic activity of porcine cerebral cortex Na+/K+- ATPase was followed in both the absence and presence of increasing concentration of [V6-CH3] [Na]2, [V6-NO2][TBA]2, [V6-C3][H]2, [V6-C5d][TBA]2 (within the range 10-8 - 10-3 mol/L. The released Pi, liberated from the enzymatic hydrolysis of ATP, was determined by spectrophotometric method, using Perkin Elmer Lambda 35 UV-VIS spectrophotometer. Results: Investigated compounds inhibit the activity of Na+/K+ ATPase in dose-dependent manner within the investigated range. Obtained results indicate that all investigated compounds inhibit the Na+/K+ ATPase activity, but with different inhibiting power. [V6-NO2] [TBA]2 (IC50 = 1,87 × 10-5 mol/L was the most potent inhibitor of Na+/K+ ATPase, while [V6-C5d][TBA]2 showed the least potent inhibiting power (IC50 = 1,31 × 10-4 mol/L . The results are consistent with previously published concentration-dependent inhibitory effect of polyoxometalates (including polioxovandates on ATPase activity from different model syistems. Conclusion: Based on the results, we can conclude that the examined compounds inhibit Na+/K+- ATPase activity in a dose-dependent manner. Inhibiting power of tested hexavanadates are different, and weaker than inhibiting power of decavanadates (tested earlier on Na+/K+- ATPase activity, which is probably due to differences in charge, size and shape of these polioxometalates. Considering the role of this enzymes in the functioning of healthy cells and the
Direct extraction of a Na- beam from a sodium plasma
International Nuclear Information System (INIS)
Sasao, Namiko; Fujita, Junji; Yamaoka, Hitoshi; Wada, Motoi.
1990-07-01
Negative sodium ions (Na - ) were extracted from a small multi-cusp ion source. A steady state sodium plasma was produced by primary electrons in a sodium gas evaporating from a metal sample placed in the discharge chamber. The Na - current density of 1.5 μA/cm 2 was obtained from a single aperture of 1.5 mm diameter at relatively low discharge power of about 0.4 W and filament power of 50 W. Extraction characteristics were studied by changing the plasma electrode bias. The extracted Na - current showed dependence on the bias voltage similar to that of H - or Li - volume production. (author)
Olah, George A; Prakash, G K Surya; Rasul, Golam
2016-01-05
The rearrangement pathways of the equilibrating tertiary carbocations, 2,3-dimethyl-2-butyl cation (C6H13(+), 1), 2,3,3-trimethyl-2-butyl cation (C7H15(+), 5) and 2,3-dimethyl-2-pentyl cation (C7H15(+), 8 and 9) were investigated using the ab initio/GIAO-CCSD(T) (13)C NMR method. Comparing the calculated and experimental (13)C NMR chemical shifts of a series of carbocations indicates that excellent prediction of δ(13)C could be achieved through scaling. In the case of symmetrical equilibrating cations (1 and 5) the Wagner-Meerwein 1,2-hydride and 1,2-methide shifts, respectively, produce the same structure. This indicates that the overall (13)C NMR chemical shifts are conserved and independent of temperature. However, in the case of unsymmetrical equilibrating cations (8 and 9) the Wagner-Meerwein shift produces different tertiary structures, which have slightly different thermodynamic stabilities and, thus, different spectra. At the MP4(SDTQ)/cc-pVTZ//MP2/cc-pVTZ + ZPE level structure 8 is only 90 calories/mol more stable than structure 9. Based on computed (13)C NMR chemical shift calculations, mole fractions of these isomers were determined by assuming the observed chemical shifts are due to the weighted average of the chemical shifts of the static ions. © 2015 Wiley Periodicals, Inc.
Evaluation report on CCTF Core-I reflood tests C1-5 (Run 14), C1-7 (Run 16) and C1-14 (Run 23)
International Nuclear Information System (INIS)
Sugimoto, Jun; Muurao, Yoshio
1983-02-01
The present report describes the effects of the initial clad temperature on the reflood phenomena observed in the Cylindrical Core Test Facility (CCTF) at Japan Atomic Energy Research Institute. The evaluation is based on the data of tests C1-5, C1-7 and C1-14 of the CCTF-Core I test series. Nominal initial peak clad temperatures in these tests are 600 0 C, 700 0 C and 800 0 C, respectively. With the higher initial clad temperature, the higher loop mass flow rate and the lower water accumulation in the core and the upper plenum were obtained in an early reflood transient. However, the core inlet flow conditions, which is sensitive to the core cooling, were not much affected by the higher initial clad temperature. The slower quench front propagation was observed with the higher initial clad temperature. However, the heat transfer coefficient was almost identical with each other before the turnaround time, which resulted in the lower temperature rise with the highest initial clad temperature. This qualitatively agreed with the results of the forced feed FLECHT experiment. (author)
Directory of Open Access Journals (Sweden)
Ivonne Rubio
2005-03-01
Full Text Available Introducción. La infección por el virus de la hepatitis C (VHC se caracteriza por la alta frecuencia de infección persistente. La capacidad del VHC para inducir alteraciones en la función de las células del sistema inmune, específicamente en las células dendríticas, parece ser una de las estrategias virales implicada en el establecimiento de la infección persistente. Esta estrategia parece estar mediada en gran parte por una de las proteínas estructurales codificada por el genoma del VHC, la proteína Core, unidad estructural de la cápside viral. Objetivo. Una de las limitantes para la evaluación de las propiedades de Core es la obtención y la purificación de la proteína nativa (191 aa. El objetivo de este estudio fue la producción y la purificación de la proteína Core completa en un sistema eucariote para evaluar las propiedades de la proteína en cultivos de células dendríticas humanas. Resultados. En este estudio se logró la producción de la proteína Core completa en el sistema de expresión de baculovirus y su purificación por la técnica de separación por punto isoeléctrico y electroelución. La pureza de la proteína obtenida se confirmó por Western blot y tinción con plata. Estos análisis mostraron dos bandas únicas correspondientes a las isoformas p23 y p21 de la proteína Core, previamente descritas en la literatura. Conclusiones. La proteína obtenida posee varias de las condiciones de la proteína Core nativa, como peso molecular, isoformas y localización subcelular. Los procedimientos descritos en este artículo son aplicables a proteínas asociadas a membranas producidas en sistemas de expresión eucarióticos.
