WorldWideScience

Sample records for na fk1 eno

  1. Main: 1FK1 [RPSD[Archive

    Lifescience Database Archive (English)

    Full Text Available 1FK1 トウモロコシ Corn Zea mays L. Nonspecific Lipid-Transfer Protein Precursor Zea Mays ...RGQGSGPSAGCCSGVRSLNNAARTTADRRAACNCLKNAAAGVSGLNAGNAASIPSKCGVSIPYTISTSTDCSRVN corn_1FK1.jpg ...

  2. Disperzní vlivy na vysokorychlostní přenos optickou sítí

    OpenAIRE

    Filip, Tomáš

    2010-01-01

    Práce se zabývá principem optického přenosu, jeho přenosovými médii a dále pak výhodami a nevýhodami. V první polovině se zaměří na nežádoucí vlivy působící naenos signálu v optických sítích, na disperzní vlivy a zejména pak na polarizační vidovou disperzi (PMD – Polarization Mode Dispersion). Druhá polovina práce se zabývá měřením vlastností optických vláken, převážně chromatické a polarizační vidové disperze, používanými metodami a jejich principy. Následně jsou uvedeny současné možnosti...

  3. New products by ENO; De nouveaux produits chez ENO

    Energy Technology Data Exchange (ETDEWEB)

    Anon.

    2000-04-01

    Located at Niort, in Western France, ENO is the only company today to be purely controlled by French investors in the multinational world of domestic appliances manufacturers. As the leader in cabinet heaters in the French market, ENO has modernized its ranges and presents today its products under modern colours and sizes adapted to 6 kg cylinders. ENO has also developed a domestic terrace heater - the Soleiro - which is equipped with an anti-fall down shut-off safety system. It is the first to comply with the new French standard regarding terrace heaters. ENO present also at the Confortec Trade Show a brand new cooker/oven designed for in board cooking on boats: the Gascogne. All these appliances use LPG. (authors)

  4. SLOŽENO KLIZANJE U DOLINI RJEČINE

    OpenAIRE

    Benac, Čedomir; Arbanas, Željko; Jardas, Branka; Kasapović, Saša; Jurak, Vladimir

    1999-01-01

    U radu su prikazani rezultati istraživanja prve faze složenog klizišta na sjeveroistočnoj padini doline Rječine između brane Valići i naselja Pašac. Bokovi doline oblikovani su u paleogenskom flišu i kvartarnim padinskim tvorevinama. Na vrhovima su zastupljene vapnenačke stijene tvoreći litice. Nastanak istražene kompleksne pojave klizišta predodređen je geološkom gradom i morfogenezom doline Rječine. To je složeno retrogresivno klizište, koje se počelo razvijati od stope prema vrhu kosine. N...

  5. Bussijuhtide streigi ärahoidmiseks on täna jäänud viimane võimalus / Ingvar Bärenklau, Hindrek Riikoja, Eno-Gerrit Link

    Index Scriptorium Estoniae

    Bärenklau, Ingvar, 1967-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 11. dets. 2007, lk. 6. Postimees : na russkom jazõke lüh. Transpordi ametiühingu ja autoettevõtete liidu delegatsioonid annavad hinnangu riikliku lepitaja ettepanekule palgatüli lahendamiseks, mis on viimane võimalus üldstreigi ärahoidmiseks. Lisa: Võimaliku streigi ajakava; Kuidas elab Tartu streigipäevadel?; Streigid ja streigiähvardused. Vt. samas intervjuud bussijuht Leo Sillastega: 6000-kroonist kuupalka peetakse kodus valejutuks; Pärnu bussijuhid on streigi osas ühel meelel

  6. Thinking Inside the Box: Brian Eno, music, movement and light

    OpenAIRE

    Loydell, Rupert; Marshall, Kingsley

    2016-01-01

    In total darkness, or in a very large room, very quietly [Eno,Brian, and Peter Schmidt. (1979). Oblique Strategies. The Authors.]\\ud \\ud This article considers how Eno has used simple but innovative ideas,programmes and processes to inform his films, apps and installation work. Avoiding spectacle, noise and complexity, Eno and his collaborators have produced an array of intriguing and engaging visual art works. In T. The New York Times Style Magazine, Eno stated that he ‘was trying to make vi...

  7. Měření dohlednosti kamerou pro účely studia vlivu reálné atmosféry naenos optického bezkabelového spoje

    Czech Academy of Sciences Publication Activity Database

    Brázda, V.; Fišer, Ondřej

    2013-01-01

    Roč. 2013, č. 1 (2013) ISSN 1802-4564 R&D Projects: GA ČR(CZ) GAP102/11/1376 Institutional support: RVO:68378289 Keywords : visibility * digital camera * free space optical link Subject RIV: DG - Athmosphere Sciences, Meteorology http://147.228.94.30/index.php?option=com_content&view=article&id=369:meni-dohlednosti-kamerou-pro-uely-studia-vlivu-realne-atmosfery-na-penos-optickeho-bezkabeloveho-spoje&catid=44:islo-12013&Itemid=51

  8. Epidemias de ferrugem asiática no Rio Grande do Sul explicadas pelo fenômeno ENOS e pela incidência da doença na entressafra

    Directory of Open Access Journals (Sweden)

    Claudinei Antonio Minchio

    Full Text Available RESUMO Estudou-se a interferência da variabilidade da variabilidade climática e do número de relatos de ferrugem asiática na entressafra sobre a epidemia da doença no estado do Rio Grande do Sul, durante 11 safras agrícolas. A ocorrência da doença foi obtida a partir de relatos apresentados no Consórcio Antiferrugem e dividida entre os períodos “Safra”, “Entressafra” e “Ano Todo”. Os dados das epidemias foram testados para correlação, via regressões polinomiais lineares e quadráticas, com as variáveis climáticas: precipitação pluvial, índice padronizado de precipitação - SPI, índice de oscilação sul - IOS e anomalia da Temperatura na Superfície do Mar - SST no Oceano Pacífico Tropical e número de ocorrências da doença no período de entressafra. Os índices que melhor explicaram a variação das ocorrências da doença para o período “Ano Todo” foram o SST e IOS, com coeficientes de determinação (R2 de 0,94 e 0,59, respectivamente. As ocorrências de ferrugem no período “Entressafra” influenciaram positivamente nas ocorrências no período “Safra”.

  9. Brian Eno Hollandi Festivali peakülaliseks

    Index Scriptorium Estoniae

    1999-01-01

    Inglise helilooja, videokunstnik ja muusikaprodutsent Brian Eno on 5.-26. juunini Amsterdamis toimuva avangardse Hollandi Festivali peakülaline, kelle videoinstallatsioon seatakse üles Stedelijki Muuseumis. Festivali programmist

  10. Association between nucleotide mutation of eNOS gene and serum ...

    African Journals Online (AJOL)

    Galaxy

    2013-05-15

    May 15, 2013 ... (Angeline et al., 2010; Mayer and Hemmens, 1997). eNOS is the product of eNOS gene which is 21 kb in size and consists of 26 exons (Ragia et al., 2010; Marsden et al., 1993). Additionally, promoter region of the eNOS gene harbors several transcription factor binding sites and regulating gene expression ...

  11. The eNOS enhancer AVE 9488: a novel cardioprotectant against ischemia reperfusion injury.

    Science.gov (United States)

    Frantz, S; Adamek, A; Fraccarollo, D; Tillmanns, J; Widder, J D; Dienesch, C; Schäfer, A; Podolskaya, A; Held, M; Ruetten, H; Ertl, G; Bauersachs, J

    2009-11-01

    Nitric oxide (NO) is an important regulator of vascular and myocardial function. Cardiac ischemia/reperfusion injury is reduced in mice overexpressing endothelial NO synthase (eNOS) suggesting cardioprotection by eNOS. Novel pharmacological substances, so called eNOS enhancers, upregulate eNOS expression and thereby increase NO production. We tested the effects of the eNOS enhancer AVE 9488 on cardiac ischemia/reperfusion injury in vivo in mice. After treatment with the eNOS enhancer AVE 9488 (30 mg/kg/day) or placebo for one week mice underwent 30 min of coronary artery ligation and 24 h of reperfusion in vivo. Ischemia-reperfusion damage was significantly reduced in mice treated with the eNOS enhancer when compared to placebo treated mice (infarct/area at risk 65.4 +/- 4.1 vs. 36.9 +/- 4.0%, placebo vs. eNOS enhancer, P = 0.0002). The protective effect was blunted in eNOS knockout mice treated with the eNOS enhancer (infarct/area at risk 64.1 +/- 6.2%, eNOS knockout + eNOS enhancer vs. WT + eNOS enhancer, P = ns). Reactive oxygen species were significantly reduced in mice treated with the eNOS enhancer as indicated by significantly lower malondialdehyde-thiobarbituric acid levels (placebo vs. eNOS enhancer, 3.2 +/- 0.5 vs. 0.8 +/- 0.07 micromol/l, P = 0.0003). Thus pharmacological interventions addressed to increase eNOS-derived NO production constitute a promising therapeutic approach to prevent myocardial ischemia/reperfusion injury.

  12. Living Water. Eno River State Park: An Environmental Education Learning Experience Designed for the Middle Grades.

    Science.gov (United States)

    Hartley, Scott; Woods, Martha

    This learning packet, one in a series of eight, was developed by the Eno River State Park in North Carolina for Grades 5-6 to teach about various aspects of water life on the Eno River. Loose-leaf pages are presented in nine sections that contain: (1) introductions to the North Carolina State Park System, the Eno River State Park, and to the…

  13. Association between nucleotide mutation of eNOS gene and serum ...

    African Journals Online (AJOL)

    Various mutation on endothelial nitric oxide synthase (eNOs) gene cause reduced production of NO, the expansion factor (VEF) and may accelerate the process of atherosclerosis. The study was designed to investigate the frequency of T-786C polymorphism of the gene or nucleotide mutation of eNOS gene in patients ...

  14. Endothelin-1 Overexpression Improves Renal Function in eNOS Knockout Mice

    Directory of Open Access Journals (Sweden)

    Oleg Tsuprykov

    2015-10-01

    Full Text Available Background/Aims: To investigate the renal phenotype under conditions of an activated renal ET-1 system in the status of nitric oxide deficiency, we compared kidney function and morphology in wild-type, ET-1 transgenic (ET+/+, endothelial nitric oxide synthase knockout (eNOS-/- and ET+/+eNOS-/- mice. Methods: We assessed blood pressure, parameters of renal morphology, plasma cystatin C, urinary protein excretion, expression of genes associated with glomerular filtration barrier and tissue remodeling, and plasma metabolites using metabolomics. Results: eNOS-/- and ET+/+eNOS-/- mice developed hypertension. Osteopontin, albumin and protein excretion were increased in eNOS-/- and restored in ET+/+eNOS-/- animals. All genetically modified mice developed renal interstitial fibrosis and glomerulosclerosis. Genes involved in tissue remodeling (serpine1, TIMP1, Col1a1, CCL2 were up-regulated in eNOS-/-, but not in ET+/+eNOS-/- mice. Plasma levels of free carnitine and acylcarnitines, amino acids, diacyl phosphatidylcholines, lysophosphatidylcholines and hexoses were descreased in eNOS-/- and were in the normal range in ET+/+eNOS-/- mice. Conclusion: eNOS-/- mice developed renal dysfunction, which was partially rescued by ET-1 overexpression in eNOS-/- mice. The metabolomics results suggest that ET-1 overexpression on top of eNOS knockout is associated with a functional recovery of mitochondria (rescue effect in β-oxidation of fatty acids and an increase in antioxidative properties (normalization of monounsaturated fatty acids levels.

  15. PKC-dependent phosphorylation of eNOS at T495 regulates eNOS coupling and endothelial barrier function in response to G+ -toxins.

    Directory of Open Access Journals (Sweden)

    Feng Chen

    Full Text Available Gram positive (G+ infections make up ∼50% of all acute lung injury cases which are characterized by extensive permeability edema secondary to disruption of endothelial cell (EC barrier integrity. A primary cause of increased permeability are cholesterol-dependent cytolysins (CDCs of G+-bacteria, such as pneumolysin (PLY and listeriolysin-O (LLO which create plasma membrane pores, promoting Ca2+-influx and activation of PKCα. In human lung microvascular endothelial cells (HLMVEC, pretreatment with the nitric oxide synthase (NOS inhibitor, ETU reduced the ability of LLO to increase microvascular cell permeability suggesting an endothelial nitric oxide synthase (eNOS-dependent mechanism. LLO stimulated superoxide production from HLMVEC and this was prevented by silencing PKCα or NOS inhibition suggesting a link between these pathways. Both LLO and PLY stimulated eNOS T495 phosphorylation in a PKC-dependent manner. Expression of a phosphomimetic T495D eNOS (human isoform resulted in increased superoxide and diminished nitric oxide (NO production. Transduction of HLMVEC with an active form of PKCα resulted in the robust phosphorylation of T495 and increased peroxynitrite production, indicative of eNOS uncoupling. To determine the mechanisms underlying eNOS uncoupling, HLMVEC were stimulated with LLO and the amount of hsp90 and caveolin-1 bound to eNOS determined. LLO stimulated the dissociation of hsp90, and in particular, caveolin-1 from eNOS. Both hsp90 and caveolin-1 have been shown to influence eNOS uncoupling and a peptide mimicking the scaffolding domain of caveolin-1 blocked the ability of PKCα to stimulate eNOS-derived superoxide. Collectively, these results suggest that the G+ pore-forming toxins promote increased EC permeability via activation of PKCα, phosphorylation of eNOS-T495, loss of hsp90 and caveolin-1 binding which collectively promote eNOS uncoupling and the production of barrier disruptive superoxide.

  16. Circulating Blood eNOS Contributes to the Regulation of Systemic Blood Pressure and Nitrite Homeostasis

    Science.gov (United States)

    Wood, Katherine C.; Cortese-Krott, Miriam M.; Kovacic, Jason C.; Noguchi, Audrey; Liu, Virginia B.; Wang, Xunde; Raghavachari, Nalini; Boehm, Manfred; Kato, Gregory J.; Kelm, Malte; Gladwin, Mark T.

    2013-01-01

    Objective Mice genetically deficient in endothelial nitric oxide synthase (eNOS−/−) are hypertensive with lower circulating nitrite levels, indicating the importance of constitutively produced nitric oxide (NO•) to blood pressure regulation and vascular homeostasis. While the current paradigm holds that this bioactivity derives specifically from expression of eNOS in endothelium, circulating blood cells also express eNOS protein. A functional red cell eNOS that modulates vascular NO• signaling has been proposed. Approach and Results To test the hypothesis that blood cells contribute to mammalian blood pressure regulation via eNOS-dependent NO• generation, we cross-transplanted WT and eNOS−/− mice, producing chimeras competent or deficient for eNOS expression in circulating blood cells. Surprisingly, we observed a significant contribution of both endothelial and circulating blood cell eNOS to blood pressure and systemic nitrite levels, the latter being a major component of the circulating NO• reservoir. These effects were abolished by the NOS inhibitor L-NAME and repristinated by the NOS substrate L-Arginine, and were independent of platelet or leukocyte depletion. Mouse erythrocytes were also found to carry an eNOS protein and convert 14C-Arginine into 14C-Citrulline in a NOS-dependent fashion. Conclusions These are the first studies to definitively establish a role for a blood borne eNOS, using cross transplant chimera models, that contributes to the regulation of blood pressure and nitrite homeostasis. This work provides evidence suggesting that erythrocyte eNOS may mediate this effect. PMID:23702660

  17. Activation of Endothelial Nitric Oxide (eNOS Occurs through Different Membrane Domains in Endothelial Cells.

    Directory of Open Access Journals (Sweden)

    Jason Tran

    Full Text Available Endothelial cells respond to a large range of stimuli including circulating lipoproteins, growth factors and changes in haemodynamic mechanical forces to regulate the activity of endothelial nitric oxide synthase (eNOS and maintain blood pressure. While many signalling pathways have been mapped, the identities of membrane domains through which these signals are transmitted are less well characterized. Here, we manipulated bovine aortic endothelial cells (BAEC with cholesterol and the oxysterol 7-ketocholesterol (7KC. Using a range of microscopy techniques including confocal, 2-photon, super-resolution and electron microscopy, we found that sterol enrichment had differential effects on eNOS and caveolin-1 (Cav1 colocalisation, membrane order of the plasma membrane, caveolae numbers and Cav1 clustering. We found a correlation between cholesterol-induced condensation of the plasma membrane and enhanced high density lipoprotein (HDL-induced eNOS activity and phosphorylation suggesting that cholesterol domains, but not individual caveolae, mediate HDL stimulation of eNOS. Vascular endothelial growth factor (VEGF-induced and shear stress-induced eNOS activity was relatively independent of membrane order and may be predominantly controlled by the number of caveolae on the cell surface. Taken together, our data suggest that signals that activate and phosphorylate eNOS are transmitted through distinct membrane domains in endothelial cells.

  18. Mild mitochondrial uncoupling and calorie restriction increase fasting eNOS, akt and mitochondrial biogenesis.

    Science.gov (United States)

    Cerqueira, Fernanda M; Laurindo, Francisco R M; Kowaltowski, Alicia J

    2011-03-31

    Enhanced mitochondrial biogenesis promoted by eNOS activation is believed to play a central role in the beneficial effects of calorie restriction (CR). Since treatment of mice with dinitrophenol (DNP) promotes health and lifespan benefits similar to those observed in CR, we hypothesized that it could also impact biogenesis. We found that DNP and CR increase citrate synthase activity, PGC-1α, cytochrome c oxidase and mitofusin-2 expression, as well as fasting plasma levels of NO• products. In addition, eNOS and Akt phosphorylation in skeletal muscle and visceral adipose tissue was activated in fasting CR and DNP animals. Overall, our results indicate that systemic mild uncoupling activates eNOS and Akt-dependent pathways leading to mitochondrial biogenesis.

  19. Mild mitochondrial uncoupling and calorie restriction increase fasting eNOS, akt and mitochondrial biogenesis.

    Directory of Open Access Journals (Sweden)

    Fernanda M Cerqueira

    2011-03-01

    Full Text Available Enhanced mitochondrial biogenesis promoted by eNOS activation is believed to play a central role in the beneficial effects of calorie restriction (CR. Since treatment of mice with dinitrophenol (DNP promotes health and lifespan benefits similar to those observed in CR, we hypothesized that it could also impact biogenesis. We found that DNP and CR increase citrate synthase activity, PGC-1α, cytochrome c oxidase and mitofusin-2 expression, as well as fasting plasma levels of NO• products. In addition, eNOS and Akt phosphorylation in skeletal muscle and visceral adipose tissue was activated in fasting CR and DNP animals. Overall, our results indicate that systemic mild uncoupling activates eNOS and Akt-dependent pathways leading to mitochondrial biogenesis.

  20. Insights into the arginine paradox: evidence against the importance of subcellular location of arginase and eNOS

    Science.gov (United States)

    Elms, Shawn; Chen, Feng; Wang, Yusi; Qian, Jin; Askari, Bardia; Yu, Yanfang; Pandey, Deepesh; Iddings, Jennifer; Caldwell, Ruth B.

    2013-01-01

    Reduced production of nitric oxide (NO) is one of the first indications of endothelial dysfunction and precedes overt cardiovascular disease. Increased expression of Arginase has been proposed as a mechanism to account for diminished NO production. Arginases consume l-arginine, the substrate for endothelial nitric oxide synthase (eNOS), and l-arginine depletion is thought to competitively reduce eNOS-derived NO. However, this simple relationship is complicated by the paradox that l-arginine concentrations in endothelial cells remain sufficiently high to support NO synthesis. One mechanism proposed to explain this is compartmentalization of intracellular l-arginine into distinct, poorly interchangeable pools. In the current study, we investigated this concept by targeting eNOS and Arginase to different intracellular locations within COS-7 cells and also BAEC. We found that supplemental l-arginine and l-citrulline dose-dependently increased NO production in a manner independent of the intracellular location of eNOS. Cytosolic arginase I and mitochondrial arginase II reduced eNOS activity equally regardless of where in the cell eNOS was expressed. Similarly, targeting arginase I to disparate regions of the cell did not differentially modify eNOS activity. Arginase-dependent suppression of eNOS activity was reversed by pharmacological inhibitors and absent in a catalytically inactive mutant. Arginase did not directly interact with eNOS, and the metabolic products of arginase or downstream enzymes did not contribute to eNOS inhibition. Cells expressing arginase had significantly lower levels of intracellular l-arginine and higher levels of ornithine. These results suggest that arginases inhibit eNOS activity by depletion of substrate and that the compartmentalization of l-arginine does not play a major role. PMID:23792682

  1. Disruption of COX-2 and eNOS does not confer protection from cardiovascular failure in lipopolysaccharide-treated conscious mice and isolated vascular rings

    DEFF Research Database (Denmark)

    Stæhr, Mette; Madsen, Kirsten; Vanhoutte, Paul M

    2011-01-01

    (NS 398), disruption of COX-2, endothelium removal, or eNOS deletion (eNOS(-/-)) did not improve vascular reactivity after LPS, while the NO synthase blockers 1400W and N(G)-nitro-l-arginine methyl ester prevented loss of tone. COX-2 and eNOS activities are not necessary for LPS-induced decreases...

  2. eNOS uncoupling in cardiovascular diseases--the role of oxidative stress and inflammation.

    Science.gov (United States)

    Karbach, Susanne; Wenzel, Philip; Waisman, Ari; Munzel, Thomas; Daiber, Andreas

    2014-01-01

    Many cardiovascular diseases and drug-induced complications are associated with - or even based on - an imbalance between the formation of reactive oxygen and nitrogen species (RONS) and antioxidant enzymes catalyzing the break-down of these harmful oxidants. According to the "kindling radical" hypothesis, the formation of RONS may trigger in certain conditions the activation of additional sources of RONS. According to recent reports, vascular dysfunction in general and cardiovascular complications such as hypertension, atherosclerosis and coronary artery diseases may be connected to inflammatory processes. The present review is focusing on the uncoupling of endothelial nitric oxide synthase (eNOS) by different mechanisms involving so-called "redox switches". The oxidative depletion of tetrahydrobiopterin (BH4), oxidative disruption of the dimeric eNOS complex, S-glutathionylation and adverse phosphorylation as well as RONS-triggered increases in levels of asymmetric dimethylarginine (ADMA) will be discussed. But also new concepts of eNOS uncoupling and state of the art detection of this process will be described. Another part of this review article will address pharmaceutical interventions preventing or reversing eNOS uncoupling and thereby normalize vascular function in a given disease setting. We finally turn our attention to the inflammatory mechanisms that are also involved in the development of endothelial dysfunction and cardiovascular disease. Inflammatory cell and cytokine profiles as well as their interactions, which are among the kindling mechanisms for the development of vascular dysfunction will be discussed on the basis of the current literature.

  3. Orthodontic force stimulates eNOS and iNOS in rat osteocytes

    NARCIS (Netherlands)

    Tan, S.D.; Xie, R.; Klein Nulend, J.; van Rheden, R.E.; Bronckers, A.L.J.J.; Kuijpers-Jagtman, A.M.; Von den Hoff, J.W.; Maltha, J.C.

    2009-01-01

    Mechanosensitive osteocytes are essential for bone remodeling. Nitric oxide, an important regulator of bone remodeling, is produced by osteocytes through the activity of constitutive endothelial nitric oxide synthase (eNOS) or inducible nitric oxide synthase (iNOS). We hypothesized that these

  4. Orthodontic force stimulates eNOS and iNOS in rat osteocytes.

    NARCIS (Netherlands)

    Tan, S.D.; Xie, R.; Klein-Nulend, J.; Rheden, R.E.M. van; Bronckers, A.L.; Kuijpers-Jagtman, A.M.; Hoff, J.W. Von den; Maltha, J.C.

    2009-01-01

    Mechanosensitive osteocytes are essential for bone remodeling. Nitric oxide, an important regulator of bone remodeling, is produced by osteocytes through the activity of constitutive endothelial nitric oxide synthase (eNOS) or inducible nitric oxide synthase (iNOS). We hypothesized that these

  5. Characterization of porcine ENO3: genomic and cDNA structure, polymorphism and expression

    Directory of Open Access Journals (Sweden)

    Xiong Yuanzhu

    2008-09-01

    Full Text Available Abstract In this study, a full-length cDNA of the porcine ENO3 gene encoding a 434 amino acid protein was isolated. It contains 12 exons over approximately 5.4 kb. Differential splicing in the 5'-untranslated sequence generates two forms of mRNA that differ from each other in the presence or absence of a 142-nucleotide fragment. Expression analysis showed that transcript 1 of ENO3 is highly expressed in liver and lung, while transcript 2 is highly expressed in skeletal muscle and heart. We provide the first evidence that in skeletal muscle expression of ENO3 is different between Yorkshire and Meishan pig breeds. Furthermore, real-time polymerase chain reaction revealed that, in Yorkshire pigs, skeletal muscle expression of transcript 1 is identical at postnatal day-1 and at other stages while that of transcript 2 is higher. Moreover, expression of transcript 1 is lower in skeletal muscle and all other tissue samples than that of transcript 2, with the exception of liver and kidney. Statistical analysis showed the existence of a polymorphism in the ENO3 gene between Chinese indigenous and introduced commercial western pig breeds and that it is associated with fat percentage, average backfat thickness, meat marbling and intramuscular fat in two different populations.

  6. Streigi saatus selgub täna lõunaks / Eno-Gerrit Link

    Index Scriptorium Estoniae

    Link, Eno-Gerrit

    2007-01-01

    Riiklik lepitaja Henn Pärn tegi viimase kompromissettepaneku. Juhul, kui ametiühingute, tööandjate ja lepitaja kohtumisel osalised seda heaks ei kiida, alustatakse hoiatusstreigiga. Vt. samas: Pärnu streikivate bussijuhtide pöördumine linnarahva poole

  7. Association of eNOS gene intron 4 a/b VNTR polymorphisms in children with nephrotic syndrome.

    Science.gov (United States)

    Dursun, Hasan; Noyan, Aytul; Matyar, Selcuk; Buyukcelik, Mithat; Soran, Mustafa; Cengiz, Nurcan; Bayazit, Aysun K; Seydaoglu, Gulsah; Attila, Gulen; Anarat, Ali

    2013-06-15

    To investigate the association of endothelial nitric oxide synthase gene intron 4 (eNOS4) polymorphisms with nephrotic syndrome, the eNOS4 genotypes were assessed in 161 children with nephrotic syndrome in comparison with 78 healthy subjects. We classified the children with nephritic syndrome into 2 groups: as steroid-sensitive nephrotic syndrome (SSNS) (n=125) and steroid-resistant nephrotic syndrome (SRNS) (n=36). The eNOS4 polymorphisms were analyzed by polymerase chain reaction. The frequencies of eNOS4 aa, ab and bb genotypes were 3%, 31%, and 66% in all the nephrotic syndrome groups, and 1%, 23%, and 76% in the control group (x(2)=2.87, p>0.05). In addition, the frequencies of eNOS4 aa, ab and bb genotypes were 2%, 33%, and 65% in SSNS group, and 5%, 28%, and 67% in the SRNS group (x(2)=1.13, p=0.567). The present study is the first to investigate eNOS4 gene polymorphisms in children with SSNS and SRNS. Our data show that the eNOS4 gene polymorphisms were not associated with the development, frequent relapse and response to steroid in nephritic syndrome. Copyright © 2013 Elsevier B.V. All rights reserved.

  8. The endothelial nitric oxide synthase (eNOS) polymorphism in otitis media with effusion (OME).

    Science.gov (United States)

    Ates, M; Cevik, C; Dokuyucu, R; Berber, O; Colak, S; Izmirli, M

    2017-02-01

    Otitis media with effusion (OME) is the most common disease after viral infections of upper respiratory tract (URTI) in children. Studies indicate the important role of nitric oxide (NO) in the etiology of hearing loss. However, there is no study that focuses on the role of nitric oxide synthase (eNOS) polymorphisms in the cases with OME. The aim of the present study is to evaluate the eNOS polymorphisms in the pediatric patients with OME. Eighty-nine patients who are diagnosed with otitis media with effusion and 85 healthy subjects who are compatible in terms of age and gender were included in the study. All patients in the study were subjected to complete ear, nose, throat (ENT) and audiological examinations. DNA analysis was performed with polymerase chain reaction (PCR) technique from the blood samples. The PCR product was cut by restriction fragment length polymorphism (RFLP) with BanII enzyme and checked by agarose gel electrophoresis. As a result of genetic analysis, there is no significant difference between patients and the controls in terms of eNOS Glu298Asp polymorphism (G/G, G/T, T/T). When these groups were compared in terms of allele distributions, a significant relationship was found between the patients and the controls (P=0.037). To the best of our knowledge, G allele was identified as predisposing to the development of OME and this is the first report indicates the correlation between the eNOS G894T polymorphism and OME in Turkey. Copyright © 2016 Elsevier Masson SAS. All rights reserved.

  9. Zasvojenost z igrami na srečo : magistrsko delo

    OpenAIRE

    Rozman, Patricia

    2014-01-01

    Namen magistrske naloge je predstaviti eno izmed najbolj skritih oblik zasvojenosti, to je zasvojenost z igrami na srečo. Zanimalo me je, kako ta oblika zasvojenosti vpliva na posameznika, tako telesno kot duševno. Ali posameznikova zasvojenost vpliva na ljudi okoli njega, na njegovo družino, prijatelje, znance in službo, ter kako se zasvojenec s tem sooča. Predvsem me je zanimalo, ali zasvojenost z igrami na srečo vodi v kriminalna dejanja in kakšna so ta dejanja ter kako je to ureje...

  10. VPLIV BARVE EMBALAŽE NA ZAZNAVANJE OKUSA GOSTEGA SOKA

    OpenAIRE

    Prevolšek, Daša

    2016-01-01

    Z barvami se srečujemo na vsakem koraku. Mogoče se njihovega vpliva ne zavedamo povsem, vendar nam lahko že pogled na določeno barvo dvigne ali pokvari razpoloženje. Barve imajo zelo velik vpliv na človeka in v nas prebujajo različna čustva. Nekatere barve so pozitivne in nas osrečujejo, druge pa na nas delujejo negativno. Ravno zaradi tega je tudi za oblikovalce embalaže zelo pomembno, da vnaprej predvidijo, kako se bodo potencialni porabniki njihovega izdelka odzivali na njihovo embalažo. P...

  11. Buckling Reduces eNOS Production and Stimulates Extracellular Matrix Remodeling in Arteries in Organ Culture.

    Science.gov (United States)

    Xiao, Yangming; Liu, Qin; Han, Hai-Chao

    2016-09-01

    Artery buckling alters the fluid shear stress and wall stress in the artery but its temporal effect on vascular wall remodeling is poorly understood. The purpose of this study was to investigate the early effect of artery buckling on endothelial nitric oxide synthase (eNOS) expression and extracellular matrix remodeling. Bilateral porcine carotid arteries were maintained in an ex vivo organ culture system with and without buckling while under the same physiological pressure and flow rate for 3-7 days. Matrix metalloproteinase-2 (MMP-2), MMP-9, fibronectin, elastin, collagen I, III and IV, tissue inhibitor of metalloproteinase-2 (TIMP-2), and eNOS were determined using Western blotting and immunohistochemistry. Our results showed that MMP-2 expression level was significantly higher in buckled arteries than in the controls and higher at the inner curve than at the outer curve of buckled arteries, while collagen IV content showed an opposite trend, suggesting that artery buckling increased MMP-2 expression and collagen IV degradation in a site-specific fashion. However, no differences for MMP-9, fibronectin, elastin, collagen I, III, and TIMP-2 were observed among the outer and inner curve sides of buckled arteries and straight controls. Additionally, eNOS expression was significantly decreased in buckled arteries. These results suggest that artery buckling triggers uneven wall remodeling that could lead to development of tortuous arteries.

  12. Activation of eNOS in endothelial cells exposed to ionizing radiation involves components of the DNA damage response pathway

    Energy Technology Data Exchange (ETDEWEB)

    Nagane, Masaki; Yasui, Hironobu; Sakai, Yuri; Yamamori, Tohru [Laboratory of Radiation Biology, Department of Environmental Veterinary Sciences, Graduate School of Veterinary Medicine, Hokkaido University, Sapporo 060-0818 (Japan); Niwa, Koichi [Laboratory of Biochemistry, Department of Food and Cosmetic Science, Faculty of Bioindustry, Tokyo University of Agriculture, Abashiri 099-2493 (Japan); Hattori, Yuichi [Department of Molecular and Medical Pharmacology, Graduate School of Medicine and Pharmaceutical Sciences, University of Toyama, Toyama 930-0194 (Japan); Kondo, Takashi [Department of Radiological Sciences, Graduate School of Medicine and Pharmaceutical Sciences, University of Toyama, Toyama 930-0194 (Japan); Inanami, Osamu, E-mail: inanami@vetmed.hokudai.ac.jp [Laboratory of Radiation Biology, Department of Environmental Veterinary Sciences, Graduate School of Veterinary Medicine, Hokkaido University, Sapporo 060-0818 (Japan)

    2015-01-02

    Highlights: • eNOS activity is increased in BAECs exposed to X-rays. • ATM is involved in this increased eNOS activity. • HSP90 modulates the radiation-induced activation of ATM and eNOS. - Abstract: In this study, the involvement of ataxia telangiectasia mutated (ATM) kinase and heat shock protein 90 (HSP90) in endothelial nitric oxide synthase (eNOS) activation was investigated in X-irradiated bovine aortic endothelial cells. The activity of nitric oxide synthase (NOS) and the phosphorylation of serine 1179 of eNOS (eNOS-Ser1179) were significantly increased in irradiated cells. The radiation-induced increases in NOS activity and eNOS-Ser1179 phosphorylation levels were significantly reduced by treatment with either an ATM inhibitor (Ku-60019) or an HSP90 inhibitor (geldanamycin). Geldanamycin was furthermore found to suppress the radiation-induced phosphorylation of ATM-Ser1181. Our results indicate that the radiation-induced eNOS activation in bovine aortic endothelial cells is regulated by ATM and HSP90.

  13. Efeitos da atorvastatina e do polimorfismo T-786C do gene eNOS sobre parâmetros do metabolismo lipídico plasmático Effects of atorvastatin and T-786C polymorphism of eNOS gene on plasma metabolic lipid parameters

    Directory of Open Access Journals (Sweden)

    Vanessa Helena de Souza Zago

    2013-01-01

    Full Text Available FUNDAMENTO: A atividade do óxido nítrico sintase endotelial (eNOS pode ser modulada pelo colesterol da lipoproteína de alta densidade (HDL-C, estatinas ou polimorfismos, como o T-786C de eNOS. OBJETIVO: Este estudo teve como objetivo avaliar se o polimorfismo T-786C está associado a alterações nos efeitos da atorvastatina no perfil lipídico, nas concentrações de metabólitos de óxido nítrico (NO e da proteína C reativa de alta sensibilidade (PCR-as. MÉTODOS: Trinta voluntários do sexo masculino, assintomáticos, com idade entre 18-56 anos foram genotipados e classificados de acordo com a ausência (TT, n = 15 ou presença (CC, n = 15 do polimorfismo. Eles foram selecionados aleatoriamente para a utilização de placebo e atorvastatina (10 mg/dia por 14 dias. Após cada tratamento foram medidos lípides, lipoproteínas, frações HDL2 e HDL3, atividade da proteína de transferência de colesteril éster (CETP, metabólitos de NO e PCR-as. RESULTADOS: As comparações entre genótipos após a administração de placebo mostraram aumento da atividade da CETP polimorfismo-dependente (TT, 12 ± 7; CC, 22 ± 12, p BACKGROUND: Endothelial nitric oxide synthase (eNOS activity may be modulated by high-density lipoprotein cholesterol (HDL-C, statins or polymorphisms, such as the T-786C of eNOS. OBJECTIVE: This study aimed at evaluating if the T-786C polymorphism is associated with changes of atorvastatin effects on the lipid profile, on the concentrations of metabolites of nitric oxide (NO and of high sensitivity C-reactive protein (hsCRP. METHODS: Thirty male volunteers, asymptomatic, aged between 18 and 56 years were genotyped and classified according to absence (TT, n = 15 or presence (CC, n = 15 of the polymorphism. They were randomly selected for the use of placebo or atorvastatin (10 mg/day/14 days. After each treatment lipids, lipoproteins, HDL2 and HDL3 composition, cholesteryl ester transfer protein (CETP activity, metabolites of NO

  14. Efeitos da atorvastatina e do polimorfismo T-786C do gene eNOS sobre parâmetros do metabolismo lipídico plasmático Effects of atorvastatin and T-786C polymorphism of eNOS gene on plasma metabolic lipid parameters

    Directory of Open Access Journals (Sweden)

    Vanessa Helena de Souza Zago

    2012-01-01

    Full Text Available FUNDAMENTO: A atividade do óxido nítrico sintase endotelial (eNOS pode ser modulada pelo colesterol da lipoproteína de alta densidade (HDL-C, estatinas ou polimorfismos, como o T-786C de eNOS. OBJETIVO: Este estudo teve como objetivo avaliar se o polimorfismo T-786C está associado a alterações nos efeitos da atorvastatina no perfil lipídico, nas concentrações de metabólitos de óxido nítrico (NO e da proteína C reativa de alta sensibilidade (PCR-as. MÉTODOS: Trinta voluntários do sexo masculino, assintomáticos, com idade entre 18-56 anos foram genotipados e classificados de acordo com a ausência (TT, n = 15 ou presença (CC, n = 15 do polimorfismo. Eles foram selecionados aleatoriamente para a utilização de placebo e atorvastatina (10 mg/dia por 14 dias. Após cada tratamento foram medidos lípides, lipoproteínas, frações HDL2 e HDL3, atividade da proteína de transferência de colesteril éster (CETP, metabólitos de NO e PCR-as. RESULTADOS: As comparações entre genótipos após a administração de placebo mostraram aumento da atividade da CETP polimorfismo-dependente (TT, 12 ± 7; CC, 22 ± 12, p BACKGROUND: Endothelial nitric oxide synthase (eNOS activity may be modulated by high-density lipoprotein cholesterol (HDL-C, statins or polymorphisms, such as the T-786C of eNOS. OBJECTIVE: This study aimed at evaluating if the T-786C polymorphism is associated with changes of atorvastatin effects on the lipid profile, on the concentrations of metabolites of nitric oxide (NO and of high sensitivity C-reactive protein (hsCRP. METHODS: Thirty male volunteers, asymptomatic, aged between 18 and 56 years were genotyped and classified according to absence (TT, n = 15 or presence (CC, n = 15 of the polymorphism. They were randomly selected for the use of placebo or atorvastatin (10 mg/day/14 days. After each treatment lipids, lipoproteins, HDL2 and HDL3 composition, cholesteryl ester transfer protein (CETP activity, metabolites of NO

  15. eNOS se correlaciona com a biogênese mitocondrial em corações com cardiopatia congênita e cianose

    Directory of Open Access Journals (Sweden)

    Juan Xiao

    2012-09-01

    Full Text Available FUNDAMENTO: O programa de biogênese mitocondrial no coração parece apresentar remodelação adaptativa após estresse biomecânico e oxidativo. Os mecanismos adaptativos que protegem o metabolismo do miocárdio durante a hipóxia são coordenados, em parte, pelo óxido nítrico (NO. OBJETIVO: Observar a biogênese mitocondrial e expressão do óxido nítrico sintase (NOS em corações de cardiopatia congênita com cianose; discutir a resposta mitocondrial à hipóxia crônica do miocárdio. MÉTODOS: Foram investigados 20 pacientes com defeitos cardíacos cianóticos (n = 10 ou acianóticos (n = 10. Foram estudadas amostras do miocárdio na via de saída ventricular direita, tomadas durante a operação. A análise morfométrica de mitocôndrias foi realizada por microscopia eletrônica de transmissão. A relação mtDNA/nDNA foi determinada com PCR em tempo real. Os níveis de transcrição da subunidade I da citocromo c oxidase (COXI, coativador-1α do receptor γ ativado por proliferador de peroxissoma (PGC-1α, o fator respiratório nuclear 1 (NRF1, e fator de transcrição mitocondrial A (Tfam foram detectados por reação em cadeia da polimerase via transcriptase reversa (RT-PCR ativado por fluorescência em tempo real. Os níveis proteicos de COXI e nNOS, iNOS e eNOS foram medidos por técnica de Western Blot. RESULTADOS: A densidade volumétrica mitocondrial (Vv e a densidade numérica (Nv foram significativamente elevadas em pacientes com cianose, em comparação com a cardiopatia congênita acianótica. MtDNA elevada e suprarregulação dos níveis de COXI, PGC-1 α, NRF1 e Tfam mRNA foram observadas em pacientes cianóticos. Os níveis de proteína de COXI e eNOS foram significativamente maiores no miocárdio de pacientes cianóticos que nos de acianóticos. Os níveis de transcrição do PGC-1α se correlacionam com os níveis de eNOS. CONCLUSÃO: A biogênese mitocondrial é ativada no miocárdio da via de saída ventricular na

  16. ENO1 promotes tumor proliferation and cell adhesion mediated drug resistance (CAM-DR) in Non-Hodgkin's Lymphomas

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Xinghua; Miao, Xiaobing; Wu, Yaxun; Li, Chunsun; Guo, Yan; Liu, Yushan; Chen, Yali; Lu, Xiaoyun [Department of Pathology, Affiliated Cancer Hospital of Nantong University, 30 North Tongyang Road, Pingchao, Nantong 226361, Jiangsu (China); Wang, Yuchan, E-mail: wangyuchannt@126.com [Department of Pathogen and Immunology, Medical College, Nantong University, 19 Qixiu Road, Nantong 226001, Jiangsu (China); He, Song, E-mail: hesongnt@126.com [Department of Pathology, Affiliated Cancer Hospital of Nantong University, 30 North Tongyang Road, Pingchao, Nantong 226361, Jiangsu (China)

    2015-07-15

    Enolases are glycolytic enzymes responsible for the ATP-generated conversion of 2-phosphoglycerate to phosphoenolpyruvate. In addition to the glycolytic function, Enolase 1 (ENO1) has been reported up-regulation in several tumor tissues. In this study, we investigated the expression and biologic function of ENO1 in Non-Hodgkin's Lymphomas (NHLs). Clinically, by western blot analysis we observed that ENO1 expression was apparently higher in diffuse large B-cell lymphoma than in the reactive lymphoid tissues. Subsequently, immunohistochemical staining of 144 NHLs suggested that the expression of ENO1 was significantly lower in the indolent lymphomas compared with the progressive lymphomas. Further, we identified ENO1 as an independent prognostic factor, and it was significantly correlated with overall survival of NHL patients. In addition, we found that ENO1 could promote cell proliferation, regulate cell cycle associated gene and PI3K/AKT signaling pathway in NHLs. Finally, we verified that ENO1 participated in the process of lymphoma cell adhesion mediated drug resistance (CAM-DR). Adhesion to FN or HS5 cells significantly protected OCI-Ly8 and Daudi cells from cytotoxicity compared with those cultured in suspension, and these effects were attenuated when transfected with ENO1-siRNA. Based on the study, we propose that inhibition of ENO1 expression may be a novel strategy for therapy for NHLs patients, and it may be a target for drug resistance. - Highlights: • ENO1 expression is reversely correlated with clinical outcomes of patients with NHLs. • ENO1 promotes the proliferation of NHL cells. • ENO1 regulates cell adhesion mediated drug resistance.

  17. Sildenafil promotes eNOS activation and inhibits NADPH oxidase in the transgenic sickle cell mouse penis.

    Science.gov (United States)

    Musicki, Biljana; Bivalacqua, Trinity J; Champion, Hunter C; Burnett, Arthur L

    2014-02-01

    Sickle cell disease (SCD)-associated vasculopathy in the penis is characterized by aberrant nitric oxide and phosphodiesterase (PDE) 5 signaling, and by increased oxidative stress. Preliminary clinical trials show that continuous treatment with PDE5 inhibitor sildenafil unassociated with sexual activity decreases priapic activity in patients with SCD. However, the mechanism of its vasculoprotective effect in the penis remains unclear. We evaluated whether continuous administration of PDE5 inhibitor sildenafil promotes eNOS function at posttranslational levels and decreases superoxide-producing enzyme NADPH oxidase activity in the sickle cell mouse penis. SCD transgenic mice were used as an animal model of SCD. WT mice served as controls. Mice received treatment with the PDE5 inhibitor sildenafil (100 mg/kg/day) or vehicle for 3 weeks. eNOS phosphorylation on Ser-1177 (positive regulatory site), eNOS interactions with heat-shock protein 90 (HSP90) (positive regulator), phosphorylated AKT (upstream mediator of eNOS phosphorylation on Ser-1177), an NADPH oxidase catalytic subunit gp91(phox), and a marker of oxidative stress (4-hydroxy-2-nonenal [HNE]) were measured by Western blot. Effect of continuous sildenafil treatment on eNOS posttranslational activation, NADPH oxidase catalytic subunit, and oxidative stress in the penis of the sickle cell mouse. Continuous treatment with sildenafil reversed (P penis. Sildenafil treatment of WT mice did not affect any of these parameters. Our findings that sildenafil enhances eNOS activation and inhibits NADPH oxidase function in the sickle cell mouse penis offers a vasculoprotective molecular basis for the therapeutic effect of sildenafil in the penis in association with SCD. © 2013 International Society for Sexual Medicine.

  18. Partial deletion of eNOS gene causes hyperinsulinemic state, unbalance of cardiac insulin signaling pathways and coronary dysfunction independently of high fat diet.

    Directory of Open Access Journals (Sweden)

    Cecilia Vecoli

    Full Text Available Abnormalities in eNOS gene, possibly interacting with high fat diet (HFD, affect peripheral vascular function and glucose metabolism. The relative role of eNOS gene, HFD and metabolic derangement on coronary function has not been fully elucidated. We test whether eNOS gene deficiency per se or in association with HFD modulates coronary function through mechanisms involving molecular pathways related to insulin signaling. Wild type (WT, eNOS-/- and eNOS+/- mice were studied. WT and eNOS+/- mice were fed with either standard or HF diet for 16 weeks and compared with standard diet fed eNOS-/-. Glucose and insulin tolerance tests were performed during the last week of diet. Coronary resistance (CR was measured at baseline and during infusions of acetylcholine (Ach or sodium-nitroprusside (SNP to evaluate endothelium-dependent or independent vasodilation, in the Langendorff isolated hearts. Cardiac expression of Akt and ERK genes as evaluation of two major insulin-regulated signaling pathways involved in the control of vascular tone were assessed by western blot. HFD-fed mice developed an overt diabetic state. Conversely, chow-fed genetically modified mice (in particular eNOS-/- showed a metabolic pattern characterized by normoglycemia and hyperinsulinemia with a limited degree of insulin resistance. CR was significantly higher in animals with eNOS gene deletions than in WT, independently of diet. Percent decrease in CR, during Ach infusion, was significantly lower in both eNOS-/- and eNOS+/- mice than in WT, independently of diet. SNP reduced CR in all groups except eNOS-/-. The cardiac ERK1-2/Akt ratio, increased in animals with eNOS gene deletions compared with WT, independently of diet. These results suggest that the eNOS genetic deficiency, associated or not with HFD, has a relevant effect on coronary vascular function, possibly mediated by increase in blood insulin levels and unbalance in insulin-dependent signaling in coronary vessels

  19. DISKRIMINACIJA PRI ZAPOSLOVANJU IN DELU NA PODLAGI SPOLNE USMERJENOSTI

    OpenAIRE

    Markovič, Polona

    2012-01-01

    Ustavno zagotovljena pravica do enakosti, brez kakršnegakoli razlikovanja na podlagi osebnih okoliščin, predstavlja eno izmed temeljnih človekovih pravic. Za zagotavljanje enakega obravnavanja posameznikov in različnih skupin oseb na vseh področjih družbenega življenja je neizogibno potrebna natančna zakonska opredelitev varstva pred diskriminacijo. Prepoved diskriminacije je pravno regulirana v določilih mnogih dokumentov, sprejetih na mednarodni in nacionalni ravni. Diskriminacijo lahko naj...

  20. Vasoinhibins Prevent Bradykinin-Stimulated Endothelial Cell Proliferation by Inactivating eNOS via Reduction of both Intracellular Ca2+ Levels and eNOS Phosphorylation at Ser1179

    Directory of Open Access Journals (Sweden)

    Carmen Clapp

    2011-07-01

    Full Text Available Vasoinhibins, a family of antiangiogenic peptides derived from prolactin proteolysis, inhibit the vascular effects of several proangiogenic factors, including bradykinin (BK. Here, we report that vasoinhibins block the BK-induced proliferation of bovine umbilical vein endothelial cells. This effect is mediated by the inactivation of endothelial nitric oxide synthase (eNOS, as the NO donor DETA-NONOate reverted vasoinhibin action. It is an experimentally proven fact that the elevation of intracellular Ca2+ levels ([Ca2+]i upon BK stimulation activates eNOS, and vasoinhibins blocked the BK-mediated activation of phospholipase C and the formation of inositol 1,4,5-triphosphate leading to a reduced release of Ca2+ from intracellular stores. The [Ca2+]i rise evoked by BK also involves the influx of extracellular Ca2+ via canonical transient receptor potential (TRPC channels. Vasoinhibins likely interfere with TRPC-mediated Ca2+ entry since La3+, which is an enhancer of TRPC4 and TRPC5 channel activity, prevented vasoinhibins from blocking the stimulation by BK of endothelial cell NO production and proliferation, and vasoinhibins reduced the BK-induced increase of TRPC5 mRNA expression. Finally, vasoinhibins prevented the BK-induced phosphorylation of eNOS at Ser1179, a post-translational modification that facilitates Ca2+-calmodulin activation of eNOS. Together, our data show that vasoinhibins, by lowering NO production through the inhibition of both [Ca2+]i mobilization and eNOS phosphorylation, prevent the BK-induced stimulation of endothelial cell proliferation. Thus, vasoinhibins help to regulate BK effects on angiogenesis and vascular homeostasis.

  1. Efeitos da atorvastatina e do polimorfismo T-786C do gene eNOS sobre parâmetros do metabolismo lipídico plasmático

    Directory of Open Access Journals (Sweden)

    Vanessa Helena de Souza Zago

    2013-01-01

    Full Text Available FUNDAMENTO: A atividade do óxido nítrico sintase endotelial (eNOS pode ser modulada pelo colesterol da lipoproteína de alta densidade (HDL-C, estatinas ou polimorfismos, como o T-786C de eNOS. OBJETIVO: Este estudo teve como objetivo avaliar se o polimorfismo T-786C está associado a alterações nos efeitos da atorvastatina no perfil lipídico, nas concentrações de metabólitos de óxido nítrico (NO e da proteína C reativa de alta sensibilidade (PCR-as. MÉTODOS: Trinta voluntários do sexo masculino, assintomáticos, com idade entre 18-56 anos foram genotipados e classificados de acordo com a ausência (TT, n = 15 ou presença (CC, n = 15 do polimorfismo. Eles foram selecionados aleatoriamente para a utilização de placebo e atorvastatina (10 mg/dia por 14 dias. Após cada tratamento foram medidos lípides, lipoproteínas, frações HDL2 e HDL3, atividade da proteína de transferência de colesteril éster (CETP, metabólitos de NO e PCR-as. RESULTADOS: As comparações entre genótipos após a administração de placebo mostraram aumento da atividade da CETP polimorfismo-dependente (TT, 12 ± 7; CC, 22 ± 12, p < 0,05. As análises da interação entre os tratamentos indicaram que a atorvastatina tem efeito sobre colesterol, LDL, nitrito e razões lípides/proteínas (HDL2 e HDL3 (p < 0,001 em ambos os genótipos. É interessante notar as interações genótipo/droga sobre a CETP (p < 0,07 e a lipoproteína (a [Lp(a] (p < 0,056, levando a uma diminuição limítrofe da CETP, embora sem afetar a Lp(a. A PRC-as não mostrou alterações. CONCLUSÃO: Os resultados sugerem que o tratamento com estatinas pode ser relevante para a prevenção primária da aterosclerose em pacientes com o polimorfismo T-786C do eNOS, considerando os efeitos no metabolismo lipídico.

  2. Mechanisms underlying erythrocyte and endothelial nitrite reduction to NO in hypoxia: role for Xanthine Oxidoreductase and eNOS

    Science.gov (United States)

    Webb, Andrew J.; Milsom, Alexandra B.; Rathod, Krishnaraj S.; Chu, Wai Lum; Qureshi, Shehla; Lovell, Matthew J.; Lecomte, Florence M.J.; Perrett, David; Raimondo, Carmello; Khoshbin, Espeed; Ahmed, Zubair; Uppal, Rakesh; Benjamin, Nigel; Hobbs, Adrian J.; Ahluwalia, Amrita

    2010-01-01

    Reduction of nitrite (NO2−) provides a major source of nitric oxide (NO) in the circulation, especially in hypoxemic conditions. Our previous studies suggest that xanthine oxidoreductase (XOR) is an important nitrite reductase in the heart and kidney. Herein, we have demonstrated that conversion of nitrite to NO by blood vessels and RBCs was enhanced in the presence of the XOR substrate, xanthine (10μM), and attenuated by the XOR inhibitor, allopurinol (100μM) in acidic and hypoxic conditions only. Whilst endothelial nitric oxide synthase (eNOS) inhibition had no effect on vascular nitrite reductase activity, in RBCs L-NAME, L-NMMA and L-arginine inhibited nitrite-derived NO production by >50% (p<0.01), at pH 7.4 and 6.8 under hypoxic conditions. Western blot and immunohistochemical analysis of RBC membranes confirmed the presence of eNOS and abundant XOR on whole RBCs. Thus, XOR and eNOS are ideally situated on the membranes of RBCs and blood vessels to generate intravascular vasodilator NO from nitrite during ischemic episodes. In addition to the proposed role of deoxyhemoglobin, our findings suggest that the nitrite reductase activity within the circulation, under hypoxic conditions (at physiological pH), is mediated by eNOS; however, as acidosis develops a substantial role for XOR becomes evident. PMID:18818408

  3. Impact of Lifestyle Intervention on HDL-Induced eNOS Activation and Cholesterol Efflux Capacity in Obese Adolescent

    Directory of Open Access Journals (Sweden)

    Jenny Wesnigk

    2016-01-01

    Full Text Available Background. Endothelial dysfunction occurs in obese children and adolescent and is regarded as a key step in the development of atherosclerosis. Important components for the development of endothelial dysfunction are reduced activity of endothelial nitric oxide synthase (eNOS and an increase in cholesterol deposition in the vessel wall, due to reduced reverse cholesterol transport (RCT activity. High density lipoprotein (HDL exhibits antiatherosclerotic properties including modulation of eNOS activity and cholesterol efflux capacity. Lifestyle intervention programs can modify endothelial dysfunction in obese adolescents, but their impact on HDL-mediated eNOS activation and RCT is unknown so far. Methods. Obese adolescents (15±1 years, BMI > 35 kg/m2 where randomized either to an intervention group (IG, n=8; restricted diet and exercise or to a usual care group (UC, n=8. At the beginning and after 10 months of treatment HDL-mediated eNOS phosphorylation and cholesterol efflux capacity were evaluated. Results. Ten months of treatment resulted in a substantial weight loss (−31%, an improvement of endothelial function, and an increase in HDL-mediated eNOS-Ser1177 phosphorylation and RCT. A correlation between change in eNOS-Ser1177 phosphorylation or RCT and change in endothelial function was noted. Conclusion. A structured lifestyle intervention program improves antiatherosclerotic HDL functions, thereby positively influencing endothelial function.

  4. Enolase1 (ENO1) and glucose-6-phosphate isomerase (GPI) are good markers to predict human sperm freezability.

    Science.gov (United States)

    Jiang, Xu-ping; Wang, Shang-qian; Wang, Wei; Xu, Yang; Xu, Zhen; Tang, Jing-yuan; Sun, Hong-yong; Wang, Zeng-jun; Zhang, Wei

    2015-08-01

    Sperm cryopreservation is a method to preserve sperm samples for a long period. However, the fertility of sperm decreases markedly after freezing and thawing in a certain amount of samples. The aim of the present study was to find useful and reliable predictive biomarkers of the capacity to withstand the freeze-thawing process in human ejaculates. Previous researches have shown that enolase1 (ENO1) and glucose-6-phosphate isomerase (GPI) are closely related to spermatozoa quality. We chose the two proteins as probable markers of sperm freezing capacity. Ejaculate samples were separated into good freezability ejaculates (GFE) and poor freezability ejaculates (PFE) according to progressive motility of the sperm after thawing. Before starting cryopreservation protocols, the two proteins from each group were compared using western blot analysis and immunofluorescence. Results showed that normalized content of ENO1 (P<0.05) and GPI (P<0.01) were both significantly higher in GFE than in PFE. The association of ENO1 and GPI with postthaw sperm viability and motility was confirmed using Pearson's linear correlation. In conclusion, ENO1 and GPI can be used as markers of human sperm freezability before starting the cryopreservation procedure. Copyright © 2015. Published by Elsevier Inc.

  5. Triterpenoic Acids from Apple Pomace Enhance the Activity of the Endothelial Nitric Oxide Synthase (eNOS).

    Science.gov (United States)

    Waldbauer, Katharina; Seiringer, Günter; Nguyen, Dieu Linh; Winkler, Johannes; Blaschke, Michael; McKinnon, Ruxandra; Urban, Ernst; Ladurner, Angela; Dirsch, Verena M; Zehl, Martin; Kopp, Brigitte

    2016-01-13

    Pomace is an easy-accessible raw material for the isolation of fruit-derived compounds. Fruit consumption is associated with health-promoting effects, such as the prevention of cardiovascular disease. Increased vascular nitric oxide (NO) bioavailability, for example, due to an enhanced endothelial nitric oxide synthase (eNOS) activity, could be one molecular mechanism mediating this effect. To identify compounds from apple (Malus domestica Borkh.) pomace that have the potential to amplify NO bioavailability via eNOS activation, a bioassay-guided fractionation of the methanol/water (70:30) extract has been performed using the (14)C-L-arginine to (14)C-L-citrulline conversion assay (ACCA) in the human endothelium-derived cell line EA.hy926. Phytochemical characterization of the active fractions was performed using the spectrophotometric assessment of the total phenolic content, as well as TLC, HPLC-DAD-ELSD, and HPLC-MS analyses. Eleven triterpenoic acids, of which one is a newly discovered compound, were identified as the main constituents in the most active fraction, accompanied by only minor contents of phenolic compounds. When tested individually, none of the tested compounds exhibited significant eNOS activation. Nevertheless, cell stimulation with the reconstituted compound mixture restored eNOS activation, validating the potential of apple pomace as a source of bioactive components.

  6. [Polymorphism of eNOS and iNOS Genes and Chronic Heart Failure in Patients With Ischemic Heart Disease].

    Science.gov (United States)

    Tepliakov, A T; Shilov, S N; Berezikova, E N; Iakovleva, N F; Maianskaia, S D; Popova, A A; Luksha, E B; Voronina, E N; Torim, Iu Iu; Karpov, R S

    2010-01-01

    URGENCY: Despite substantial progress in the treatment of coronary heart disease (CHD) and chronic heart failure (CHF) prognosis in these conditions remains extremely serious. This warrants their timely prevention and early detection. Aim. To study influence of inducible NO synthase (iNOS) (CCTTT)n, Glu298Asp and diallel polymorphism in the fourth intron (4a/4b polymorphism) of endothelial NO synthase gene (eNOS gene) on the state of endothelial function and risk of development of CHF in patients with CHD. 165 patients with CHD were studied (121 male and 44 female, mean age 56.7 + or - 5.3 years). Vasomotor endothelial function was evaluated using ultrasound method in the reactive hyperemia and trinitroglycerol tests. Genotypes were identified using RFLP analysis of PCR products. Control group consisted of 114 persons (54 male and 60 female, mean age 53.2 + or - 4.9 years). It was determined that the number of repeats of polymorphic locus (CCTTT)n of the iNOS gene and Glu allele of the polymorphic locus Glu298Asp of eNOS gene in the homozygous state were associated with the risk of development of CHD and class of severity of CHF clinical manifestation. In addition Glu allele of the polymorphic locus Glu298Asp of eNOS gene in the homozygous state was associated with the severity and unfavorable development of CHF. The endothelial-dependent dysfunction was more severe in homozygotes of Glu allele of the polymorphic locus Glu298Asp of eNOS gene than in carrier of allele 298Asp. Associations between polymorphic variant of VNTR intron 4 gene eNOS and CHF with the risk of development and endothelial dysfunction were not found. An association between polymorphism of iNOS gene (CCTTT)n, eNOS gene (Glu298Asp) with development of CHD and severity of CHF was shown. The polymorphism of eNOS gene (Glu298Asp) was associated with endothelial dysfunction.

  7. Effects of hyperbaric oxygen therapy in enhancing expressions of e-NOS, TNF-α and VEGF in wound healing

    Science.gov (United States)

    Susilo, Imam; Devi, Anita; Purwandhono, Azham; Hadi Warsito, Sunaryo

    2017-05-01

    Wound healing is a physiological process that occurs progressively through overlapping phases. Tissue oxygenation is an important part of the complex regulation for wound healing. Hyperbaric Oxygen (HBO) therapy is a method of increasing oxygen delivery to tissues. The therapy improves tissue oxygenation and stimulates the formation of H2O2 as a secondary messenger for Tumour Necrosis Factor alpha (TNF α), e-NOS, VEGF and Nuclear Factor Kappa Beta phosphorylation (NF-Kb) which play an important role in the rapid transcription of a wide variety of genes in response to extracellular stimuli. This study aims to determine the effects of Hyperbaric Oxygen therapy in enhancing the expressions of e-NOS, TNF-α, VEGF and wound healing. This study is an animal study with a ‘randomized control group of pre-test and post test design’ on 28 Wistar rats. Randomly, the rats were divided into 4 groups with 7 rats in each group. The HBO treatment group 1 received 5 sessions of HBO 2.4 ATA in 3 × 30 minutes; the HBO treatment group 2 received 10 sessions of HBO 2.4 ATA in 3 × 30 minutes; and each of the control groups were without HBO. Each of the 28 male rats were given a full thickness excisional wound of 1 × 1cm. Examinations of e-NOS, TNF-α, VEGF expressions and wound healing were performed on day-0 (pre-HBO) and day-5 HBO or on day-0 (pre-HBO) and day-10 HBO. The resultsshowthat the Hyperbaric Oxygen therapy can improve e-NOS (p=0.02), TNF-α (p= 0.02), VEGF expression (p=0.02) and wound healing (p=0.002) significantly in the provision of HBO 2.4 ATA for 3 × 30 minutes in 5 sessions over 5 consecutive days. While the 10 sessions of HBO 2.4 ATA for 3 × 30 minutes over 10 consecutive days only increase e-NOS (p=0.02), TNF-α (p=0.04), VEGF expression significantly (p=0.03) but do not improve wound healing significantly (p=0.3) compared with no HBO. The study concludes that HBO can improve the expressions of e-NOS, TNF-α, VEGF and wound healing in the provision of HBO

  8. An Eulerian method for computation of multimaterial impact with ENO shock-capturing and sharp interfaces

    CERN Document Server

    Udaykumar, H S; Belk, D M; Vanden, K J

    2003-01-01

    A technique is presented for the numerical simulation of high-speed multimaterial impact. Of particular interest is the interaction of solid impactors with targets. The computations are performed on a fixed Cartesian mesh by casting the equations governing material deformation in Eulerian conservation law form. The advantage of the Eulerian setting is the disconnection of the mesh from the boundary deformation allowing for large distortions of the interfaces. Eigenvalue analysis reveals that the system of equations is hyperbolic for the range of materials and impact velocities of interest. High-order accurate ENO shock-capturing schemes are used along with interface tracking techniques to evolve sharp immersed boundaries. The numerical technique is designed to tackle the following physical phenomena encountered during impact: (1) high velocities of impact leading to large deformations of the impactor as well as targets; (2) nonlinear wave-propagation and the development of shocks in the materials; (3) modelin...

  9. Načrtovanje izkoriščanja hidroenergije na primeru reke Mure

    OpenAIRE

    Madjar, Klaudija

    2016-01-01

    Reka Mura lahko kot neizkoriščen hidro potencial pripomore k zvišanju deleža energije iz obnovljivih virov. V diplomski nalogi je opisano izkoriščanje energije vode za pridobivanje električne energije, predstavljene pa so tudi obstoječe hidroelektrarne v Sloveniji. Nadalje so opisane hidrološke značilnosti reke Mure in ekosistemi ob njej. Načrtovane hidroelektrarne na reki Muri predstavljajo precejšen poseg v določeno območje, zato ga je pred realizacijo potrebno dobro proučiti. Izgradnja hid...

  10. Implicações farmacogenéticas de polimorfismos da eNOS para drogas de ação cardiovascular

    Directory of Open Access Journals (Sweden)

    Pâmela Souza Silva

    2011-02-01

    Full Text Available A farmacogenética é um dos campos mais promissores da medicina. A conclusão do Projeto Genoma permitiu que esse campo começasse a descobrir fatores complexos modulando a resposta às drogas, e novas tecnologias estão a poucos passos de permitir uma grande expansão da área. As doenças cardiovasculares estão atualmente entre as maiores causas de internações hospitalares e morte, e têm sido alvo de grande parte dos estudos genéticos de doenças complexas. Paralelamente à identificação de marcadores de suscetibilidade à doença, é necessária a investigação de como perfis genéticos diferentes podem alterar respostas aos fármacos atualmente empregados. O sistema biológico que controla a produção endotelial do óxido nítrico tem sido um dos grandes alvos nas respostas farmacológicas aos fármacos usados na terapia de doenças cardiovasculares. Esta revisão tem como objetivo abordar os conhecimentos correntes da interação entre as variações genéticas da eNOS e as respostas farmacológicas aos fármacos empregados no sistema cardiovascular.

  11. PP130. ENOS tagging SNP haplotypes in hypertensive disorders of pregnancy.

    Science.gov (United States)

    Sandrim, V; Muniz, L; Luizon, M; Palei, A C; Lacchini, R; Duarte, G; Cavalli, R; Tanus-Santos, J E

    2012-07-01

    Haplotypes formed by polymorphisms (T-786C, rs2070744; a variable number of tandem repeats in intron 4, and Glu298Asp, rs1799983) of eNOS gene were associated previously with gestational hypertension (GH) and preeclampsia (PE). However, no study has explored the tagging SNPs rs743506 and rs7830 in these disorders. The aim of the current study was to compare the distribution of the genotypes and haplotypes formed by the two tagging SNPs or by the five eNOS polymorphisms mentioned among healthy pregnant GH and PE. We recruited 122 HP, 138 GH and 157 PE. Genotypes for the T-786C, the Glu298Asp and rs743506 polymorphisms were determined by Taqmanâ Allele Discrimination assays and fluorescence signals were measured on Chromo 4 Detector (Bio-Rad Laboratories, USA). Genotypes for the VNTR polymorphism in intron 4 and rs7830, however, were determined by PCR and fragment separation by electrophoresis in 8% polyacrylamide gels. Plasma aliquots were analyzed in triplicate for their nitrite content using an ozone-based chemiluminescence assay. The haplotype formed by the most common variants in each polymorphism "T b G A C" was more frequent in PE group compared to HP (P=0.00004), which may be explained by the higher linkage disequilibrium found in PE compared to GH and HP. Conversely, the haplotype "C b G G C" was more frequent in HP compared to PE (P=0.00113), which is supported by previous findings that demonstrated the association of the combination "C b G" with higher level of nitrite (NO marker). Our results suggest a protective effect of the haplotype "C b G G C" against the development of PE. This study was funded by the Fundação de Amparo a Pesquisa do Estado de Minas Gerais (FAPEMIG-Brazil), the Coordenação de Aperfeiçoamento de Pessoal de Nível Superior (CAPES), Conselho Nacional de Desenvolvimento Científico e Tecnológico (CNPq) and the Fundação de Amparo a Pesquisa do Estado de São Paulo (FAPESP-Brazil). Copyright © 2012. Published by Elsevier B.V.

  12. FEATURES OF THE CLINICAL SIGNIFICANCE OF POLYMORPHIC VARIANTS OF ENOS AND AGTR2 GENES IN PATIENTS WITH CAD

    Directory of Open Access Journals (Sweden)

    A. L. Khokhlov

    2016-01-01

    Full Text Available Coronary heart disease (CHD is a major cause of mortality. Morphological substrate of CHD in most cases is atherosclerosis, which is based on structural genes polymorphism eNOS and AGTR2. The aim of the study was to study the prevalence of eNOS and AGTR2 genes in patients with coronary artery disease and the association of these genes with coronary heart disease. The study involved 187 patients aged 36 to 86 years (62,2±11,2 with different forms of CHD: stable and unstable angina, myocardial infarction and 45 people without CHD. Determination of gene polymorphisms was performed by real-time PCR analyzer of nucleic acids IQ 5 Bio-Rad. Statistical analysis was performed using Statistica 10.0. The study revealed a significant difference between the incidence of homozygous AA allelic variant gene AGTR2 group of patients with myocardial infarction and the comparison group; polymorphic variant AA AGTR2 gene is associated with earlier onset of coronary artery disease; It found that carriers of the polymorphic variant gene GA AGTR2 beginning statistically CHD occurred significantly later than in carriers of alleles GG and AA; age CHD debut TT allele carriers of the eNOS gene is associated with an earlier onset of the disease and statistically significantly different from the age of first CHD in carriers of alleles of polymorphic variants of GG and GT; revealed a positive correlation between the polymorphic allele AGTR2 gene with the presence of arterial hypertension in patients with coronary artery disease; It determined that the T allele carriers of the polymorphic gene eNOS is associated more early onset of hypertension, found the association of the polymorphic allele gene AGTR2 the need to use higher doses of ACE inhibitor — perindopril.

  13. Immunomodulatory effects of royal jelly on aorta CD3, CD68 and eNOS expression in hypercholesterolaemic rats

    Directory of Open Access Journals (Sweden)

    Amal Attia El-Morsy Ibrahim

    2014-08-01

    RJ administration (300 mg/kg/day with CH, produced a counteractive effect, represented in recompense of biochemical alteration, CD4 and CD8 expression. RJ intake also amended the histological picture. The immunohistochemical picture revealed a decrease in CD3, CD86 and eNOS in the aortic tissue. These findings attributed to the significant immunomodulatory effect of RJ remedy suppress deleterious effects of hypercholesterolaemia.

  14. Prevalence of endothelial nitric oxide synthase (eNOS) gene exon 7 Glu298Asp variant in North Eastern India

    Science.gov (United States)

    Shankarishan, Priyanka; Borah, Prasanta Kumar; Ahmed, Giasuddin; Mahanta, Jagadish

    2011-01-01

    Background & objectives Endothelial nitric oxide is a potent vasodilator and impairment of its generation brought about by gene polymorphism is considered a major predictor for several diseases. A single nucleotide polymorphism G894T within exon 7 of endothelial nitric oxide synthase (eNOS-7) gene, resulting in a replacement of glutamic acid by aspartic acid, has been studied as a putative candidate gene for cardiovascular diseases. The pattern of eNOS-7 Glu298Asp variant in the Indian population is poorly known. The present study was planned to determine the prevalence of the variant of this gene among tea garden community in Assam, North-East India with high prevalence of hypertension. Methods Study participants of both sex aged ≥18 yr were recruited randomly from temporary field clinics established in tea gardens of Dibrugarh, Assam. Genomic DNA was extracted from 409 subjects by the conventional phenol-chloroform method. The prevalence of the eNOS exon 7 Glu298Asp variant was determined by polymerase chain reaction and restriction fragment length polymorphism analysis. Results The study population was in Hardy-Weinberg Equilibrium. The frequency of the eNOS GG, GT and TT genotypes was found to be 75, 22 and 3 per cent respectively and did not show any significant difference in gender wise analysis. Interpretation & conclusions Our results showed that the prevalence of the homozygous GG genotype was high (75%) and the rare mutant genotype (homozygous, TT) was 3 per cent in a population at risk with cardiovascular disease. Such population-based data on various polymorphisms can ultimately be exploited in pharmacogenomics. PMID:21623032

  15. Substance P ameliorates tumor necrosis factor-alpha-induced endothelial cell dysfunction by regulating eNOS expression in vitro.

    Science.gov (United States)

    Piao, Jiyuan; Hong, Hyun Sook; Son, Youngsook

    2018-04-01

    The aim of this study was to explore the beneficial effects of SP on NO production and inflammation-induced vascular endothelium cell death. To mimic the inflammatory environment, TNF-α was treated with HUVECs, and SP was added prior to TNF-α to determine its protective effect. WST-1 assay was performed to detect cell viability. NO level in conditioned medium was measured by Griess Reagent System. The protein level of cleaved caspase-3, eNOS, and phosphorylated Akt was detected by Western blot analysis. TNF-α declined endothelial cell viability by downregulating Akt and NO production. TNF-α-induced cell death was reliably restored by NO, confirming the requirement of NO for cell survival. By contrast, pretreatment of SP attenuated TNF-α-induced cellular apoptosis, accompanied by an increase in the phosphorylation of Akt, eNOS expression, and NO production. Blockage of NK-1R, phosphorylated Akt or eNOS by CP-96345, A6730, or L-NAME entirely eliminated the effect of SP. SP can protect the vascular endothelium against inflammation-induced damage through modulation of the Akt/eNOS/NO signaling pathway. © 2018 John Wiley & Sons Ltd.

  16. The Puerarin improves renal function in STZ-induced diabetic rats by attenuating eNOS expression.

    Science.gov (United States)

    Zhang, Yong; Wang, Hongya; Yu, Li; Chen, Jimin

    2015-05-01

    Diabetic nephropathy (DN) is a serious complication and it leads to kidney failure. The endothelial nitric oxide synthases (eNOS) seems to be involved in the development and progression of DN. The Puerarin is a well-known Chinese traditional formula, which is widely used in clinical practice for the treatment of kidney disease. The present study was designed to investigate the renal protective effects of Puerarin on streptozotocin (STZ)-induced diabetic rats. Thirty Sprague-Dawley (SD) male rats were divided into three groups at random. The diabetic group and the Puerarin-treated group were intraperitoneally injected with STZ 65 mg/kg and the Puerarin-treated rats were intraperitoneally injected Puerarin 100 mg/kg/day for 4 weeks. The results showed the Puerarin could improve body weight, blood sugar, BUN and SCr levels, and reduce ultrastructural changes of kidney in diabetic rats. It also attenuated eNOS expression in glomerular endothelial cells and tubular cells of diabetic rats with Puerarin treatment (p renal-protective effects for the diabetic nephropathy, possibly through regulating eNOS expression, and it may be used as a potential therapeutic reagent.

  17. Efectos ecológicos del fenómeno ENOS en Colombia

    Directory of Open Access Journals (Sweden)

    Yesid Carvajal

    2014-06-01

    Full Text Available El fenómeno ENOS, tiene un sustancial efecto sobre las variaciones del clima a nivel mundial; por lo tanto, no sorprende que sus efectos tengan un impacto ecológico y socioeconómico fuerte, alterando la seguridad alimentaria de los países a nivel mundial. Ante este panorama, es comprensible que haya despertado el mayor interés mundial, no sólo en los especialistas en meteorología y oceanografía sino también entre biólogos, ecólogos, físicos, matemáticos, agrónomos, hidrólogos, economistas, sociólogos y planificadores, entre otros. En el presente documento, se muestra algunos de los principales efectos ecológicos en Colombia durante las fases extremas cálida (El Niño y fría (La Niña, indicando que es una necesidad urgente, orientar la investigación en sus causas, consecuencias e impactos.

  18. Purinergic glio-endothelial coupling during neuronal activity: role of P2Y1 receptors and eNOS in functional hyperemia in the mouse somatosensory cortex.

    Science.gov (United States)

    Toth, Peter; Tarantini, Stefano; Davila, Antonio; Valcarcel-Ares, M Noa; Tucsek, Zsuzsanna; Varamini, Behzad; Ballabh, Praveen; Sonntag, William E; Baur, Joseph A; Csiszar, Anna; Ungvari, Zoltan

    2015-12-01

    Impairment of moment-to-moment adjustment of cerebral blood flow (CBF) via neurovascular coupling is thought to play a critical role in the genesis of cognitive impairment associated with aging and pathological conditions associated with accelerated cerebromicrovascular aging (e.g., hypertension, obesity). Although previous studies demonstrate that endothelial dysfunction plays a critical role in neurovascular uncoupling in these conditions, the role of endothelial NO mediation in neurovascular coupling responses is not well understood. To establish the link between endothelial function and functional hyperemia, neurovascular coupling responses were studied in mutant mice overexpressing or deficient in endothelial NO synthase (eNOS), and the role of P2Y1 receptors in purinergic glioendothelial coupling was assessed. We found that genetic depletion of eNOS (eNOS(-/-)) and pharmacological inhibition of NO synthesis significantly decreased the CBF responses in the somatosensory cortex evoked by whisker stimulation and by administration of ATP. Overexpression of eNOS enhanced NO mediation of functional hyperemia. In control mice, the selective and potent P2Y1 receptor antagonist MRS2179 attenuated both whisker stimulation-induced and ATP-mediated CBF responses, whereas, in eNOS(-/-) mice, the inhibitory effects of MRS2179 were blunted. Collectively, our findings provide additional evidence for purinergic glio-endothelial coupling during neuronal activity, highlighting the role of ATP-mediated activation of eNOS via P2Y1 receptors in functional hyperemia. Copyright © 2015 the American Physiological Society.

  19. La precipitación de verano en el centro-oeste de Argentina y los fenómenos interanual El Niño/Oscilación Sur (ENOS e interdecádico "tipo" ENOS

    Directory of Open Access Journals (Sweden)

    Rosa Hilda Compagnucci

    2008-12-01

    Full Text Available Gran parte de la variabilidad interanual a multidecádica de la precipitación en el continente Sudamericano es atribuida a la variabilidad de la cuenca del Pacífico ecuatorial. Esta vinculación se establece a través del fenómeno de 2-6 años El Niño/Oscilación Sur (ENOS o de la variabilidad interdecádica "tipo" ENOS (Díaz y otros 1998, Grimm y otros 2000, Grimm 2003, entre otros. Por tanto, el presente estudio intenta examinar la relación existente entre la variabilidad interanual a multidecádica de la precipitación de verano en la región Centro-Oeste de Argentina y ambos procesos oceánicos de baja frecuencia. Los resultados muestran que tanto para la escala interanual (fenómeno ENOS como en menores escalas (interdecádico "tipo" ENOS no hay vinculación entre las condiciones de temperatura superficial del mar en la cuenca del Pacífico ecuatorial y la precipitación. Solo aparecen vinculadas físicamente las áreas oceánicas próximas al cono sur de Sudamérica del Pacífico Sur y del Atlántico Sur, siendo el sudoeste del Atlántico Sur el que mayor varianza explica.Most of the interanual-to-multidecadal variability of the South American precipitation is attributed to the variability of the equatorial Pacific basin. The link between both is established through either 2-to-6-year El Niño/Southern Oscillation (ENSO or the interdecadal El Niño-like variability (Díaz et al. 1998, Grimm et al. 2000, Grimm 2003, amongst other. Therefore, this study aims to examine the relationship between the interanual-to-multidecadal variability of the summer precipitation in Central-West Argentina, in South America, and both oceanic low-frequency processes. Results show that both at interanual scales (ENSO and at lower scales (ENSO-like there no exists link between the sea surface temperature in the equatorial Pacific and precipitation. Only the areas closer to the Southern American continent over the South Atlantic and South Pacific seem to be

  20. Effect of Antioxidants on Testicular iNOS and eNOS after High-Fat Diet in Rat.

    Science.gov (United States)

    Sohrabi, Maryam; Hosseini, Mahnaz; Inan, Sevinc; Alizadeh, Zohreh; Vahabian, Mehrangiz; Vahidinia, Ali Asghar; Lahoutian, Hosein

    2017-01-01

    Spermatogenesis is a process by which germ cells produce spermatozoa and can be disturbed at every level. Nitric Oxide Synthases (NOS), implicate in interactions with Oxidative Stress (OS) which is one of the main factors in the etiology of male infertility. The High Fat Diet (HFD) is a major factor of obesity which in turn is important for enhancing OS. Antioxidants and garlic could attenuate or reverse effects of HFD. The aim of the study was to investigate the effects of dietary antioxidants and garlic on testicular inducible NOS (iNOS) and endothelial NOS (eNOS) in Wistar albino rats fed on HFD. Groups (each n = 8) were: SD (100% access to standard diet), F-HFD, (100% access to HFD) and R-HFD (70% access to HFD), F-HFD +antioxidants, F-HFD+garlic and R-HFD+antioxidants. The HFD consisted of a 60% fatty diet in 3 forms: Without antioxidants, with antioxidants and with garlic. The testicular iNOS and eNOS were studied by immunohistochemical (IHC) method. Also used ANOVA, repeated measures ANOVA, t-tests and Tukey's test (where necessary) to analyze the data (pantioxidants groups. The eNOS increased in R-HFD,F-HFD and F-HFD+garlic groups. The H-E evaluation in R-HFD group showed a decrease in spermatogenesis score count and seminiferous tubules diameters (μm) in comparison with the SD and F-HFD groups. R-HFD+antioxidants group had lower score than F-HFD+antioxidants and F-HFD+garlic groups. Restricted fat diet consumption causes increase in weight and impairs spermatogenesis. Results of this study reveal that adding the antioxidants can't improve histological changes of testis. The iNOS expression in seminiferous tubules in restricted fat diet along with antioxidants, suggest a potential role of iNOS in spermatogenesis and male infertility.

  1. Investigation of gene expression and serum levels of PIN1 and eNOS with high blood pressure in patients with Alzheimer disease.

    Science.gov (United States)

    Azimi, Mina; Nikanfar, Masoud; Khakikhatibi, Fatemeh; Rahbarghazi, Reza; Nourazarian, Seyed Manuchehr; Biray Avci, Cigir; Nourazarian, Alireza

    2017-09-01

    According to evidence, Alzheimer's disease is known as one of the most serious neurodegenerative diseases, for which hypertension has been observed to be a key risk factor. Therefore, this study aims to examine the relationship between the PIN1 and eNOS genes expression, as well as serum levels and hypertension in Alzheimer's disease sufferers. Blood samples were obtained from subjects who were divided into four groups: the control group, normotensive Alzheimer's patients, the Alzheimer's sufferers group with hypertension, and the healthy group with only hypertension, considering the inhibition of confounding factors. Thereafter, eNOS and PIN1 genes expression along with serum levels were studied. Based on the obtained results, a statistically significant correlation didn't exist between serum level of PIN1 and the systolic and diastolic blood pressure, between serum level of eNOS and diastolic blood pressure in the norm tension Alzheimer's disease patients, between serum levels of PIN1, eNOS and systolic blood pressure, and between serum eNOS and systolic and diastolic blood pressure in the patients with hypertension (pdiseases in Alzheimer's disease. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. Propionyl-L-carnitine induces eNOS activation and nitric oxide synthesis in endothelial cells via PI3 and Akt kinases.

    Science.gov (United States)

    Ning, Wen-hu; Zhao, Kan

    2013-01-01

    Propionyl-l-carnitine (PLC) is a natural short-chain derivative of l-carnitine (LC), a natural amino acid that plays an important role in fatty acid metabolism. Recent studies suggest that PLC has vascular protective effects. Because of the importance of endothelial nitric oxide synthase (eNOS) and its product, antiatherogenic molecule nitric oxide (NO), in vascular endothelial function, we sought to elucidate that if PLC would stimulate eNOS and its upstream activators Akt and phosphatidylinositol 3-kinase (PI3 Kinase) in cultured human aortic endothelial cells (HAEC). PLC caused eNOS phosphorylation at Ser-1177, and dominant negative Akt and a novel Akt-selective inhibitor MK-2206 inhibited both PLC-mediated phosphorylation and activation of the enzyme. PI3 kinase inhibition also blocked the phosphorylation and activation of eNOS by PLC. Studies with specific drug inhibitors PD173955 and PP2 showed that the non-receptor tyrosine kinase, src, is an upstream stimulator of the PI3 kinase-Akt pathway in this pathway. In addition, PLC significantly decreased intracellular ATP/ADP ratio and activate AMPK, subsequently leading to Src activation. Finally, we demonstrated that the effects of PLC to augment eNOS activity were associated with a net increase in NO release from endothelial cells. NO production following incubation with PLC was abolished in endothelial cells coincubated with L-NAME, PD173955, LY294002, MK-2206 and compound C. In conclusion, PLC, via AMPK/Src-mediated signaling that leads to activation of PI3 kinase and Akt, stimulates eNOS, leading to increased production of NO. © 2013.

  3. Relationship between endothelial nitric oxide synthase (eNOS) and natural history of intracranial aneurysms: meta-analysis.

    Science.gov (United States)

    Paschoal, Eric Homero Albuquerque; Yamaki, Vitor Nagai; Teixeira, Renan Kleber Costa; Paschoal Junior, Fernando Mendes; Jong-A-Liem, Glaucia Suzanna; Teixeira, Manoel Jacobsen; Yamada, Elizabeth Sumi; Ribeiro-Dos-Santos, Ândrea; Bor-Seng-Shu, Edson

    2018-01-01

    The aneurysmal subarachnoid hemorrhage is a major public health problem described as a sudden drastic event with no warning symptoms and high morbidity and mortality rates. The role of the endothelial isoform of nitric oxide synthase gene polymorphism in intracranial aneurysms (IAs) is still a matter of controversy with divergent findings among European, American, and Asian populations. Our study purposed to test the association between intracranial aneurysms formation and nitric oxide gene polymorphisms through a systematic review and meta-analysis. Systematic search on Medline, Lilacs, and EMBASE was performed. The primary search resulted in 139 papers, out of which 9 met our inclusion criteria after a full text analysis. The dominant T786C model found a significant association with IA (OR 1.22, 95 % CI 1.04-1.44, p = 0.01), so did studies of the recessive T786C model (OR 0.37, 95 % CI 0.30-0.45, p < 0.0001) but with opposite effect. Our findings support the presence of the T786C polymorphism as a predictor for the development of intracranial aneurysm in the cerebral vascular system. More studies are necessary in order to elucidate the pathways of the endothelial nitric oxide synthase (eNOS) in cerebrovascular diseases and in defining how different allelic combinations of the eNOS gene single-nucleotide polymorphism (SNP) could favor this pathological process.

  4. Sildenafil Ameliorates Gentamicin-Induced Nephrotoxicity in Rats: Role of iNOS and eNOS

    Directory of Open Access Journals (Sweden)

    Mohamed A. Morsy

    2014-01-01

    Full Text Available Gentamicin, an aminoglycoside antibiotic, is used for the treatment of serious Gram-negative infections. However, its usefulness is limited by its nephrotoxicity. Sildenafil, a selective phosphodiesterase-5 inhibitor, was reported to prevent or decrease tissue injury. The aim of this study is to evaluate the potential protective effects of sildenafil on gentamicin-induced nephrotoxicity in rats. Male Wistar rats were injected with gentamicin (100 mg/kg/day, i.p. for 6 days with and without sildenafil. Sildenafil administration resulted in nephroprotective effect in gentamicin-intoxicated rats as it significantly decreased serum creatinine and urea, urinary albumin, and renal malondialdehyde and nitrite/nitrate levels, with a concomitant increase in renal catalase and superoxide dismutase activities compared to gentamicin-treated rats. Moreover, immunohistochemical examination revealed that sildenafil treatment markedly reduced inducible nitric oxide synthase (iNOS expression, while expression of endothelial nitric oxide synthase (eNOS was markedly enhanced. The protective effects of sildenafil were verified histopathologically. In conclusion, sildenafil protects rats against gentamicin-induced nephrotoxicity possibly, in part, through its antioxidant activity, inhibition of iNOS expression, and induction of eNOS production.

  5. Prunella vulgaris Suppresses HG-Induced Vascular Inflammation via Nrf2/HO-1/eNOS Activation

    Directory of Open Access Journals (Sweden)

    Ho Sub Lee

    2012-01-01

    Full Text Available Vascular inflammation is an important factor which can promote diabetic complications. In this study, the inhibitory effects of aqueous extract from Prunella vulgaris (APV on high glucose (HG-induced expression of cell adhesion molecules in human umbilical vein endothelial cells (HUVEC are reported. APV decreased HG-induced expression of intercellular adhesion molecule-1 (ICAM-1, vascular cell adhesion molecule-1 (VCAM-1, and E-selectin. APV also dose-dependently inhibited HG-induced adhesion of HL-60 monocytic cells. APV suppressed p65 NF-κB activation in HG-treated cells. APV significantly inhibited the formation of intracellular reactive oxygen species (ROS. HG-stimulated HUVEC secreted gelatinases, however, APV inhibited it. APV induced Akt phosphorylation as well as activation of heme oxygenase-1 (HO-1, eNOS, and nuclear factor E2-related factor 2 (Nrf2, which may protect vascular inflammation caused by HG. In conclusion, APV exerts anti-inflammatory effect via inhibition of ROS/NF-κB pathway by inducing HO-1 and eNOS expression mediated by Nrf2, thereby suggesting that Prunella vulgaris may be a possible therapeutic approach to the inhibition of diabetic vascular diseases.