The contribution of transport policies to the mitigation potential and cost of 2 °C and 1.5 °C goals
Zhang, Runsen; Fujimori, Shinichiro; Hanaoka, Tatsuya
2018-05-01
The transport sector contributes around a quarter of global CO2 emissions; thus, low-carbon transport policies are required to achieve the 2 °C and 1.5 °C targets. In this paper, representative transport policy scenarios are structured with the aim of achieving a better understanding of the interaction between the transport sector and the macroeconomy. To accomplish this, the Asia–Pacific Integrated Model/Transport (AIM/Transport) model, coupled with a computable general equilibrium model (AIM/CGE), is used to simulate the potential for different transport policy interventions to reduce emissions and cost over the period 2005–2100. The results show that deep decarbonization in the transport sector can be achieved by implementing transport policies such as energy efficiency improvements, vehicle technology innovations particularly the deployment of electric vehicles, public transport developments, and increasing the car occupancy rate. Technological transformations such as vehicle technological innovations and energy efficiency improvements provide the most significant reduction potential. The key finding is that low-carbon transport policies can reduce the carbon price, gross domestic product loss rate, and welfare loss rate generated by climate mitigation policies to limit global warming to 2 °C and 1.5 °C. Interestingly, the contribution of transport policies is more effective for stringent climate change targets in the 1.5 °C scenario, which implies that the stronger the mitigation intensity, the more transport specific policy is required. The transport sector requires attention to achieve the goal of stringent climate change mitigation.
The local structure of Ca{sub N}a pyroxenes. I. XANES study at the Na K-edge
Energy Technology Data Exchange (ETDEWEB)
Mottana, Annibale [Rome, Univ. III (Italy). Dipt. di Scienze Geologiche; Murata, T. [Kyoto, Univ. of Education (Japan). Dept. of Physics; Wu, Ziyu; Marcelli, Augusto [INFN, Frascati (Italy). Laboratori Nazionali di Frascati; Paris, E. [Camerino, Univ. (Italy). Dipt. di Scienze della Terra
1996-07-01
X-ray absorption Na K-edge spectra have been recorded on synthetic end member jadeite and on a series of natural Ca-Na pyroxenes compositionally straddling the Jd-Di. The disordered C2/c members of the series are systematically different from the ordered P2/n members. These differences can be interpreted and explained by comparing the experimental spectra with theoretical spectra. These have been calculated by the multiple-scattering formalism from the atomic positional parameters determined by single-crystal X-ray diffraction structure refinement on the same samples. In the full multiple scattering region of the spectrum (1075 to 1095 eV) C-pyroxenes exhibit three features which reflect the 6-2 configuration of the O back-scattering atoms around the Na absorber located at the center of the cluster (site M2 of the jadeite structure). P-pyroxenes show more complicated spectra in which at least four features can be recognized; they reflect the two types of the configuration (6-2 and 4-2-2) of the oxygens around Na in the two independent M2 and M21 eight-fold coordinated sites of the omphacite structure. A weak, sometimes poorly resolved peak at 1079 eV diagnostic and discriminates C- from P-pyroxenes. The Garnet Ridge C2/c impure jadeite exhibits a spectrum which is intermediate between those of jadeite and omphacite. The Hedin-Lundqist potential proves best for these insulating materials and allows multiple-scattering calculations agreeing well with experiments. The assessment of the local electronic properties of compositionally and structurally complex minerals such as clinopyroxenes is thus enhanced.
Influence of seeding on crystallization behaviour of BaNaB9 glasses
Indian Academy of Sciences (India)
Administrator
Influence of seeding on crystallization behaviour of BaNaB9. O15 glasses. RAHUL VAISH and K B R VARMA*. Materials Research Centre, Indian Institute of Science, Bangalore 560 012, India. MS received 18 August 2008. Abstract. Transparent BaNaB9O15 (BNBO) glasses were fabricated via the conventional melt- ...
Na2MnSiO4 as an attractive high capacity cathode material for sodium-ion battery
Law, Markas; Ramar, Vishwanathan; Balaya, Palani
2017-08-01
Here we report a polyanion-based cathode material for sodium-ion batteries, Na2MnSiO4, registering impressive sodium storage performances with discharge capacity of 210 mAh g-1 at an average voltage of 3 V at 0.1 C, along with excellent long-term cycling stability (500 cycles at 1 C). Insertion/extraction of ∼1.5 mol of sodium ion per formula unit of the silicate-based compound is reported and the utilisation of Mn2+ ⇋ Mn4+ redox couple is also demonstrated by ex-situ XPS. Besides, this study involves a systematic investigation of influence of the electrolyte additive (with different content) on the sodium storage performance of Na2MnSiO4. The electrolyte additive forms an optimum protective passivation film on the electrode surface, successfully reducing manganese dissolution.