  6. Estrogen and phytoestrogens: Effect on eNOS expression and in vitro vasodilation in cerebral arteries in ovariectomized Watanabe heritable hyperlipidemic rabbits

    DEFF Research Database (Denmark)

    Lund, Claus Otto; Mortensen, A; Nilas, Lisbeth

    2007-01-01

    . Concentration response curves to carbamylcholine chloride, sodium nitroprusside (SNP) and l-NAME were evaluated after precontraction with potassium. Total RNA was extracted, reverse transcribed and eNOS quantitated by real-time polymerase chain reaction (real-time PCR). RESULTS: Plasma cholesterol...... in any of the arteries. Correspondingly, eNOS mRNA was similarly expressed in all treatment groups in both arteries. CONCLUSIONS: Improvement of cerebral endothelial function by estrogen or soy isoflavones in ovariectomized WHHL rabbits is not supported by the present data. The findings may be unique...

  7. UPORABA POSPEŠKOMETRA ZA RAČUNALNIŠKE IGRE NA MOBILNI NAPRAVI

    OpenAIRE

    Krpan, Blaž

    2011-01-01

    V okviru diplomske naloge smo izdelali preprosto računalniško igro, ki teče na mobilni napravi z operacijskim sistemom android. Igralec mora z nagibanjem mobilne naprave pripeljati kroglico po labirintu do cilja. Delo mu otežujejo luknje, v katere kroglica ne sme pasti, in ledene površine, na katerih je nadziranje kroglice oteženo zaradi manjšega trenja. Igra ima menije, po katerih se sprehajamo z dotikanjem zaslona. Na voljo so različni labirinti, lestvica najboljših rezultatov za posamezen ...

  8. Odvodnja okoliša hotela Corinthia u Baški na Krku

    OpenAIRE

    Capić, Marinko

    2005-01-01

    Opisuje se projekt izvedbe odvodnje slivnih, oborinskih i procjednih voda okoliša hotela Corinthia u Baški na otoku Krku da bi se mogla izgraditi nova prilazna cesta i parkirališta. Prikazano je zatečeno stanje i način njegove sanacije za koju je trebalo izvesti tri vrste kanala: dva oblika betonskih kanala (trapeznih i cijevnih) za prihvat oborinskih, procjednih i voda s prometnica te obodni kanal na rubu zemljišne čestice za prihvat susjednih oborinskih voda.

  9. Influence of eNOS gene polymorphism on cardiometabolic parameters in response to physical training in postmenopausal women

    Directory of Open Access Journals (Sweden)

    R.D. Esposti

    2011-09-01

    Full Text Available The health-promoting effects of exercise training (ET are related to nitric oxide (NO production and/or its bioavailability. The objective of this study was to determine whether single nucleotide polymorphism of the endothelial NO synthase (eNOS gene at positions -786T>C, G894T (Glu298Asp and at the variable number of tandem repeat (VNTR Intron 4b/a would interfere with the cardiometabolic responses of postmenopausal women submitted to physical training. Forty-nine postmenopausal women were trained in sessions of 30-40 min, 3 days a week for 8 weeks. Genotypes, oxidative stress status and cardiometabolic parameters were then evaluated in a double-blind design. Both systolic and diastolic blood pressure values were significantly reduced after ET, which was genotype-independent. However, women without eNOS gene polymorphism at position -786T>C (TT genotype and Intron 4b/a (bb genotype presented a better reduction of total cholesterol levels (-786T>C: before = 213 ± 12.1, after = 159.8 ± 14.4, Δ = -24.9% and Intron 4b/a: before = 211.8 ± 7.4, after = 180.12 ± 6.4 mg/dL, Δ = -15%, and LDL cholesterol (-786T>C: before = 146.1 ± 13.3, after = 82.8 ± 9.2, Δ = -43.3% and Intron 4b/a: before = 143.2 ± 8, after = 102.7 ± 5.8 mg/dL, Δ = -28.3% in response to ET compared to those who carried the mutant allele. Superoxide dismutase activity was significantly increased in trained women whereas no changes were observed in malondialdehyde levels. Women without eNOS gene polymorphism at position -786T>C and Intron 4b/a showed a greater reduction of plasma cholesterol levels in response to ET. Furthermore, no genotype influence was observed on arterial blood pressure or oxidative stress status in this population.

  10. Riik hakkab Via Baltica maanteed neljarealiseks joonistama / Eno-Gerrit Link

    Index Scriptorium Estoniae

    Link, Eno-Gerrit

    2008-01-01

    Ilmunud ka: Postimees : na russkom jazõke 25. sept. lk. 2. Pärnu maavalitsuse ja maanteeameti eestvedamisel alustatakse Tallinnast Iklani kulgeva Via Baltica liiklussoone teemaplaneeringut, mille järgi tuleb Pärnumaal leida lahendused Are ja Pärnu ümbersõidule ning Nurme õgvendusele. Arvamust avaldab Are vallavanem Jaanus Männik

  11. Eno-culture and Identity: The installation as a new methodology in Artistic Research and Heritage Education

    Directory of Open Access Journals (Sweden)

    Ruth Marañón Martínez de la Puente

    2018-03-01

    Full Text Available The aesthetic experience and the artistic knowledge always have been connected with the Heritage Education, due to the great importance in rewarding pedagogic processes, specially, in non-formal spaces. In our research, the installation (with its features and competences has turned into the most interesting educational tool to transform the reality of our work’s context: Rioja Alavesa. Thus, across the workshops "Instálate" (organized inside different wineries of the region, we worked the Wine Cultural Heritage (Eno-culture, the Artistic Research and the knowledge based on the sensitive experience. In this article, we showed the results of this experience, proposing the installation as a new interesting and practical method of Artistic Research in Heritage Education. In conclusion, we propose the art-installation as a different key to work the identity, contemporary art, culture and heritage.

  12. A Multilevel Prediction of Physiological Response to Challenge: Interactions among Child Maltreatment, Neighborhood Crime, eNOS and GABRA6

    Science.gov (United States)

    Lynch, Michael; Manly, Jody Todd; Cicchetti, Dante

    2015-01-01

    Physiological response to stress has been linked to variety of healthy and pathological conditions. The current study conducted a multilevel examination of interactions among environmental toxins – i.e., neighborhood crime and child maltreatment – and specific genetic polymorphisms of eNOS and GABRA6. A total of 186 children were recruited at age 4. At this time, the presence or absence of child maltreatment was determined, as was the amount of crime that occurred in their neighborhood during the previous year. At age 9, the children were brought to the lab where their physiological response to a cognitive challenge – i.e., change in the amplitude of RSA – was assessed and DNA samples were collected for subsequent genotyping. Results confirmed that complex G x G, E x E, and G x E interactions were associated with different patterns of RSA reactivity. The implications for future research and evidence-based intervention are discussed. PMID:26535938

  13. Chronic aerobic exercise associated to dietary modification improve endothelial function and eNOS expression in high fat fed hamsters.

    Directory of Open Access Journals (Sweden)

    Beatriz C S Boa

    Full Text Available Obesity is epidemic in the western world and central adipose tissue deposition points to increased cardiovascular morbidity and mortality, independently of any association between obesity and other cardiovascular risk factors. Physical exercise has been used as non-pharmacological treatment to significantly reverse/attenuate obesity comorbidities. In this study we have investigated effects of exercise and/or dietary modification on microcirculatory function, body composition, serum glucose, iNOS and eNOS expression on 120 male hamsters treated for 12 weeks with high fat chow (HF, n = 30 starting on the 21st day of birth. From week 12 to 20, animals were randomly separated in HF (no treatment change, return to standard chow (HFSC, n = 30, high fat chow associated to an aerobic exercise training program (AET (HFEX, n = 30 and return to standard chow+AET (HFSCEX, n = 30. Microvascular reactivity in response to acetylcholine and sodium nitroprusside and macromolecular permeability increase induced by 30 minutes ischemia followed by reperfusion were assessed on the cheek pouch preparation. Total body fat and aorta eNOS and iNOS expression by immunoblotting assay were evaluated on the experimental day. Compared to HFSC and HFSCEX groups, HF and HFEX ones presented increased visceral fat [(mean±SEM (HF4.9±1.5 g and (HFEX4.7±0.9 g vs. (HFSC*3.0±0.7 g and (HFSCEX*1.9±0.4 g/100 g BW]; impaired endothelial-dependent vasodilatation [Ach 10(-8 M (HF87.9±2.7%; (HFSC*116.7±5.9%; (HFEX*109.1±4.6%; (HFSCEX*105±2.8%; Ach10(-6 M (HF95.3±3.1%; (HFSC*126±6.2%; (HFEX*122.5±2.8%; (HFSCEX*118.1±4.3% and Ach10(-4 M (HF109.5±4.8%; (HFSC*149.6±6.6%; (HFEX*143.5±5.4% and (HFSCEX*139.4±5.2%], macromolecular permeability increase after ischemia/reperfusion [(HF40.5±4.2; (HFSC*19.0±1.6; (HFEX*18.6±2.1 and (HFSCEX* 21.5±3.7 leaks/cm2, decreased eNOS expression, increased leptin and glycaemic levels. Endothelial-independent microvascular

  14. Priapism in a Fabry disease mouse model is associated with upregulated penile nNOS and eNOS expression.

    Science.gov (United States)

    Meng, Xing-Li; Arning, Erland; Wight-Carter, Mary; Day, Taniqua S; Jabbarzadeh-Tabrizi, Siamak; Chen, Shuyuan; Ziegler, Robin J; Bottiglieri, Teodoro; Schneider, Jay W; Cheng, Seng H; Schiffmann, Raphael; Shen, Jin-Song

    2018-03-01

    Fabry disease is a glycosphingolipidosis caused by deficient activity of α-galactosidase A; it is one of a few diseases that are associated with priapism, an abnormal prolonged erection of the penis. The goal of this study was to investigate the pathogenesis of Fabry disease-associated priapism in a mouse model of the disease. We found that Fabry mice develop late-onset priapism. Neuronal nitric oxide synthase (nNOS), which was predominantly present as the 120-kDa N-terminus-truncated form, was significantly upregulated in the penis of 18-month-old Fabry mice compared to wild type controls (~fivefold). Endothelial NOS (eNOS) was also upregulated (~twofold). NO level in penile tissues of Fabry mice was significantly higher than wild type controls at 18 months. Gene transfer-mediated enzyme replacement therapy reversed abnormal nNOS expression in the Fabry mouse penis. The penile nNOS level was restored by antiandrogen treatment, suggesting that hyperactive androgen receptor signaling in Fabry mice may contribute to nNOS upregulation. However, the phosphodiesterase-5A expression level and the adenosine content in the penis, which are known to play roles in the development of priapism in other etiologies, were unchanged in Fabry mice. In conclusion, these data suggested that increased nNOS (and probably eNOS) content and the consequential elevated NO production and high arterial blood flow in the penis may be the underlying mechanism of priapism in Fabry mice. Furthermore, in combination with previous findings, this study suggested that regulation of NOS expression is susceptible to α-galactosidase A deficiency, and this may represent a general pathogenic mechanism of Fabry vasculopathy.

  15. Nebivolol alleviates aortic remodeling through eNOS upregulation and inhibition of oxidative stress in l-NAME-induced hypertensive rats.

    Science.gov (United States)

    Wang, Yan; Zhang, Fei; Liu, Yu; Yin, Sha; Pang, Xuefen; Li, Zhidong; Wei, Zehui

    2017-01-01

    To investigate the effect and mechanism of nebivolol on aortic remodeling in N-nitro-l-arginine methyl ester (l-NAME)-induced hypertension. Male Sprague-Dawley rats were treated with equal volumes of drinking water or l-NAME (60 mg/kg/day), alone or in combination with nebivolol (8 mg/kg/day) or atenolol (80 mg/kg/day) by gavage for 8 weeks. Systolic blood pressure (SBP), aortic morphometry, plasma nitric oxide (NO) levels, nitric oxide synthase (NOS) activity, and relaxation of aorta to acetylcholine were determined. Protein expression of endothelial NOS (eNOS), Akt, and NADPH oxidase (Nox) was evaluated. l-NAME-treated rats showed an elevated SBP associated with aortic remodeling. l-NAME-treated rats showed reduced plasma NO levels and NOS activity and increased reactive oxygen species (ROS). Protein expression of eNOS, eNOS phosphorylated at Ser 1177 (p-eNOS), Akt, and Akt phosphorylated at Ser 473 (p-Akt) decreased, whereas that of Nox2, Nox4, and p22 phox increased in the aortas from l-NAME-treated rats. Nebivolol treatment reduced SBP and ameliorated aortic remodeling. The effects of nebivolol were accompanied by increasing NO levels, NOS activity, and expression of eNOS, p-eNOS, Akt, and p-Akt, as well as reduction of ROS generation and Nox2, Nox4, and p22 phox expression. These effects of nebivolol were not reproduced by atenolol. Our data indicate a protective role of nebivolol on the high blood pressure and vascular remodeling induced by l-NAME. The beneficial vascular effect of nebivolol is mediated by the upregulation of eNOS and inhibition of oxidative stress.

  16. Enolase 1 (ENO1 and protein disulfide-isomerase associated 3 (PDIA3 regulate Wnt/β-catenin-driven trans-differentiation of murine alveolar epithelial cells

    Directory of Open Access Journals (Sweden)

    Kathrin Mutze

    2015-08-01

    Full Text Available The alveolar epithelium represents a major site of tissue destruction during lung injury. It consists of alveolar epithelial type I (ATI and type II (ATII cells. ATII cells are capable of self-renewal and exert progenitor function for ATI cells upon alveolar epithelial injury. Cell differentiation pathways enabling this plasticity and allowing for proper repair, however, are poorly understood. Here, we applied proteomics, expression analysis and functional studies in primary murine ATII cells to identify proteins and molecular mechanisms involved in alveolar epithelial plasticity. Mass spectrometry of cultured ATII cells revealed a reduction of carbonyl reductase 2 (CBR2 and an increase in enolase 1 (ENO1 and protein disulfide-isomerase associated 3 (PDIA3 protein expression during ATII-to-ATI cell trans-differentiation. This was accompanied by increased Wnt/β-catenin signaling, as analyzed by qRT-PCR and immunoblotting. Notably, ENO1 and PDIA3, along with T1α (podoplanin; an ATI cell marker, exhibited decreased protein expression upon pharmacological and molecular Wnt/β-catenin inhibition in cultured ATII cells, whereas CBR2 levels were stabilized. Moreover, we analyzed primary ATII cells from mice with bleomycin-induced lung injury, a model exhibiting activated Wnt/β-catenin signaling in vivo. We observed reduced CBR2 significantly correlating with surfactant protein C (SFTPC, whereas ENO1 and PDIA3 along with T1α were increased in injured ATII cells. Finally, siRNA-mediated knockdown of ENO1, as well as PDIA3, in primary ATII cells led to reduced T1α expression, indicating diminished cell trans-differentiation. Our data thus identified proteins involved in ATII-to-ATI cell trans-differentiation and suggest a Wnt/β-catenin-driven functional role of ENO1 and PDIA3 in alveolar epithelial cell plasticity in lung injury and repair.

  17. Antenatal Maternally-Administered Phosphodiesterase Type 5 Inhibitors Normalize eNOS Expression in the Fetal Lamb Model of Congenital Diaphragmatic Hernia

    Science.gov (United States)

    Shue, Eveline H; Schecter, Samuel C.; Gong, Wenhui; Etemadi, Mozziyar; Johengen, Michael; Iqbal, Corey; Derderian, S. Christopher; Oishi, Peter; Fineman, Jeffrey R.; Miniati, Doug

    2013-01-01

    Purpose Pulmonary hypertension (pHTN), a main determinant of survival in congenital diaphragmatic hernia (CDH), results from in utero vascular remodeling. Phosphodiesterase type 5 (PDE5) inhibitors have never been used antenatally to treat pHTN. The purpose of this study is to determine if antenatal PDE5 inhibitors can prevent pHTN in the fetal lamb model of CDH. Methods CDH were created in pregnant ewes. Postoperatively, pregnant ewes received oral placebo or tadalafil, a PDE5 inhibitor, until delivery. Near term gestation, lambs underwent resuscitations, and lung tissue was snap frozen for protein analysis. Results Mean cGMP levels were 0.53±0.11 in placebo-treated fetal lambs and 1.73±0.21 in tadalafil-treated fetal lambs (p=0.002). Normalized expression of eNOS was 82±12% in Normal-Placebo, 61±5% in CDH-Placebo, 116±6% in Normal-Tadalafil, and 86±8% in CDH-Tadalafil lambs. Normalized expression of β-sGC was 105±15% in Normal-Placebo, 82±3% in CDH-Placebo, 158±16% in Normal-Tadalafil, and 86±8% in CDH-Tadalafil lambs. Endothelial NOS and β-sGC were significantly decreased in CDH (p = 0.0007 and 0.01 for eNOS and β-sGC, respectively), and tadalafil significantly increased eNOS expression (p = 0.0002). Conclusions PDE5 inhibitors can cross the placental barrier. β-sGC and eNOS are downregulated in fetal lambs with CDH. Antenatal PDE5 inhibitors normalize eNOS and may prevent in utero vascular remodeling in CDH. PMID:24439578

  18. Role of Ca2+ in the control of H2O2-modulated phosphorylation pathways leading to eNOS activation in cardiac myocytes.

    Directory of Open Access Journals (Sweden)

    Juliano L Sartoretto

    Full Text Available Nitric oxide (NO and hydrogen peroxide (H(2O(2 play key roles in physiological and pathological responses in cardiac myocytes. The mechanisms whereby H(2O(2-modulated phosphorylation pathways regulate the endothelial isoform of nitric oxide synthase (eNOS in these cells are incompletely understood. We show here that H(2O(2 treatment of adult mouse cardiac myocytes leads to increases in intracellular Ca(2+ ([Ca(2+](i, and document that activity of the L-type Ca(2+ channel is necessary for the H(2O(2-promoted increase in sarcomere shortening and of [Ca(2+](i. Using the chemical NO sensor Cu(2(FL2E, we discovered that the H(2O(2-promoted increase in cardiac myocyte NO synthesis requires activation of the L-type Ca(2+ channel, as well as phosphorylation of the AMP-activated protein kinase (AMPK, and mitogen-activated protein kinase kinase 1/2 (MEK1/2. Moreover, H(2O(2-stimulated phosphorylations of eNOS, AMPK, MEK1/2, and ERK1/2 all depend on both an increase in [Ca(2+](i as well as the activation of protein kinase C (PKC. We also found that H(2O(2-promoted cardiac myocyte eNOS translocation from peripheral membranes to internal sites is abrogated by the L-type Ca(2+ channel blocker nifedipine. We have previously shown that kinase Akt is also involved in H(2O(2-promoted eNOS phosphorylation. Here we present evidence documenting that H(2O(2-promoted Akt phosphorylation is dependent on activation of the L-type Ca(2+ channel, but is independent of PKC. These studies establish key roles for Ca(2+- and PKC-dependent signaling pathways in the modulation of cardiac myocyte eNOS activation by H(2O(2.

  19. Alteration in cardiac uncoupling proteins and eNOS gene expression following high-intensity interval training in favor of increasing mechanical efficiency

    Science.gov (United States)

    Fallahi, Ali Asghar; Shekarfroush, Shahnaz; Rahimi, Mostafa; Jalali, Amirhossain; Khoshbaten, Ali

    2016-01-01

    Objective(s): High-intensity interval training (HIIT) increases energy expenditure and mechanical energy efficiency. Although both uncoupling proteins (UCPs) and endothelial nitric oxide synthase (eNOS) affect the mechanical efficiency and antioxidant capacity, their effects are inverse. The aim of this study was to determine whether the alterations of cardiac UCP2, UCP3, and eNOS mRNA expression following HIIT are in favor of increased mechanical efficiency or decreased oxidative stress. Materials and Methods: Wistar rats were divided into five groups: control group (n=12), HIIT for an acute bout (AT1), short term HIIT for 3 and 5 sessions (ST3 and ST5), long-term training for 8 weeks (LT) (6 in each group). The rats of the training groups were made to run on a treadmill for 60 min in three stages: 6 min running for warm-up, 7 intervals of 7 min running on treadmill with a slope of 5° to 20° (4 min with an intensity of 80-110% VO2max and 3 min at 50-60% VO2max), and 5-min running for cool-down. The control group did not participate in any exercise program. Rats were sacrificed and the hearts were extracted to analyze the levels of UCP2, UCP3 and eNOS mRNA by RT-PCR. Results: UCP3 expression was increased significantly following an acute training bout. Repeated HIIT for 8 weeks resulted in a significant decrease in UCPs mRNA and a significant increase in eNOS expression in cardiac muscle. Conclusion: This study indicates that Long term HIIT through decreasing UCPs mRNA and increasing eNOS mRNA expression may enhance energy efficiency and physical performance. PMID:27114795

  20. Model Skinner Operant Conditioning automata i bionički naučeno upravljanje robota

    OpenAIRE

    Cai, Jianxian; Hong, Li; Cheng, Lina; Yu, Ruihong

    2016-01-01

    Fuzzy Skinner Operant Conditioning Automaton (FSOCA) sastavljen je na temelju Operant Conditioning mehanizma primjenom teorije neizrazitih skupova. Osnovno obilježje automata FSOCA je sljedeće: neizraziti rezultati stanja pomoću Gausove funkcije koriste se kao skupovi neizrazitog stanja; neizrazita pravila preslikavanja (fuzzy mapping rules) kod fuzzy-conditioning-operacije zamjenjuju stohastičke "conditioning-operant" skupove preslikavanja. Stoga se automat FSOCA može koristiti za opisivanje...

  1. Vpliv organizacije vzgojno-izobraževalnega procesa likovne umetnosti na dosežke učencev

    OpenAIRE

    Zorjan, Marlene

    2016-01-01

    Pri pouku likovne umetnosti ugotavljamo, da so šole premalo fleksibilne pri oblikovanju urnika. Pouk likovne umetnosti lahko poteka v različnih oblikah, na primer posamezno po eno uro na teden ali strnjeno po dve šolski uri, torej v blok uri na štirinajst dni. V praksi ugotavljamo, da so zaradi organizacije učnega procesa razlike v likovnem spominu, saj je začetek reševanja likovne naloge časovno omejen, snovanje idej učencev pa je prekinjeno, zato pri nadaljevanju likovne naloge učitelj potr...

  2. Effects of aerobic exercise on the blood pressure, oxidative stress and eNOS gene polymorphism in pre-hypertensive older people.

    Science.gov (United States)

    Zago, Anderson Saranz; Park, Joon-Young; Fenty-Stewart, Nicola; Silveira, Leonardo Reis; Kokubun, Eduardo; Brown, Michael D

    2010-11-01

    The polymorphisms of endothelial nitric oxide synthase (eNOS) are associated with reduced eNOS activity. Aerobic exercise training (AEX) may influence resting nitric oxide (NO) production, oxidative stress and blood pressure. The purpose of this study was to investigate the effect of AEX on the relationship among blood pressure, eNOS gene polymorphism and oxidative stress in pre-hypertensive older people. 118 pre-hypertensive subjects (59 ± 6 years) had blood samples collected after a 12 h overnight fast for assessing plasma NO metabolites (NOx) assays, thiobarbituric acid reactive substances (T-BARS) and superoxide dismutase activity (ecSOD). eNOS polymorphism (T-786C and G-894T) was done by standard PCR methods. All people were divided according to the genotype results (G1: TT/GG, G2: TT/GT + TT, G3: TC + CC/GG, G4: TC + CC/GT + TT). All parameters were measured before and after 6 months of AEX (70% of VO(2 max)). At baseline, no difference was found in systolic and diastolic blood pressure, ecSOD and T-BARS activity. Plasma NOx levels were significantly different between G1 (19 ± 1 μM) and G4 (14.2 ± 0.6 μM) and between G2 (20.1 ± 1.7 μM) and G4 (14.2 ± 0.6 μM). Therefore, reduced NOx concentration in G4 group occurred only when the polymorphisms were associated, suggesting that these results are more related to genetic factors than NO-scavenging effect. After AEX, the G4 increased NOx values (17.2 ± 1.2 μM) and decreased blood pressure. G1, G3 and G4 decreased T-BARS levels. These results suggest the AEX can modulate the NOx concentration, eNOS activity and the relationship among eNOS gene polymorphism, oxidative stress and blood pressure especially in C (T-786C) and T (G-894T) allele carriers.

  3. Evaluation of Protective Immune Responses Induced by Recombinant TrxLp and ENO2 Proteins against Toxoplasma gondii Infection in BALB/c Mice

    Directory of Open Access Journals (Sweden)

    Meng Wang

    2016-01-01

    Full Text Available Toxoplasma gondii is an obligate intracellular parasitic protozoan that can infect almost all species of warm-blooded animals. As any chemical-based drugs could not act against the tissue cyst stage of T. gondii, vaccination may be one of the ideal control strategies. In the present study, two new vaccine candidates, named TgENO2 and TgTrxLp, were purified from Escherichia coli with pET-30a(+ expression system and then were injected into BALB/c mice to evaluate the protective efficacy against acute and chronic toxoplasmosis. The results showed that both the recombinant proteins, either alone or in combination, could elicit strong humoral and cellular immune responses with a higher level of IgG antibodies, IFN-γ, IL-2, CD4+, and CD8+ T cells as compared to those in mice from control groups. After acute challenge with tachyzoites of the GJS strain, mice immunized with rTgTrxLp (8±2.77 d, rTgENO2 (7.4±1.81 d, and rTgTrxLp + rTgENO2 (8.38±4.57 d proteins showed significantly longer survival time than those that received Freund’s adjuvant (6.78±2.08 d and PBS (6.38±4.65 d (χ2 = 9.687, df = 4, P=0.046. The protective immunity of rTgTrxLp, rTgENO2, and rTgTrxLp + rTgENO2 proteins against chronic T. gondii infection showed 69.77%, 58.14%, and 20.93% brain cyst reduction as compared to mice that received PBS. The present study suggested that both TgENO2 and TgTrxLp were potential candidates for the development of multicomponent vaccines against toxoplasmosis.

  4. DRUŽBENA OMREŽJA NA INTERNETU

    OpenAIRE

    Ploj, Alen

    2013-01-01

    Družbena omrežja na spletu so zadnje čase zelo popularen način posredne komunikacije in predstavljajo naš vsakdan. Uporaba je enostavna in hitra, učinkovitost pa neverjetna. Zaradi priljubljenosti družbenih omrežij se njihove uporabe poslužujejo tudi različne organizacije, ki z njihovo pomočjo širijo obseg svojega delovanja ter obveščanja uporabnikov o svojih izdelkih/storitvah (marketing). Kot vsako donosno tržišče je tudi internetno tržišče nasičeno z družbenimi omrežji, ki ponujajo najr...

  5. IZVANMATERNIČNA TRUDNOĆA NAKON LAPAROSKOPSKE STERILIZACIJE TUBA– PRIKAZ SLUČAJA

    OpenAIRE

    Strelec, Mihajlo; Dmitrović, Romana; Crvenković, Gordan

    2005-01-01

    Prikazan je slučaj pacijentice koja se nakon devet trudnoća odlučila na laparoskopsku sterilizaciju tuba. Godinu dana nakon izvedene operacije zanijela je izvan maternice. Kod ponovne laparoskopske operacije primijećeno je da je zahvat sterilizacije godinu dana ranije učinjen kirurški korektno, to jest da obostrano nedostaje istmični dio jajovoda u dužini od oko 3 cm. Unatoč tomu, nađena je trudnoća u ampularnom dijelu desnog jajovoda.

  6. Testosterone replacement in transgenic sickle cell mice controls priapic activity and upregulates PDE5 expression and eNOS activity in the penis.

    Science.gov (United States)

    Musicki, B; Karakus, S; Akakpo, W; Silva, F H; Liu, J; Chen, H; Zirkin, B R; Burnett, A L

    2018-01-01

    Sickle cell disease (SCD)-associated priapism is characterized by decreased nitric oxide (NO) signaling and downregulated phosphodiesterase (PDE)5 protein expression and activity in the penis. Priapism is also associated with testosterone deficiency, but molecular mechanisms underlying testosterone effects in the penis in SCD are not known. Given the critical role of androgens in erection physiology and NO synthase (NOS)/PDE5 expression, we hypothesized that testosterone replacement to eugonadal testosterone levels reduces priapism by reversing impaired endothelial (e)NOS activity and molecular abnormalities involving PDE5. Adult male transgenic Berkeley sickle cell (Sickle) and wild-type (WT) mice were implanted with testosterone pellets, which release 1.2 μg testosterone/day for 21 days, or vehicle. After 21 days, animals underwent erectile function assessment followed by collection of blood for serum testosterone measurements, penes for molecular analysis, and seminal vesicles as testosterone-responsive tissue. Serum testosterone levels were measured by radioimmunoassay; protein expressions of PDE5, α-smooth muscle actin, eNOS and nNOS, and phosphorylation of PDE5 at Ser-92, eNOS at Ser-1177, neuronal (n) NOS at Ser-1412, and Akt at Ser-473 were measured by Western blot in penile tissue. Testosterone treatment reversed downregulated serum testosterone levels and increased (p testosterone levels in Sickle mice. Testosterone treatment reduced (p penis. Testosterone treatment did not affect P-nNOS (Ser-1412), eNOS, nNOS, or α-smooth muscle actin protein expressions in the Sickle mouse penis. In conclusion, in the mouse model of human SCD, increasing testosterone to eugonadal levels reduced priapic activity and reversed impaired Akt/eNOS activity and PDE5 protein expression in the penis. © 2017 American Society of Andrology and European Academy of Andrology.

  7. Oxidative Stress-Induced miR-200c Disrupts the Regulatory Loop Among SIRT1, FOXO1, and eNOS.

    Science.gov (United States)

    Carlomosti, Fabrizio; D'Agostino, Marco; Beji, Sara; Torcinaro, Alessio; Rizzi, Roberto; Zaccagnini, Germana; Maimone, Biagina; Di Stefano, Valeria; De Santa, Francesca; Cordisco, Sonia; Antonini, Annalisa; Ciarapica, Roberta; Dellambra, Elena; Martelli, Fabio; Avitabile, Daniele; Capogrossi, Maurizio Colognesi; Magenta, Alessandra

    2017-08-20

    Reactive oxygen species (ROS) play a pivotal role in different pathologic conditions, including ischemia, diabetes, and aging. We previously showed that ROS enhance miR-200c expression, causing endothelial cell (EC) apoptosis and senescence. Herein, we dissect the interaction among miR-200c and three strictly related proteins that modulate EC function and ROS production: sirtuin 1 (SIRT1), endothelial nitric oxide synthase (eNOS), and forkhead box O1 (FOXO1). Moreover, the role of miR-200c on ROS modulation was also investigated. We demonstrated that miR-200c directly targets SIRT1, eNOS, and FOXO1; via this mechanism, miR-200c decreased NO and increased the acetylation of SIRT1 targets, that is, FOXO1 and p53. FOXO1 acetylation inhibited its transcriptional activity on target genes, that is, SIRT1 and the ROS scavengers, catalase and manganese superoxide dismutase. In keeping, miR-200c increased ROS production and induced p66Shc protein phosphorylation in Ser-36; this mechanism upregulated ROS and inhibited FOXO1 transcription, reinforcing this molecular circuitry. These in vitro results were validated in three in vivo models of oxidative stress, that is, human skin fibroblasts from old donors, femoral arteries from old mice, and a murine model of hindlimb ischemia. In all cases, miR-200c was higher versus control and its targets, that is, SIRT1, eNOS, and FOXO1, were downmodulated. In the mouse hindlimb ischemia model, anti-miR-200c treatment rescued these targets and improved limb perfusion. Innovation and Conclusion: miR-200c disrupts SIRT1/FOXO1/eNOS regulatory loop. This event promotes ROS production and decreases NO, contributing to endothelial dysfunction under conditions of increased oxidative stress such as aging and ischemia. Antioxid. Redox Signal. 27, 328-344.

  8. Upregulation of ERK1/2-eNOS via AT2 receptors decreases the contractile response to angiotensin II in resistance mesenteric arteries from obese rats.

    Directory of Open Access Journals (Sweden)

    Graziela N Hagihara

    Full Text Available It has been clearly established that mitogen-activated protein kinases (MAPKS are important mediators of angiotensin II (Ang II signaling via AT1 receptors in the vasculature. However, evidence for a role of these kinases in changes of Ang II-induced vasoconstriction in obesity is still lacking. Here we sought to determine whether vascular MAPKs are differentially activated by Ang II in obese animals. The role of AT2 receptors was also evaluated. Male monosodium glutamate-induced obese (obese and non-obese Wistar rats (control were used. The circulating concentrations of Ang I and Ang II, determined by HPLC, were increased in obese rats. Ang II-induced isometric contraction was decreased in endothelium-intact resistance mesenteric arteries from obese compared with control rats and exhibited a retarded AT1 receptor antagonist response. Blocking of AT2 receptors and inhibition of either endothelial nitric oxide synthase (eNOS or extracellular signal-regulated protein kinases 1 and 2 (ERK1/2 restored Ang II-induced contraction in obese rats. Western blot analysis revealed increased protein expression of AT2 receptors in arteries from obese rats. Basal and Ang II-induced ERK1/2 phosphorylation was also increased in obese rats. Blockade of either AT1 or AT2 receptors corrected the increased ERK1/2 phosphorylation in arteries from obese rats to levels observed in control preparations. Phosphorylation of eNOS was increased in obese rats. Incubation with the ERK1/2 inhibitor before Ang II stimulation did not affect eNOS phosphorylation in control rats; however, it corrected the increased phosphorylation of eNOS in obese rats. These results clearly demonstrate that enhanced AT2 receptor and ERK1/2-induced, NO-mediated vasodilation reduces Ang II-induced contraction in an endothelium-dependent manner in obese rats.

  9. Quercetin modulates iNOS, eNOS and NOSTRIN expressions and attenuates oxidative stress in warm hepatic ischemia-reperfusion injury in rats

    Directory of Open Access Journals (Sweden)

    Mohamed Abd-Elbaset

    2015-09-01

    Full Text Available The pathogenesis of hepatic ischemia/reperfusion (I/R is mediated through the generation of oxidative and nitrosative stress-induced cell injury. Hence, the present study was designed to evaluate the hepatoprotective effect of quercetin (QR compared to N-acetylcysteine (NAC against hepatic I/R injury in rats and to assess iNOS, eNOS and NOSTRIN protein expressions, as a possible mechanism of its hepatoprotective effect. Hepatic ischemia was surgically performed by occlusion of hepatic pedicle (hepatic artery, portal vein, bile duct that supplies the left and medial lobes (approximately 70% of the total liver mass, for 30 min with a vascular clamp followed by releasing the clamp and the liver was reperfused for 30 min. QR-pretreatment increased eNOS protein expression with simultaneous decrease in iNOS and NOSTRIN protein expressions. It also decreased serum aspartate aminotransferase (AST, alanine aminotransferases (ALT and hepatic myeloperoxidase (MPO activities. In addition, it restored the depleted content of reduced glutathione (GSH and decreased malondialdehyde (MDA and nitric oxide (NO levels. A notable finding is that QR alleviated I/R-induced histopathological changes. Therefore, the present study illustrates the hepatoprotective effect of quercetin compared to N-acetylcysteine against ischemia/reperfusion-induced liver injury by inhibiting oxidative stress and by modulating iNOS, eNOS and NOSTRIN protein expressions.

  10. Exercise Training Could Improve Age-Related Changes in Cerebral Blood Flow and Capillary Vascularity through the Upregulation of VEGF and eNOS

    Directory of Open Access Journals (Sweden)

    Sheepsumon Viboolvorakul

    2014-01-01

    Full Text Available This study aimed to investigate the effect of exercise training on age-induced microvascular alterations in the brain. Additionally, the association with the protein levels of vascular endothelial growth factor (VEGF and endothelial nitric oxide synthase (eNOS was also assessed. Male Wistar rats were divided into four groups: sedentary-young (SE-Young, n=5, sedentary aged (SE-Aged, n=8, immersed-aged (IM-Aged, n=5, and exercise trained-aged (ET-Aged, 60 minutes/day and 5 days/week for 8 weeks, n=8 rats. The MAPs of all aged groups, SE-Aged, IM-Aged, and ET-Aged, were significantly higher than that of the SE-Young group. The regional cerebral blood flow (rCBF in the SE-Aged and IM-Aged was significantly decreased as compared to SE-Young groups. However, rCBF of ET-Aged group was significantly higher than that in the IM-Aged group (P<0.05. Moreover, the percentage of capillary vascularity (%CV and the levels of VEGF and eNOS in the ET-Aged group were significantly increased compared to the IM-Aged group (P<0.05. These results imply that exercise training could improve age-induced microvascular changes and hypoperfusion closely associated with the upregulation of VEGF and eNOS.

  11. β3-Adrenoceptor activation relieves oxidative inhibition of the cardiac Na+-K+ pump in hyperglycemia induced by insulin receptor blockade.

    Science.gov (United States)

    Karimi Galougahi, Keyvan; Liu, Chia-Chi; Garcia, Alvaro; Fry, Natasha A; Hamilton, Elisha J; Figtree, Gemma A; Rasmussen, Helge H

    2015-09-01

    Dysregulated nitric oxide (NO)- and superoxide (O2 (·-))-dependent signaling contributes to the pathobiology of diabetes-induced cardiovascular complications. We examined if stimulation of β3-adrenergic receptors (β3-ARs), coupled to endothelial NO synthase (eNOS) activation, relieves oxidative inhibition of eNOS and the Na(+)-K(+) pump induced by hyperglycemia. Hyperglycemia was established in male New Zealand White rabbits by infusion of the insulin receptor antagonist S961 for 7 days. Hyperglycemia increased tissue and blood indexes of oxidative stress. It induced glutathionylation of the Na(+)-K(+) pump β1-subunit in cardiac myocytes, an oxidative modification causing pump inhibition, and reduced the electrogenic pump current in voltage-clamped myocytes. Hyperglycemia also increased glutathionylation of eNOS, which causes its uncoupling, and increased coimmunoprecipitation of cytosolic p47(phox) and membranous p22(phox) NADPH oxidase subunits, consistent with NADPH oxidase activation. Blocking translocation of p47(phox) to p22(phox) with the gp91ds-tat peptide in cardiac myocytes ex vivo abolished the hyperglycemia-induced increase in glutathionylation of the Na(+)-K(+) pump β1-subunit and decrease in pump current. In vivo treatment with the β3-AR agonist CL316243 for 3 days eliminated the increase in indexes of oxidative stress, decreased coimmunoprecipitation of p22(phox) with p47(phox), abolished the hyperglycemia-induced increase in glutathionylation of eNOS and the Na(+)-K(+) pump β1-subunit, and abolished the decrease in pump current. CL316243 also increased coimmunoprecipitation of glutaredoxin-1 with the Na(+)-K(+) pump β1-subunit, which may reflect facilitation of deglutathionylation. In vivo β3-AR activation relieves oxidative inhibition of key cardiac myocyte proteins in hyperglycemia and may be effective in targeting the deleterious cardiac effects of diabetes. Copyright © 2015 the American Physiological Society.

  12. The synthetic peptide PnPP-19 induces peripheral antinociception via activation of NO/cGMP/KATPpathway: Role of eNOS and nNOS.

    Science.gov (United States)

    Freitas, A C N; Silva, G C; Pacheco, D F; Pimenta, A M C; Lemos, V S; Duarte, I D G; de Lima, M E

    2017-04-01

    and purpose: The peptide PnPP-19, derived from the spider toxin PnTx2-6 (renamed as δ-CNTX-Pn1c), potentiates erectile function by activating the nitrergic system. Since NO has been studied as an antinociceptive molecule and PnPP-19 is known to induce peripheral antinociception, we intended to evaluate whether PnPP-19 could induce peripheral antinociception through activation of this pathway. Nociceptive thresholds were measured by paw pressure test. PGE 2 (2 μg/paw) was administered intraplantarly together with PnPP-19 and inhibitors/blockers of NOS, guanylyl cyclase and K ATP channels. The nitrite concentration was accessed by Griess test. The expression and phosphorylation of eNOS and nNOS were determined by western blot. PnPP-19 (5, 10 and 20 μg/paw) induced peripheral antinociception in rats. Administration of NOS inhibitor (L-NOarg), selective nNOS inhibitor (L-NPA), guanylyl cyclase inhibitor (ODQ) and the blocker of K ATP (glibenclamide) partially inhibited the antinociceptive effect of PnPP-19 (10 μg/paw). Tissue nitrite concentration increased after PnPP-19 (10 μg/paw) administration. Expression of eNOS and nNOS remained the same in all tested groups, however the phosphorylation of nNOS Ser852 (inactivation site) increased and phosphorylation of eNOS Ser1177 (activation site) decreased after PGE 2 injection. Administration of PnPP-19 reverted this PGE 2 -induced effect. The peripheral antinociceptive effect induced by PnPP-19 is resulting from activation of NO-cGMP-K ATP pathway. Activation of eNOS and nNOS might be required for such effect. Our results suggest PnPP-19 as a new drug candidate to treat pain and reinforce the importance of nNOS and eNOS activation, as well as endogenous NO release, for induction of peripheral antinociception. Copyright © 2017 Elsevier Inc. All rights reserved.

  13. MiR-21 is induced in endothelial cells by shear stress and modulates apoptosis and eNOS activity

    Energy Technology Data Exchange (ETDEWEB)

    Weber, Martina; Baker, Meredith B.; Moore, Jeffrey P. [Division of Cardiology, Emory University, 1639 Pierce Drive, WMB 319, Atlanta, GA 30322 (United States); Searles, Charles D., E-mail: csearle@emory.edu [Division of Cardiology, Emory University, 1639 Pierce Drive, WMB 319, Atlanta, GA 30322 (United States); Atlanta Veterans Administration Medical Center, 1670 Clarimont Road, Decatur, GA 30033 (United States)

    2010-03-19

    Mechanical forces associated with blood flow play an important role in regulating vascular signaling and gene expression in endothelial cells (ECs). MicroRNAs (miRNAs) are a class of noncoding RNAs that posttranscriptionally regulate the expression of genes involved in diverse cell functions, including differentiation, growth, proliferation, and apoptosis. miRNAs are known to have an important role in modulating EC biology, but their expression and functions in cells subjected to shear stress conditions are unknown. We sought to determine the miRNA expression profile in human ECs subjected to unidirectional shear stress and define the role of miR-21 in shear stress-induced changes in EC function. TLDA array and qRT-PCR analysis performed on HUVECs exposed to prolonged unidirectional shear stress (USS, 24 h, 15 dynes/cm{sup 2}) identified 13 miRNAs whose expression was significantly upregulated (p < 0.05). The miRNA with the greatest change was miR-21; it was increased 5.2-fold (p = 0.002) in USS-treated versus control cells. Western analysis demonstrated that PTEN, a known target of miR-21, was downregulated in HUVECs exposed to USS or transfected with pre-miR-21. Importantly, HUVECs overexpressing miR-21 had decreased apoptosis and increased eNOS phosphorylation and nitric oxide (NO{sup {center_dot}}) production. These data demonstrate that shear stress forces regulate the expression of miRNAs in ECs, and that miR-21 influences endothelial biology by decreasing apoptosis and activating the NO{sup {center_dot}} pathway. These studies advance our understanding of the mechanisms by which shear stress forces modulate vascular homeostasis.

  14. Ibuprofen arginate retains eNOS substrate activity and reverses endothelial dysfunction: implications for the COX-2/ADMA axis.

    Science.gov (United States)

    Kirkby, Nicholas S; Tesfai, Abel; Ahmetaj-Shala, Blerina; Gashaw, Hime H; Sampaio, Walkyria; Etelvino, Gisele; Leão, Nádia Miricéia; Santos, Robson A; Mitchell, Jane A

    2016-12-01

    Nonsteroidal antiinflammatory drugs, including ibuprofen, are among the most commonly used medications and produce their antiinflammatory effects by blocking cyclooxygenase (COX)-2. Their use is associated with increased risk of heart attacks caused by blocking COX-2 in the vasculature and/or kidney, with our recent work implicating the endogenous NOS inhibitor asymmetric dimethylarginine (ADMA), a cardiotoxic hormone whose effects can be prevented by l-arginine. The ibuprofen salt ibuprofen arginate (Spididol) was created to increase solubility but we suggest that it could also augment the NO pathway through codelivery of arginine. Here we investigated the idea that ibuprofen arginate can act to simultaneously inhibit COX-2 and preserve the NO pathway. Ibuprofen arginate functioned similarly to ibuprofen sodium for inhibition of mouse/human COX-2, but only ibuprofen arginate served as a substrate for NOS. Ibuprofen arginate but not ibuprofen sodium also reversed the inhibitory effects of ADMA and N G -nitro-l-arginine methyl ester on inducible NOS (macrophages) and endothelial NOS in vitro (aorta) and in vivo (blood pressure). These observations show that ibuprofen arginate provides, in one preparation, a COX-2 inhibitor and NOS substrate that could act to negate the harmful cardiovascular consequences mediated by blocking renal COX-2 and increased ADMA. While remarkably simple, our findings are potentially game-changing in the nonsteroidal antiinflammatory drug arena.-Kirkby, N. S., Tesfai, A., Ahmetaj-Shala, B., Gashaw, H. H., Sampaio, W., Etelvino, G., Leão, N. M., Santos, R. A., Mitchell, J. A. Ibuprofen arginate retains eNOS substrate activity and reverses endothelial dysfunction: implications for the COX-2/ADMA axis. © The Author(s).

  15. Impacto del fenómeno ENOS en el régimen hidrometeorológico de Mendoza, Argentina

    Directory of Open Access Journals (Sweden)

    1998-01-01

    Full Text Available IMPACT DU PHÉNOMÈNE ENSO SUR LE RÉGIME HYDROMÉTÉOROLOGIQUE DE MENDONZA, ARGENTINE. Le principal objectif de ce travail est d’analyser les effets hydrométéorologiques causés par ENSO dans la province de Mendoza, Argentine. Ensuite on étudiera les conditions météorologiques prédominantes (situations synoptiques les plus fréquentes et les phénomènes de méso-échelle associés pendant l’hiver, en plaine et dans la cordillère. On caractérise la zone étudiée hydrologiquement et climatologiquement. On utilise pour cela les données de débits mensuels des principales rivières de la région ainsi que les données climatiques, synoptiques et des images de satellite. Notre étude couvre les événements ENSO de ce siècle et plus particulièrement ceux de 1982-1983, 1986-1987, 1991-1993 et les premières manifestations de celui de 1997-1998. Les principaux résultats montrent, pour les années ENSO, une forte augmentation des débits des rivières à la fin du printemps et pendant l’été provoqué par l’excès de précipitation de l’hiver antérieur. Les plus forts débits ont été observés au cours de l'événement chaud de 1982-1983, considéré jusqu'à 1997 comme le plus fort de ce siècle. L’impact principal sur le régime hydrique est dû à l’anomalie positive de précipitations dans la partie de la cordillère qui a un régime hivernal. On en conclut que les plus fortes précipitations de la cordillère sont reliées à une augmentation de la fréquence des passages de zones de basse pression et d’incursions d’onde longue à des latitudes plus basses que la normale. Ceci provoque une anomalie négative dans le champ de pression de surface et des couches moyennes de l’atmosphère. El objetivo principal del trabajo es analizar los efectos hidrometeorológicos que ocasiona el evento cálido ENOS en la provincia de Mendoza, Argentina. Los objetivos secundarios son considerar las condiciones meteorol

  16. Posodobitev pomožnega vretena in konjička na brusilnem stroju Danobat RP-500

    OpenAIRE

    Jurič, Denis

    2015-01-01

    Cilj podjetja s serijsko proizvodnjo je zagotoviti nemoteno in stabilno delovanje obdelovalnih strojev, kar je ključnega pomena za doseganje dobrih proizvodnih rezultatov. To pa lahko dosežemo na takšen način, da v delovni vsakdan vključimo razmišljanje o nenehnih izboljšavah. Podjetje se mora zaradi konkurenčnosti prilagajati ter nenehno izboljševati. Eno izmed takšnih podjetij je tudi GKN Driveline Zreče. Zato se je s strani mehanskega vzdrževanja porodila ideja o posodobitvi brusilnega str...

  17. Influence of eNOS gene 4a/bVNTR polymorphism on development of endothelial dysfunction and respiratory system disorders in children - residents of radioactively contaminated areas

    International Nuclear Information System (INIS)

    Stepanova, Je.Yi.; Kolpakov, Yi.Je.; Zigalo, V.M.; And Others

    2015-01-01

    Total of 184 children were examined to determine the possible associative links between eNOS gene intron 4m polymorphism and indices characterizing the functional state of the endothelium and the bronchopulmonary system. Of them the main group of children consisted of 135 childrenresidents of radioactively contaminated areas, the control group - of 49 healthy children who lived in ''clean'' regions by the radioactive con tamination and were not belonging to victims of the Chernobyl accident contingents. The molecular genetic study determining the eNOS gene intron 4 polymorphism was performed. Children of the main group did not differ from that of control and literature data by the frequency of geno types 4a/b and eNOS gene allele polymorphism. An increase in the duration of circulation restoration up to the ini tial level after occlusion test was noted in children of the main group with genotype 4a/4b comparing to children with genotype 4b/4b ; a decrease in the nitrite content was observed in blood serum. The integral indices of elastic ity and tensility of the lung tissue, respiratory permeability were decreased; the signs of bronchospasm were record ed 1.5 times more often. These adverse effects were associated with the presence of genotype allele 4a , the signs of endothelial dysfunction and the level of the incorporated 137 Cs. More pronounced changes in vascular endothelial reaction to occlusion and the significant decrease of serum nitrite level in allele 4a carriers, especially in children who live in adverse ecological conditions, give the right to include them into the risk group for the development of endothelial dysfunction, and to conside pulmonary dysfunction as one of its manifestations

  18. Enhanced estradiol-induced vasorelaxation in aortas from type 2 diabetic mice may reflect a compensatory role of p38 MAPK-mediated eNOS activation.

    Science.gov (United States)

    Taguchi, Kumiko; Morishige, Akitaka; Matsumoto, Takayuki; Kamata, Katsuo; Kobayashi, Tsuneo

    2012-08-01

    Cardiovascular problems are a major cause of morbidity and mortality, mainly due to coronary artery disease and atherosclerosis, in type 2 diabetes mellitus. However, female gender is a protective factor in the development of, for example, atherosclerosis and hypertension. One of the female hormones, 17β-estradiol (E2), is known to protect against the cardiovascular injury resulting from endothelial dysfunction, but the mechanism by which it does so remains unknown. Our hypothesis was that E2-mediated activation of Akt and mitogen-activated protein kinase (MAPK), and the subsequent endothelial NO synthase (eNOS) phosphorylation, might protect the aorta in diabetic mellitus. The experimental type 2 diabetic model we employed to test that hypothesis (female mice given streptozotocin and nicotinamide) is here termed fDM. In fDM aortas, we examined the E2-induced relaxation response and the associated protein activities. In control (age-matched, nondiabetic) aortas, E2 induced a vascular relaxation response that was mediated via Akt/eNOS and mitogen-activated/ERK-activating kinase (MEK)/eNOS pathways. In fDM aortas (vs. control aortas), (a) the E2-induced relaxation was enhanced, (b) the mediation of the response was different (via Akt/eNOS and p38 MAPK/eNOS pathways), and (c) E2 stimulation increased p38 MAPK and eNOS phosphorylations, decreased MEK phosphorylation, but did not alter estrogen receptor activity. We infer that at least in fDM aortas, E2 has beneficial effects (enhanced vascular relaxation and protection) that are mediated through Akt activation and (compensating for reduced MEK activation) p38 MAPK activation, leading to enhanced eNOS phosphorylation.

  19. Human umbilical cord expresses several vasoactive peptides involved in the local regulation of vascular tone: protein and gene expression of Orphanin, Oxytocin, ANP, eNOS and iNOS

    Directory of Open Access Journals (Sweden)

    Aldo Gerbino

    2011-07-01

    Full Text Available Full-term human umbilical cord contains three blood vessels: two arteries coiled around a vein and surrounded by Wharton’s jelly, a mucous tissue with few mesenchymal stromal cells and abundant extracellular matrix. Umbilical vessels lack innervations, thus endothelial cells must play a role in the control of blood flow. The aim of this study was to investigate in human umbilical cord the expression of five peptides that could be involved in the regulation of vascular tone: Orphanin FQ, Oxytocin, Atrial Natriuretic Peptide (ANP, endothelial Nitric Oxide Synthase (eNOS and inducible Nitric Oxide Synthase (iNOS. The expression of these molecules in full-term human umbilical cord was investigated through immunohistochemistry and RT-PCR. Immunoreactivity for Orphanin FQ was detected in Wharton’s jelly, vessel musculature and endothelium; Oxytocin, ANP and eNOS were expressed by the umbilical epithelium, Wharton’s jelly and endothelium, whereas iNOS only by endothelial cells. RT-PCR analysis showed transcriptional expression of Oxytocin, ANP and eNOS mRNAs. The presence of Orphanin, Oxytocin, ANP, eNOS and iNOS proteins was identified in the human umbilical cord. mRNA expression for Oxytocin, ANP and eNOS suggest that these molecules are synthesized by umbilical cord cells themselves. The expression of these vasoactive molecules could be part of a general mechanism locally regulating vascular tone. (Folia Histochemica et Cytobiologica 2011; Vol. 49, No. 2, pp. 211–218

  20. Association of G894T eNOS, 4G/5G PAI and T1131C APOA5 polymorphisms with susceptibility to myocardial infarction in Morocco.

    Science.gov (United States)

    Hassani Idrissi, Hind; Hmimech, Wiam; Diakite, Brehima; Korchi, Farah; Baghdadi, Dalila; Habbal, Rachida; Nadifi, Sellama

    2016-09-01

    Myocardial infarction (MI) is a common multifactorial disease. Numerous studies have found that genetic plays an essential role in MI occurrence. The main objective of our case-control study is to explore the association of G894T eNOS (rs1799983), 4G/5G PAI (rs1799889) and T1131C APOA5 (rs662799) polymorphisms with MI susceptibility in the Moroccan population. 118 MI patients were recruited vs 184 healthy controls. DNA samples were genotyped by PCR-RFLP method using MboI, BslI and MseI restriction enzymes respectively for the G894T eNOS, 4G/5G PAI and T1131C APOA5 polymorphisms. Our results show that the G894T eNOS was significantly associated with increased risk of MI under the three genetic transmission models (dominant: OR = 1.64, 95% CI = 1.05-2.58, P = 0.003; recessive: OR = 2.15, 95% CI = 0.74-6.16, P = 0.03; additive: OR = 1.54, 95% CI = 1.06-2.23, P = 0.001). The T1131C APOA5 polymorphism was associated to MI risk in recessive and additive models (OR = 1.53, 95% CI = 0.72-3.2, P = 0.04 and OR = 1.78, 95% CI = 1.26-2.51, P = 0.03 respectively). For the 4G/5G PAI variant, even the cases and controls groups were not in Hardy-Weinberg Equilibrium (HWE), the dominant and additive models show a statistically significant association with MI risk (OR = 7.96, 95%CI = 3.83-16.36, P = 0.01 and OR = 1.96, 95% CI = 1.4-2.72, P = 0.03 respectively). Our results suggest that G894T eNOS and T1131C APOA5 polymorphisms may be considered as genetic markers of MI among the Moroccan population. Further studies including larger sample sizes and exploring more genetic associations are needed to confirm our results and to better understand the susceptibility to MI.

  1. Estrogen and phytoestrogens: Effect on eNOS expression and in vitro vasodilation in cerebral arteries in ovariectomized Watanabe heritable hyperlipidemic rabbits

    DEFF Research Database (Denmark)

    Lund, Claus O.; Mortensen, Alicja; Nilas, Lisbeth

    2007-01-01

    Objectives: To evaluate the effect of estrogen replacement therapy or soy isoflavones supplement on endothelium-dependent relaxation in vitro and gene expression of endothelial nitric oxide synthase (eNOS) in cerebral arteries in a rabbit model of human hypercholesterolemia. Study design: Thirty...... cholesterol was significantly higher at termination in the SoyLife(R) group (P lipoprotein (LDL) cholesterol was comparable in all treatment groups. Neither treatment influenced the endothelium-dependent responses to carbamylcholine chloride or L-NAME or the endothelium...

  2. Passive leg movement enhances interstitial VEGF protein, endothelial cell proliferation, and eNOS mRNA content in human skeletal muscle

    DEFF Research Database (Denmark)

    Hellsten, Ylva; Rufener, Nora; Nielsen, Jens J

    2008-01-01

    were analyzed for mRNA content of VEGF, endothelial nitric oxide synthase (eNOS), and matrix metalloproteinase-2 (MMP-2). The passive leg movement caused an increase (P ... to cultured endothelial cells revealed that dialysate obtained during leg movement induced a 3.2-fold higher proliferation rate (P MMP-2 mRNA levels were......The present study used passive limb movement as an experimental model to study the effect of increased blood flow and passive stretch, without enhanced metabolic demand, in young healthy male subjects. The model used was 90 min of passive movement of the leg leading to a 2.8-fold increase (P

  3. Utjecaj iontoforeze na funkcijski kapacitet ručnog zgloba u bolesnika s reumatoidnim artritisom

    OpenAIRE

    VLAK, Tonko; BEDALOV, Marica; JAJIĆ, Ivo

    1994-01-01

    Najčešće upalno promijenjeni zglob u bolesnika s reumatoidnim artritisom je ručni zglob, aficiran prema nekim autorima u više od 80% bolesnika. Ocjenjujući učinak iontoforeze Voltaren gela (diklofenak) na povećanje funkcijskog kapaciteta i smanjenje bolnosti ručnog zgloba u 30 bolesnika s reumatoidnim artritisom, uočeno je da lijek unešen u zglob kroz intaktnu kožu preko katode, nakon l S terapijskih obrada, značajno povećava dorzalnu tleksiju i adukciju u ručnom zglobu bolesni...

  4. Relationship of the MTHFD1 (rs2236225, eNOS (rs1799983, CBS (rs2850144 and ACE (rs4343 gene polymorphisms in a population of Iranian pediatric patients with congenital heart defects

    Directory of Open Access Journals (Sweden)

    Mehri Khatami

    2017-09-01

    Full Text Available Congenital heart defects are structural cardiovascular malformations that arise from abnormal formation of the heart or major blood vessels during the fetal period. To investigate the association of 4 single nucleotide polymorphisms (SNPs in the MTHFD1, eNOS, CBS and ACE genes, we evaluated their relationship with CHD in Iranian patients. In this case–control study, a total of 102 children with CHD and 98 control children were enrolled. Four SNPs including MTHFD1 G1958A, eNOS G894T, CBS C-4673G and ACE A2350G were genotyped by PCR-SSCP, Multiplex ARMS PCR and PCR-RFLP methods and confirmed by direct sequencing. We genotyped 102 patients and 98 controls for four polymorphisms by statistically analysis. There were three SNPs including MTHFD1 G1958A, eNOS G894T and ACE A2350G which might increase the risk of CHD, but CBS C-4673G was not significantly different between patients and controls. (P = 0.017, P = 0.048, P = 0.025 and P = 0.081 respectively. The allele frequencies of three SNPs for MTHFD1 G1958A, eNOS G894T and ACE A2350G in CHD are higher than that in control. Our results show that there is a significant relationship between MTHFD1 G1958A, eNOS G894T and ACE A2350G polymorphisms with CHD. Therefore, The AA and GA genotypes of MTHFD1 G1958A, TT and GT genotypes of eNOS G894T and the AA and GA genotypes of ACE A2350G are susceptible factors for CHD and may increase the risk of CHD.

  5. eNOS S-nitrosylates β-actin on Cys374 and regulates PKC-θ at the immune synapse by impairing actin binding to profilin-1.

    Directory of Open Access Journals (Sweden)

    Almudena García-Ortiz

    2017-04-01

    Full Text Available The actin cytoskeleton coordinates the organization of signaling microclusters at the immune synapse (IS; however, the mechanisms involved remain poorly understood. We show here that nitric oxide (NO generated by endothelial nitric oxide synthase (eNOS controls the coalescence of protein kinase C-θ (PKC-θ at the central supramolecular activation cluster (c-SMAC of the IS. eNOS translocated with the Golgi to the IS and partially colocalized with F-actin around the c-SMAC. This resulted in reduced actin polymerization and centripetal retrograde flow of β-actin and PKC-θ from the lamellipodium-like distal (d-SMAC, promoting PKC-θ activation. Furthermore, eNOS-derived NO S-nitrosylated β-actin on Cys374 and impaired actin binding to profilin-1 (PFN1, as confirmed with the transnitrosylating agent S-nitroso-L-cysteine (Cys-NO. The importance of NO and the formation of PFN1-actin complexes on the regulation of PKC-θ was corroborated by overexpression of PFN1- and actin-binding defective mutants of β-actin (C374S and PFN1 (H119E, respectively, which reduced the coalescence of PKC-θ at the c-SMAC. These findings unveil a novel NO-dependent mechanism by which the actin cytoskeleton controls the organization and activation of signaling microclusters at the IS.

  6. The coagulation factor V Leiden, MTHFRC677T variant and eNOS 4ab polymorphism in young Chinese population with ischemic stroke.

    Science.gov (United States)

    Shi, Congning; Kang, Xixiong; Wang, Yajie; Zhou, Yali

    2008-10-01

    The mechanisms of ischemic stroke in young adults are poorly understood. The main goal of the current investigation was to determine the possible contribution of genes affecting hemostasis, homocysteine metabolism and endothelial function on the occurrence of ischemic stroke in a cohort of young cases and corresponding controls. We evaluated in 97 consecutive patients referred to our center between April 2006 and July 2007 for a history of young adult ischemic stroke (age at first event, V Leiden, 5,10-methylenetetrahydrofolate reductase (MTHFR) C677T and endothelial nitric oxide synthase (eNOS) 4ab gene variants. Ninety-nine subjects age and gender matched (18 to 45 y) from other departments of the Tiantan Hospital served as controls. Homozygosity for the TT genotype of the MTHFR gene was 29 of 97 (29.9%) in patients and 34 of 99 (34.3%) in controls; this difference was not statistically significant (p>0.05, chi2). Variation of factor V Leiden was not detected both in patients and in controls of this cohort. Genotype eNOS 4bb was 90 of 97 (92.8%) in patients and 81 of 99 (81.8%) in controls; this difference was statistically significant (pyoung Chinese population.

  7. Differential effect of beetroot bread on postprandial DBP according to Glu298Asp polymorphism in the eNOS gene: a pilot study.

    Science.gov (United States)

    Hobbs, D A; George, T W; Lovegrove, J A

    2014-12-01

    Our objective was to investigate whether the presence of Glu298Asp polymorphism in the endothelial NO synthase (eNOS) gene differentially affects the postprandial blood pressure response to dietary nitrate-rich beetroot bread. A randomised, single-blind, controlled, crossover acute pilot study was performed in 14 healthy men (mean age: 34±9 years) who were retrospectively genotyped for Glu298Asp polymorphism (7GG; T carriers 7). Volunteers were randomised to receive 200 g beetroot-enriched bread (1.1 mmol nitrate) or control bread (no beetroot; 0.01 mmol nitrate) on two separate occasions 10 days apart. Baseline and incremental area under the curve of blood pressure and NOx (nitrate/nitrite) were measured for a 6-h postprandial period. A treatment × genotype interaction was observed for diastolic blood pressure (Pconsumption of beetroot bread compared with control bread. No significant differences were observed in the GG group. The beneficial diastolic blood pressure reduction was observed only in the T carriers of the Glu298Asp polymorphism in the eNOS gene after consumption of nitrate-rich beetroot bread. These data require confirmation in a larger population group.

  8. eNOS Glu298Asp polymorphism is associated with development of complicated plaques in patients from Serbia with advanced carotid atherosclerosis

    Directory of Open Access Journals (Sweden)

    Đurić Tamara

    2013-01-01

    Full Text Available Nitric oxide inhibits adhesion of thrombocytes, proliferation and migration of smooth muscle cells and restricts oxidation of atherogenic low-density lipoproteins. Therefore, decreased production or activity of NO may play a role in the initiation, progression or complications of atherosclerosis. The aim of this study was to estimate the effect of Glu298Asp eNOS gene polymorphism on the individual risk for development of complicated carotid atherosclerotic plaque in patients from Serbia with advanced carotid atherosclerosis (CA who had undergone endarterectomy. The study population included 233 patients. eNOS G894T gene polymorphism was identified by PCR and RFLP methods. Multivariate logistic regression analysis showed that Asp298Asp is an independent risk factor for the presence of complicated plaques in CA patients. Patients who were homozygous for the Asp298 allele had an adjusted OR of 4.36 for the development of complicated plaques compared to those that carry the Glu298 allele. Further validation and replication studies are needed. [Projekat Ministarstva nauke Republike Srbije, br. OI175085

  9. Association analysis of genetic variations of eNOS and α2ß1 integrin genes with type 2 diabetic retinopathy

    Directory of Open Access Journals (Sweden)

    Azmy R

    2012-07-01

    Full Text Available Rania Azmy,1 Ashraf Dawood,1 Ayman Kilany,1 Yasser El-Ghobashy,1 Amin Faisal Ellakwa,2 May El-Daly31Medical Biochemistry Department, 2Ophthalmology Department, Faculty of Medicine, 3National Liver Institute, Menoufiya University, Shebin Elkom, EgyptBackground: Diabetic retinopathy (DR is classically defined as a microvasculopathy that primarily affects the small blood vessels of the inner retina as a complication of diabetes mellitus. It has been suggested that nitric oxide (NO and α2β1 integrin (a platelet receptor for collagen play an important role in the pathogenesis of microvascular complications in DR.Aim: The aim of this study was to investigate the association of two candidate genes involved in the regulation of retinal vasculature, endothelial nitric oxide synthase (eNOS and α2β1 integrin (ITGA2 genes, with the development of DR in Egyptian patients with type 2 diabetes mellitus and to investigate whether genetic variants will affect the type of retinopathy (proliferative or nonproliferative.Methods: In this study, 70 patients were enrolled and categorized into two groups: (1 a DR group consisting of 50 patients with DR, which was further subclassified into 25 patients with nonproliferative DR (NPDR group and 25 patients with proliferative DR (PDR group and (2 a diabetes without retinopathy (DWR group, comprising 20 patients with type 2 diabetes of more than 10 years' duration who showed no signs of DR. Associations of the genetic polymorphisms of eNOS (G894T and ITGA2 (BgI II were studied. Polymerase chain reaction-restriction fragment length polymorphism analysis was performed for all samples to evaluate the genotypes and correlate with the phenotype of the disease.Results: The allele frequencies of both polymorphisms showed considerable differences between patients with and without DR. The GG genotype of G894T polymorphism of eNOS was associated with a 9.75-fold increased risk of DR (95% confidence interval 1.7–55.4 and the

  10. Redox-sensitive up-regulation of eNOS by purple grape juice in endothelial cells: role of PI3-kinase/Akt, p38 MAPK, JNK, FoxO1 and FoxO3a.

    Directory of Open Access Journals (Sweden)

    Mahmoud Alhosin

    Full Text Available The vascular protective effect of grape-derived polyphenols has been attributable, in part, to their direct action on blood vessels by stimulating the endothelial formation of nitric oxide (NO. The aim of the present study was to determine whether Concord grape juice (CGJ, which contains high levels of polyphenols, stimulates the expression of endothelial NO synthase (eNOS in porcine coronary artery endothelial cells and, if so, to determine the signaling pathway involved. CGJ dose- and time-dependently increased eNOS mRNA and protein levels and this effect is associated with an increased formation of NO in endothelial cells. The stimulatory effect of CGJ on eNOS mRNA is not associated with an increased eNOS mRNA stability and inhibited by antioxidants such as MnTMPyP, PEG-catalase, and catalase, and by wortmannin (an inhibitor of PI3-kinase, SB 203580 (an inhibitor of p38 MAPK, and SP 600125 (an inhibitor of JNK. Moreover, CGJ induced the formation of reactive oxygen species (ROS in endothelial cells and this effect is inhibited by MnTMPyP, PEG-catalase, and catalase. The CGJ-induced the phosphorylation of p38 MAPK and JNK kinases is abolished by MnTMPyP. CGJ induced phosphorylation of transcription factors FoxO1 and FoxO3a, which regulate negatively eNOS expression, and this effect is prevented by MnTMPyP, PEG-catalase, wortmannin, SB203580 and SP600125. Moreover, chromatin immunoprecipitation assay indicated that the FoxO3a protein is associated with the eNOS promoter in control cells and that CGJ induced its dissociation. Thus, the present study indicates that CGJ up-regulates the expression of eNOS mRNA and protein leading to an increased formation of NO in endothelial cells. The stimulatory effect of CGJ is a redox-sensitive event involving PI3-kinase/Akt, p38 MAPK and JNK pathways, and the inactivation of the FoxO transcription factors, FoxO1 and FoxO3a, thereby preventing their repression of the eNOS gene.

  11. Převodník Ethernet na RS-232

    OpenAIRE

    Dreiseitel, Jiří

    2012-01-01

    Práce je věnována problematice konstrukce převodníku Ethernet na RS-232 za pomocí jednočipového mikrokontroléru. Cílem je seznámit čtenáře se síťovou technologií Ethernet a technologií pro sériový přenos založený na protokolu RS-232 a zároveň s technologií vestavěných systémů pro konstrukci zařízení. Součástí práce je kompletní návrh převodníku Ethernet na RS-232 včetně návrhu a implementace firmware v jazyce C za využití LwIP TCP/IP stacku. Převodník je postaven na základě vývojového kitu ST...

  12. „Dolje madjarski hrvatski sabor, dolje madjaroni“ Narodni pokret 1903./1904. godine na području grada Bjelovara i Bjelovarsko-križevačke županije

    OpenAIRE

    Karaula, Željko

    2014-01-01

    Autor kronološkim redom obrađuje Narodni pokret 1903.-1904. na području grada Bjelovara i bjelovarsko- križevačkog područja, razdoblje obilježeno nemirima, političkim demonstracijama, uličnim sukobima, neredima te održavanjem protestnih narodnih skupština po cijeloj Hrvatskoj.

  13. Oral administration of bisphenol A induces high blood pressure through angiotensin II/CaMKII-dependent uncoupling of eNOS.

    Science.gov (United States)

    Saura, Marta; Marquez, Susana; Reventun, Paula; Olea-Herrero, Nuria; Arenas, María Isabel; Moreno-Gómez-Toledano, Rafael; Gómez-Parrizas, Mónica; Muñóz-Moreno, Carmen; González-Santander, Marta; Zaragoza, Carlos; Bosch, Ricardo J

    2014-11-01

    Bisphenol A (BPA) is found in human urine and fat tissue. Higher urinary BPA concentrations are associated with arterial hypertension. To shed light on the underlying mechanism, we orally administered BPA (4 nM to 400 μM in drinking water) to 8-wk-old CD11 mice over 30 d. Mice developed dosage-dependent high blood pressure (systolic 130 ± 12 vs. 170 ± 12 mmHg; EC50 0.4 μM), impairment of acetylcholine (AcH)-induced carotid relaxation (0.66 ± 0.08 vs. 0.44 ± 0.1 mm), a 1.7-fold increase in arterial angiotensin II (AngII), an 8.7-fold increase in eNOS mRNA and protein, and significant eNOS-dependent superoxide and peroxynitrite accumulation. AngII inhibition with 0.5 mg/ml losartan reduced oxidative stress and normalized blood pressure and endothelium-dependent relaxation, which suggests that AngII uncouples eNOS and contributes to the BPA-induced endothelial dysfunction by promoting oxidative and nitrosative stress. Microarray analysis of mouse aortic endothelial cells revealed a 2.5-fold increase in expression of calcium/calmodulin-dependent protein kinase II-α (CaMKII-α) in response to 10 nM BPA, with increased expression of phosphorylated-CaMKII-α in carotid rings of BPA-exposed mice, whereas CaMKII-α inhibition with 100 nM autocamptide-2-related inhibitor peptide (AIP) reduced BPA-mediated increase of superoxide. Administration of CaMKII-α inhibitor KN 93 reduced BPA-induced blood pressure and carotid blood velocity in mice, and reverted BPA-mediated carotid constriction in response to treatment with AcH. Given that CaMKII-α inhibition prevents BPA-mediated high blood pressure, our data suggest that BPA regulates blood pressure by inducing AngII/CaMKII-α uncoupling of eNOS. © FASEB.

  14. L-Arginine ameliorates cardiac left ventricular oxidative stress by upregulating eNOS and Nrf2 target genes in alloxan-induced hyperglycemic rats

    International Nuclear Information System (INIS)

    Ramprasath, Tharmarajan; Hamenth Kumar, Palani; Syed Mohamed Puhari, Shanavas; Senthil Murugan, Ponniah; Vasudevan, Varadaraj; Selvam, Govindan Sadasivam

    2012-01-01

    Highlights: ► L-Arginine treatment reduced the metabolic disturbances in diabetic animals. ► Antioxidant marker proteins were found high in myocardium by L-arginine treatment. ► Elevated antioxidant status, mediates the reduced TBA-reactivity in left ventricle. ► L-Arginine treatment enhanced the Nrf2 and eNOS signaling in left ventricle. ► Improved cell survival signaling by arginine, offers a novel tactic for targeting. -- Abstract: Hyperglycemia is independently related with excessive morbidity and mortality in cardiovascular disorders. L-Arginine-nitric oxide (NO) pathway and the involvement of NO in modulating nuclear factor-E2-related factor-2 (Nrf2) signaling were well established. In the present study we investigated, whether L-arginine supplementation would improve the myocardial antioxidant defense under hyperglycemia through activation of Nrf2 signaling. Diabetes was induced by alloxan monohydrate (90 mg kg −1 body weight) in rats. Both non-diabetic and diabetic group of rats were divided into three subgroups and they were administered either with L-arginine (2.25%) or L-NAME (0.01%) in drinking water for 12 days. Results showed that L-arginine treatment reduced the metabolic disturbances in diabetic rats. Antioxidant enzymes and glutathione levels were found to be increased in heart left ventricles, thereby reduction of lipid peroxidation by L-arginine treatment. Heart histopathological analysis further validates the reversal of typical diabetic characteristics consisting of alterations in myofibers and myofibrillary degeneration. qRT-PCR studies revealed that L-arginine treatment upregulated the transcription of Akt and downregulated NF-κB. Notably, transcription of eNOS and Nrf2 target genes was also upregulated, which were accompanied by enhanced expression of Nrf2 in left ventricular tissue from diabetic and control rats. Under these findings, we suggest that targeting of eNOS and Nrf2 signaling by L-arginine supplementation could be

  15. L-Arginine ameliorates cardiac left ventricular oxidative stress by upregulating eNOS and Nrf2 target genes in alloxan-induced hyperglycemic rats

    Energy Technology Data Exchange (ETDEWEB)

    Ramprasath, Tharmarajan; Hamenth Kumar, Palani; Syed Mohamed Puhari, Shanavas; Senthil Murugan, Ponniah; Vasudevan, Varadaraj [Molecular Cardiology Unit, Department of Biochemistry, Center for Excellence in Genomic Sciences, School of Biological Sciences, Madurai Kamaraj University, Madurai 625 021, Tamilnadu (India); Selvam, Govindan Sadasivam, E-mail: drselvamgsbiochem@rediffmail.com [Molecular Cardiology Unit, Department of Biochemistry, Center for Excellence in Genomic Sciences, School of Biological Sciences, Madurai Kamaraj University, Madurai 625 021, Tamilnadu (India)

    2012-11-23

    Highlights: Black-Right-Pointing-Pointer L-Arginine treatment reduced the metabolic disturbances in diabetic animals. Black-Right-Pointing-Pointer Antioxidant marker proteins were found high in myocardium by L-arginine treatment. Black-Right-Pointing-Pointer Elevated antioxidant status, mediates the reduced TBA-reactivity in left ventricle. Black-Right-Pointing-Pointer L-Arginine treatment enhanced the Nrf2 and eNOS signaling in left ventricle. Black-Right-Pointing-Pointer Improved cell survival signaling by arginine, offers a novel tactic for targeting. -- Abstract: Hyperglycemia is independently related with excessive morbidity and mortality in cardiovascular disorders. L-Arginine-nitric oxide (NO) pathway and the involvement of NO in modulating nuclear factor-E2-related factor-2 (Nrf2) signaling were well established. In the present study we investigated, whether L-arginine supplementation would improve the myocardial antioxidant defense under hyperglycemia through activation of Nrf2 signaling. Diabetes was induced by alloxan monohydrate (90 mg kg{sup -1} body weight) in rats. Both non-diabetic and diabetic group of rats were divided into three subgroups and they were administered either with L-arginine (2.25%) or L-NAME (0.01%) in drinking water for 12 days. Results showed that L-arginine treatment reduced the metabolic disturbances in diabetic rats. Antioxidant enzymes and glutathione levels were found to be increased in heart left ventricles, thereby reduction of lipid peroxidation by L-arginine treatment. Heart histopathological analysis further validates the reversal of typical diabetic characteristics consisting of alterations in myofibers and myofibrillary degeneration. qRT-PCR studies revealed that L-arginine treatment upregulated the transcription of Akt and downregulated NF-{kappa}B. Notably, transcription of eNOS and Nrf2 target genes was also upregulated, which were accompanied by enhanced expression of Nrf2 in left ventricular tissue from diabetic

  16. Ellagic Acid Prevents L-NAME-Induced Hypertension via Restoration of eNOS and p47phox Expression in Rats.

    Science.gov (United States)

    Berkban, Thewarid; Boonprom, Pattanapong; Bunbupha, Sarawoot; Welbat, Jariya Umka; Kukongviriyapan, Upa; Kukongviriyapan, Veerapol; Pakdeechote, Poungrat; Prachaney, Parichat

    2015-06-30

    The effect of ellagic acid on oxidative stress and hypertension induced by Nω-Nitro-L-arginine methyl ester hydrochloride (L-NAME) was investigated. Male Sprague-Dawley rats were administrated with L-NAME (40 mg/kg/day) for five weeks. L-NAME induced high systolic blood pressure (SBP) and increased heart rate (HR), hindlimb vascular resistance (HVR) and oxidative stress. Concurrent treatment with ellagic acid (7.5 or 15 mg/kg) prevented these alterations. Co-treatment with ellagic acid was associated with up-regulation of endothelial nitric oxide synthase (eNOS) protein production and alleviation of oxidative stress as indicated by decreased superoxide production in the vascular tissue, reduced plasma malondialdehyde levels, reduced NADPH oxidase subunit p47phox expression and increased plasma nitrate/nitrite levels. Our results indicate that ellagic acid attenuates hypertension by reducing NADPH oxidase subunit p47phox expression, which prevents oxidative stress and restores NO bioavailability.

  17. Role of C677T and A1298C MTHFR, A2756G MTR and -786 C/T eNOS gene polymorphisms in atrial fibrillation susceptibility.

    Directory of Open Access Journals (Sweden)

    Betti Giusti

    Full Text Available BACKGROUND: Hyperhomocysteinemia has been suggested to play a role in the NonValvular Atrial Fibrillation (NVAF pathogenesis. Polymorphisms in genes coding for homocysteine (Hcy metabolism enzymes may be associated with hyperhomocysteinemia and NVAF. METHODOLOGIES: 456 NVAF patients and 912 matched controls were genotyped by an electronic microchip technology for C677T and A1298C MTHFR, A2756G MTR, and -786C/T eNOS gene polymorphisms. Hcy was determined by an immunoassay method. PRINCIPAL FINDINGS: The genotype distribution of the four polymorphisms as well as genotype combinations did not differ in patients and controls. Hcy was higher in patients than in controls (15.2, 95%CI 14.7-15.7 vs 11.3, 95%CI 11.0-11.6 micromol/L; p<0.0001. In both populations, a genotype-phenotype association (p<0.0001 between Hcy and C677T MTHFR polymorphism was observed; in controls a significant (p = 0.029 association between tHcy and -786C/T eNOS polymorphism was also observed. At the multivariate analysis the NVAF risk significantly increased in the upper quartiles of Hcy compared to the lowest: OR from 2.8 (1.68-4.54 95%CI in Q2 to 12.9 (7.96-21.06 95%CI in Q4. CONCLUSIONS: Our data demonstrated the four polymorphisms, although able, at least in part, to affect Hcy, were not associated with an increased risk of NVAF per se or in combination.

  18. Pharmacogenetic influence of eNOS gene variant on endothelial and glucose metabolism responses to L-arginine supplementation: Post hoc analysis of the L-arginine trial.

    Science.gov (United States)

    Monti, Lucilla D; Galluccio, Elena; Fontana, Barbara; Spadoni, Serena; Comola, Mauro; Marrocco Trischitta, Massimiliano M; Chiesa, Roberto; Comi, Giancarlo; Bosi, Emanuele; Piatti, Piermarco

    2015-11-01

    To evaluate whether variants of the eNOS gene are associated with endothelial and metabolic responses to L-arginine (L-arg) supplementation. We examined a single nucleotide polymorphism of the eNOS gene (rs753482-A>C) to investigate the effects of this variant on endothelial function (EF), colony-forming unit-endothelial cell (CFU-EC) number, asymmetric-dimethylarginine (ADMA) level, insulin sensitivity index (ISI), and insulin secretion (IS) in a post hoc analysis of the L-arg trial. The L-arg trial (6.4 g/day for 18 months) was a single-center, randomized, double-blind, parallel-group, placebo-controlled, phase III trial in individuals with impaired glucose tolerance and metabolic syndrome. followed by a 12-month extended follow-up period after termination of the study drug (NCT 00917449). At baseline, EF, CFU-EC numbers, ADMA levels, and ISI were impaired in subjects carrying minor allele C (both heterozygotes, AC and homozygotes, CC) as compared to subjects carrying major allele A (homozygotes, AA) (p<0.01). Compared to placebo, L-arg increased EF, CFU-EC numbers, and ISI, and improved ADMA levels and IS (p<0.01). The greatest improvements were found in AA subjects treated with L-arg, while the worst results were found in AC+CC subjects treated with placebo. In the placebo-treated subjects, EF, CFU-EC, ISI, and IS were significantly lower and ADMA was significantly higher in AC+CC subjects than in AA subjects. Treatment with L-arg induced similar improvements in EF, CFU-EC numbers, ADMA levels, ISI, and IS in both AA subjects and AC+CC subjects. The presence of minor allele resulted in the worst prognosis in terms of EF, CFU-EC numbers, ADMA levels, ISI, and IS during the 30-month observation period. Copyright © 2015 Elsevier Inc. All rights reserved.

  19. Altered vasoreactivity in neonatal rats with pulmonary hypertension associated with bronchopulmonary dysplasia: Implication of both eNOS phosphorylation and calcium signaling.

    Directory of Open Access Journals (Sweden)

    Eric Dumas de la Roque

    Full Text Available Bronchopulmonary dysplasia (BPD consists of an arrest of pulmonary vascular and alveolar growth, with persistent hypoplasia of the pulmonary microvasculature and alveolar simplification. In 25 to 40% of the cases, BPD is complicated by pulmonary hypertension (BPD-PH that significantly increases the risk of morbidity. In vivo studies suggest that increased pulmonary vascular tone could contribute to late PH in BPD. Nevertheless, an alteration in vasoreactivity as well as the mechanisms involved remain to be confirmed. The purpose of this study was thus to assess changes in pulmonary vascular reactivity in a murine model of BPD-PH. Newborn Wistar rats were exposed to either room air (normoxia or 90% O2 (hyperoxia for 14 days. Exposure to hyperoxia induced the well-known features of BPD-PH such as elevated right ventricular systolic pressure, right ventricular hypertrophy, pulmonary vascular remodeling and decreased pulmonary vascular density. Intrapulmonary arteries from hyperoxic pups showed decreased endothelium-dependent relaxation to acetylcholine without any alteration of relaxation to the NO-donor sodium nitroprusside. This functional alteration was associated with a decrease of lung eNOS phosphorylation at the Ser1177 activating site. In pups exposed to hyperoxia, serotonin and phenylephrine induced exacerbated contractile responses of intrapulmonary arteries as well as intracellular calcium response in pulmonary arterial smooth muscle cells (PASMC. Moreover, the amplitude of the store-operated Ca2+ entry (SOCE, induced by store depletion using a SERCA inhibitor, was significantly greater in PASMC from hyperoxic pups. Altogether, hyperoxia-induced BPD-PH alters the pulmonary arterial reactivity, with effects on both endothelial and smooth muscle functions. Reduced activating eNOS phosphorylation and enhanced Ca2+ signaling likely account for alterations of pulmonary arterial reactivity.

  20. Altered vasoreactivity in neonatal rats with pulmonary hypertension associated with bronchopulmonary dysplasia: Implication of both eNOS phosphorylation and calcium signaling.

    Science.gov (United States)

    Dumas de la Roque, Eric; Smeralda, Gwladys; Quignard, Jean-François; Freund-Michel, Véronique; Courtois, Arnaud; Marthan, Roger; Muller, Bernard; Guibert, Christelle; Dubois, Mathilde

    2017-01-01

    Bronchopulmonary dysplasia (BPD) consists of an arrest of pulmonary vascular and alveolar growth, with persistent hypoplasia of the pulmonary microvasculature and alveolar simplification. In 25 to 40% of the cases, BPD is complicated by pulmonary hypertension (BPD-PH) that significantly increases the risk of morbidity. In vivo studies suggest that increased pulmonary vascular tone could contribute to late PH in BPD. Nevertheless, an alteration in vasoreactivity as well as the mechanisms involved remain to be confirmed. The purpose of this study was thus to assess changes in pulmonary vascular reactivity in a murine model of BPD-PH. Newborn Wistar rats were exposed to either room air (normoxia) or 90% O2 (hyperoxia) for 14 days. Exposure to hyperoxia induced the well-known features of BPD-PH such as elevated right ventricular systolic pressure, right ventricular hypertrophy, pulmonary vascular remodeling and decreased pulmonary vascular density. Intrapulmonary arteries from hyperoxic pups showed decreased endothelium-dependent relaxation to acetylcholine without any alteration of relaxation to the NO-donor sodium nitroprusside. This functional alteration was associated with a decrease of lung eNOS phosphorylation at the Ser1177 activating site. In pups exposed to hyperoxia, serotonin and phenylephrine induced exacerbated contractile responses of intrapulmonary arteries as well as intracellular calcium response in pulmonary arterial smooth muscle cells (PASMC). Moreover, the amplitude of the store-operated Ca2+ entry (SOCE), induced by store depletion using a SERCA inhibitor, was significantly greater in PASMC from hyperoxic pups. Altogether, hyperoxia-induced BPD-PH alters the pulmonary arterial reactivity, with effects on both endothelial and smooth muscle functions. Reduced activating eNOS phosphorylation and enhanced Ca2+ signaling likely account for alterations of pulmonary arterial reactivity.

  1. Influencia de ENOS sobre las variaciones interanuales de ciertos ríos en América del Sur

    Directory of Open Access Journals (Sweden)

    1998-01-01

    plusieurs influences qui affectent la partie centrale des Andes tropicales soumise à l’influence du Pacifique équatorial, du bassin amazonien, de l’Océan Atlantique et de la Mer des Caraïbes. Las diferentes respuestas de los ríos sudamericanos a los estímulos de las fases de El Niño/Oscilación del Sur son estudiadas bajo tres condiciones: El Niño (EN, Anti-Niño (AN, y años normales. Ríos de la costa norte del Perú, Ecuador y el sur de Colombia experimentan altos caudales durante los veranos con EN y bajas descargas durante AN. Las descargas son normales en los otros años. Los ríos de los Andes peruanos y el Altiplano tienen bajos caudales durante EN y descargas normales en las otras dos condiciones. Los ríos de Chile central y los Andes de Argentina experimentan altos caudales durante EN y bajos durante AN. En Patagonia y el sur de Chile existe una independencia con respecto a las fases de ENOS ya que las descargas más altas tienen lugar durante años normales. Los ríos de la Pampa, las tierras bajas de la cuenca del Plata y el extremo sur de Brasil, tienen altas descargas durante EN y bajas durante AN. Los ríos de la costa central de Brasil demuestran independencia con respecto a las tres condiciones. En el noreste de Brasil las descargas son bajas durante EN y altas durante AN. La cuenca del Amazonas tiene diversas respuestas: en la sección central los ríos experimentan bajos caudales durante EN mientras que los tributarios de los Andes tienden a ofrecer altas descargas durante algunos EN. Los ríos de las Guayanas, de Venezuela y Colombia expuestos al Caribe experimentan bajos caudales durante EN y altos volúmenes durante AN. En los Andes del sur de Colombia y Ecuador existe una mezcla: algunos ríos tienen altos caudales durante EN extremadamente fuertes, otros durante las fases AN. Esta región sintetiza las distintas influencias que afectan la parte central de los Andes tropicales, sometida a influencias del Pacífico ecuatorial, de la cuenca

  2. A influência dos modos de variabilidade climática na temperatura em superfície na Antártica

    Directory of Open Access Journals (Sweden)

    Douglas da Silva Lindemann

    2015-06-01

    Full Text Available Este trabalho analisa a variação sazonal da temperatura do ar à superfície (Tar na Antártica, e sua relação com os modos de variabilidade climática El Niño-Oscilação Sul (ENOS e Oscilação Antártica (OA. Os resultados indicam que para os 4 períodos sazonais as Tar nas estações localizadas no setor oriental da Antártica apresentaram significativas correlações negativas (nível de significância de 1% na maioria das estações com a OA. Todavia o único período sazonal, em que o setor continental (Amundsen-Scott, Dome C apresentou forte correlação negativa com a OA, foi durante o inverno (significativa a 1%. Correlações positivas foram encontradas (significâncias entre 1% e 5% entre as Tar da Península Antártica e Shetland do Sul com a OA para os períodos de outono, inverno e primavera. Os resultados demonstram a influência que a OA exerce sobre a climatologia da Tar na Antártica. É importante notar um dipolo entre as regiões oriental da Antártica e da Península Antártica, no que concerne as influências da OA. O modo de variabilidade ENOS apresentou correlação negativa significativa com as três estações da Península Antártica somente durante a primavera, enquanto que para a estação Rothera, à oeste da Península, a correlação foi significativa também para o outono e inverno. A correlação entre ENOS e Tar foi positiva e significativa no setor do Mar de Ross durante a primavera, e com o setor oriental da Antártica durante o verão, com nível de significância chegando a 5%.

  3. Dual-Specificity Phosphatase 4 Overexpression in Cells Prevents Hypoxia/Reoxygenation-Induced Apoptosis via the Upregulation of eNOS

    Directory of Open Access Journals (Sweden)

    Chun-An Chen

    2017-04-01

    Full Text Available Mitogen-activated protein kinases (MAPKs signaling cascades regulate several cellular functions, including differentiation, proliferation, survival, and apoptosis. The duration and magnitude of phosphorylation of these MAPKs are decisive determinants of their physiological functions. Dual-specificity phosphatases exert kinetic control over these signaling cascades. Previously, we demonstrated that DUSP4−/− hearts sustain a larger infarct and have poor functional recovery, when isolated hearts were subjected to ischemia/reperfusion. Uncontrolled p38 activation and upregulation of Nox4 expression are the main effectors for this functional alteration. Here, dual-specificity phosphatase 4 (DUSP4 overexpression in endothelial cells was used to investigate the role of DUSP4 on the modulation of reactive oxygen species (ROS generation and vascular function, when cells were subjected to hypoxia/reoxygenation (H/R insult. Immunostaining with cleaved caspase-3 revealed that DUSP4 overexpression prevents caspase-3 activation and apoptosis after H/R. The beneficial effects occur via modulating p38 activity, increased NO bioavailability, and reduced oxidative stress. More importantly, DUSP4 overexpression upregulates eNOS protein expression (1.62 ± 0.33 versus 0.65 ± 0.16 during H/R-induced stress. NO is a critical small molecule involved in regulating vascular tone, vascular growth, platelet aggregation, and modulation of inflammation. The level of NO generation determined using DAF-2 fluorescence demonstrated that DUSP4 overexpression augments NO production and thus improves vascular function. The level of superoxide generated from cells after being subjected to H/R was determined using dihydroethidium-HPLC method. The results suggested that DUSP4 overexpression in cells decreases H/R-induced superoxide generation (1.56 ± 0.14 versus 1.19 ± 0.05 and thus reduces oxidant stress. This also correlates with the reduction in the total

  4. Dual-Specificity Phosphatase 4 Overexpression in Cells Prevents Hypoxia/Reoxygenation-Induced Apoptosis via the Upregulation of eNOS

    Science.gov (United States)

    Dougherty, Julie A.; Kilbane Myers, Joanna; Khan, Mahmood; Angelos, Mark G.; Chen, Chun-An

    2017-01-01

    Mitogen-activated protein kinases (MAPKs) signaling cascades regulate several cellular functions, including differentiation, proliferation, survival, and apoptosis. The duration and magnitude of phosphorylation of these MAPKs are decisive determinants of their physiological functions. Dual-specificity phosphatases exert kinetic control over these signaling cascades. Previously, we demonstrated that DUSP4−/− hearts sustain a larger infarct and have poor functional recovery, when isolated hearts were subjected to ischemia/reperfusion. Uncontrolled p38 activation and upregulation of Nox4 expression are the main effectors for this functional alteration. Here, dual-specificity phosphatase 4 (DUSP4) overexpression in endothelial cells was used to investigate the role of DUSP4 on the modulation of reactive oxygen species (ROS) generation and vascular function, when cells were subjected to hypoxia/reoxygenation (H/R) insult. Immunostaining with cleaved caspase-3 revealed that DUSP4 overexpression prevents caspase-3 activation and apoptosis after H/R. The beneficial effects occur via modulating p38 activity, increased NO bioavailability, and reduced oxidative stress. More importantly, DUSP4 overexpression upregulates eNOS protein expression (1.62 ± 0.33 versus 0.65 ± 0.16) during H/R-induced stress. NO is a critical small molecule involved in regulating vascular tone, vascular growth, platelet aggregation, and modulation of inflammation. The level of NO generation determined using DAF-2 fluorescence demonstrated that DUSP4 overexpression augments NO production and thus improves vascular function. The level of superoxide generated from cells after being subjected to H/R was determined using dihydroethidium-HPLC method. The results suggested that DUSP4 overexpression in cells decreases H/R-induced superoxide generation (1.56 ± 0.14 versus 1.19 ± 0.05) and thus reduces oxidant stress. This also correlates with the reduction in the total protein S

  5. Effects of stimulation of soluble guanylate cyclase on diabetic nephropathy in diabetic eNOS knockout mice on top of angiotensin II receptor blockade.

    Directory of Open Access Journals (Sweden)

    Ina M Ott

    Full Text Available The prevalence of diabetes mellitus and its complications, such as diabetic nephropathy (DN, is rising worldwide and prevention and treatment are therefore becoming increasingly important. Therapy of DN is particularly important for patients who do not adequately respond to angiotensin receptor blocker (ARB treatment. Novel approaches include the stimulation of soluble guanylate cyclase (sGC as it is reported to have beneficial effects on cardiac and renal damage. We aimed to investigate the effects of the sGC stimulator riociguat and ARB telmisartan on kidney function and structure in a hypertensive model of diabetic nephropathy. Seventy-six diabetic male eNOS knockout C57BL/6J mice were randomly divided after having received streptozotocin: telmisartan (1 mg/kg/d, riociguat (3 mg/kg/d, riociguat+telmisartan (3+1 mg/kg/d, and vehicle. Fourteen mice were used as non-diabetic controls. Treatment duration was 11 weeks. Glucose concentrations were increased and similar in all diabetic groups. Telmisartan insignificantly reduced blood pressure by 5.9 mmHg compared with diabetic controls (111.2±2.3 mmHg vs. 117.1±2.2 mmHg; p = 0.071. Treatment with riociguat both alone and in combination with telmisartan led to a significant reduction of blood pressure towards diabetic vehicle (105.2±2.5 mmHg and 105.0±3.2 mmHg, respectively, vs. 117.1±2.2 mmHg. Combined treatment also significantly decreased albuminuria compared with diabetic controls (47.3±9.6 µg/24 h vs. 170.8±34.2 µg/24 h; p = 0.002 reaching levels similar to those of non-diabetic controls (34.4±10.6 µg/24 h, whereas the reduction by single treatment with either telmisartan (97.8±26.4 µg/24 h or riociguat (97.1±15.7 µg/24 h was not statistically significant. The combination treatment led to a significant (p<0.01 decrease of tissue immunoreactivity of malondialdehyde, as consequence of reduced oxidative stress. In conclusion, stimulation of sGC significantly reduced urinary

  6. Immunohistochemical expression of nitric oxide synthase enzymes (iNOS, eNOS, nNOS) in the estrual and luteal phases of the sexual cycle in the cow oviduct.

    Science.gov (United States)

    Özen, A; Ergün, E; Öztaş, E; Ergün, L; Özcan, Z; Alabay, B; Bayraktaroğlu, A G; Kürüm, A; Erdoğan, E

    2013-10-01

    This study was aimed to determine staining intensity, cellular localization and distribution of the nitric oxide synthase (NOS) enzymes during the sexual cycle in the cow oviduct. Oviduct samples belonging to 20 cows, 10 of which were in the estrual phase and 10 in the luteal phase of the sexual cycle, were examined by an immunohistochemical procedure to determine the presence of the NOS enzymes. In the epithelial cells of the isthmus, endothelial NOS (eNOS) expression showed a strong positive reaction during the estrual phase and a weak positive reaction during the luteal phase in the endothelium and smooth muscle of the blood vessels found in the serosa and lamina propria. eNOS expression was not observed in the epithelium of either the ampulla or the fimbria in the two particular phases of the sexual cycle. The eNOS reactions observed in the blood vessel wall in these regions were stronger during the estrual phase. eNOS activity was not observed in the tunica muscularis in any of the regions of the oviduct. During the estrual phase, it was observed that inducible NOS expression showed a stronger positive reaction in the epithelium and muscle layer of the isthmus and ampulla and in the epithelium of the fimbria, compared to the luteal phase. Neuronal NOS immunoreactivity was observed in the epithelial cells of all oviduct regions and in the muscle layer of the isthmus and ampulla and did not display any significant difference between the estrual and luteal phases. © 2013 Blackwell Verlag GmbH.

  7. Ellagic Acid Prevents L-NAME-Induced Hypertension via Restoration of eNOS and p47phox Expression in Rats

    Directory of Open Access Journals (Sweden)

    Thewarid Berkban

    2015-06-01

    Full Text Available The effect of ellagic acid on oxidative stress and hypertension induced by Nω-Nitro-l-arginine methyl ester hydrochloride (L-NAME was investigated. Male Sprague-Dawley rats were administrated with L-NAME (40 mg/kg/day for five weeks. L-NAME induced high systolic blood pressure (SBP and increased heart rate (HR, hindlimb vascular resistance (HVR and oxidative stress. Concurrent treatment with ellagic acid (7.5 or 15 mg/kg prevented these alterations. Co-treatment with ellagic acid was associated with up-regulation of endothelial nitric oxide synthase (eNOS protein production and alleviation of oxidative stress as indicated by decreased superoxide production in the vascular tissue, reduced plasma malondialdehyde levels, reduced NADPH oxidase subunit p47phox expression and increased plasma nitrate/nitrite levels. Our results indicate that ellagic acid attenuates hypertension by reducing NADPH oxidase subunit p47phox expression, which prevents oxidative stress and restores NO bioavailability.

  8. Synergistic Antihypertensive Effect of Carthamus tinctorius L. Extract and Captopril in l-NAME-Induced Hypertensive Rats via Restoration of eNOS and AT1R Expression

    Science.gov (United States)

    Maneesai, Putcharawipa; Prasarttong, Patoomporn; Bunbupha, Sarawoot; Kukongviriyapan, Upa; Kukongviriyapan, Veerapol; Tangsucharit, Panot; Prachaney, Parichat; Pakdeechote, Poungrat

    2016-01-01

    This study examined the effect of Carthamus tinctorius (CT) extract plus captopril treatment on blood pressure, vascular function, nitric oxide (NO) bioavailability, oxidative stress and renin-angiotensin system (RAS) in Nω-Nitro-l-arginine methyl ester (l-NAME)-induced hypertension. Rats were treated with l-NAME (40 mg/kg/day) for five weeks and given CT extract (75 or 150 or 300 or 500 mg/kg/day): captopril (5 mg/kg/day) or CT extract (300 mg/kg/day) plus captopril (5 mg/kg/day) for two consecutive weeks. CT extract reduced blood pressure dose-dependently, and the most effective dose was 300 mg/kg/day. l-NAME-induced hypertensive rats showed abnormalities including high blood pressure, high vascular resistance, impairment of acetylcholine-induced vasorelaxation in isolated aortic rings and mesenteric vascular beds, increased vascular superoxide production and plasma malondialdehyde levels, downregulation of eNOS, low level of plasma nitric oxide metabolites, upregulation of angiotensin II type 1 receptor and increased plasma angiotensin II. These abnormalities were alleviated by treatment with either CT extract or captopril. Combination treatment of CT extract and captopril normalized all the abnormalities found in hypertensive rats except endothelial dysfunction. These data indicate that there are synergistic antihypertensive effects of CT extract and captopril. These effects are likely mediated by their anti-oxidative properties and their inhibition of RAS. PMID:26938552

  9. Synergistic Antihypertensive Effect of Carthamus tinctorius L. Extract and Captopril in L-NAME-Induced Hypertensive Rats via Restoration of eNOS and AT₁R Expression.

    Science.gov (United States)

    Maneesai, Putcharawipa; Prasarttong, Patoomporn; Bunbupha, Sarawoot; Kukongviriyapan, Upa; Kukongviriyapan, Veerapol; Tangsucharit, Panot; Prachaney, Parichat; Pakdeechote, Poungrat

    2016-02-29

    This study examined the effect of Carthamus tinctorius (CT) extract plus captopril treatment on blood pressure, vascular function, nitric oxide (NO) bioavailability, oxidative stress and renin-angiotensin system (RAS) in N(ω)-Nitro-l-arginine methyl ester (l-NAME)-induced hypertension. Rats were treated with l-NAME (40 mg/kg/day) for five weeks and given CT extract (75 or 150 or 300 or 500 mg/kg/day): captopril (5 mg/kg/day) or CT extract (300 mg/kg/day) plus captopril (5 mg/kg/day) for two consecutive weeks. CT extract reduced blood pressure dose-dependently, and the most effective dose was 300 mg/kg/day. l-NAME-induced hypertensive rats showed abnormalities including high blood pressure, high vascular resistance, impairment of acetylcholine-induced vasorelaxation in isolated aortic rings and mesenteric vascular beds, increased vascular superoxide production and plasma malondialdehyde levels, downregulation of eNOS, low level of plasma nitric oxide metabolites, upregulation of angiotensin II type 1 receptor and increased plasma angiotensin II. These abnormalities were alleviated by treatment with either CT extract or captopril. Combination treatment of CT extract and captopril normalized all the abnormalities found in hypertensive rats except endothelial dysfunction. These data indicate that there are synergistic antihypertensive effects of CT extract and captopril. These effects are likely mediated by their anti-oxidative properties and their inhibition of RAS.

  10. Synergistic Antihypertensive Effect of Carthamus tinctorius L. Extract and Captopril in l-NAME-Induced Hypertensive Rats via Restoration of eNOS and AT1R Expression

    Directory of Open Access Journals (Sweden)

    Putcharawipa Maneesai

    2016-02-01

    Full Text Available This study examined the effect of Carthamus tinctorius (CT extract plus captopril treatment on blood pressure, vascular function, nitric oxide (NO bioavailability, oxidative stress and renin-angiotensin system (RAS in Nω-Nitro-l-arginine methyl ester (l-NAME-induced hypertension. Rats were treated with l-NAME (40 mg/kg/day for five weeks and given CT extract (75 or 150 or 300 or 500 mg/kg/day: captopril (5 mg/kg/day or CT extract (300 mg/kg/day plus captopril (5 mg/kg/day for two consecutive weeks. CT extract reduced blood pressure dose-dependently, and the most effective dose was 300 mg/kg/day. l-NAME-induced hypertensive rats showed abnormalities including high blood pressure, high vascular resistance, impairment of acetylcholine-induced vasorelaxation in isolated aortic rings and mesenteric vascular beds, increased vascular superoxide production and plasma malondialdehyde levels, downregulation of eNOS, low level of plasma nitric oxide metabolites, upregulation of angiotensin II type 1 receptor and increased plasma angiotensin II. These abnormalities were alleviated by treatment with either CT extract or captopril. Combination treatment of CT extract and captopril normalized all the abnormalities found in hypertensive rats except endothelial dysfunction. These data indicate that there are synergistic antihypertensive effects of CT extract and captopril. These effects are likely mediated by their anti-oxidative properties and their inhibition of RAS.

  11. Voltametrijske metode na bazi jednostavnih i savremenih elektroda/senzora za određivanje odabranih analita od farmakološkog značaja

    OpenAIRE

    Vajdle, Olga

    2017-01-01

    Danas, u raznim analitičkim laboratorijama postoji veći broj analitičkih protokola,zasnovanih bilo na izuzetno sofisticiranim ili jednostavnijim tehnikama, koji služe zaodređivanje različitih ciljnih analita od farmakološkog značaja. Među tim grupama ciljnih analita pripadaju i antibiotici koji predstavljaju veliko otkriće u oblasti medicine i zahvaljujući njima spašeno je više od sedam miliona života, ali pored navedenih koristi, antibiotici mogu da izazovu  veliki ...

  12. Inhibition of kidney proximal tubular glucose reabsorption does not prevent against diabetic nephropathy in type 1 diabetic eNOS knockout mice.

    Directory of Open Access Journals (Sweden)

    Muralikrishna Gangadharan Komala

    Full Text Available BACKGROUND AND OBJECTIVE: Sodium glucose cotransporter 2 (SGLT2 is the main luminal glucose transporter in the kidney. SGLT2 inhibition results in glycosuria and improved glycaemic control. Drugs inhibiting this transporter have recently been approved for clinical use and have been suggested to have potential renoprotective benefits by limiting glycotoxicity in the proximal tubule. We aimed to determine the renoprotective benefits of empagliflozin, an SGLT2 inhibitor, independent of its glucose lowering effect. RESEARCH DESIGN AND METHODS: We induced diabetes using a low dose streptozotocin protocol in 7-8 week old endothelial nitric oxide (eNOS synthase knockout mice. We measured fasting blood glucose on a monthly basis, terminal urinary albumin/creatinine ratio. Renal histology was assessed for inflammatory and fibrotic changes. Renal cortical mRNA transcription of inflammatory and profibrotic cytokines, glucose transporters and protein expression of SGLT2 and GLUT1 were determined. Outcomes were compared to diabetic animals receiving the angiotensin receptor blocker telmisartan (current best practice. RESULTS: Diabetic mice had high matched blood glucose levels. Empagliflozin did not attenuate diabetes-induced albuminuria, unlike telmisartan. Empagliflozin did not improve glomerulosclerosis, tubular atrophy, tubulointerstitial inflammation or fibrosis, while telmisartan attenuated these. Empagliflozin did not modify tubular toll-like receptor-2 expression in diabetic mice. Empagliflozin did not reduce the upregulation of macrophage chemoattractant protein-1 (MCP-1, transforming growth factor β1 and fibronectin mRNA observed in the diabetic animals, while telmisartan decreased transcription of MCP-1 and fibronectin. Empagliflozin increased GLUT1 mRNA expression and telmisartan increased SGLT2 mRNA expression in comparison to untreated diabetic mice. However no significant difference was found in protein expression of GLUT1 or SGLT2 among the

  13. Multifactor dimensionality reduction analysis of MTHFR, PAI-1, ACE, PON1, and eNOS gene polymorphisms in patients with early onset coronary artery disease.

    Science.gov (United States)

    Agirbasli, M; Guney, A I; Ozturhan, H S; Agirbasli, D; Ulucan, K; Sevinc, D; Kirac, D; Ryckman, K K; Williams, S M

    2011-12-01

    Association studies in the Turkish population have investigated the single locus effects of different gene polymorphisms on coronary artery disease (CAD). CAD is a complex polygenic disease that involves complex interactions among multiple genetic and environmental conditions. We evaluated associations of five candidate genetic polymorphisms (methylene tetrahydrofolate reductase C677T, plasminogen activator inhibitor 4G/5G, endothelial nitric oxide synthase (eNOS) 3-27 base pair repeat, insertion, or deletion of a 287 bp Alu repeat sequence polymorhism of angiotensin I converting enzyme, and paraoxonase Gln192Arg PON1 polymorphisms) with the presence and extent of early onset CAD. DNA was isolated and amplified from 90 consecutive patients with angiographically proven early onset CAD (ages 41 ± 5 for men, 49 ± 7 for women) and also from 90 control subjects with no significant coronary obstruction angiographically (ages 42 ± 5 for men, 48 ± 6 for women). Multifactor dimensionality reduction (MDR) analysis was performed to identify a model of CAD based on both genetic and conventional risk factors. MDR analysis detected a significant model with four genes (prediction success ∼ 61%, p = 0.03). When the total number of the conventional risk factors is analysed with the candidate polymorphisms, a different model is identified that includes three of the four genes from the above model and achieves a similar prediction of CAD as the gene only model. These data indicate that gene-gene and gene-environmental risk interactions form significant models in predicting early onset CAD.

  14. NO Metabolites Levels in Human Red Blood Cells are Affected by Palytoxin, an Inhibitor of Na(+)/K(+)-ATPase Pump.

    Science.gov (United States)

    Carelli-Alinovi, Cristiana; Tellone, Ester; Russo, Anna Maria; Ficarra, Silvana; Pirolli, Davide; Galtieri, Antonio; Giardina, Bruno; Misiti, Francesco

    2014-01-01

    Palytoxin (PTX), a marine toxin, represents an increasing hazard for human health. Despite its high toxicity for biological systems, the mechanisms triggered by PTX, are not well understood. The high affinity of PTX for erythrocyte Na(+)/K(+)-ATPase pump is largely known, and it indicates PTX as a sensitive tool to characterize the signal transducer role for Na(+)/K(+)-ATPase pump. Previously, it has been reported that in red blood cells (RBC), probably via a signal transduction generated by the formation of a PTX-Na(+)/K(+)-ATPase complex, PTX alters band 3 functions and glucose metabolism. The present study addresses the question of which other signaling pathways are regulated by Na(+)/K(+)-ATPase in RBC. Here it has been evidenced that PTX following its interaction with Na(+)/K(+)-ATPase pump, alters RBC morphology and this event is correlated to decreases by 30% in nitrites and nitrates levels, known as markers of plasma membrane eNOS activity. Orthovanadate (OV), an antagonist of PTX binding to Na(+)/K(+)-ATPase pump, was able to reverse the effects elicited by PTX. Finally, current investigation firstly suggests that Na(+)/K(+)-ATPase pump, following its interaction with PTX, triggers a signal transduction involved in NO metabolism regulation.

  15. MicroRNA-27b plays a role in pulmonary arterial hypertension by modulating peroxisome proliferator-activated receptor γ dependent Hsp90-eNOS signaling and nitric oxide production

    Energy Technology Data Exchange (ETDEWEB)

    Bi, Rui; Bao, Chunrong; Jiang, Lianyong; Liu, Hao; Yang, Yang; Mei, Ju; Ding, Fangbao, E-mail: dbcar126@126.com

    2015-05-01

    Pulmonary artery endothelial dysfunction is associated with pulmonary arterial hypertension (PAH). Based on recent studies showing that microRNA (miR)-27b is aberrantly expressed in PAH, we hypothesized that miR-27b may contribute to pulmonary endothelial dysfunction and vascular remodeling in PAH. The effect of miR-27b on pulmonary endothelial dysfunction and the underlying mechanism were investigated in human pulmonary artery endothelial cells (HPAECs) in vitro and in a monocrotaline (MCT)-induced model of PAH in vivo. miR-27b expression was upregulated in MCT-induced PAH and inversely correlated with the levels of peroxisome proliferator-activated receptor (PPAR)-γ, and miR-27b inhibition attenuated MCT-induced endothelial dysfunction and remodeling and prevented PAH associated right ventricular hypertrophy and systolic pressure in rats. PPARγ was confirmed as a direct target of miR-27b in HPAECs and shown to mediate the effect of miR-27b on the disruption of endothelial nitric oxide synthase (eNOS) coupling to Hsp90 and the suppression of NO production associated with the PAH phenotype. We showed that miR-27b plays a role endothelial function and NO release and elucidated a potential mechanism by which miR-27b regulates Hsp90-eNOS and NO signaling by modulating PPARγ expression, providing potential therapeutic targets for the treatment of PAH. - Highlights: • miR-27b plays a role in endothelial function and NO release. • miR-27b inhibition ameliorates MCT-induced endothelial dysfunction and PAH. • miR-27b targets PPARγ in HPAECs. • miR-27b regulates PPARγ dependent Hsp90-eNOS and NO signaling.

  16. Puruvana puruvanavana : [luuletused] / Eno Raud

    Index Scriptorium Estoniae

    Raud, Eno, 1928-1996

    2000-01-01

    Sisu: Puruvana puruvanavana ; Vetesell ; Pada ja katel ; Nääripäkapikk ; Vanapaar ; Mere peremees ; Lepamaim ; Kiilaspää kiilasjääl ; Tõugu unistus ; Naljatilk silk ; Muttide jalutuskäik ; Hiir lumes ; Kalakari salakaril ; Naljalammas ; Mesilastest ; Kure mure ; Voki laul karule ; Põrsalaul ; Kurk ja kõrvits ; Tuhk ja tina ; Õige pea ja vale pea ; Suu pea, puupea! ; Siga õuel

  17. ANÁLISE DOS CICLOS DE PRECIPITAÇÃO NA REGIÃO DE BOA VISTA - RR NOS ANOS DE 1910 A 2014

    Directory of Open Access Journals (Sweden)

    Danielle Alves Silva

    2015-12-01

    Full Text Available Este estudo buscou relacionar e identificar a influência dos fenômenos ENOS nos índices de precipitação da série histórica (1910 a 2014 da estação pluviométrica de Boa Vista, Capital do Estado de Roraima, Brasil. Os procedimentos metodológicos compreenderam: a análises estatísticas dos dados diários, mensais e anuais para definição da série pluviométrica identificação de diferentes ciclos pluviométricos; b identificação e confrontação dos dados pluviométricos com os períodos de vigência dos fenômenos ENOS (El Niño e La Niña a fim de identificar relações destes com anomalias observadas na série histórica. A análise da série histórica permitiu a identificação de quatro ciclos pluviométricos, representados por dois ciclos secos e outros dois úmidos. Os eventos ENOS (El Niño e La Niña apresentaram grande compatibilidade com as variações pluviométricas da série. Os resultados apontam para a necessidade do estado e da sociedade civil se organizar aos efeitos dos ciclos de El Niño, em especial a retração do volume superficial de água disponível, estações secas mais fortes e ampliação de eventos de queimadas e, no caso dos ciclos de  La Niña, recorrência de cheias e eventos associados.

  18. Lipopolysaccharide increases Na(+),K(+)-pump, but not ENaC, expression in guinea-pig airway epithelium.

    Science.gov (United States)

    Dodrill, Michael W; Beezhold, Donald H; Meighan, Terence; Kashon, Michael L; Fedan, Jeffrey S

    2011-01-25

    Earlier, we found in functional experiments that lipopolysaccharide (LPS; 4mg/kg; i.p.) hyperpolarized the epithelium by stimulating the transepithelial transport of Na(+) in guinea-pig tracheal epithelium. Epithelial sodium channel (ENaC) activity and Na(+),K(+)-pump activity were increased. In this study, we hypothesized that LPS increases the expression of ENaC and the Na(+),K(+)-pump in the epithelium and investigated the levels of transcription and protein abundance. Using qPCR, the effects of LPS on the transcription of αENaC, α(1) Na(+),K(+)-pump, COX-2, eNOS, iNOS, IL-1β, and TNF-α were measured at 3 and 18h. In the epithelium, LPS increased the transcription of COX-2, IL-1β, and, to a nonsignificant extent, TNF-α at 3h, but not at 18h. In alveolar macrophages, TNF-α, and, to a nonsignificant extent, COX-2 and IL-1β were up-regulated at 3h, but not at 18h. Even though LPS stimulated the transcription of some genes, αENaC and α(1) Na(+),K(+)-ATPase transcription were not affected. The expressions of α-, β-, and γ-ENaC and α(1) Na(+),K(+)-pump from the tracheal epithelium and kidney cortex/medulla were investigated by western blotting. All three ENaC subunits were detected as cleavage fragments, yet LPS had no effect on their expression. LPS increased the expression of the α(1) subunit and the α(1), α(2), and α(3) subunits, collectively, of the Na(+),K(+)-pump. Taken together, these data indicate that LPS increases Na(+) transport downstream of the genetic level, in part, by stimulating the expression of the Na(+),K(+)-pump. Published by Elsevier B.V.

  19. Reduction of Adhesion Molecule Production and Alteration of eNOS and Endothelin-1 mRNA Expression in Endothelium by Euphorbia hirta L. through Its Beneficial β-Amyrin Molecule

    Directory of Open Access Journals (Sweden)

    Mei Fen Shih

    2014-07-01

    Full Text Available The inflammatory reaction in large blood vessels involves up-regulation of vascular adhesion molecules such as endothelial cell selectin (E-selectin, soluble vascular cell adhesion molecule (sVCAM-1, and soluble intercellular adhesion molecule (sICAM-1. These vascular dysfunctions are associated with the development of atherosclerosis. β-Amyrin, an active component of Euphorbia hirta L., has potent anti-inflammatory effects. So far, its preventive effects against the expression of inflammatory mediator-induced adhesion molecules have not been investigated. Endothelial cells (SVEC4-10 cell line were treated with 50% RAW conditioned media (i.e., normal SVEC4-10 culture media contains 50% of lipopolysaccharide-activated macrophage culture media without or with β-amyrin (0.6 and 0.3 µM. The production levels of E-selectin, sICAM-1, and sVCAM-1 in the SVEC4-10 cells were measured with ELISA assay kits. Under the same treatment conditions, expression of endothelin (ET-1 and endothelial type of NO synthase (eNOS mRNA were analyzed by RT-PCR and agarose gel. With β-amyrin, the 50% RAW conditioned media-induced E-selectin, sICAM-1, and sVCAM-1 levels as well as ET-1 gene expression were all suppressed. β-Amyrin treatment also restored the 50% RAW conditioned media-suppressed eNOS mRNA expression. These data indicate that β-amyrin is potentially useful in preventing chronic inflammation-related vascular diseases.

  20. Reduction of adhesion molecule production and alteration of eNOS and endothelin-1 mRNA expression in endothelium by Euphorbia hirta L. through its beneficial β-amyrin molecule.

    Science.gov (United States)

    Shih, Mei Fen; Cherng, Jong Yuh

    2014-07-18

    The inflammatory reaction in large blood vessels involves up-regulation of vascular adhesion molecules such as endothelial cell selectin (E-selectin), soluble vascular cell adhesion molecule (sVCAM)-1, and soluble intercellular adhesion molecule (sICAM)-1. These vascular dysfunctions are associated with the development of atherosclerosis. β-Amyrin, an active component of Euphorbia hirta L., has potent anti-inflammatory effects. So far, its preventive effects against the expression of inflammatory mediator-induced adhesion molecules have not been investigated. Endothelial cells (SVEC4-10 cell line) were treated with 50% RAW conditioned media (i.e., normal SVEC4-10 culture media contains 50% of lipopolysaccharide-activated macrophage culture media) without or with β-amyrin (0.6 and 0.3 µM). The production levels of E-selectin, sICAM-1, and sVCAM-1 in the SVEC4-10 cells were measured with ELISA assay kits. Under the same treatment conditions, expression of endothelin (ET)-1 and endothelial type of NO synthase (eNOS) mRNA were analyzed by RT-PCR and agarose gel. With β-amyrin, the 50% RAW conditioned media-induced E-selectin, sICAM-1, and sVCAM-1 levels as well as ET-1 gene expression were all suppressed. β-Amyrin treatment also restored the 50% RAW conditioned media-suppressed eNOS mRNA expression. These data indicate that β-amyrin is potentially useful in preventing chronic inflammation-related vascular diseases.

  1. Vliv konečné apertury naenos výkonu super-gaussovských svazků - analýza s využitím VirtualLabu

    Czech Academy of Sciences Publication Activity Database

    Stanke, Ladislav; Palatka, Miroslav

    2017-01-01

    Roč. 62, Jan (2017), s. 26-29 ISSN 0447-6441 R&D Projects: GA MŠk EF15_008/0000162 Grant - others:ELI Beamlines(XE) CZ.02.1.01/0.0/0.0/15_008/0000162 Institutional support: RVO:68378271 Keywords : beam clipping * super-Gaussian beams * simulation Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics)

  2. KOORDINIRANA REGULACIJA NAPETOSTI V DISTRIBUCIJSKIH OMREŽJIH Z RAZPRŠENO PROIZVODNJO OB RAZLIČNIH KRITERIJIH REGULACIJE JALOVE MOČI

    OpenAIRE

    KOLENC, MARKO

    2015-01-01

    Doktorska disertacija sega na področje kakovosti električne energije in pametnih distribucijskih omrežij v elektroenergetiki. V prvem poglavju so predstavljeni glavni pojmi in smernice v elektroenergetiki. V Sloveniji in svetu se poraba energije neprenehoma zvišuje. Tako je lahko pričakovati, da bomo leta 2035 porabili približno 36 % več energije kot leta 2000. Od tega se bo najbolj povečala raba električne energije, do leta 2035 za približno 70 %, največjo rast pa se pričakuje v državah ...

  3. A serendipidade na medicina e na anestesiologia

    OpenAIRE

    Vale, Nilton Bezerra do; Delfino, José; Vale, Lúcio Flávio Bezerra do

    2005-01-01

    JUSTIFICATIVA E OBJETIVOS: Neste trabalho foram examinados mais de uma centena dos mais felizes acoplamentos de uma mente brilhante com a sorte benfazeja (serendipidade), através da releitura das mais relevantes histórias sobre invenções e descobertas relacionadas à ciência (n = 46), à Medicina (n = 46) e à Anestesiologia (n = 16). CONTEÚDO: Conceito de serendipidade; exemplos célebres de serendipidade em Ciência e Tecnologia; serendipidade na pesquisa e prática médicas; serendipidade na Anes...

  4. NA60 Status Report

    CERN Document Server

    Usai, G

    2010-01-01

    This report shortly summarizes the main results obtained from the analysis of the NA60 data during 2010, perspectives for the analysis activity during 2011 and the requests to CERN following from them. In addition, renewed interest is expressed for a possible continuation of NA60, including future running at lower SPS energies.

  5. A multilevel prediction of physiological response to challenge: Interactions among child maltreatment, neighborhood crime, endothelial nitric oxide synthase gene (eNOS), and GABA(A) receptor subunit alpha-6 gene (GABRA6).

    Science.gov (United States)

    Lynch, Michael; Manly, Jody Todd; Cicchetti, Dante

    2015-11-01

    Physiological response to stress has been linked to a variety of healthy and pathological conditions. The current study conducted a multilevel examination of interactions among environmental toxins (i.e., neighborhood crime and child maltreatment) and specific genetic polymorphisms of the endothelial nitric oxide synthase gene (eNOS) and GABA(A) receptor subunit alpha-6 gene (GABRA6). One hundred eighty-six children were recruited at age 4. The presence or absence of child maltreatment as well as the amount of crime that occurred in their neighborhood during the previous year were determined at that time. At age 9, the children were brought to the lab, where their physiological response to a cognitive challenge (i.e., change in the amplitude of the respiratory sinus arrhythmia) was assessed and DNA samples were collected for subsequent genotyping. The results confirmed that complex Gene × Gene, Environment × Environment, and Gene × Environment interactions were associated with different patterns of respiratory sinus arrhythmia reactivity. The implications for future research and evidence-based intervention are discussed.

  6. At NA2

    CERN Multimedia

    1977-01-01

    One of the NA2 calorimeter sections is moved in. The NA2 calorimeter was divided in two halves, to the left and the right of the beam, each half consisting of sheets of passive high Z material interleaved with blades of plastic scintillators. The photo shows on the right, the upstream 'electron' module with eleven lead plates for a total radiation length of 20.

  7. Polarization dependence of Na* + Na* associative ionization revisited

    NARCIS (Netherlands)

    Meijer, H.A.J.; Meulen, H.P. v.d.; Morgenstern, R.; Hertel, I.V.; Meyer, E.; Witte, R.

    1986-01-01

    The dependence of the associative ionization process Na 3 2P3/2 + Na 3 2P3/2 → Na2+ + e- on the polarization of the laser light used for Na excitation was independently investigated in Utrecht and Berlin. The purpose of this paper is to clarify discrepancies between two other earlier experimental

  8. Letramento na contemporaneidade

    OpenAIRE

    Kleiman, Angela B.

    2014-01-01

    Neste trabalho examino a relação entre letramento e contemporaneidade, tomando como base para a discussão o letramento no mundo escolar e sua relação com os letramentos de outras instituições do mundo contemporâneo, a fim de determinar as relações entre as finalidades contemporâneas da leitura e da escrita (em outras palavras, o que significa ser letrado na contemporaneidade) e as práticas mobilizadas e as atividades realizadas na escola para atingir essas finalidades. Através de diversos exe...

  9. Nietzsche na moda

    OpenAIRE

    José,João

    2016-01-01

    Resumo Ao resgatar o filósofo alemão do esquecimento, Stefan Zweig seria o principal responsável pela atual "voga Nietzsche". A edição brasileira de seu livro em 1931 e o artigo "L'actualité de Nietzsche", publicado anonimamente na França em 1933, atestariam o crescente interesse pelo autor de Zaratustra . A presença de Nietzsche na cena contemporânea, todavia, dever-se-ia não somente aos ensaios de outros estudiosos como Salomé (1893), Bertram (1918), Andler (1920) e Walz (1932), mas a um fe...

  10. NOVÉ NA STARÉ – Brno, nároží Bratislavská - Stará

    OpenAIRE

    Červinková, Kateřina

    2014-01-01

    Řešené území se nachází v městské části Brno-střed, na nárožní poloze ulic Bratislavská a Stará. Je tvořeno několika parcelami, které jsou v současné době nezastaveny, nebo se na nich nachází stavby dočasného charakteru. Část vymezeného území dnes slouží jako parkoviště Policie České republiky. Od historického centra ji dělí dopravní - malý městský okruh vedoucí ulicí Koliště. V blízkosti řešeného území jsou městské domy většinou s obchodním parterem, postavené v rozmezí konce 19. - 1.pol. 20...

  11. Factors responsible for subclinical mastitis in cows caused by Staphylococcus chromogenes and its susceptibility to antibiotics based on bap, fnbA, eno, mecA, tetK, and ermA genes.

    Science.gov (United States)

    Bochniarz, M; Adaszek, Ł; Dzięgiel, B; Nowaczek, A; Wawron, W; Dąbrowski, R; Szczubiał, M; Winiarczyk, S

    2016-12-01

    The aim of this study was to recognize selected factors of virulence determining the adhesion of Staphylococcus chromogenes to cows' udder tissues in subclinical mastitis and to evaluate the susceptibility of this pathogen to antibiotics. The subjects of the study were 38 isolates of Staph. chromogenes from 335 samples of milk from cows with subclinical coagulase-negative staphylococci mastitis. Somatic cell count ranged between 216,000 and 568,000/mL of milk (average 356,000/mL of milk). We confirmed the ability to produce slime in 24 isolates (63.2%), and the ability to produce protease in 29 isolates (76.3%). In each slime-producing isolate, the bap gene was not found, and the fnbA and eno genes were not detected. In vitro tests showed that ceftiofur had the highest effectiveness against Staph. chromogenes (89.5% of susceptible isolates). Minimum inhibitory concentrations ranged from 0.06 to 2µg/mL for susceptible isolates. The minimum concentrations required to inhibit growth of 90 and 50% of the isolates for ceftiofur were at or below the cutoffs recommended by the Clinical and Laboratory Standards Institute (2 and 0.06µg/mL, respectively). A significant percentage of the isolates were susceptible to other β-lactam antibiotics: amoxicillin with clavulanic acid (84.2%) and ampicillin (81.6%). The lowest effectiveness among β-lactams was for penicillin (73.7% of susceptible isolates), and the minimum inhibitory concentration for penicillin ranged from chromogenes (71.1 and 63.2% of susceptible isolates, respectively). The genes tetK (6 isolates) and ermA (1 isolate) were also detected. Copyright © 2016 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  12. Riso na epilepsia

    Directory of Open Access Journals (Sweden)

    Edymar Jardim

    1967-06-01

    Full Text Available São estudados três casos de síndrome convulsiva temporal, com manifestações concomitantes de riso na sua fase inicial. As características principais foram a imotivação e á incoercibilidade do riso. Esses sintomas desapareceram com o uso de anticonvulsivantes.

  13. Biotecnologia na agricultura

    Directory of Open Access Journals (Sweden)

    Helaine Carrer

    2010-01-01

    Full Text Available A expectativa de o crescimento populacional atingir 9 bilhões de habitantes em 2050 em adição às questões da sustentabilidade e do aquecimento global nos desafiam a aumentar a oferta de alimentos. Uma metodologia alternativa que contribua para a redução do impacto desse cenário envolve a biotecnologia, que, nas últimas décadas, trouxe marcantes oportunidades tecnológicas na agricultura, resultando em relevante desenvolvimento na obtenção de novas variedades de plantas, na melhoria da qualidade de diversos alimentos e atualmente também na bioenergia. As técnicas biotecnológicas envolvendo os marcadores moleculares, a genômica e a transformação genética estão transformando a agricultura e são discutidas neste artigo.The expected population growth to reach 9 billion by 2050 in addition to issues of sustainability and global warming challenges us to increase the supply of food. An alternative approach to help reducing the impact of this scenario involves biotechnology which in recent decades has brought remarkable technological opportunities in the agriculture that resulted in relevant development in obtaining new plant varieties, improved quality of different foods, and now also in bioenergy. The biotechnology techniques involving molecular markers, genomics and genetic transformation are transforming agriculture and will be discussed in this article.

  14. Hidroma subdural na fossa posterior

    Directory of Open Access Journals (Sweden)

    José Carlos Vasques

    1970-03-01

    Full Text Available Os autores relatam um caso de hidroma subdural na fossa craniana posterior conseqüente a traumatismo na região occipital. O paciente foi operado com pleno sucesso. A raridade da localização de hidroma na fossa posterior é salientada, sendo discutidos os possíveis mecanismos etio-patogênicos.

  15. A epilepsia na neurocisticercose

    Directory of Open Access Journals (Sweden)

    Luís Marques-Assis

    1972-12-01

    Full Text Available Foram estudados 131 casos de epilepsia com etiologia cisticercótica comprovada. A idade variou de 2 a 68 anos; 75 pacientes eram de sexo masculino e 56 de sexo feminino; 117 eram brancos, 10 pardos, três pretos e um amarelo. A idade de início da doença predominou na primeira década. O estudo foi feito em relação ao tipo de epilepsia, ao tempo decorrido após a primeira crise, à freqüência das crises e ao eletrencefalograma relativamente às epilepsias em geral. Investigação foi feita também em relação à cefaléia, aos achados neurológicos, liquóricos, radiológicos simples e contrastados e anátomo-patológicos. A análise dos resultados permitiu aos autores as seguintes conclusões: 1 No grupo de neurocisticercose o início da doença predominou na primeira e a partir da quarta década em relação às epilepsias em geral. 2 Dentre as manifestações clínicas predominaram as formas convulsivas da doença (61%, sendo as crises bravas-jacksonianas as menos freqüentes (4%; quando comparadas com as epilepsias em geral, verifica-se incidência menor das convulsões generalizadas na neurocisticercose. 3 Quanto ao tempo de doença, verifica-se predomínio das formas de duração mais curta (um ano ou menos na neurocisticercose. 4 A severidade da epilepsia, traduzida pela freqüência das crises, foi menor no grupo com neurocisticercose. 5 Excluídos os casos com anormalidades eletrencefalográficas contínuas, foram encontrados maiores índices percentuais de EEG normal na neurocisticercose que nas epilepsias em geral. 6 A cefaléia estava presente em 68% dos casos, assumindo caráter paroxístico na maior parte (78%; em 67% dos casos com cefaléia paroxística não havia concomitantemente sinais de hipertensão intracraniana; nos casos com cefaléia contínua, em apenas dois (13% esses sinais não estavam presentes. 7 Na maior parte dos casos (62% as manifestações epilépticas se apresentaram isoladamente, sem sinais neurol

  16. The CERES / NA45 experiment

    CERN Multimedia

    Laurent Guiraud

    2000-01-01

    Ceres is one of the second generation heavy ion experiments at CERN's SPS. It is dedicated to the study of electron-positron pairs in relativistic nuclear collisions. NA45 is one of the seven experiments (NA44, NA45, NA49, NA50, NA52, WA97/NA57 and WA98) involved in CERN's Heavy Ion programme which provided evidence for the existence of a new state of matter, the quark-gluon plasma. In this state, quarks, instead of being bound up into more complex particles such as protons and neutrons, are liberated and roam freely. Theory predicts that this state must have existed at about 10 microseconds after the Big Bang, before the formation of matter as we know it today.

  17. El cuento americano: Güeno-mapu

    Directory of Open Access Journals (Sweden)

    Gabriel Carvajal

    1966-02-01

    Full Text Available Helechos. Susurran como el abanico del pavo real. Ahí están. En grupos o hileras sobre la huella rojiza que va al caserío. Junto a la selva. Lejos, adentro, a donde solo llegan a ramonear los vahuales. En la traba de pellines, ulmos y araucarias, rosal silvestre y zarza levantada en altura de lianas y cañaveral.

  18. na Perua

    Directory of Open Access Journals (Sweden)

    Jorge Carvalho

    1989-01-01

    Full Text Available Antes de se caracterizar como tentativa de ensaio ou de análise a qualquer coisa, o presente artigo tem, antes de mais nada, a pretensão de se constituir uma provocação ao debate acerca da questão do esporte na escola. A provocação parte basicamente do relato da minha experiência pessoal como Secretário da Educação do Município de Aracaju, cargo que exerci no período de 1º de janeiro de 1986 a 27 de janeiro de 1987.

  19. Envolvimento pulmonar na polimiosite

    Directory of Open Access Journals (Sweden)

    Direndra Hasmucrai

    2010-07-01

    Full Text Available Resumo: Introdução: A polimiosite (PM e a dermatomiosite são classificadas como miopatias inflamatórias idiopáticas. O envolvimento pulmonar por PM é pouco frequente, estando descrito na literatura em cerca de 10% de casos.Os autores apresentam um caso de uma mulher de 75 anos, com queixas de febre, perda ponderal, artralgias, mialgias e diminuição simétrica e proximal da força muscular com impotência funcional dos membros superiores e inferiores, com início um mês antes do internamento. Apresentava infiltrados pulmonares na telerradiografia de tórax. Após estudo exaustivo estabeleceu-se o diagnóstico de envolvimento pulmonar na forma de pneumonia organizativa por PM. Efectuou-se corticoterapia e terapêutica com micofenolato com melhoria clínica, analítica e radiológica.Conclusão: Neste caso, foi a alteração na telerradiografia de tórax numa doente sem sintomatologia respiratória que levou ao estudo exaustivo até ao diagnóstico de PM, realçando mais uma vez a importância da telerradiografia no rastreio de patologias de outros foros.Rev Port Pneumol 2010; XVI (4: 671-677 Abstract: Introduction: Polymyositis and dermatomyositis are classified as idiopathic inflammatory myopathies. Interstitial lung disease is rare and is described in the literature in about 10% of cases.The authors describes a case of 75 year old woman presenting with one month evolution of fever, weight loss, arthralgia, myalgia and symmetric and proximal muscle weakness of upper and lower limbs. Nonspecific interstitial changes was found in chest X-ray. After exhaustive study, the diagnosis of pulmonary envolvement in the form of organizing pneumonia by polymyositis, was established. Glucocorticoids and mycophenolate were prescribed with good clinical, analytical and radiological outcome.Conclusion: In this case, it was the changes in the chest X-ray in a patient without respiratory sym ptomatology, that conducted to exhaustive study to polymyositis

  20. Envolvimento pulmonar na polimiosite

    Directory of Open Access Journals (Sweden)

    Direndra Hasmucrai

    2010-07-01

    Full Text Available Resumo: Introdução: A polimiosite (PM e a dermatomiosite são classificadas como miopatias inflamatórias idiopáticas. O envolvimento pulmonar por PM é pouco frequente, estando descrito na literatura em cerca de 10% de casos.Os autores apresentam um caso de uma mulher de 75 anos, com queixas de febre, perda ponderal, artralgias, mialgias e diminuição simétrica e proximal da força muscular com impotência funcional dos membros superiores e inferiores, com início um mês antes do internamento. Apresentava infiltrados pulmonares na telerradiografia de tórax. Após estudo exaustivo estabeleceu-se o diagnóstico de envolvimento pulmonar na forma de pneumonia organizativa por PM. Efectuou-se corticoterapia e terapêutica com micofenolato com melhoria clínica, analítica e radiológica. Conclusão: Neste caso, foi a alteração na telerradiografia de tórax numa doente sem sintomatologia respiratória que levou ao estudo exaustivo até ao diagnóstico de PM, realçando mais uma vez a importância da telerradiografia no rastreio de patologias de outros foros. Abstract: Introduction: Polymyositis and dermatomyositis are classified as idiopathic inflammatory myopathies. Interstitial lung disease is rare and is described in the literature in about 10% of cases.The authors describes a case of 75 year old woman presenting with one month evolution of fever, weight loss, arthralgia, myalgia and symmetric and proximal muscle weakness of upper and lower limbs. Nonspecific interstitial changes was found in chest X-ray. After exhaustive study, the diagnosis of pulmonary envolvement in the form of organizing pneumonia by polymyositis, was established. Glucocorticoids and mycophenolate were prescribed with good clinical, analytical and radiological outcome. Conclusion: In this case, it was the changes in the chest X-ray in a patient without respiratory symptomatology, that conducted to exhaustive study to polymyositis diagnosis, enhancing once again the

  1. Avaliação da seca de 2005 na Amazônia: uma análise da calha do rio Solimões

    Directory of Open Access Journals (Sweden)

    Edivaldo Afonso de Oliveira Serrão

    2014-12-01

    Full Text Available A Bacia Amazônica, com uma área estimada de 6.110.000 km², sofre influência de diversos sistemas atmosféricos. Estes podem ser agrupados em 3 tipos: convecção diurna resultante do aquecimento da superfície e condições de larga-escala favoráveis; linhas de instabilidade originadas na costa N-NE do litoral do Atlântico; e aglomerados convectivos de meso e larga escala, associados com a penetração de sistemas frontais na região S/SE do Brasil e interagindo com a região Amazônica. A consequência direta destes pode ser observada nas variações de nível d´água verificadas nas bacias hidrográficas componentes. A presente proposta teve por objetivo realizar uma análise espacial da precipitação durante o período chuvoso e menos chuvoso, do ano de 2005, na calha do rio Solimões, marcado por uma das maiores secas na Amazônia, associando aos sistemas atmosféricos atuantes nessa região e causadores desta estiagem severa. Os resultados obtidos ilustram que o médio-baixo curso do rio Solimões, foi o mais afetado no período pela redução da precipitação, com valores próximos a 104 mm período de (julho-dezembro; esta precipitação pode ser vinculada aos fenômenos do ENOS fase positiva e do dipolo do Atlântico positivo, que são fortes moduladores da precipitação na Amazônia

  2. Reakce na text „Věda jako kooperující systém, nebo jako bojiště oborů?“

    Directory of Open Access Journals (Sweden)

    Martin Braniš

    2013-05-01

    Full Text Available Přečetl jsem příspěvek Martina Říhy a marně uvažoval o tom, proč se objevil na stránkách poslední Envigogiky. Slíbený motiv uvedený v titulu článku totiž není v jeho obsahu do nijaké hloubky reflektován. Jádro textu se točí okolo názoru na to, jak má být naloženo s lesy v Národním parku Šumava. Bohužel, přestože je jakousi reakcí na (podle autora tendenční a povrchní vystoupení prof. Kindlmanna z pražské Přírodovědecké fakulty, samo postrádá téměř jakékoli „tvrdé argumenty“ a „nezpochybnitelná fakta“. Mimo jiné, ten, kdo se vyzná v metodologii vědy (tedy jakékoli vědy, neb ta je pouze jedna, nemůže nikdy od vědy očekávat nezpochybnitelná fakta, neboť věda je založena nikoli na potvrzování hypotéz, ale na jejich falzifikaci. Ale dost zatím o vědě.

  3. Comprometimento pulmonar na leptospirose

    Directory of Open Access Journals (Sweden)

    Jorge Eduardo Manhães de Carvalho

    1992-03-01

    Full Text Available Em 23 pacientes com leptospirose apresentando comprometimento pulmonar, internados no Hospital Universitário Antônio Pedro da XJFF, Niterói, hemoptise e hemoptóicos foram observados em 21,7% e 30,4%, respectivajnente. Gasometria arterial revelou hipoxemia e hipocapnia na maioria dos casos. Radiografia de tórax em 15 pacientes mostrou comprometimento alveolar em 60%, comprometimento intersticial-reticular em 6%, padrão misto (alveolar e intersticial em20%e ausência de alterações radiológicas em 14%. A necrópsiade 13 pacientes mostrou edema, congestão e hemorragia nos pulmões em 100% dos casos. A hemorragia foi focal em 46% e difusa em 54% dos casos. Houve formação de membrana hialina em 30% e trombos de fibrina em 46% dos pulmões estudados, o que estabelece o diagnóstico da coagulação intravascular disseminada e a ocorrência da síndrome de angústia respiratória na leptospirose.

  4. Influencia del fenómeno El Niño - La Niña / Oscilación Sur (ENOS y de la temperatura del Atlántico norte en los caudales del Río Caura, Guayana Venezolana

    Directory of Open Access Journals (Sweden)

    Jorge Paolini

    2012-04-01

    Full Text Available Este trabajo analiza 33 años (1971-2003 de una serie de tiempo de caudales con una estacionalidad muy marcada recolectada en la Cuenca del Río Caura. Esta cuenca es de vital importancia porque es una de las últimas regiones prístinas de la Guayana venezolana. Los datos provienen de tres estaciones hidrométricas ubicadas en la cuenca del Río Caura. Se analiza la influencia del fenómeno El Niño Oscilación Sur (ENOS y las anomalías de las temperaturas del océano Atlántico Tropical sobre los caudales del río. Para el análisis de las relaciones entre el fenómeno ENOS y la serie de caudales se utilizan los índices ONI y MEI. La exploración de las singularidades en los datos se realiza utilizando una segmentación de las series de tiempo basada en el índice ONI. La segmentación de la series de tiempo permite detectar relaciones específicas entre el caudal y cada una de las fases del fenómeno del Niño.

  5. ANALIZA POSLOVNE KULTURE NA JAPONSKEM

    OpenAIRE

    Ocvirk, Katja

    2012-01-01

    Poslovanje na mednarodnih trgih se z globalizacijo vedno bolj spreminja. V delu diplomskega seminarja sem opredelila kulturo in opisala njene pomembne sestavine ter značilnosti. Spoznala sem, da mora biti poslovnež, ki deluje na mednarodnem trgu, zelo dobro pripravljen in seznanjen s kulturnimi razlikami, da se izogne nepotrebnim napakam in spodrsljajem. Menim, da moramo pri poslovanju s poslovnimi partnerji, ki prihajajo iz drugih kultur, vedeti, kako deluje njihovo poslovno okolje. Na ...

  6. NA48 prototype calorimeter

    CERN Multimedia

    1990-01-01

    This is a calorimeter, a detector which measures the energy of particles. When in use, it is filled with liquid krypton at -152°C. Electrons and photons passing through interact with the krypton, creating a shower of charged particles which are collected on the copper ribbons. The ribbons are aligned to an accuracy of a tenth of a millimetre. The folding at each end allows them to be kept absolutely flat. Each shower of particles also creates a signal in scintillating material embedded in the support disks. These flashes of light are transmitted to electronics by the optical fibres along the side of the detector. They give the time at which the interaction occurred. The photo shows the calorimeter at NA48, a CERN experiment which is trying to understand the lack of anti-matter in the Universe today.

  7. Na Cauda do Cometa

    Science.gov (United States)

    Voelzke, M. R.

    2009-01-01

    Quando viam um cometa, os antigos gregos imaginavam uma estrela com uma vasta cabeleira. Não à toa, a palavra deriva do termo koma, que significa cabelo. Constituídos por fragmentos de gelo e gases, os cometas possuem um núcleo sólido, que pode ter vários quilômetros de diâmetro, e uma cauda que sempre aponta na direção contrária ao Sol, devido aos ventos solares. Graças à aparência de pontos luminosos em movimento (ao contrário de outros astros, que parecem estáticos), esses corpos celestes foram interpretados por diferentes povos com muito misticismo, inspirando mitos tanto de boas-novas como de maus presságios. Conheça algumas dessas histórias:

  8. A ENGENHARIA NA ESCOLA

    Directory of Open Access Journals (Sweden)

    Valéria Pelizzer Casara

    2015-04-01

    Full Text Available Este projeto teve por objetivo principal mostrar às jovens do ensino médio, como as áreas de exatas e de engenharia podem estar inseridas em situações rotineiras por elas vivenciadas e incentivá-las para ingressarem nessas áreas. O projeto foi executado na escola de ensino Médio Nelson Horostecki na cidade de Chapecó, Santa Catarina. Mostrou-se de forma simples que as áreas de exatas e de engenharia têm aplicações práticas nas nossas vidas. No desenvolvimento do projeto, realizaram-se oficinas na escola cujo tema principal abordado foi o processo de fabricação do chocolate, visto que o mesmo é um produto muito apreciado pelas adolescentes. Dentro dessa temática, foram trabalhadas as questões que envolvem conhecimentos das áreas de exatas e de engenharia, mais especificamente a Engenharia Ambiental. O projeto auxiliou na formação cidadã e também na escolha profissional das meninas. Muitas das alunas participantes nunca haviam tido contato direto com alunos graduandos de cursos na área das exatas. Mais ainda, este projeto oportunizou a aproximação da universidade com a comunidade externa. Palavras-chave: Extensão Universitária, Ciências Exatas e Engenharia, Chocolate, Oficinas.   Engineering in the school Abstract: The main objective of this project was to show high school female students how the exact sciences and engineering can be included in their routine situations encouraging them to entering in these areas. The project was carried out at the Nelson Horostecki High School in Chapecó, Santa Catarina State, Brazil. It was showed in a simple manner how exact sciences and engineering have practical applications in our lives. Workshops were conducted in the school during the execution of the project in which the main subject was the chocolate manufacturing process, since chocolate is a product greatly appreciated by the young female people. Within this matter, the activities were performed using the knowledge of

  9. Hodler à Iéna

    OpenAIRE

    2017-01-01

    A la mort de Hodler, on demanda que les planches qui recouvrait la fresque de Iéna, depuis la protestation contre le bombardement de Reims, soit enlevées. Les autorités de Iéna ont refusé énergiquement.

  10. Valores na escola

    Directory of Open Access Journals (Sweden)

    Menin Maria Suzana De Stefano

    2002-01-01

    Full Text Available Neste texto pretende-se discorrer sobre valores morais na escola e suas implicações para a formação de professores. Para tanto discutir-se-á, em primeiro lugar, e brevemente, o que são valores morais, ou éticos, e como a escola pode situar-se em relação a eles. Em seguida, serão relatadas algumas observações a respeito de valores de professores e práticas daí decorrentes. São comentados resultados de pesquisa que ilustram a transmissão de valores de forma doutrinal e a educação moral e cívica tal como realizada na ditadura militar, e, por outro lado, a posição relativista e/ou de laissez-faire que certas escolas podem adotar, metodologicamente, sobre a educação em valores. Finalmente, defender-se-á a idéia de que é necessária uma discussão sobre valores pelos diversos membros da escola e uma opção por uma metodologia para ensiná-los, seja os professores, em sua formação inicial e continuada, seja os alunos. A teoria de desenvolvimento moral de Jean Piaget será apresentada como uma referência possível para a educação em valores. Exemplos de situações escolares de conflito de valores entre direção, pais e alunos são discutidas para ilustrar como uma escola pode adotar um procedimento democrático de educação em valores, que se apresenta como um terceiro caminho possível de educação moral nas escolas, além das posições doutrinárias ou relativistas.

  11. Statistička analiza termovizijske i televizijske slike i prag detekcije pokreta na sceni / Statistical analysis of television and thermo vision image and change detection thresholding

    Directory of Open Access Journals (Sweden)

    Žarko Barbarić

    2006-04-01

    Full Text Available U ovom radu prikazana je uporedna analiza osobina televizijske i termovizijske slike iste scene. Analizirani su raspodela nivoa sivog, srednja vrednost, standardna devijacija, entropija i korelacija televizijske i termovizijske slike bliske i daleke scene. Rezultati analize ukazuju na razlike i sličnosti televizijske i termovizijske slike iste scene. Razlike u vrednostima statističkih parametara televizijske i termovizijske slike bliske scene posledica su dominantnosti komponenata radijanse scene, dok je za slike daleke scene dominantan uticaj transmitivnosti atmosfere. Sličnost postoji zbog fizičkih dimenzija objekata na sceni i sličnih principa vizuelizacije scene termovizijskom i televizijskom kamerom. Analiza je sprovedena i za slike razlike dobijene oduzimanjem sukcesivnih frejmova, posebno za televizijsku i termovizijsku sliku. Ova analiza slika razlike sukcesivnih frejmova ukazuje na veliku suglasnost statističkih parametara ova dva tipa slika iste scene, stoje iskorišćeno za određivanje praga detekcije pokreta istim postupkom na oba tipa slike razlike. / A comparative analysis of statistical properties of television and thermovision images of the same scene is analyzed. Histogram, mean value, standard deviation, entropy, and correlation of gray level both images we studied, for near and far scenes. Results show differences and similarities between television and thermo vision image of the same scene. Differences in values of statistical properties of television and thermo vision images of near scene are consequence of scene radiance. The transmittance of atmosphere is dominated effect for far scene images. Similarities are consequence of scene objects dimensions and similar concepts of visualization television and thermovision cameras. In addition, statistical analysis on the difference images, obtained as difference two successive frames, for television and thermovision image, is given. This analysis shows good agreement on

  12. A aposta na filosofia

    Directory of Open Access Journals (Sweden)

    Márcio Suzuki

    2011-12-01

    Full Text Available Para Hume, filosofar é uma atividade semelhante às demais ocupações humanas. A decisão que leva à atividade filosófica é menos resultado de uma argumentação teórica do que fruto de um cálculo prático, que é entendido como uma caça ou um jogo. O objetivo deste trabalho será o de mostrar que no jogo filosófico perde quem joga sério demais. A aposta na filosofia tem que passar pelo bom humor e pela diversão: uma resposta a Pascal?For Hume, philosophy is in itself neither more nor less important than other human activities. On the contrary, it can be explained from its resemblance with game and hunting. If one chooses to dedicate himself to philosophy, his decision is not the consequence of logical reasoning, but depends on practical evaluation, which has something to do with gambling. The following text tries to show that in philosophy, like in other games, the loser will be the one who plays too earnestly. The philosophical game requires good humour and some relaxation: Is this a good answer to Pascal's pari?

  13. A Arquitetura na Cidade

    Directory of Open Access Journals (Sweden)

    Euler Sandeville Junior

    2013-07-01

    Full Text Available Este artigo é uma reflexão sobre três casos em que a arquitetura define a configuração do espaço público, investigando seus significados e pressupostos. São levantadas questões que não comportam respostas definitivas, mas que induzem a alguns parâmetros para discutir a atuação do arquiteto no espaço público, nas áreas centrais de nossas cidades. Nosso título é, sem dúvida, devedor do célebre trabalho de Aldo Rossi, a Arquitetura da cidade (1966. Porém, nos ocupamos apenas da inserção da arquitetura na cidade e numa perspectiva teórica muito distinta, reconhecendo para o projeto do objeto arquitetônico uma dependência do espaço e do tempo e das relações sociais que assim se estabelecem. São analisados o Memorial da América Latina, a estação Barra Funda do Metrô e a Praça da Sé. São aqui entendidos como campos de projeto da paisagem e, como tal, problematizados.

  14. O SUBLIME NA MODERNIDADE

    Directory of Open Access Journals (Sweden)

    Martha de Almeida

    2009-03-01

    Full Text Available A obra Uma investigação filosófica sobre a origem de nossas idéias do sublime e dobelo, do sensualista inglês Edmund Burke (1757, data as origens do sublime na Modernidade. Nosublime ocorre é um prazer ligado à dor, um "horror delicioso" que sentimos quando acreditamosque estamos em perigo sem que isso esteja ocorrendo realmente. Em O mundo como Vontade erepresentação Schopenhauer assume as influências que sofreu de Kant no que diz respeito à suainterpretação sobre o belo e o sublime, porém difere dele quanto à natureza dessa impressão. ParaSchopenhauer a experiência estética pressupõe a dissolução da subjetividade num movimento decontemplação das idéias livre do querer imposto pela vontade individual. As idéias deSchopenhauer influenciaram a estética do Nietzsche de O nascimento da tragédia.

  15. SPOLNO NADLEGOVANJE NA DELOVNEM MESTU

    OpenAIRE

    Rubič, Gašper

    2016-01-01

    V diplomskem delu smo v uvodu predstavili problem spolnega nadlegovanja na delovnem mestu in predstavili podjetje TEKSTIL d.d. V nadaljevanju smo z anketo raziskali, ali problem spolnega nadlegovanja na delovnem mestu v obravnavanem podjetju obstaja in če, kako se nanj odziva okolje. V teoretičnem delu smo nadaljevali in predstavili definicijo spolnega nadlegovanja, ki je kakršna koli oblika nezaželenega verbalnega in neverbalnega ali fizičnega ravnanja spolne narave z učinkom ali nameno...

  16. Hemisferectomia na hemiplegia infantil

    Directory of Open Access Journals (Sweden)

    Rolando A. Tenuto

    1956-03-01

    Full Text Available Os autores relatam o caso de um paciente com 18 anos de idade, portador de paralisia cerebral instalada aos 4 anos de idade após moléstia febril prolongada (hemiplegia esquerda, crises convulsivas generalizadas, freqüentes e rebeldes à medicação, deficiência mental e alterações de conduta. O eletrencefalograma e o pneumencefalograma revelaram alterações graves do hemisfério direito; tendo o primeiro destes exames demonstrado a existência de perturbações propagadas ao outro hemisfério. Foi praticada a hemisferectomia direita. Durante o ato cirúrgico, por exigência técnica foram extirpados, além do hemisfério cerebral, os dois terços rostrais do núcleo caudado e o núcleo amigdalóide. No pós-operatório foi intercorrência de osteomielite e meningite, medicadas com antibióticos e seqüestrectomia. Apesar da complicação pós-operatória, instalou-se progressiva melhora em relação à conduta social; diminuiu também a espasticidade no membro inferior esquerdo e não mais se repetiram as crises convulsivas. Não foram observadas modificações quanto ao rendimento intelectual e quanto aos distúrbios sensitivos que existiam antes da intervenção cirúrgica. O exame neurocular mostrou hemianopsia homônima esquerda. Êstes resultados são concordantes com os assinalados na literatura sobre o assunto.

  17. Active transport of Na+ by reconstituted Na,K-ATPase

    International Nuclear Information System (INIS)

    Boldyrev, A.A.; Svinukhova, I.A.

    1987-01-01

    The ability of ATP, CTP, ITP, GTP, and UTP to support ouabain-sensitive accumulation of Na + by proteoliposomes with a reconstituted Na/K-pump was investigated. At a low [Na + ]/[K + ] ratio in the medium (20 mM/50 mM), a correlation is observed between the proton-accepting capacity of the nucleotide and its effectiveness as a substrate of active transport. To test the hypothesis of the importance of the presence of a negative charge in the 1-position of the purine (3-pyrimidine) base of the nucleotide for mutual transitions between the Na- and K-conformations of Na,K-ATPase they used two analogs of ATP: N 1 -hydroxy-ATP, possessing proton acceptor capacity, and N 1 -methoxy-ATP, in the molecule of which the negative charge is quenched by a methyl group. The first substrate supports active accumulation of Na + in proteoliposomes at the same rate as ATP, whereas the second substrate is relatively ineffective

  18. Maestro di Pico i iluminacije u inkunabuli De Civitate Dei (Nicolas Jenson, Venecija, 1475. u samostanu Sv. Duje u Kraju na Pašmanu

    Directory of Open Access Journals (Sweden)

    Bojan Goja

    2014-12-01

    Full Text Available U franjevačkom samostanu Sv. Duje u Kraju na otoku Pašmanu čuva se inkunabula „O državi Božjoj“ (De Civitate Dei Sv. Aurelija Augustina koju je 1475. godine u Veneciji tiskao Nicolas Jenson. Inkunabula je na f. 17 (kako je naknadno označena paginacija grafitnom olovkom, tj. stranici incipita – liber primus kao i na više drugih stranica ukrašena lijepim višebojnim iluminacijama renesansnih stilskih karakteristika izrađenih temperom, zlatnim listićima, zlatnim prahom, sepijom, tintom i akvarelom. Iluminacije f. 17 sastoje se od dva fitomorfna inicijala, dekorativnog okvira i slobodnih figurativnih prizora tj. minijatura, dok su pojedine druge stranice ukrašene fitomorfnim i brojnim inicijala tipa littera notabilior visine dva retka izrađenima u crvenoj ili plavoj boji. Dekorativni ornamentirani okvir zaključen trolistima ispunjava gornju i lijevu marginu početne stranice. Osnovu dekoracije čini traka sastavljena od pet tankih linija koja se spiralno povija i tvori kružnice koje su ispunjene cvjetovima, listovima i bobicama u plavoj i zelenoj boji i boji ciklame te stiliziranim zlatnim cvjetovima čička (lat. Arctium lappa; pojedini autori nazivaju ove ukrasne motive bottoni dorati ili gold dots. U gornjem lijevom uglu okvira naslikan je češljugar. Na mjestu gdje započinje tekst lijevog stupca naslikan je unutar pravokutnog polja na zlatnoj pozadini inicijal „I“ sastavljen od fitomorfnih motiva plave, zelene i boje ciklame s osjenčanjima u različitim nijansama. Unutar dekorativnog okvira, na sredini visine inicijala, nalazi se medaljon unutar kojeg je naslikano poprsje Sv. Aurelija Augustina. Dekorativni ornamentirani okvir koji ispunjava gornju marginu ukrašen je na isti način kao i onaj uz desnu ali skromnije. Ime tiskara dodatno je naznačeno tako da je sa gornje i donje strane okvira ukrašeno sa po jednim stiliziranim zlatnim cvijetom čička sa gornje i češljugovine (lat. Dipsacus fullonum sa donje strane

  19. Development of new technologies for high quality thin film and its application to energy engineering; Hikari seigyo to sokudo senbetsu ni yoru chokinshitsu usumaku no seisaku to energy bun`ya eno tekiyo

    Energy Technology Data Exchange (ETDEWEB)

    Hijikata, K.; Inoue, T.; Nagasaki, T.; Suzuki, Y.; Sato, I. [Tokyo Institute of Technology, Tokyo (Japan); Nakabeppu, O. [The University of Tokyo, Tokyo (Japan). Faculty of Engineering

    1997-02-01

    This paper describes laser irradiation and velocity selective deposition experiments for fabricating high quality thin films. For the formation of Ag thin film by vacuum deposition method, YAG laser was irradiated to atoms or clusters parallel or perpendicular to the NaCl single crystal substrate, to deposit them on the substrate. For another experiment, Ag atoms selected in the given velocity were deposited on the (001) NaCl substrate by passing the molecular beam through the velocity selector. When laser was not irradiated, the thin film showed a random structure. Epitaxial growth was accelerated by the laser irradiation. When the selective velocity was set in 353 m/s at the constant intensity of molecular beam, the diffraction pattern of the thin film showed net pattern. When the selective velocity was set in 529 m/s, a structure in which ring pattern was overlapped on the net pattern was obtained. 2 figs.

  20. Risbjerg: Historisk stemmeskred med NA

    DEFF Research Database (Denmark)

    Thomsen, Søren Risbjerg

    2007-01-01

    ANALYSE: NA flytter 12,3 pct. af stemmerne i majs meningsmålinger - historisk mange vælgere på en måned, skriver professor Risbjerg. Udgivelsesdato: 3. juni 2007......ANALYSE: NA flytter 12,3 pct. af stemmerne i majs meningsmålinger - historisk mange vælgere på en måned, skriver professor Risbjerg. Udgivelsesdato: 3. juni 2007...

  1. Na via do Behemoth

    Directory of Open Access Journals (Sweden)

    Gérard Rabinovitch

    2008-06-01

    Full Text Available O momento nazista permanece um enigma impensado de que a cultura contemporânea continua cativa. O autor levanta a hipótese de que a persistência desse enigma e seus estragos duráveis se devem à insistência dos pensamentos político, sociológico e filosófico em construírem o nazismo à luz da metáfora hobbesiana do Leviatã. Propõe retomar a questão do nazismo sob a perspectiva do Behemoth, antônimo do Leviatã. Para tanto, sugere a necessidade de retornar a Freud e à psicanálise, balizas de um possível novo pensamento do político que escrutine a destrutividade nazista. Propõe ainda sondar as homologias entre nazismo, corjas e máfias, com base na figura da " heroicização da violência" que lhes seria comum. E avança um modelo " econômico" : a quimera, suscetível de capturar o caráter heterotópico e heterocrônico de sua construção criminosa.The paths of Behemoth. The Nazi moment remains as the thoughtless enigma of which contemporary culture is still captive. The author raises the hypothesis where the persistency of this enigma and its durable damages are due to the insistence of the political, social and philosophical thoughts in building the Nazism at the view of the Hobbesian metaphor of Leviathan. It is here proposed to resume the Nazism matter under Behemoth's perspective, antonym to Leviathan. For such, it is suggested a necessity to look back at Freud and the psychoanalysis, structured by a possible new political thought which scrutinizes the destructivity of the Nazism. It is also here proposed to gaze at the homologies between Nazism, mafias and gangs, with a base in the figure of " violence as a heroically act" that are their common ground. The author also advances an economical model: the chimera susceptible to capture the heterotopic and heterochronic character of its criminal construction.

  2. Estresse ocupacional na enfermagem atuante na unidade de terapia intensiva

    OpenAIRE

    Borges Teixeira, Larissa; Portela Veloso, Lorena Uchôa; Universidade Estadual do Piauí; Pereira Ribeiro, Ítalo Arão; Universidade Estadual do Piauí; Nunes de Oliveira, Tauane; Instituto de Ensino Superior Franciscano; Leal Cortez, Antônio Carlos; Universidade Estadual do Piauí

    2017-01-01

    Introdução: O estresse tem sido um dos problemas que mais tem acometido a equipe de enfermagem dentro da unidade de terapia intensiva (UTI), causando prejuízo funcional, bem como instabilidade na saúde desses profissionais. Objetivo: Descrever, através da revisão integrativa, o estresse no trabalho da enfermagem na UTI, bem como identificar fatores, sinais e sintomas associados ao estresse ocupacional. Método: Trata-se de uma pesquisa integrativa, utilizando como banco de dados a Biblioteca V...

  3. Corpo e sexualidade na gravidez

    Directory of Open Access Journals (Sweden)

    Natalúcia Matos Araújo

    2012-06-01

    Full Text Available Estudo etnográfico que teve como objetivo compreender como as gestantes vivenciam os processos fisiológicos do seu corpo durante a gestação e a sua repercussão na sexualidade. A pesquisa envolveu sete mulheres residentes em bairro popular de São Paulo. Na coleta de dados, utilizou-se observação participante e entrevista com questões norteadoras. Os dados foram apresentados na forma de narrativa e posteriormente organizados nas categorias: Percebendo as transformações corporais; Convivendo com as mudanças no corpo; Sentimentos e sensações na vida sexual durante a gestação e imaginando o corpo e a sexualidade após a gestação. As mulheres referiram-se às transformações do corpo como desconfortos e expressaram a preocupação de que fossem definitivas. Expressaram o desejo de que, após o parto, o corpo volte a ser como era e que volte a sentir desejo sexual. O reconhecimento destes fatos constitui-se numa ferramenta primordial na adequação das práticas profissionais.

  4. All new for NA62

    CERN Multimedia

    Antonella Del Rosso

    2012-01-01

    This week sees the start of the first run of the new NA62 experiment. This will be a unique opportunity for the collaboration to test its new beam, new detectors and new data acquisition system before the physics run in 2014. Speaking to the Bulletin, the NA62 technical coordinator Ferdinand Hahn shares the many challenges that the various teams faced to be on time for beam. Ready, steady, start!   A Large Angle Veto detector (white) in place in the NA62 decay volume (blue). With components from almost all the detectors in place downstream of the decay point of the mother particles – the kaons – and of the KTAG detector that tags the kaons before they decay, NA62 is ready for its first technical run. This unique run will test all the equipment as well as the trigger and the data acquisition systems. “This year, we will have about five weeks of beam from the SPS before the long shutdown of all the CERN machines,” says Ferdinand Hahn, NA62 Technical Co-...

  5. Kostel na Lesné

    OpenAIRE

    Pospíšil, Vojtěch

    2017-01-01

    Tato teoretická diplomová práce se zabývá prostorovou akustikou a s tím úzce spojenou problematikou doby dozvuku. Součástí práce je zpracování návrhu akustických úprav kostela na základě ručního výpočtu, který byl dále upravován ve specializovaném softwaru Odeon Room Acoustics Program. Pro okolní zástavbu kostela byla vytvořena hluková studie v programu Hluk+, aby bylo posouzeno, jaký bude mít tato novostavba hlukový dopad z kostelních zvonů dopad na své okolí. Na základě specializace, bylo v...

  6. gigapanorama of NA 62 cavern

    CERN Multimedia

    Brice, Maximilien

    2015-01-01

    The image shows the new rare Kaon decay experiment at CERN, called NA62. The NA62 experiment is 270 metres long and includes a 120-metre-long vacuum tank, shown here, housing several of the particle detectors. (Note: the experiment axis is a straight line, the curving of the tank is an optical effect of the photo.) Kaons are particles that decay into lighter elementary particles. The kaon decay processes are mostly well known, except for some very rare decay modes. For example, NA62 is investigating a rare decay predicted by the Standard Model in which a kaon decays into one pion and two neutrinos. This process occurs only once every 10 billion decays. The understanding of such ultra-rare decays are of great importance because they test the Standard Model in energy ranges not accessible by direct measurements. They are therefore complementary to the measurements at the LHC. ultra high definition on demand (photolab@cern.ch).

  7. OGLAŠEVANJE NA FACEBOOKU

    OpenAIRE

    Renko, Katica

    2013-01-01

    V magistrskem delu smo se seznanili z oglaševanjem na Facebooku. S pregledom gradiva, ki nam je ponujeno, smo preverili pogoje, načine, oblike … oglaševanja, ki pa smo jih s pregledom situacije v praksi preverili in dopolnili. Ob zaključku dela lahko rečemo, da je oglaševanje preko FB enostavnejše, cenejše, dostopnejše, omogoča nam ažurnost in samo komunikacijo z naslovniki, ki so potencialni kupci naših ponudb. Množični mediji nam omogočajo mnogotero obliko oglaševanja. Izbrana oblika ponuja...

  8. Využití routerboardů MikroTik pro výuku síťových kurzů na FIT

    OpenAIRE

    Šebeň, Patrik

    2010-01-01

    Bakalářská práce se zabývá využitím routerboardů MikroTik při výuce síťových kurzů. Bylo v ní vytvořeno několik cvičení zaměřených na směrování, směrovací protokoly, běh a zabezpečení bezdrátových síťí. Dále se zabývá výběrem alternativního operačního systému pro směrovač RB433AH a postupem pro jeho nasazení do zařízení. This bachelor thesis analyzes usage of routerboard Mikrotik for education at network courses. Several exercises were created, oriented at routing, routing protocols, confi...

  9. Standard NIJ 0115.00 za testiranje otpornosti zaštitnih prsluka na ubode nožem i predmetima sa oštrim vrhom / NIJ 0115.00 standard for testing stab resistance of body armor

    Directory of Open Access Journals (Sweden)

    Đuro Jovanić

    2008-04-01

    Full Text Available Standard NIJ 0115.00 (prema Nacionalnom institutu pravde SAD, namenjen je za utvrđivanje minimuma tehničkih zahteva i metoda ispitivanja otpornosti zaštitnih prsluka, koji treba da zaštite gornji deo tela od uboda nožem i predmetima sa oštrim vrhom. Područje primene ovog standarda ograničeno je samo na pretnje ubodima, a ne na balističke pretnje, poput onih koje su obuhvaćene standardom NIJ 0101.04 za testiranje balističke otpornosti zaštitnih prsluka. / In this work made presentation of NIJ 0115.04. (National Institute of Justice standard, witch purpose is to establish minimum performance requirements and methods of testing for the stab resistance of body armor intended to protect the torso against slash and stab threats. The scope of the standard is limited to stab resistance only; the standard does not address ballistic threats, as those are covered by NIJ Standard 0101.04. Ballistic Resistance of Personal Body Armor.

  10. Guatemala: Ozbrojený konflikt 1960-1996 a současná situace: se zvláštním zaměřením na Máje

    OpenAIRE

    Vilímková, Olga

    2009-01-01

    Tématem disertační práce je Guatemala: ozbrojený konflikt v letech 1960 - 1996 a současná situace se zvláštním zaměřením na Máje. Příčiny ozbrojeného konfliktu druhé ploviny XX. století (a mnoha současných problémů) v Guatemale se nacházejí v hluboké minulosti země. Už v době koloniální se začaly formovat ekonomicko - sociální vztahy mezi dvěma antagonistickými vrstvami společnosti: kolonizátory a původním obyvatelstvem, které bylo porobeno, vytlačeno na okraj společnosti a využíváno jako pra...

  11. NA60 frees the quarks

    CERN Multimedia

    2003-01-01

    Fitted with new state-of-the-art silicon detectors, NA60 is prepared to study the phase transition from confined hadronic matter to a deconfined (free) quark-gluon plasma, a state of matter which probably existed an instant after the Big Bang.

  12. Hodler et Iéna

    OpenAIRE

    2017-01-01

    Suites de la protestation contre le bombardement de la cathédrale de Reims. Le recteur de l'Université de Jena propose d'enlever le tableau monumental de Hodler "Départ des étudiants d'Iéna pour la guerre de libération contre Napoléon en 1813".

  13. NA62: Hidden Sector Physics

    CERN Document Server

    Cesarotti, Carissa Joyce

    2016-01-01

    Modern experimental physics is often probing for new physics by either finding deviations from predictions on extremely precise measurements, or by looking for a new signal that cannot be explained with existing models. The NA62 experiment at CERN does the former by measuring the ultra-rare decay $K^+ \\rightarrow \\pi^+ \

  14. The system NaVO3-Na2WO4-Na2W2O7

    International Nuclear Information System (INIS)

    Kazanbekov, V.R.; Gasanaliev, A.M.; Kazanbekov, R.G.

    1994-01-01

    Phase diagrams of sodium metavanadate-sodium ditungstate, sodium metavanadate-sodium tungstate systems and surface of primary crystallization of sodium metavabadate-sodium tungstate-sodium ditungstate system were studied. The system sodium metavanadate-sodium ditungstate is eutectic one. Compound NaVO 3 x2Na 2 WO 4 is formed in solid state in sodium metavanadate-sodium tungstate system. Liquidus surface of sodium metavanadate-sodium tungstate-sodium ditungstate is presented by three crystallization fields of initial components. Composition and melting point of ternary eutectics are determined

  15. Europlanet NA2 Science Networking

    Science.gov (United States)

    Harri, Ari-Matti; Szego, Karoly; Genzer, Maria; Schmidt, Walter; Krupp, Norbert; Lammer, Helmut; Kallio, Esa; Haukka, Harri

    2013-04-01

    Europlanet RI / NA2 Science Networking [1] focused on determining the major goals of current and future European planetary science, relating them to the Research Infrastructure that the Europlanet RI project [2] developed, and placing them in a more global context. NA2 also enhanced the ability of European planetary scientists to participate on the global scene with their own agenda-setting projects and ideas. The Networking Activity NA2 included five working groups, aimed at identifying key science issues and producing reference books on major science themes that will bridge the gap between the results of present and past missions and the scientific preparation of the future ones. Within the Europlanet RI project (2009-2012) the NA2 and NA2-WGs organized thematic workshops, an expert exchange program and training groups to improve the scientific impact of this Infrastructure. The principal tasks addressed by NA2 were: • Science activities in support to the optimal use of data from past and present space missions, involving the broad planetary science community beyond the "space club" • Science activities in support to the preparation of future planetary missions: Earth-based preparatory observations, laboratory studies, R&D on advanced instrumentation and exploration technologies for the future, theory and modeling etc. • Develop scientific activities, joint publications, dedicated meetings, tools and services, education activities, engaging the public and industries • Update science themes and addressing the two main scientific objectives • Prepare and support workshops of the International Space Science Institute (ISSI) in Bern and • Support Trans National Activities (TNAs), Joined Research Activities (JRAs) and the Integrated and Distributed Information Service (IDIS) of the Europlanet project These tasks were achieved by WG workshops organized by the NA2 working groups, by ISSI workshops and by an Expert Exchange Program. There were 17 official WG

  16. El niño, oscilación del sur (ENOS, con relación a la transmisión de malaria, densidad y paridad de An. albimanus y An. darlingi (diptera: culicidae en dos regiones de Colombia

    Directory of Open Access Journals (Sweden)

    Ricardo Mantilla

    2000-02-01

    Full Text Available

    Una fuerte asociación ha sido registrada entre los incrementos en la transmisiónas forzadas por el fenómeno El Niño. Entre las posibles explicaciones para esta asociación está el efecto del clima sobre la dinámica de población de vectores, por ejemplo, generando cambios en la densidad y en las tasas de sobrevivencia de la población, y en la cantidad y calidad de sitios de reproducción, como también a través de cambios en el período de incubación extrínseco del parásito dentro del vector. Con el propósito de evaluar la influencia de ENOS sobre la densidad y paridad de Anopheles albimanus y An. darlingi, y su relación con la transmisión de malaria, se realizó un estudio longitudinal en Chocó y Casanare. En cada área se seleccionaron dos localidades y se realizaron muestreos entomológicos durante una semana cada mes, desde finales de 1997 hasta 1999. Este período cubrió los eventos El Niño 1997 -1998 y La Niña 1998 - 2000. En las localidades de Chocó se observó un importante incremento en el número de casos de malaria durante el evento ENOS, asociado con la temperatura. No se observó una asociación estadísticamente significativa entre los casos de malaria y la precipitación o la humedad relativa. La relación entre el incremento de malaria durante El Niño y las variables entomológicas no fue evidente. La densidad y paridad de ambas especies de vectores fluctuaron durante el período de estudio y no se encontró una asociación significativa entre estas variables y los factores climáticos como la temperatura. La precipitación y la humedad relativa. La densidad de larvas de An. albimanus fluctuó durante el estudio, y mostró altas densidades alrededor de julio - agosto. No se observó asociación entre la densidad de larvas con la densidad de adultos o las variables climáticas. El efecto del evento ENOS sobre las poblaciones de vectores

  17. Na+-stimulated ATPase of alkaliphilic halotolerant cyanobacterium Aphanothece halophytica translocates Na+ into proteoliposomes via Na+ uniport mechanism

    Directory of Open Access Journals (Sweden)

    Soontharapirakkul Kanteera

    2010-08-01

    Full Text Available Abstract Background When cells are exposed to high salinity conditions, they develop a mechanism to extrude excess Na+ from cells to maintain the cytoplasmic Na+ concentration. Until now, the ATPase involved in Na+ transport in cyanobacteria has not been characterized. Here, the characterization of ATPase and its role in Na+ transport of alkaliphilic halotolerant Aphanothece halophytica were investigated to understand the survival mechanism of A. halophytica under high salinity conditions. Results The purified enzyme catalyzed the hydrolysis of ATP in the presence of Na+ but not K+, Li+ and Ca2+. The apparent Km values for Na+ and ATP were 2.0 and 1.2 mM, respectively. The enzyme is likely the F1F0-ATPase based on the usual subunit pattern and the protection against N,N'-dicyclohexylcarbodiimide inhibition of ATPase activity by Na+ in a pH-dependent manner. Proteoliposomes reconstituted with the purified enzyme could take up Na+ upon the addition of ATP. The apparent Km values for this uptake were 3.3 and 0.5 mM for Na+ and ATP, respectively. The mechanism of Na+ transport mediated by Na+-stimulated ATPase in A. halophytica was revealed. Using acridine orange as a probe, alkalization of the lumen of proteoliposomes reconstituted with Na+-stimulated ATPase was observed upon the addition of ATP with Na+ but not with K+, Li+ and Ca2+. The Na+- and ATP-dependent alkalization of the proteoliposome lumen was stimulated by carbonyl cyanide m - chlorophenylhydrazone (CCCP but was inhibited by a permeant anion nitrate. The proteoliposomes showed both ATPase activity and ATP-dependent Na+ uptake activity. The uptake of Na+ was enhanced by CCCP and nitrate. On the other hand, both CCCP and nitrate were shown to dissipate the preformed electric potential generated by Na+-stimulated ATPase of the proteoliposomes. Conclusion The data demonstrate that Na+-stimulated ATPase from A. halophytica, a likely member of F-type ATPase, functions as an electrogenic Na

  18. Photodesorption of Na atoms from rough Na surfaces

    DEFF Research Database (Denmark)

    Balzer, Frank; Gerlach, R.; Manson, J.R.

    1997-01-01

    We investigate the desorption of Na atoms from large Na clusters deposited on dielectric surfaces. High-resolution translational energy distributions of the desorbing atoms are determined by three independent methods, two-photon laser-induced fluorescence, as well as single-photon and resonance......-enhanced two-photon ionization techniques. Upon variation of surface temperature and for different substrates (mica vs lithium fluoride) clear non-Maxwellian time-of-flight distributions are observed with a cos θ angular dependence and most probable kinetic energies below that expected of atoms desorbing from...... atoms are scattered by surface vibrations. Recent experiments providing time constants for the decay of the optical excitations in the clusters support this model. The excellent agreement between experiment and theory indicates the importance of both absorption of the laser photons via direct excitation...

  19. Photodesorption of Na atoms from rough Na surfaces

    DEFF Research Database (Denmark)

    Balzer, Frank; Gerlach, R.; Manson, J.R.

    1997-01-01

    atoms are scattered by surface vibrations. Recent experiments providing time constants for the decay of the optical excitations in the clusters support this model. The excellent agreement between experiment and theory indicates the importance of both absorption of the laser photons via direct excitation......We investigate the desorption of Na atoms from large Na clusters deposited on dielectric surfaces. High-resolution translational energy distributions of the desorbing atoms are determined by three independent methods, two-photon laser-induced fluorescence, as well as single-photon and resonance......-enhanced two-photon ionization techniques. Upon variation of surface temperature and for different substrates (mica vs lithium fluoride) clear non-Maxwellian time-of-flight distributions are observed with a cos θ angular dependence and most probable kinetic energies below that expected of atoms desorbing from...

  20. Obiteljska i bračna psihoterapija

    OpenAIRE

    Štalekar, Vlasta

    2010-01-01

    U radu je ukratko prikazana povijest obiteljske terapije na temelju koje se prati razvoj novih koncepata i terapijskih modela. Prikazana je podjela obiteljskih i bračnih terapija na brojne pravce, a navedene u ovom radu su sistemska, dinamska, strukturalna, strateška, transgeneracijska, iskustvena (prvenstveno je didaktičkog karaktera jer se u praksi ovi modeli uvelike preklapaju i nadopunjuju). Svaki terapijski model na jedinstven način tumači disfunkcije obiteljskog sustava t...

  1. Novel aspects of Na+,K+-ATPase

    OpenAIRE

    Aizman, Oleg

    2002-01-01

    Na,K-ATPase, an integral membrane protein expressed in each eukaryotic cell, serves as the major determinant of intracellular ion composition. In the current study we investigated novel aspects of Na,K-ATPase function and regulation. It is well established that Na,K-ATPase activity is regulated by reversible phosphorylation. New findings in this study are: 1) the level of intracellular Ca 2. concentration determines the functional effects of PKA and PKC-mediated Na,K-ATP...

  2. Carne suína

    OpenAIRE

    Ortigara, Claudino

    2000-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro Tecnológico. A carne suína é a fonte de proteína animal mais consumida no mundo. No entanto, em muitos países e em especial no Brasil o consumo per capita é muito baixo. Como conseqüência disso, limita-se o crescimento do segmento produtivo e uma série de benefícios socioeconômicos que são gerados pela atividade suinocultura.Com esse trabalho, buscamos uma explicação para entender a resistência da população ao consum...

  3. Economia na consulta de Endodontia

    OpenAIRE

    Pinto, Diogo Filipe Cardoso

    2016-01-01

    Introdução: Em Portugal a realidade actual, clínica e financeira do exercício da Medicina Dentária é bem distinta da do final do séc. XX devido à pletora de Médicos Dentistas e à baixa de honorários por acto Médico registada nos últimos anos. Objectivos: Este trabalho teve como objectivo perceber um pouco sobre os detalhes a ter em consideração aquando da abertura de uma clínica centrada na realização de tratamentos na área da Endodontia, e como publicitá-la de forma legal e apelativa. Pre...

  4. A Umbanda Portuguesa na Internet

    Directory of Open Access Journals (Sweden)

    Ismael Pordeus Júnior

    2004-01-01

    Full Text Available A partir de considerações sobre o processo de transculturação da Umbanda de Omolocô vou a propósito do grupo religioso do Terreiro de Umbanda Ogum Megê em Lisboa - Portugal discutir a textualização da memória. Como outras religiões que visam hoje o universal a Umbanda utiliza novas tecnologias disponíveis na Internet. Esse novo meio de comunicação favorece o processo de transculturação religiosa. Utilizando uma abordagem antropológica procuro realizar um estudo dos sites da Umbanda portuguesa na Internet, propondo uma visão ampla da utilização de novas tecnologias utilizadas para difusão da religião. Opto pelo estudo de caso, pois penso que permite uma melhor abordagem desse campo tecnológico.

  5. Otto Richard Gottlieb na UFRRJ

    OpenAIRE

    Raimundo Braz Filho; Universidade Estadual do Norte Fluminense Darcy Ribeiro; Mário Geraldo de Carvalho; Universidade Federal Rural do Rio de Janeiro

    2011-01-01

    Informações importantes da trajetória científica e produtiva do Prof. Otto Richard Gottlieb e sobre seu legado são revelados por dois de seus ex-alunos. Revelam sua perseverança na criação de grupos comprometidos com pesquisas em produtos naturais no Brasil. Inicialmente na Universidade de Brasília (UnB) e, em consequência de pressões políticas da década de sessenta, seu grupo deslocou-se para outras instituições recebendo apoio da Universidade Federal de Minas Gerais (UFMG), do Centro de Pes...

  6. Makosa Yanayofanywa na Wanafunzi Wanaojifunza Kiswahili kama ...

    African Journals Online (AJOL)

    Makala haya, yanashughulika na makosa ambayo hufanywa na wanafunzi wanaojifunza Kiswahili kama lugha ya pili katika shule za sekondari nchini Uganda. Mtafiti ameyaainisha makosa mbalimbali na kuyaeleza kiusahihi. Makala yanaeleza namna ambavyo makosa hayo hutokea. Yaani, kama ni makosa ...

  7. NA50 quark-gluon plasma experiment

    CERN Multimedia

    1997-01-01

    View of the NA50 detector, which studies quark-gluon plasma. The picture shows one of the six hodoscopes, made of 48 scintillator counters, used in the muon trigger of the NA50 spectrometer. The picture shows one of the six hodoscopes, made of 48 scintillator counters, used in the muon trigger of the NA50 spectrometer

  8. Štetni faktori u radnim i kontrolnim prostorijama pogona na ratnim brodovima / Harmful factors in engine-rooms and machinery control-rooms on warships

    Directory of Open Access Journals (Sweden)

    Živomir Radojković

    2002-03-01

    Full Text Available Na devet ratnih brodova (sedam borbenih i dva pomoćna RM VJ ispitivani su štetni faktori u motorskim i turbinskim prostorima kao i kontrolnim kabinama motorskog prostora. Utvrđeno je da zaposleni u navedenim prostorima rade u uslovima nedovoljne osvetljenosti, da su izloženi visokoj temperaturi, bud vibracijama, a potencijalno i izduvnim gasovima. Izmereni nivoi buke u motorskim i turbinskim prostorima iznosili su 104-124 dB(A, i bili su znatno iznad dopuštenog nivoa od 85 dB(A, dok je u kontrolnim kabinama većine brodova buka bila ispod nivoa od 80 dB(A. U kontrolnim kabinama dva ratna broda buka je bila iznad dozvoljenog nivoa i iznosila je 83 dB(A i 95 dB(A. Buka kojoj su izloženi zaposleni u motorskim i turbinskim prostorima može da dovede do oštećenja čula sluha, ukoliko se ne koriste predviđena zaštitna sredstva. / Harmful factors in engine and machinery control rooms on 9 warships (7 combat and 2 auxiliary ships were examined. The results show that crews on thee sea ships work in conditions of insufficient luminance, elevated air temperature noise, vibration, and possibly are exposed to exhaust gases. The entire noise levels in engine and turbine rooms were between 104 dB(A and 124 dB(A, and they were significantly above the permissible levels of 85 dB(A and 80 dB(A. On two ships, in machinery control-rooms, the entire noise was above the permissible level (83 dB(A and 95 dB(A. These mentioned noise levels could lead to hearing damage if the self protecting devices for hearing protection are not used.

  9. Critical contribution of Na+-Ca2+ exchanger to the Ca2+-mediated vasodilation activated in endothelial cells of resistance arteries.

    Science.gov (United States)

    Lillo, Mauricio A; Gaete, Pablo S; Puebla, Mariela; Ardiles, Nicolás M; Poblete, Inés; Becerra, Alvaro; Simon, Felipe; Figueroa, Xavier F

    2018-04-01

    Na + -Ca 2+ exchanger (NCX) contributes to control the intracellular free Ca 2+ concentration ([Ca 2+ ] i ), but the functional activation of NCX reverse mode (NCXrm) in endothelial cells is controversial. We evaluated the participation of NCXrm-mediated Ca 2+ uptake in the endothelium-dependent vasodilation of rat isolated mesenteric arterial beds. In phenylephrine-contracted mesenteries, the acetylcholine (ACh)-induced vasodilation was abolished by treatment with the NCXrm blockers SEA0400, KB-R7943, or SN-6. Consistent with that, the ACh-induced hyperpolarization observed in primary cultures of mesenteric endothelial cells and in smooth muscle of isolated mesenteric resistance arteries was attenuated by KB-R7943 and SEA0400, respectively. In addition, both blockers abolished the NO production activated by ACh in intact mesenteric arteries. In contrast, the inhibition of NCXrm did not affect the vasodilator responses induced by the Ca 2+ ionophore, ionomycin, and the NO donor, S-nitroso- N-acetylpenicillamine. Furthermore, SEA0400, KB-R7943, and a small interference RNA directed against NCX1 blunted the increase in [Ca 2+ ] i induced by ACh or ATP in cultured endothelial cells. The analysis by proximity ligation assay showed that the NO-synthesizing enzyme, eNOS, and NCX1 were associated in endothelial cell caveolae of intact mesenteric resistance arteries. These results indicate that the activation of NCXrm has a central role in Ca 2+ -mediated vasodilation initiated by ACh in endothelial cells of resistance arteries.-Lillo, M. A., Gaete, P. S., Puebla, M., Ardiles, N. M., Poblete, I., Becerra, A., Simon, F., Figueroa, X. F. Critical contribution of Na + -Ca 2+ exchanger to the Ca 2+ -mediated vasodilation activated in endothelial cells of resistance arteries.

  10. Pseudo-ternary phase diagram in the Na2O-Na2O2-NaOH system

    International Nuclear Information System (INIS)

    Saito, Jun-ichi; Tendo, Masayuki; Aoto, Kazumi

    1997-10-01

    Generally, the phase diagrams are always used to understand the present state of compounds at certain temperature. In order to understand the corrosion behavior of structural material for FBR by main sodium compounds (Na 2 O, Na 2 O 2 and NaOH), it is very important to comprehend the phase diagrams of their compounds. However, only Na 2 O-NaOH pseudo-binary phase diagram had been investigated previously in this system. There is no study of other pseudo-binary or ternary phase diagrams in the Na 2 O-Na 2 O 2 -NaOH system. In this study, in order to clarify the present states of their compounds at certain temperatures, the pseudo-binary and ternary phase diagrams in the Na 2 O-Na 2 O 2 -NaOH system were prepared. A series of thermal analyses with binary and ternary component system has been carried out using the differential scanning calorimetry (DSC). The liquidus temperature and ternary eutectic temperatures were confirmed by these measurements. The beneficial indications for constructing phase diagrams were obtained from these experiments. On the basis of these results, the interaction parameters between compounds which were utilized for the Thermo-Calc calculation were optimized. Thermo-Calc is one of thermodynamic calculation software. Consequently the accurate pseudo-binary and ternary phase diagrams were indicated using the optimized parameters. (author)

  11. Homocisteína Homocysteine

    Directory of Open Access Journals (Sweden)

    Lindalva Batista Neves

    2004-10-01

    Full Text Available A homocisteína, formada a partir da metionina hepática, é metabolizada nas vias de desmetilação e de transulfuração, sendo que seus valores plasmáticos e urinários refletem a síntese celular. Sua determinação, realizada em jejum e após sobrecarga de metionina, caracteriza as diferenças dessas vias metabólicas, principalmente quando de natureza genética. A hiper-homocisteinemia tem sido associada a maior risco de eventos aterotrombóticos, e a literatura sugere associação causal, independente de outros fatores de risco para doença arterial. Diminuição da homocisteína plasmática para valores normais é seguida de redução significante na incidência de doença aterotrombótica. A relação entre homocisteína e o fígado vem adquirindo importância nos dias atuais, uma vez que alterações das lipoproteínas e da depuração de metionina são comuns em pacientes com doença hepática crônica (hepatocelular e canalicular. O tratamento da hiper-homocisteinemia fundamenta-se na suplementação alimentar e medicamentosa de ácido fólico e vitaminas B6 e B12.Homocysteine, formed from hepatic methionine, is metabolized through the pathways of demethylation and transsulfuration. Its plasmatic and urinary values reflect the cell synthesis. Its determination after fasting and increased infusion of methionine shows the differences of these two metabolic pathways, mainly when it is related to genetic diseases. Hyperhomocysteinemia has been associated with a higher risk of vascular thrombotic events. Several authors suggest a causal relationship between these events independently of other risk factors for vascular diseases. Decrease in plasmatic homocysteine to normal levels is followed by a significant reduction on the incidence of vascular thrombotic events. The correlation between the liver and homocysteine is becoming more important because of the recent findings that alterations of lipoproteins and methionine clearance are

  12. Composición y abundancia de artrópodos epígeos del Parque Nacional Llanos de Challe: impactos del ENOS de 1997 y efectos del hábitat pedológico Abundance and composition of epigean arthropods from Llanos de Challe National Park: impacts of ENSO-1997 and effects of the pedological habitat

    Directory of Open Access Journals (Sweden)

    JORGE CEPEDA-PIZARRO

    2005-12-01

    Full Text Available Mediante el uso de trampas de intercepción, se estudió el efecto de la precipitación y el tipo de hábitat sobre la denso-actividad del ensamble de artrópodos epígeos _en particular Tenebrionidae_ del Parque Nacional Llanos de Challe. Este parque está ubicado en el desierto costero transicional de Chile, en la III Región de Atacama. Los muestreos se realizaron durante tres días por mes (septiembre, octubre y diciembre en el período de máxima actividad biológica del sistema y en los años 1989 (año no-ENOS seco, 1997 (año ENOS intenso y 2000 (año no-ENOS húmedo. En las comparaciones se utilizaron dos sitios pedológicamente contrastantes: un hábitat dunario costero y un hábitat pedregoso interior. Se registró la presencia de 15 órdenes de Arthropoda. Los hexápodos constituyeron > 95 % del total de los especímenes capturados (9.065 individuos, siendo Collembola (36,1 % y Coleoptera (29,8 % los órdenes con mayor representatividad numérica. El número de órdenes con representantes activos varió ligeramente entre años: 13 órdenes se registraron en 1989 (44 % de precipitación bajo el promedio, 15 en 1997 (443 % sobre el promedio y 11 en 2000 (52 % sobre el promedio. El efecto del evento ENOS se reflejó claramente en la contribución numérica en la mayoría de los taxa registrados. Aunque más sutilmente, este efecto también se reflejó en la composición del ensamble de taxa dominantes y entre hábitat pedológicos, particularmente con Tenebrionidae y Formicidae. Especialmente en las dunas costeras, Tenebrionidae dominó claramente el ensamble de artrópodos epígeos, siendo Gyriosomus Guérin-Méneville el género más diverso y abundante. La dominancia de Gyriosomus plantea un conjunto de interrogantes respecto de su nivel de endemismo, diversidad y distribución de sus especies, y el papel funcional de estas en el ecosistema estudiadoBy using pitfall traps, the effects of rainfall and habitat type on the denso

  13. High-performance liquid chromatography/mass spectrometric identification of dibenzylbutyrolactone-type lignans: insights into electrospray ionization tandem mass spectrometric fragmentation of lign-7-eno-9,9'-lactones and application to the lignans of Linum usitatissimum L. (Common Flax).

    Science.gov (United States)

    Schmidt, Thomas J; Alfermann, A Wilhelm; Fuss, Elisabeth

    2008-11-01

    In continuation of our studies into the mass spectrometric detection of natural lignans and their identification in complex mixtures such as crude plant extracts, the electrospray ionization tandem mass spectrometric (ESI-MS/MS) fragmentation of Delta(7,8)-unsaturated dibenzylbutyrolactone-type lignans (lign-7-eno-9,9'-lactones) was studied in detail. It is demonstrated that the characteristic fragmentation allows unambiguous identification including distinction between constitutional isomers. These lignans containing an alpha,beta-unsaturated lactone structure exist as equilibrium mixtures of E- and Z-isomers indistinguishable by mass spectrometry, but it is shown that chromatographic retention time can be used to distinguish between the isomeric forms. Based on these observations, re-analysis of the dichloromethane extract obtained from flowering aerial parts of Linum usitatissimum L. by high-performance liquid chromatography (HPLC)/ESI-MS/MS led to the identification of eighteen lignans of these types (five lignano- and one lignenolactone previously reported along with five further lignano- as well as seven lignenolactones hitherto unreported for this plant). The simultaneous identification of eighteen different lignans in the complex matrix of a crude plant extract by a single analysis demonstrates the potential of this method, which will certainly lead to new insights into the lignan composition and metabolism of different Linum species and many other plants.

  14. Myocardial Na,K-ATPase: Clinical aspects

    OpenAIRE

    Kjeldsen, Keld

    2003-01-01

    The specific binding of digitalis glycosides to Na,K-ATPase is used as a tool for Na,K-ATPase quantification with high accuracy and precision. In myocardial biopsies from patients with heart failure, total Na,K-ATPase concentration is decreased by around 40%; a correlation exists between a decrease in heart function and a decrease in Na,K-ATPase concentration. During digitalization, around 30% of remaining pumps are occupied by digoxin. Myocardial Na,K-ATPase is also influenced by other drugs...

  15. Istraživanje uticaja nekih parametara na osetljivost eksplozivnih materija na toplotni impuls

    OpenAIRE

    Jeremić Radun

    2002-01-01

    Ispitivana je osetljivost nekoliko vrsta eksplozivnih materija na toplotni impuls merenjem vremena zadrške u zavisnosti od temperature. Na osnovu eksperimentalnih rezultata određene su vrednosti energije aktivacije i predeksponencijalni faktori u jednačini Semjonova. Istraživan je i uticaj mase ispitivanog uzorka, granulacije i veličine kristala eksploziva na osetljivost na toplotni impuls. Pokazano je da ovi parametri imaju značajan uticaj na osetljivost eksplozivnih materija, pa je neophodn...

  16. Silicene for Na-ion battery applications

    KAUST Repository

    Zhu, Jiajie

    2016-08-19

    Na-ion batteries are promising candidates to replace Li-ion batteries in large scale applications because of the advantages in natural abundance and cost of Na. Silicene has potential as the anode in Li-ion batteries but so far has not received attention with respect to Na-ion batteries. In this context, freestanding silicene, a graphene-silicene-graphene heterostructure, and a graphene-silicene superlattice are investigated for possible application in Na-ion batteries, using first-principles calculations. The calculated Na capacities of 954mAh/g for freestanding silicene and 730mAh/g for the graphenesilicene superlattice (10% biaxial tensile strain) are highly competitive and potentials of >0.3 V against the Na/Na potential exceed the corresponding value of graphite. In addition, the diffusion barriers are predicted to be <0.3 eV.

  17. Hali ya taaluma ya ukalimani Tanzania: jana, leo na kesho ...

    African Journals Online (AJOL)

    Umuhimu wa ukalimani katika mawasiliano umeongezeka kutokana na utandawazi. Utandawazi umerahisisha kukutanika na kuwasiliana kwa watu wazungumzao lugha tofauti kupitia wakalimani. Kutokana na ongezeko hilo la umuhimu wa ukalimani, kumekuwa na jitihada mbalimbali katika nchi mbalimbali kuhakikisha ...

  18. Docência na universidade: professores inovadores na USP

    Directory of Open Access Journals (Sweden)

    Chamlian Helena Coharik

    2003-01-01

    Full Text Available O artigo trata de pesquisa realizada com um grupo de professores inovadores da Universidade de São Paulo tendo como objetivo procurar subsídios para a formação do professor universitário. Esses docentes foram entrevistados, solicitando que detalhassem melhor suas experiências inovadoras; explicassem as razões pelas quais haviam introduzido modificações em sua forma de trabalho; explicitassem as relações entre sua atividade de docência e de pesquisa, expressassem o papel que atribuíam ao ensino na universidade, bem como a forma pela qual sua trajetória acadêmica havia se cumprido até então. A diversidade de experiências relatadas e, ao mesmo tempo, a convergência de visões a respeito de suas funções de ensino e de pesquisa na universidade permitem-nos afirmar que, mais do que uma formação pedagógica específica, a sensibilização para as dificuldades do ensino e a valorização institucional dessa atividade consistiriam em grande avanço para a formação do professor.

  19. Na alvorada de um sport

    OpenAIRE

    Sartori, Carina

    2013-01-01

    Dissertação (mestrado) - Universidade Federal de Santa Catarina, Centro de Filosofia e Ciências Humanas, Programa de Pós-graduação em História, Florianópolis, 2013 Em Florianópolis, a primeira Sociedade de Regatas organizada, meados do século XIX, contaria com a participação dos Coronéis da Marinha e da Escola de Menores e Marinheiros da Canhoneira. Na virada do século, a fundação do Clube 29 de Abril permitiria que as atividades relacionadas ao Remo fossem oferecidas a todos que se associ...

  20. A Umbanda Portuguesa na Internet

    OpenAIRE

    Ismael Pordeus Júnior

    2004-01-01

    A partir de considerações sobre o processo de transculturação da Umbanda de Omolocô vou a propósito do grupo religioso do Terreiro de Umbanda Ogum Megê em Lisboa - Portugal discutir a textualização da memória. Como outras religiões que visam hoje o universal a Umbanda utiliza novas tecnologias disponíveis na Internet. Esse novo meio de comunicação favorece o processo de transculturação religiosa. Utilizando uma abordagem antropológica procuro realizar um estudo dos sites da Umbanda portuguesa...

  1. Relationship between intracellular Na+ concentration and reduced Na+ affinity in Na+,K+-ATPase mutants causing neurological disease

    DEFF Research Database (Denmark)

    Toustrup-Jensen, Mads Schak; Einholm, Anja P.; Schack, Vivien

    2014-01-01

    The neurological disorders familial hemiplegic migraine type 2 (FHM2), alternating hemiplegia of childhood (AHC), and rapid-onset dystonia parkinsonism (RDP) are caused by mutations of Na+,K+-ATPase α2- and α3-isoforms, expressed in glial and neuronal cells, respectively. Although these disorders......, addressing the question to what extent they cause a change of the intracellular Na+ and K+ concentrations ([Na+]i and [K+]i) in COS cells. C-terminal extension mutants generally showed dramatically reduced Na+ affinity without disturbance of K+ binding, as did other RDP mutants. No phosphorylation from ATP...... was observed for the +28 mutation of α2, despite a high expression level. A significant rise of [Na+]i and reduction of [K+]i was detected in cells expressing mutants with reduced Na+ affinity, and did not require a concomitant reduction of the maximal catalytic turnover rate or expression level. Moreover, two...

  2. O ATLETISMO NA PERSPECTIVA EDUCACIONAL

    Directory of Open Access Journals (Sweden)

    Leandro Araujo de Sousa

    2017-06-01

    Full Text Available A educação física escolar deve proporcionar experiências aos alunos para o seu desenvolvimento integral. As aulas muitas vezes são reduzidas ao ensino de esportes tradicionais, o que limita o repertório de movimentos dos alunos. Dessa forma o presente estudo de revisão objetiva problematizar o atletismo no ambiente escolar e propor possibilidades pedagógicas para seu ensino. Nesta pesquisa propomos tratar o ensino do atletismo na escola, caracterizando-o pelo seu repertório de movimentos que são naturais ao ser humano, como correr, saltar e lançar, o que possibilita maior praticidade em sua aplicação pedagógica, porém essas possibilidades não são consideradas no ambiente educacional. Diante dos dados encontrados, sugerimos que esse esporte seja abordado de forma multidimensional no ambiente escolar contextualizando-o à visão de algumas correntes teóricas. Nessa perspectiva do esporte educacional, o atletismo pode, assim como deve ser trabalhado nas aulas de educação física como instrumento pedagógico de ensino e auxiliar na formação do aluno de forma global.

  3. Identidades Homossexuais na Territorialidade Tradicionalista

    Directory of Open Access Journals (Sweden)

    Edipo Djavan dos Reis Göergen

    2015-12-01

    Full Text Available Este artigo apresenta o debate teórico que sustenta a pesquisa de mestrado desenvolvida pelo autor. Tendo por base suas vivências em contextos de tradicionalismo gaúcho, o autor deste trabalho tem percebido a grande quantidade de homossexuais, ou indivíduos que se auto-denominam não-heterossexuais, integrando as atividades artísticas do Movimento Tradicionalista Gaúcho, ou a territorialidade tradicionalista. Interessado em investigar tal fenômeno, o autor tem desenvolvido o projeto de pesquisa “Os Espaços Paradoxais de Relações Homoeróticas na Territorialidade Tradicionalista”, sob orientação do prof. Dr. Benhur Pinós da Costa, no Programa de Pós-Graduação em Geografia (UFSM. Para que essa pesquisa seja realizada, levam-se em conta as relações de gênero e de sexualidade que estão envolvidas no tema. Dessa forma, por ainda se tratarem de temáticas tidas como insignificantes na sociedade em geral e marginalizadas no campo científico, para que o presente trabalho fosse empreendido, buscou-se amparo teórico nas geografias feministas e queer, segmentos contemporâneos da ciência geográfica.

  4. Micotoxinas e Micotoxicoses na Avicultura

    Directory of Open Access Journals (Sweden)

    Santurio JM

    2000-01-01

    Full Text Available Esta revisão tem como objetivo principal mostrar, baseado em dezenas de pesquisas realizadas, os efeitos tóxicos das micotoxinas aflatoxinas, tricotecenos, zealenona e fumonisinas sobre o desempenho das aves. O descobrimento das propriedades hepatotóxicas e hepatocarcinogênicas de algumas linhagens de Aspergillus flavus e A. parasiticus em perus, na Inglaterra, no início da década de 1960, seguida pela elucidação da estrutura de seus metabólitos tóxicos, as aflatoxinas, deu novo enfoque e prioridade para a pesquisa sobre micotoxinas. Análises de aflatoxinas realizadas no Laboratório de Análises Micotoxicológicas (LAMIC da Universidade Fedaral de Santa Maria, entre os anos de 1986 e janeiro de 2000, em 15.600 amostras de alimentos destinados principalmente ao consumo animal, demonstram que no milho analisado, 41,9% das amostras estavam contaminadas por aflatoxinas. Em surtos de aflatoxicose no campo, uma das características mais marcantes é a má absorção que se manifesta como partículas de ração mal digeridas na excreta das aves. Também observa-se, em frangos e poedeiras que recebem AFL, extrema palidez das mucosas e pernas. Dietas deficientes em riboflavina ou colecalciferol (vit. D tornaram frangos sensíveis, nos índices de desenvolvimento corporal, a concentrações muito baixas de AFL. O efeito aflatoxina nos frangos é maior na fase inicial de crescimento, ou seja, quando as aves ingeriram aflatoxina nos primeiros 21 dias de vida, e quanto maior o nível de stress do lote, menor a quantidade de AFL para afetar negativamente seu desempenho, seja na produção de carne ou de ovos. As principais micotoxinas do grupo dos tricotecenos são: toxina T-2; deoxynivalenol (DON; diacetoxyscirpenol (DAS, todas produzidas através de diversas espécies de fungos do gênero Fusarium. Além dos tricotecenos, o fusarium também pode produzir zearalenona e fumonisinas. Dessas fusarium-toxinas, somente toxina T-2 gera patologias s

  5. Ocorrência de períodos secos na região de Rio Largo, Alagoas

    Directory of Open Access Journals (Sweden)

    André Luiz de Carvalho

    2013-06-01

    Full Text Available A disponibilidade de água de uma região está diretamente relacionada a frequência e a magnitude dos eventos de chuva. Maiores ocorrências de dias caracterizados como seco podem gerar diversos prejuízos, principalmente, para a agricultura. Assim, o objetivo deste trabalho foi determinar a probabilidade das ocorrências de períodos secos em Rio Largo, Alagoas, e relacioná-la a fenômenos de escala climática, tais como, El Niño Oscilação Sul (El Niño e La Niña. Os períodos secos foram avaliados em três diferentes intervalos de tempo com sequência de dias secos (> 5 dias, > 7 dias e > 10 dias. O dia foi definido seco com base em diferentes limites de precipitação (< 0, 1, 2, 3, 4 e 5 mm. O fim de cada período seco foi determinado pela ocorrência de um dia chuvoso. As análises foram realizadas com a utilização do aplicativo Instat Climatic. O intervalo de 5 dias mostrou maior ocorrência na estação seca e chuvosa. Na estação chuvosa (abril a agosto, esse período seco apresentou probabilidade elevada de ocorrência (5 a 85%. Enquanto, a ocorrência de períodos secos de 7 dias (0 a 45% e 10 dias (0 a 5% foi inferior. Notou-se forte influência de eventos de ENOS (El Niño Oscilação Sul nas ocorrências dos períodos secos da região. Em anos de El Niño, as ocorrências de períodos secos foram intensificadas (10 a 60%, e reduzidas em anos de eventos de La Niña atingindo (0 a 45%.

  6. Fotografia na Imprensa: conflitos na câmara escura

    Directory of Open Access Journals (Sweden)

    José Lúcio da Silva Menezes

    2014-07-01

    Full Text Available Este artigo recupera o teor ideológico do discurso que a Revista Veja elaborou sobre a classe trabalhadora que emergiu no cenário brasileiro, no final da década de 1970. O destaque dado aos trabalhadores como temática central resgatada, deve-se aos movimentos grevistas por eles encetados, após anos de ocultamento de sua resistência sob a repressão da ditadura civil-militar (1964-1985. Com a rebeldia operária, as matérias a respeito deste grupo, na Revista,foram se tornando mais constantes e visíveis, pois já não era mais possível, para a Revista Veja, ignorar a existência da classe operária que, com a força insurgente das greves, ocupava as ruas do Brasil.

  7. Vpliv toplotnih mostov na porabo energije za ogrevanje na primeru osnovne šole

    OpenAIRE

    Megušar, Primož

    2015-01-01

    Na primeru Osnovne šole Dobrova sem preveril, kakšen vpliv imajo dejanski toplotni mostovi na porabo energije za ogrevanje. Iz načrtov stavbe sem evidentiral vse toplotne mostove, kateri vplivajo na porabo energije. Tem toplotnim mostovom sem nato v standardu SIST EN ISO 14683 poiskal ustrezne približke. Nato sem s programom TOST izvedel tri simulacije. V prvem primeru toplotnih mostov nisem upošteval. V drugem primeru sem toplotne mostove upošteval na poenostavljen način, v zadnjem primeru p...

  8. Na and K dependence of the Na/K pump in cystic fibrosis fibroblasts.

    OpenAIRE

    Reznik, V M; Schneider, J A; Mendoza, S A

    1981-01-01

    The Na and K dependence of the Na/K pump was measured in skin fibroblasts from patients with cystic fibrosis and age/sex-matched controls. Under basal conditions, there was no difference between control and cystic fibrosis cells in protein per cell, intracellular Na and K content, or Na/K pump activity (measured as ouabain-sensitive 86Rb uptake). There was no difference in the Na dependence of the Na/K pump between cystic fibrosis cells and control cells. In cells from patients with cystic fi...

  9. Modification of single Na+ channels by batrachotoxin.

    Science.gov (United States)

    Quandt, F N; Narahashi, T

    1982-11-01

    The modifications in the properties of voltage-gated Na+ channels caused by batrachotoxin were studied by using the patch clamp method for measuring single channel currents from excised membranes of N1E-115 neuroblastoma cells. The toxin-modified open state of the Na+ channel has a decreased conductance in comparison to that of normal Na+ channels. The lifetime of the modified open state is drastically prolonged, and channels now continue to open during a maintained depolarization so that the probability of a channel being open becomes constant. Modified and normal open states of Na+ channels coexist in batrachotoxin-exposed membrane patches. Unlike the normal condition, Na+ channels exposed to batrachotoxin open spontaneously at large negative potentials. These spontaneous openings apparently cause the toxin-induced increase in Na+ permeability which, in turn, causes membrane depolarization.

  10. Low-spin states of 23Na

    International Nuclear Information System (INIS)

    Bakkum, E.L.

    1987-01-01

    A study of 23 Na via the 22 Ne(p,γ) 23 Na and 23 Na(γ,γ) 23 Na reactions is presented. Only a limited number of resonances has been studied, selected on the basis of strong excitation of the lowest levels of which the spin was unknown. As a result the spins are now known of all levels of 23 Na with excitation energies up to 7 MeV, except for a few high-spin states which are too weakly excited in the decay of the known 22 Ne(p,γ) resonances. The mean lifetimes of the 23 Na levels at 4.43 and 7.89 MeV were found to be 350±70 and 220±17 attoseconds (1 attosecond = 10 -18 seconds) respectively. 97 refs.; 22 figs.; 12 tabs

  11. Modification of single Na+ channels by batrachotoxin.

    OpenAIRE

    Quandt, F N; Narahashi, T

    1982-01-01

    The modifications in the properties of voltage-gated Na+ channels caused by batrachotoxin were studied by using the patch clamp method for measuring single channel currents from excised membranes of N1E-115 neuroblastoma cells. The toxin-modified open state of the Na+ channel has a decreased conductance in comparison to that of normal Na+ channels. The lifetime of the modified open state is drastically prolonged, and channels now continue to open during a maintained depolarization so that the...

  12. PRIMERJAVA GEODETSKIH METOD NA ZAHTEVNEM GRADBENEM OBJEKTU

    OpenAIRE

    Reberčnik, Matic

    2017-01-01

    V projektni nalogi smo v uvodnih poglavjih predstavili različne načine izvajanja geodetskih meritev, ki jih v gradbeništvu uporabljamo pri analizi pomikov in deformacij gradbenih konstrukcij ter terena, na katerem so le-te postavljene. V nadaljevanju opisujemo terestične in GNSS (globalni navigacijski satelitski sistem) metode, ki smo jih uporabljali pri izvajanju meritev na izbranem premostitvenem objektu avtocestnega odseka v Sloveniji (zaradi varovanja podatkov ga imenujemo Objekt 1). Pod...

  13. Ionic dependence of active Na-K transport: clamping of cellular Na+ with monensin

    International Nuclear Information System (INIS)

    Haber, R.S.; Pressley, T.A.; Loeb, J.N.; Ismail-Beigi, F.

    1987-01-01

    The Na + ionophore monensin was used to study the Na + - and K + -dependence of ouabain-inhibitable 86 Rb + uptake in ARL 15 cells, a rat liver cell line. Graded concentrations of monensin rapidly induced incremental elevations of cellular Na + that were stable for up to 2 h. In experiments in which cellular Na + was thus clamped at various levels, the activation curve for ouabain-inhibitable 86 Rb + uptake as a function of intracellular Na + was found to be steepest near basal Na + levels (Hill coefficient /congruent/ 2.4), indicating that these cells can respond to relatively large changes in passive Na + entry by increasing the rate of Na-K pump function with only minimal increases in cellular Na + . Exposure of cells to monensin also permitted examination of the extracellular-K + dependence of ouabain inhibitable 86 Rb + uptake in presence of saturating intracellular Na + and yielded a Hill coefficient of ∼ 1.5. The rate of ATP hydrolysis calculated from measurements of the maximal rate of ouabain-inhibitable 86 Rb + uptake in intact cells was similar to the enzymatic V/sub max/ of the Na + -K + -ATPase in cell lysates, suggesting that the Na + -K + -ATPase activity in these broken-cell preparations closely reflects the functional transport capacity of the Na-K pump

  14. Fabrication of implanted $^{22}$Na targets

    CERN Multimedia

    2002-01-01

    A knowledge of the $^{22}$Na(p,$\\gamma$)$^{23}$ Mg reaction rate is of significant astrophysical interest. In order to complete previous studies of this reaction, radioactive $^{22}$Na targets of high purity are required. We ask for support to fabricate these targets via the implantation technique at ISOLDE GPS (off—line mode) using $^{22}$Na nuclides in an Al matrix produced in Nov. 1990 at the PSI (Zürich). The $^{22}$Na nuclides are released and ionized in a surface ionisation source, mass-analyzed at ISOLDE GPS, and implanted in a Ni-Ta backing and a C—foil in a special implantation setup.

  15. OGLAŠEVANJE NA FACEBOOKU V SLOVENIJI

    OpenAIRE

    Dobnik, Monja

    2013-01-01

    Danes so zahvaljujoč napredni mobilni tehnologiji družbena omrežja z nami na vsakem koraku. Facebook (FB) se po priljubljenosti uvršča v sam vrh družbenih omrežij in glede na to, da ga uporablja že več kot milijarda zemljanov, ponuja tudi odlične trg za oglaševanje. To so ugotovili tudi slovenski podjetniki. V diplomski nalogi je predstavljeno, kako na FB oglašujejo nekatera slovenska podjetja, s pomočjo spletnega vprašalnika pa je ugotovljeno tudi, kaj o oglasih na FB menijo njegovi uporabni...

  16. Na+ Recirculation and Isosmotic Transport

    DEFF Research Database (Denmark)

    Larsen, Erik Hviid; Møbjerg, N

    2006-01-01

    of the absorbate. Mathematical modeling reproducing bioelectric and hydrosmotic properties of small intestine and proximal tubule, respectively, predicts a significant range of observations such as isosmotic transport, hyposmotic transport, solvent drag, anomalous solvent drag, the residual hydraulic permeability...... external baths. Hyperosmolarity of lis is governed by the hydraulic permeability of the apical plasma membrane and tight junction with 6-7 mOsm in small intestine and transport demands a Na(+) recirculation of 50-70% in small intestine but might be barely...... measurable in proximal tubule. The model fails to reproduce a certain type of observations: The reduced volume absorption at transepithelial osmotic equilibrium in AQP1 knockout mice, and the stimulated water absorption by gallbladder in diluted external solutions. Thus, it indicates cellular regulation...

  17. O consumo na vida digital

    Directory of Open Access Journals (Sweden)

    Iuri Yudi Furukita Baptista

    2016-02-01

    Full Text Available O modelo de consumo não possui as mesmas características sempre: suas relações, motivações, formatos, espaços, interesses e atividades são construções sociais que se modificam atreladas ao cenário econômico, político e tecnológico. O presente trabalho repassa o surgimento da sociedade do consumidor para então conjecturar sobre as propriedades distintivas do consumo na vida digital. O que se defende ao final é que o consumidor já não se restringe ao papel de consumir.

  18. Na+/Ca2+ exchange and Na+/K+-ATPase in the heart

    Science.gov (United States)

    Shattock, Michael J; Ottolia, Michela; Bers, Donald M; Blaustein, Mordecai P; Boguslavskyi, Andrii; Bossuyt, Julie; Bridge, John H B; Chen-Izu, Ye; Clancy, Colleen E; Edwards, Andrew; Goldhaber, Joshua; Kaplan, Jack; Lingrel, Jerry B; Pavlovic, Davor; Philipson, Kenneth; Sipido, Karin R; Xie, Zi-Jian

    2015-01-01

    This paper is the third in a series of reviews published in this issue resulting from the University of California Davis Cardiovascular Symposium 2014: Systems approach to understanding cardiac excitation–contraction coupling and arrhythmias: Na+ channel and Na+ transport. The goal of the symposium was to bring together experts in the field to discuss points of consensus and controversy on the topic of sodium in the heart. The present review focuses on cardiac Na+/Ca2+ exchange (NCX) and Na+/K+-ATPase (NKA). While the relevance of Ca2+ homeostasis in cardiac function has been extensively investigated, the role of Na+ regulation in shaping heart function is often overlooked. Small changes in the cytoplasmic Na+ content have multiple effects on the heart by influencing intracellular Ca2+ and pH levels thereby modulating heart contractility. Therefore it is essential for heart cells to maintain Na+ homeostasis. Among the proteins that accomplish this task are the Na+/Ca2+ exchanger (NCX) and the Na+/K+ pump (NKA). By transporting three Na+ ions into the cytoplasm in exchange for one Ca2+ moved out, NCX is one of the main Na+ influx mechanisms in cardiomyocytes. Acting in the opposite direction, NKA moves Na+ ions from the cytoplasm to the extracellular space against their gradient by utilizing the energy released from ATP hydrolysis. A fine balance between these two processes controls the net amount of intracellular Na+ and aberrations in either of these two systems can have a large impact on cardiac contractility. Due to the relevant role of these two proteins in Na+ homeostasis, the emphasis of this review is on recent developments regarding the cardiac Na+/Ca2+ exchanger (NCX1) and Na+/K+ pump and the controversies that still persist in the field. PMID:25772291

  19. Analiza utjecaja stabilizatora na određivanje elemenata vanjske orijentacije kamere na bespilotnoj letjelici

    OpenAIRE

    Gašparović, Mateo; Gajski, Dubravko

    2016-01-01

    U radu su prikazani i interpretirani rezultati analize utjecaja stabilizatora kamere na određivanje elemenata vanjske orijentacije na bespilotnim letjelicama. Riječ je o 3-osnom stabilizatoru baziranom na elektromotorima bez četkica. Prikazan je i objašnjen koncept rada stabilizatora kamera na bespilotnim letjelicama. Za potrebe rada stabilizator je unaprijeđen upotrebom drugog inercijalnog mjernog uređaja (IMU). Provedena su dva testiranja stabilizatora upotrebom jednog i dva inercijalna mje...

  20. Na+,K+-ATPase Na+ affinity in rat skeletal muscle fiber types

    DEFF Research Database (Denmark)

    Kristensen, Michael; Juel, Carsten

    2010-01-01

    Previous studies in expression systems have found different ion activation of the Na(+)/K(+)-ATPase isozymes, which suggest that different muscles have different ion affinities. The rate of ATP hydrolysis was used to quantify Na(+),K(+)-ATPase activity, and the Na(+) affinity of Na(+),K(+)-ATPase......Previous studies in expression systems have found different ion activation of the Na(+)/K(+)-ATPase isozymes, which suggest that different muscles have different ion affinities. The rate of ATP hydrolysis was used to quantify Na(+),K(+)-ATPase activity, and the Na(+) affinity of Na......(+),K(+)-ATPase was studied in total membranes from rat muscle and purified membranes from muscle with different fiber types. The Na(+) affinity was higher (K(m) lower) in oxidative muscle compared with glycolytic muscle and in purified membranes from oxidative muscle compared with glycolytic muscle. Na......(+),K(+)-ATPase isoform analysis implied that heterodimers containing the beta(1) isoform have a higher Na(+) affinity than heterodimers containing the beta(2) isoform. Immunoprecipitation experiments demonstrated that dimers with alpha(1) are responsible for approximately 36% of the total Na,K-ATPase activity. Selective...

  1. Exploration of NaVOPO4 as a cathode for a Na-ion battery.

    Science.gov (United States)

    Song, Jie; Xu, Maowen; Wang, Long; Goodenough, John B

    2013-06-11

    Monoclinic NaVOPO4 is explored as a cathode material for a sodium ion battery. It exhibits electrochemical activity operating at an average potential of 3.6 V (vs. Na(+)/Na) and delivers a reversible capacity of 90 mA h g(-1) at 1/15 C.

  2. Study of the Na-C-O and Na-H-O ternary systems in the sodium rich corner

    International Nuclear Information System (INIS)

    Maupre, J.-P.

    1978-02-01

    The purpose of this study is to provide a contribution to the understanding of the sodium - carbon - oxygen and sodium - hydrogen - oxygen ternary systems in the sodium rich corner. In order to do this the Na-NaH-Na 2 O-NaOH phase diagram was completed and the Na-Na 2 O-Na 2 CO 3 -C phase diagram was outlined. This work is made up of two parts. The first is devoted to a critical literature survey essential to establish correct phase diagrams. The second is an experimental study followed by a discussion collating our finding to the literary data. The basic experimental technique used is differential thermal analysis (DTA) but it has been completed by quenching, X-ray and chemical analysis methods. The proposed phase diagrams imply that Na-NaH-Na 2 O-NaOH and Na-Na 2 O-Na 2 CO 3 -C systems are reciprocal ternary systems. Temperatures of stable pairs reversal are respectively 410 and 690 0 C. The stable pairs are Na-NaOH and Na-Na 2 CO 3 at elevated temperature, Na 2 O-NaH and Na 2 O-C at low temperature [fr

  3. OGLAŠEVANJE NA DRUŽBENIH OMREŽJIH NA PRIMERU FACEBOOKA

    OpenAIRE

    Novak, Martina

    2012-01-01

    V diplomskem delu obravnavamo družbene medije kot novo priložnost za promocijo in oglaševanje podjetij. Spoznali smo družbena omrežja na splošno in nekaj teh, ki jih uporabljamo tudi v Sloveniji na kratko predstavili. Podrobneje smo se osredotočili na družbeno omrežje Facebook, predvsem na samo spletno stran, njen izgled in storitve, ki jih ponuja uporabnikom. V nalogi je podrobneje opisan Facebook kot orodje za uporabo oglaševanja. Spoznali smo brezplačne in plačljive načine promocije in ogl...

  4. Extracellular Na+ levels regulate formation and activity of the NaX/alpha1-Na+/K+-ATPase complex in neuronal cells.

    Directory of Open Access Journals (Sweden)

    Emmanuelle eBerret

    2014-12-01

    Full Text Available MnPO neurons play a critical role in hydromineral homeostasis regulation by acting as sensors of extracellular sodium concentration ([Na+]out. The mechanism underlying Na+-sensing involves Na+-flow through the NaX channel, directly regulated by the Na+/K+-ATPase α1-isoform which controls Na+-influx by modulating channel permeability. Together, these two partners form a complex involved in the regulation of intracellular sodium ([Na+]in. Here we aim to determine whether environmental changes in Na+ could actively modulate the NaX/Na+/K+-ATPase complex activity.We investigated the complex activity using patch-clamp recordings from rat MnPO neurons and Neuro2a cells. When the rats were fed with a high-salt-diet, or the [Na+] in the culture medium was increased, the activity of the complex was up-regulated. In contrast, drop in environmental [Na+] decreased the activity of the complex. Interestingly under hypernatremic condition, the colocalization rate and protein level of both partners were up-regulated. Under hyponatremic condition, only NaX protein expression was increased and the level of NaX/Na+/K+-ATPase remained unaltered. This unbalance between NaX and Na+/K+-ATPase pump proportion would induce a bigger portion of Na+/K+-ATPase-control-free NaX channel. Thus we suggest that hypernatremic environment increases NaX/Na+/K+-ATPase α1-isoform activity by increasing the number of both partners and their colocalization rate, whereas hyponatremic environment down-regulates complex activity via a decrease in the relative number of NaX channels controlled by the pump.

  5. K+ congeners that do not compromise Na+ activation of the Na+,K+-ATPase

    DEFF Research Database (Denmark)

    Mahmmoud, Yasser A; Kopec, Wojciech; Khandelia, Himanshu

    2015-01-01

    to no antagonism to cytoplasmic Na(+) activation. Na(+),K(+)-ATPase structures revealed a previously undescribed rotamer transition of the hydroxymethyl side chain of the absolutely conserved Thr(772) of the α-subunit. The side chain contributes its hydroxyl to Na(+) in site I in the E1 form and rotates......The Na(+),K(+)-ATPase is essential for ionic homeostasis in animal cells. The dephosphoenzyme contains Na(+) selective inward facing sites, whereas the phosphoenzyme contains K(+) selective outward facing sites. Under normal physiological conditions, K(+) inhibits cytoplasmic Na(+) activation...... to contribute its methyl group toward K(+) in the E2 form. Molecular dynamics simulations to the E1·AlF4 (-)·ADP·3Na(+) structure indicated that 1) bound organic cations differentially distorted the ion binding sites, 2) the hydroxymethyl of Thr(772) rotates to stabilize bound Form(+) through water molecules...

  6. Crystal structure of Na+, K(+)-ATPase in the Na(+)-bound state.

    Science.gov (United States)

    Nyblom, Maria; Poulsen, Hanne; Gourdon, Pontus; Reinhard, Linda; Andersson, Magnus; Lindahl, Erik; Fedosova, Natalya; Nissen, Poul

    2013-10-04

    The Na(+), K(+)-adenosine triphosphatase (ATPase) maintains the electrochemical gradients of Na(+) and K(+) across the plasma membrane--a prerequisite for electrical excitability and secondary transport. Hitherto, structural information has been limited to K(+)-bound or ouabain-blocked forms. We present the crystal structure of a Na(+)-bound Na(+), K(+)-ATPase as determined at 4.3 Å resolution. Compared with the K(+)-bound form, large conformational changes are observed in the α subunit whereas the β and γ subunit structures are maintained. The locations of the three Na(+) sites are indicated with the unique site III at the recently suggested IIIb, as further supported by electrophysiological studies on leak currents. Extracellular release of the third Na(+) from IIIb through IIIa, followed by exchange of Na(+) for K(+) at sites I and II, is suggested.

  7. LEITURA E LEITURA NA UNIVERSIDADE

    Directory of Open Access Journals (Sweden)

    Profª Drª Márcia A. G. Molina

    2015-12-01

    Full Text Available O texto apresenta uma discussão acerca da leitura, traçando, primeiramente, um percurso histórico dessa questão, iniciando-se no XIX aqui no Brasil.. Na sequência, aponta-se para a importância daquele que trabalha com a leitura ter paixão por ela, para que possa formar sujeitos também apaixonados pelo ato de ler. Continua mostrando os tipos de leitura, de acordo com FREIRE (1989, KOCK e ELIAS (2006 e apontando as atuais orientações para os procedimentos de leitura de um texto, baseados em KLEIMAN (2002. Conclui-se que, para formar o bom leitor, entendido como aquele que lê o não-dito e caminha para além da paráfrase reprodutiva, deve-se: ter paixão pela leitura, orientar os estudantes para essa prática, estabelecendo-se objetivos de leitura e reconhecer as estratégias que compreendem essa atividade.

  8. Necessidades da vida na morte

    Directory of Open Access Journals (Sweden)

    Denise Stefanoni Combinato

    2017-04-01

    Full Text Available Em função do envelhecimento populacional e aumento de doenças crônicas não transmissíveis, a Estratégia Saúde da Família (ESF tem se deparado com as necessidades das pessoas em processo de morte. A partir da análise do trabalho de profissionais da saúde que cuidaram de pessoas em processo de morte, o objetivo deste artigo é discutir as necessidades de saúde nesse processo, a fim de subsidiar o trabalho com essa população, especialmente na Atenção Primária à Saúde. Participaram da entrevista, após serem selecionados por dois questionários, onze profissionais (enfermeiros e médicos da ESF de Campinas/SP. A análise de dados foi pautada no referencial teórico-metodológico da Psicologia histórico-cultural. Como resultado, tem-se que as necessidades dos pacientes e familiares não são restritas ao momento de vida (proximidade da morte, mas referem-se, também, às condições de vulnerabilidade social.

  9. Terapia de linguagem na afasia

    Directory of Open Access Journals (Sweden)

    Mauro Spinelli

    1977-12-01

    Full Text Available A terapia da linguagem na afasia foi estudada em 15 pacientes, 8 do sexo masculino e 7 do sexo feminino; a idade variou de menos de 10 anos a mais de 50 anos; em 11 casos a afasia era sequela de acidente vascular cerebral e, em 4, de traumatismo crânio-encefálico. Quanto ao tipo de afasia, 5 pacientes apresentavam déficits predominantemente de expressão e 10 apresentavam déficits receptivos e expressivos em graus equiparáveis. Em 6 casos a terapia foi iniciada dentro dos 3 primeiros meses de instalação do quadro; nos restantes foi iniciada mais tardiamente. Dos 15 pacientes, 11 apresentaram evolução satisfatória, a qual não depndeu do grau de afasia, do tipo de afasia, da idade do paciente, do tipo de patologia e do intervalo entre a instalação do quadro afásico e o início da terapia. A terapia da linguagem no paciente afásico é efetiva, o prognóstico não pode ser feito a priori. Somente a evolução do caso com sua retestagem criteriosa poderá dar dados realmente úteis para se falar em evolução.

  10. Liquido cefalorraquiano na cisticercose encefalica

    Directory of Open Access Journals (Sweden)

    João Baptista dos Reis

    1979-06-01

    Full Text Available Foi feito um estudo do comportamento do líquido cefalorraquiano (LCR na cisticercose encefálica, com base em 656 observações retiradas de um material constituído por 120.000 exames de pacientes neurológicos e psiquiátricos, reunidas em 35 anos de trabalho. Com base nos casos comprovados por necrópsia ou cirurgia foram descritas as alterações do LCR. O estudo consecutivo de amostras de LCR obtidas em anos sucessivos, durante o decurso da doença, mostrou a persistência das alterações em numerosos casos, mesmo depois de 4 a 18 anos de observação. A reação de fixação de complemento para cisticerco permaneceu positiva durante todos estes anos. Foram também apreciadas as modificações do LCR em casos de cisticercose sub-cutânea e do globo ocular e em casos com cisticercos calcificados no encéfalo.

  11. Barroco: A tempestade na Biblioteca

    Directory of Open Access Journals (Sweden)

    Diego Cervelin

    2008-10-01

    Full Text Available http://dx.doi.org/10.5007/1984-784x.2008v8n12p167 Desde que Heinrich Wölfflin, nos últimos vinte anos do século XIX, se interessou por trazer à tona as formas arquitetônicas do século XVII conferindo-lhes caráter autônomo de estilo histórico determinável, não é nenhuma novidade que os estudos sobre o barroco pudessem polarizar – quase sempre em um tom colérico – os pesquisadores da arte e da cultura. Em terras do Brasil, não chega a ser de todo descabido recordar a severíssima crítica operada por Sérgio Buarque de Holanda em Raízes do Brasil. O livro, que pretende detectar a avalanche de equívocos que teria povoado o passado nacional com as vistas voltadas para a concretização de um projeto de emancipação e progresso na linha da história brasileira, apresenta em seu quarto capítulo uma impugnação explícita ao passado colonial.

  12. Barroco: A tempestade na Biblioteca

    Directory of Open Access Journals (Sweden)

    Diego Cervelin

    2008-12-01

    Full Text Available Desde que Heinrich Wölfflin, nos últimos vinte anos do século XIX, se interessou por trazer à tona as formas arquitetônicas do século XVII conferindo-lhes caráter autônomo de estilo histórico determinável, não é nenhuma novidade que os estudos sobre o barroco pudessem polarizar – quase sempre em um tom colérico – os pesquisadores da arte e da cultura. Em terras do Brasil, não chega a ser de todo descabido recordar a severíssima crítica operada por Sérgio Buarque de Holanda em Raízes do Brasil. O livro, que pretende detectar a avalanche de equívocos que teria povoado o passado nacional com as vistas voltadas para a concretização de um projeto de emancipação e progresso na linha da história brasileira, apresenta em seu quarto capítulo uma impugnação explícita ao passado colonial.

  13. Gasotransmitters: Novel regulators of epithelial Na+ transport?

    Directory of Open Access Journals (Sweden)

    Mike eAlthaus

    2012-04-01

    Full Text Available The vectorial transport of Na+ across epithelia is crucial for the maintenance of Na+ and water homeostasis in organs such as the kidneys, lung or intestine. Dysregulated Na+ transport processes are associated with various human diseases such as hypertension, the salt-wasting syndrome pseudohypoaldosteronism type 1, pulmonary edema, cystic fibrosis or intestinal disorders, which indicate that a precise regulation of epithelial Na+ transport is essential. Novel regulatory signaling molecules are gasotransmitters. There are currently three known gasotransmitters: nitric oxide (NO, carbon monoxide (CO and hydrogen sulfide (H2S. These molecules are endogenously produced in mammalian cells by specific enzymes and have been shown to regulate various physiological processes. There is a growing body of evidence, which indicates that gasotransmitters may also regulate Na+ transport across epithelia. This review will summarize the available data concerning NO, CO and H2S dependent regulation of epithelial Na+ transport processes and will discuss whether or not these mediators can be considered as true physiological regulators of epithelial Na+ transport biology.

  14. NMR studies on Na+ transport in Synechococcus PCC 6311

    Science.gov (United States)

    Nitschmann, W. H.; Packer, L.

    1992-01-01

    The freshwater cyanobacterium Synechococcus PCC 6311 is able to adapt to grow after sudden exposure to salt (NaCl) stress. We have investigated the mechanism of Na+ transport in these cells during adaptation to high salinity. Na+ influx under dark aerobic conditions occurred independently of delta pH or delta psi across the cytoplasmic membrane, ATPase activity, and respiratory electron transport. These findings are consistent with the existence of Na+/monovalent anion cotransport or simultaneous Na+/H+ +anion/OH- exchange. Na+ influx was dependent on Cl-, Br-, NO3-, or NO2-. No Na+ uptake occurred after addition of NaI, NaHCO3, or Na2SO4. Na+ extrusion was absolutely dependent on delta pH and on an ATPase activity and/or on respiratory electron transport. This indicates that Na+ extrusion via Na+/H+ exchange is driven by primary H+ pumps in the cytoplasmic membrane. Cells grown for 4 days in 0.5 m NaCl medium, "salt-grown cells," differ from control cells by a lower maximum velocity of Na+ influx and by lower steady-state ratios of [Na+]in/[Na+]out. These results indicate that cells grown in high-salt medium increase their capacity to extrude Na+. During salt adaptation Na+ extrusion driven by respiratory electron transport increased from about 15 to 50%.

  15. Na/K pump inactivation, subsarcolemmal Na measurements, and cytoplasmic ion turnover kinetics contradict restricted Na spaces in murine cardiac myocytes

    OpenAIRE

    Lu, Fang-Min; Hilgemann, Donald W.

    2017-01-01

    The Na/K pump exports cytoplasmic Na ions while importing K ions, and its activity is thought to be affected by restricted intracellular Na diffusion in cardiac myocytes. Lu and Hilgemann find instead that the pump can enter an inactivated state and that inactivation can be relieved by cytoplasmic Na.

  16. Fotokromne tiskarske barve na osnovi resorufina

    OpenAIRE

    Drnovšek, Petra

    2017-01-01

    Pametni materiali pod vplivom zunanjega dejavnika na predvidljiv in navadno uporaben način spremenijo svoje lastnosti. Takšni materiali so fotokatalitsko aktivne tiskarske barve, pri katerih se pod vplivom ultravijoličnega sevanja (v nadaljevanju UV) in/ali vidne svetlobe sproži fotokataliza, čemur sledi sprememba barve. Ena izmed možnih aplikacij fotokatalitsko aktivnih tiskarskih barv je ta, da uporabnika s spremembo barve opozarjajo na količino izpostavljenosti potencialno škodljivemu UV s...

  17. Pretpostavke za valorizaciju zapisa na elektronskim medijima

    OpenAIRE

    Eržišnik, Davorin

    1999-01-01

    U napisu se raspravlja o razlozima za valorizaciju zapisa na elektronskim medijima. Oni su ujedno i pretpostavke za tu valorizaciju, jer da bi ona uoće provodila, moraju postojati i razlozi. Istraživanje se bazira na usporedbi izmedju tih zapisa s jedne strane te klasičnih dokumenata i mikrofilmskih zapisa, s druge. Zaključuje se da u odnosu na tu drugu stranu, elektronski zapisi moraju imati i neke dodatne prednosti i kvalitete. U protivnom, ni ta valorizacija ne bi imala smisla.

  18. Naša eko hrana

    OpenAIRE

    Kelnerić, Tatjana

    2013-01-01

    Zdrav način življenja trajna je zadaća održivog razvoja i može se reći da ne postoji dobna granica za početak takvog načina života. U tom kontekstu neizbježno je da cilj svakog odgojno-obrazovnog rada, bilo da je riječ o projektu ili svakodnevici jedne odgojno-obrazovne skupine u dječjem vrtiću, mora biti usmjeren na čisto i zdravo okruženje, neposredan kontakt djeteta s prirodom, pravilnu prehranu i kretanje.

  19. VPLIV TEHNOLOŠKIH SPREMEMB NA GLOBALIZACIJO

    OpenAIRE

    Mohar, Nives

    2015-01-01

    Magistrsko delo z naslovom »Vpliv tehnoloških dejavnikov na globalizacijo« zajema dve večji področji ekonomske teorije – tehnologijo in globalizacijo. Namen magistrskega dela je analizirati odnose med tehnološkimi spremembami, gospodarsko rastjo in globaliziranostjo držav. Teoretični del smo razdelili na obravnavo tehnologije in globalizacije. Najprej smo predstavili pojme, ki se navezujejo na tehnologijo, nato smo prikazali mesto tehnologije skozi zgodovino ekonomske teorije in predstavi...

  20. Na+,K+ pumpen vedbliver at overraske

    DEFF Research Database (Denmark)

    Vilsen, Bente

    2008-01-01

    This article provides an overview of news about the Na+,K+ pump, an indispensable enzyme whose protein structure has been described in a recent article in Nature, 50 years after its discovery. In combination with mutational analysis, the structure reveals the binding pocket for the K+ ions...... and the regulation of Na+ transport by a strategically located C-terminus of the protein. Focus is also on the pathophysiology of two neurological disorders, familial hemiplegic migraine and rapid-onset dystonia-parkinsonism, recently shown to be caused by mutations in the Na+,K+-ATPase. Udgivelsesdato: may 19...

  1. Myocardial Na,K-ATPase: Clinical aspects

    Science.gov (United States)

    Kjeldsen, Keld

    2003-01-01

    The specific binding of digitalis glycosides to Na,K-ATPase is used as a tool for Na,K-ATPase quantification with high accuracy and precision. In myocardial biopsies from patients with heart failure, total Na,K-ATPase concentration is decreased by around 40%; a correlation exists between a decrease in heart function and a decrease in Na,K-ATPase concentration. During digitalization, around 30% of remaining pumps are occupied by digoxin. Myocardial Na,K-ATPase is also influenced by other drugs used for the treatment of heart failure. Thus, potassium loss during diuretic therapy has been found to reduce myocardial Na,K-ATPase, whereas angiotensin-converting enzyme inhibitors may stimulate Na,K pump activity. Furthermore, hyperaldosteronism induced by heart failure has been found to decrease Na,K-ATPase activity. Accordingly, treatment with the aldosterone antagonist, spironolactone, may also influence Na,K-ATPase activity. The importance of Na,K pump modulation with heart disease, inhibition in digitalization and other effects of medication should be considered in the context of sodium, potassium and calcium regulation. It is recommended that digoxin be administered to heart failure patients who, after institution of mortality-reducing therapy, still have heart failure symptoms, and that the therapy be continued if symptoms are revealed or reduced. Digitalis glycosides are the only safe inotropic drugs for oral use that improve hemodynamics in heart failure. An important aspect of myocardial Na,K pump affection in heart disease is its influence on extracellular potassium (Ke) homeostasis. Two important aspects should be considered: potassium handling among myocytes, and effects of potassium entering the extracellular space of the heart via the bloodstream. It should be noted that both of these aspects of Ke homeostasis are affected by regulatory aspects, eg, regulation of the Na,K pump by physiological and pathophysiological conditions, as well as by medical

  2. Prepoznavanje spolnega nadlegovanja na delovnem mestu v zdravstvu

    OpenAIRE

    Lešnik, Tina

    2013-01-01

    Diplomsko delo predstavlja problem spolnega nadlegovanja na delovnem mestu na podlagi slovenske in tuje teorije ter se osredotoča na ugotavljanje pojava spolnega nadlegovanja na delovnem mestu v zdravstvu. Izhodišča: Dosedanje raziskave nasilja in spolnega nadlegovanja na delovnem mestu kažejo, da so zdravstveni delavci le temu izpostavljeni bolj kot delavci v drugih panogah. V okviru diplomskega dela smo raziskali prepoznavanje in pojavnost spolnega nadlegovanja na delovnem mestu med štu...

  3. Glutathionylation-Dependence of Na+-K+-Pump Currents Can Mimic Reduced Subsarcolemmal Na+ Diffusion

    Science.gov (United States)

    Garcia, Alvaro; Liu, Chia-Chi; Cornelius, Flemming; Clarke, Ronald J.; Rasmussen, Helge H.

    2016-01-01

    The existence of a subsarcolemmal space with restricted diffusion for Na+ in cardiac myocytes has been inferred from a transient peak electrogenic Na+-K+ pump current beyond steady state on reexposure of myocytes to K+ after a period of exposure to K+-free extracellular solution. The transient peak current is attributed to enhanced electrogenic pumping of Na+ that accumulated in the diffusion-restricted space during pump inhibition in K+-free extracellular solution. However, there are no known physical barriers that account for such restricted Na+ diffusion, and we examined if changes of activity of the Na+-K+ pump itself cause the transient peak current. Reexposure to K+ reproduced a transient current beyond steady state in voltage-clamped ventricular myocytes as reported by others. Persistence of it when the Na+ concentration in patch pipette solutions perfusing the intracellular compartment was high and elimination of it with K+-free pipette solution could not be reconciled with restricted subsarcolemmal Na+ diffusion. The pattern of the transient current early after pump activation was dependent on transmembrane Na+- and K+ concentration gradients suggesting the currents were related to the conformational poise imposed on the pump. We examined if the currents might be accounted for by changes in glutathionylation of the β1 Na+-K+ pump subunit, a reversible oxidative modification that inhibits the pump. Susceptibility of the β1 subunit to glutathionylation depends on the conformational poise of the Na+-K+ pump, and glutathionylation with the pump stabilized in conformations equivalent to those expected to be imposed on voltage-clamped myocytes supported this hypothesis. So did elimination of the transient K+-induced peak Na+-K+ pump current when we included glutaredoxin 1 in patch pipette solutions to reverse glutathionylation. We conclude that transient K+-induced peak Na+-K+ pump current reflects the effect of conformation-dependent β1 pump subunit

  4. Altered Na+ transport after an intracellular alpha-subunit deletion reveals strict external sequential release of Na+ from the Na/K pump.

    Science.gov (United States)

    Yaragatupalli, Siddhartha; Olivera, J Fernando; Gatto, Craig; Artigas, Pablo

    2009-09-08

    The Na/K pump actively exports 3 Na(+) in exchange for 2 K(+) across the plasmalemma of animal cells. As in other P-type ATPases, pump function is more effective when the relative affinity for transported ions is altered as the ion binding sites alternate between opposite sides of the membrane. Deletion of the five C-terminal residues from the alpha-subunit diminishes internal Na(+) (Na(i)(+)) affinity approximately 25-fold [Morth et al. (2007) Nature 450:1043-1049]. Because external Na(+) (Na(o)(+)) binding is voltage-dependent, we studied the reactions involving this process by using two-electrode and inside-out patch voltage clamp in normal and truncated (DeltaKESYY) Xenopus-alpha1 pumps expressed in oocytes. We observed that DeltaKESYY (i) decreased both Na(o)(+) and Na(i)(+) apparent affinities in the absence of K(o)(+), and (ii) did not affect apparent Na(o)(+) affinity at high K(o)(+). These results support a model of strict sequential external release of Na(+) ions, where the Na(+)-exclusive site releases Na(+) before the sites shared with K(+) and the DeltaKESYY deletion only reduces Na(o)(+) affinity at the shared sites. Moreover, at nonsaturating K(o)(+), DeltaKESYY induced an inward flow of Na(+) through Na/K pumps at negative potentials. Guanidinium(+) can also permeate truncated pumps, whereas N-methyl-D-glucamine cannot. Because guanidinium(o)(+) can also traverse normal Na/K pumps in the absence of both Na(o)(+) and K(o)(+) and can also inhibit Na/K pump currents in a Na(+)-like voltage-dependent manner, we conclude that the normal pathway transited by the first externally released Na(+) is large enough to accommodate guanidinium(+).

  5. Painful Na-channelopathies: an expanding universe.

    Science.gov (United States)

    Waxman, Stephen G

    2013-07-01

    The universe of painful Na-channelopathies--human disorders caused by mutations in voltage-gated sodium channels--has recently expanded in three dimensions. We now know that mutations of sodium channels cause not only rare genetic 'model disorders' such as inherited erythromelalgia and channelopathy-associated insensitivity to pain but also common painful neuropathies. We have learned that mutations of NaV1.8, as well as mutations of NaV1.7, can cause painful Na-channelopathies. Moreover, recent studies combining atomic level structural models and pharmacogenomics suggest that the goal of genomically guided pain therapy may not be unrealistic. Copyright © 2013 Elsevier Ltd. All rights reserved.

  6. Erythrocyte 22Na+ influx in hypertension

    International Nuclear Information System (INIS)

    Shalev, O.; Eaton, J.W.; Ben-Ishay, D.

    1984-01-01

    We assessed 22Na+ uptake by erythrocytes (RBC) from 38 individuals with essential hypertension and 37 healthy controls. All subjects were male, white, non-obese and with normal renal function, obviating sex, race, hormonal, ponderal and renal factors known to influence RBC Na+ handling. The mean +/- sem 22Na+ uptake of the patients was 284 +/- 16 mumole/liter RBC/hour while that of normal controls was 249 +/- 11 mumole/liter RBC/hour; although the difference reached borderline significance, individual values showed considerable overlap. Consequently, in our population, RBC 22Na+ uptake is not a reliable marker for essential hypertension. We believe that previous studies should be reassessed with regard to patients' characteristics and future studies employ rigorous criteria in selection of subjects

  7. Na+-H+ exchange and Na+-dependent transport systems in streptozotocin diabetic rat kidneys

    International Nuclear Information System (INIS)

    El-Seifi, S.; Freiberg, J.M.; Kinsella, F.J.; Cheng, L.; Sacktor, B.

    1987-01-01

    The streptozotocin-induced diabetic rat was used to test the hypothesis that Na + -H + exchange activity in the proximal tubule luminal membrane would be increased in association with renal hypertrophy, altered glomerular hemodynamics, enhanced filtered load and tubular reabsorption of 22 Na + , and stimulated 22 Na= pump activity in the basolateral membrane, previously reported characteristics of this experimental animal model. Amiloride-sensitive H + gradient-dependent Na + uptake and Na + gradient-dependent H + flux were increased in brush-border membrane vesicles from the streptozotocin-treated animals. Na + gradient-dependent uptakes of phosphate, D-glucose, L-proline, and myoinositol were decreased in the drug-induced diabetic animals. These membrane transport alterations were not found when the streptozotocin-diabetic animals were treated with insulin

  8. Perfil nutricional na artrite reumatoide

    Directory of Open Access Journals (Sweden)

    Rachel Simone Maccarini Zarpellon

    2014-01-01

    Full Text Available Objetivo: Estudar o perfil nutricional de pacientes com artrite reumatoide (AR. Métodos: Estudo transversal observacional de 102 pacientes com AR. Os pacientes foram estudados para dados clínicos, demográficos, sorológicos, atividade de doença e perfil nutricional. Neste último incluiu-se a medida do índice de massa corporal (IMC, relação quadril/cintura, pregas cutâneas bicipitais (PCB e sua adequação; prega cutânea tricipital (PCT e sua adequação e circunferência muscular do braço (CMB e sua adequação. Estudos de associação foram feitos usando os testes de Fisher e qui-quadrado para dados nominais e teste t não pareado e Mann Whitney para dados numéricos. Para cálculo de correlação usou-se o teste de Spearman. Resultado: Na amostra existiam 14/102 homens e 88/102 mulheres com idade média de 52,1 ± 11,5 anos e duração média de doença de 10,6 ± 7,4 anos. A relação cintura/quadril média era de 0,92 ± 0,07. De acordo com IMC, 30,3% tinham peso normal e 65,5% tinham peso acima do normal. De acordo com PCB, 74,5% eram normais e 25,5% tinham depleção; de acordo com a PCT, 83,3% eram normais e 16,7% tinham depleção. Associação de variáveis nutricionais com gênero, fator reumatoide, nódulos e atividade da doença não mostraram diferenças (p = NS exceto, por uma relação cintura/quadril menor em indivíduos com nódulos (p = 0,02 e uma correlação modesta da PCT com a duração de doença (p = 0,02; R = 0,22; 95% IC = 0,01-0,40. Conclusão: Existe uma alta prevalência de sobrepeso e obesidade em artrite reumatoide e uma pequena frequência de depleção muscular.

  9. Glutathionylation-Dependence of Na+-K+-Pump Currents Can Mimic Reduced Subsarcolemmal Na+ Diffusion

    OpenAIRE

    Garcia, Alvaro; Liu, Chia-Chi; Cornelius, Flemming; Clarke, Ronald?J.; Rasmussen, Helge?H.

    2016-01-01

    The existence of a subsarcolemmal space with restricted diffusion for Na+ in cardiac myocytes has been inferred from a transient peak electrogenic Na+-K+ pump current beyond steady state on reexposure of myocytes to K+ after a period of exposure to K+-free extracellular solution. The transient peak current is attributed to enhanced electrogenic pumping of Na+ that accumulated in the diffusion-restricted space during pump inhibition in K+-free extracellular solution. However, there are no know...

  10. Theoretical study of Na(4p2P)+Na(3s2S) and Cd(5p3P0)+Na(3s2S) collisions and their role in the energy transfer between Cd* and Na

    International Nuclear Information System (INIS)

    Magnier, S.; Pisa Univ.; Angeli, C.; Granucci, G.; Masnou-Seeuws, F.; Allegrini, M.; Pisa Univ.; Persico, M.

    1997-01-01

    We have computed the cross sections for the energy transfer process Cd(5p 3 P 0 ) + Na(3s 2 S) →Cd(5s 1 S) + Na(4p 2 P) and for the state changing collision Na(4p 2 P) + Na(3s 2 S)→Na(3d 2 D) + Na(3s 2 S), based on theoretical interaction potentials for the NaCd and Na 2 systems, respectively. Our calculations shed light on the interpretation of experiments with laser excited Na+Cd vapour mixtures. It turns out that Cd(5p 3 P 0 ), in rapid equilibrium with the doorway state Cd(5p 3 P 1 ), efficiently transfers energy to Na, populating the 4p 2 P state. The collisions with ground state Na cause a very fast conversion of the 4p 2 P to the 3d 2 D state, from which the strongest emission is observed. (orig.)

  11. Space tourism; next goal of rocketry; Uchu eno ryokaku yuso

    Energy Technology Data Exchange (ETDEWEB)

    Inatani, Y. [Institute of the Space and Astronautical Science,Tokyo (Japan)

    2000-01-05

    As to the space travel to be conducted as business, the paper presented the results of the study being made to extract subjects. The single-stage space transport system which can be completely reused is said to be realized by much more weight reduction in airframe structure and improvement of propulsion performance, judging from the present technology standard. The reason the present form of rocket has to be reformed is that the cost needed to put a load of 1kg into orbit around the earth is higher in order of 1 million yen than those of other vehicles. Because the rocket is disposable, it is difficult to make an enormous cost reduction, and therefore, it is necessary to realize the same operation form as that adopted to airplane. The price of tickets for space travel rationally determined by the demand side is between 1.5-2.0 million yen. The annual sales are estimated at approximately 1.3 trillion yen on the market. When calculating this as business, it is necessary to reduce the transportation cost from 1,000,000 yen to 90,000-10,000 yen. A conceptual design was made of a space travel standard airframe 'Kanko-maru.' (NEDO)

  12. Meedikud loodavad rahumeelsele leppele / Eno-Gerrit Link

    Index Scriptorium Estoniae

    Link, Eno-Gerrit

    2007-01-01

    Tervishoiutöötajate kutseliitude esindajad võtsid väljakuulutatud streigihoiatuse maha lootuses, et kokkulepe meditsiinitöötajate miinimumtunnitasu osas võib sõlmida rahulikul teel. Arvamust avaldab Haiglate Liidu juhatuse esimees Urmas Sule

  13. President Ilves kohtus õpilaste ja kaitseliitlastega / Eno-Gerrit Link

    Index Scriptorium Estoniae

    Link, Eno-Gerrit

    2007-01-01

    President Toomas Hendrik Ilves külastas mitteametlikul visiidil 9.11.2007 Pärnu Sütevaka humanitaargümnaasiumi ja Kaitseliidu Pärnumaa malevat. Sütevaka humanitaargümnaasiumis kuulas president muusikakanali MTV Europe parima uustulnuka auhinna võitnud poistebändi Bedwetters esinemist ning osales lõpuklassi ühiskonnaõpetuse tunnis, rääkides kooli loosungist "Vabadus, loovus, vastutus" inspireeritult vabadusest ja vastutusest

  14. President istutas Torisse tamme / Eno-Gerrit Link

    Index Scriptorium Estoniae

    Link, Eno-Gerrit

    2007-01-01

    President Toomas Hendrik Ilves osales Toris Eesti sõjameeste mälestuskirikus traditsioonilisel vabadusvõitluse mälestusele pühendatud jumalateenistusel ja istutas kiriku kõrvale prominentide parki tamme. Varem on sellesse parki tammepuu istutanud president Arnold Rüütel, 20. augusti klubi, endine kaitseväe juhataja Aleksander Einseln ja peapiiskop Andres Põder

  15. Feminismo e/no pós-colonialismo

    Directory of Open Access Journals (Sweden)

    Deepika Bahri

    2013-11-01

    Full Text Available http://dx.doi.org/10.1590/S0104-026X2013000200018 Neste artigo, a autora discorre sobre a relação entre feminismo e pós-colonialismoa partir dos conceitos-chave nos estudos pós-coloniais, salientando as premissas, os métodose as tensões dessa aliança, bem como os desafios entre os feminismos “ocidental” e “póscolonial”no contexto da globalização.

  16. Suppression of Na interstitials in Na-F codoped ZnO

    Science.gov (United States)

    Huo, Wenxing; Mei, Zengxia; Tang, Aihua; Liang, Huili; Du, Xiaolong

    2018-04-01

    Controlling the formation of interstitial Na (Nai) self-compensating defects has been a long-term physics problem for effective Na doping in ZnO. Herein, we present an experimental approach to the suppression of Nai defects in ZnO via Na and F codoping under an oxygen-rich condition during the molecular beam epitaxy growth process. It is found that the incorporation of such large numbers of Na and F dopants (˜1020 cm-3) does not cause an obvious influence on the lattice parameters. Hall-effect measurements demonstrate that F doping efficiently raises the Fermi level (EF) of ZnO films, which is expected to make the formation energy of Nai and NaZn increase and decrease, respectively. Most of the Na atoms occupy the substitutional Zn sites, and the formation of Nai is suppressed consequently. Secondary ion mass spectrometry measurements reveal that F and Na atoms are tightly bonded together due to their strong Coulomb interaction. The enhanced deep level emission (DLE) in ZnO:Na-F is ascribed to the considerable amount of isolated Zn vacancy (VZn) defects induced by the elevated EF and the formation of neutral (" separators="| FO + - Na Zn - ) 0 complexes. On the other hand, formation of (" separators="| FO + - VZn 2 - ) - complexes in ZnO:F exhausts most of the isolated Zn vacancies, leading to the disappearance of the DLE band.

  17. Absolute quantification of Na + bound fraction by double-quantum filtered 23Na NMR spectroscopy

    Science.gov (United States)

    Mouaddab, Mohamed; Foucat, Loïc; Donnat, Jean Pierre; Renou, Jean Pierre; Bonny, Jean Marie

    2007-11-01

    A method is described for the absolute quantification of double-quantum filtered spectra of spin-3/2 nuclei ( 23Na). The method was tested on a model system, a cationic exchange resin for which the number of Na + binding sites was quantitatively controlled. The theoretical and experimental approaches were validated on samples with different Na + concentrations. An excellent agreement between the results obtained by double-quantum and single-quantum acquisitions was found. This method paves the way for absolute quantification of both bound and free fractions of Na +, which are determining factors in the characterization of salted/brined/dried food products.

  18. Interaction between Na+/K+-pump and Na+/Ca2+-exchanger modulates intercellular communication.

    Science.gov (United States)

    Matchkov, Vladimir V; Gustafsson, Helena; Rahman, Awahan; Briggs Boedtkjer, Donna M; Gorintin, Sarah; Hansen, Anne Kirstine; Bouzinova, Elena V; Praetorius, Helle A; Aalkjaer, Christian; Nilsson, Holger

    2007-04-13

    Ouabain, a specific inhibitor of the Na(+)/K(+)-pump, has previously been shown to interfere with intercellular communication. Here we test the hypothesis that the communication between vascular smooth muscle cells is regulated through an interaction between the Na(+)/K(+)-pump and the Na(+)/Ca(2+)-exchanger leading to an increase in the intracellular calcium concentration ([Ca(2+)](i)) in discrete areas near the plasma membrane. [Ca(2+)](i) in smooth muscle cells was imaged in cultured rat aortic smooth muscle cell pairs (A7r5) and in rat mesenteric small artery segments simultaneously with force. In A7r5 coupling between cells was estimated by measuring membrane capacitance. Smooth muscle cells were uncoupled when the Na(+)/K(+)-pump was inhibited either by a low concentration of ouabain, which also caused a localized increase of [Ca(2+)](i) near the membrane, or by ATP depletion. Reduction of Na(+)/K(+)-pump activity by removal of extracellular potassium ([K(+)](o)) also uncoupled cells, but only after inhibition of K(ATP) channels. Inhibition of the Na(+)/Ca(2+)-exchange activity by SEA0400 or by a reduction of the equilibrium potential (making it more negative) also uncoupled the cells. Depletion of intracellular Na(+) and clamping of [Ca(2+)](i) at low concentrations prevented the uncoupling. The experiments suggest that the Na(+)/K(+)-pump may affect gap junction conductivity via localized changes in [Ca(2+)](i) through modulation of Na(+)/Ca(2+)-exchanger activity.

  19. HCO3(-)-coupled Na+ influx is a major determinant of Na+ turnover and Na+/K+ pump activity in rat hepatocytes

    International Nuclear Information System (INIS)

    Fitz, J.G.; Lidofsky, S.D.; Weisiger, R.A.; Xie, M.H.; Cochran, M.; Grotmol, T.; Scharschmidt, B.F.

    1991-01-01

    Recent studies in hepatocytes indicate that Na(+)-coupled HCO3- transport contributes importantly to regulation of intracellular pH and membrane HCO3- transport. However, the direction of net coupled Na+ and HCO3- movement and the effect of HCO3- on Na+ turnover and Na+/K+ pump activity are not known. In these studies, the effect of HCO3- on Na+ influx and turnover were measured in primary rat hepatocyte cultures with 22Na+, and [Na+]i was measured in single hepatocytes using the Na(+)-sensitive fluorochrome SBFI. Na+/K+ pump activity was measured in intact perfused rat liver and hepatocyte monolayers as Na(+)-dependent or ouabain-suppressible 86Rb uptake, and was measured in single hepatocytes as the effect of transient pump inhibition by removal of extracellular K+ on membrane potential difference (PD) and [Na+]i. In hepatocyte monolayers, HCO3- increased 22Na+ entry and turnover rates by 50-65%, without measurably altering 22Na+ pool size or cell volume, and HCO3- also increased Na+/K+ pump activity by 70%. In single cells, exposure to HCO3- produced an abrupt and sustained rise in [Na+]i from approximately 8 to 12 mM. Na+/K+ pump activity assessed in single cells by PD excursions during transient K+ removal increased congruent to 2.5-fold in the presence of HCO3-, and the rise in [Na+]i produced by inhibition of the Na+/K+ pump was similarly increased congruent to 2.5-fold in the presence of HCO3-. In intact perfused rat liver, HCO3- increased both Na+/K+ pump activity and O2 consumption. These findings indicate that, in hepatocytes, net coupled Na+ and HCO3- movement is inward and represents a major determinant of Na+ influx and Na+/K+ pump activity. About half of hepatic Na+/K+ pump activity appears dedicated to recycling Na+ entering in conjunction with HCO3- to maintain [Na+]i within the physiologic range

  20. Clues to NaCN formation

    Science.gov (United States)

    Quintana-Lacaci, G.; Cernicharo, J.; Velilla Prieto, L.; Agúndez, M.; Castro-Carrizo, A.; Fonfría, J. P.; Massalkhi, S.; Pardo, J. R.

    2017-11-01

    Context. ALMA is providing us essential information on where certain molecules form. Observing where these molecules emission arises from, the physical conditions of the gas, and how this relates with the presence of other species allows us to understand the formation of many species, and to significantly improve our knowledge of the chemistry that occurs in the space. Aims: We studied the molecular distribution of NaCN around IRC +10216, a molecule detected previously, but whose origin is not clear. High angular resolution maps allow us to model the abundance distribution of this molecule and check suggested formation paths. Methods: We modeled the emission of NaCN assuming local thermal equilibrium (LTE) conditions. These profiles were fitted to azimuthal averaged intensity profiles to obtain an abundance distribution of NaCN. Results: We found that the presence of NaCN seems compatible with the presence of CN, probably as a result of the photodissociation of HCN, in the inner layers of the ejecta of IRC +10216. However, similar as for CH3CN, current photochemical models fail to reproduce this CN reservoir. We also found that the abundance peak of NaCN appears at a radius of 3 × 1015 cm, approximately where the abundance of NaCl, suggested to be the parent species, starts to decay. However, the abundance ratio shows that the NaCl abundance is lower than that obtained for NaCN. We expect that the LTE assumption might result in NaCN abundances higher than the real ones. Updated photochemical models, collisional rates, and reaction rates are essential to determine the possible paths of the NaCN formation. Based on observations carried out with ALMA and the IRAM 30 m Telescope. ALMA is a partnership of ESO (representing its member states), NSF (USA) and NINS (Japan), together with NRC (Canada) and NSC and ASIAA (Taiwan), in cooperation with the Republic of Chile. The Joint ALMA Observatory is operated by ESO, AUI/NRAO and NAOJ. IRAM is supported by INSU/CNRS (France

  1. Quasi–solid state rechargeable Na-CO2 batteries with reduced graphene oxide Na anodes

    Science.gov (United States)

    Hu, Xiaofei; Li, Zifan; Zhao, Yaran; Sun, Jianchao; Zhao, Qing; Wang, Jianbin; Tao, Zhanliang; Chen, Jun

    2017-01-01

    Na-CO2 batteries using earth-abundant Na and greenhouse gas CO2 are promising tools for mobile and stationary energy storage, but they still pose safety risks from leakage of liquid electrolyte and instability of the Na metal anode. These issues result in extremely harsh operating conditions of Na-CO2 batteries and increase the difficulty of scaling up this technology. We report the development of quasi–solid state Na-CO2 batteries with high safety using composite polymer electrolyte (CPE) and reduced graphene oxide (rGO) Na anodes. The CPE of PVDF-HFP [poly(vinylidene fluoride-co-hexafluoropropylene)]–4% SiO2/NaClO4–TEGDME (tetraethylene glycol dimethyl ether) has high ion conductivity (1.0 mS cm−1), robust toughness, a nonflammable matrix, and strong electrolyte-locking ability. In addition, the rGO-Na anode presents fast and nondendritic Na+ plating/stripping (5.7 to 16.5 mA cm−2). The improved kinetics and safety enable the constructed rGO-Na/CPE/CO2 batteries to successfully cycle in wide CO2 partial pressure window (5 to 100%, simulated car exhaust) and especially to run for 400 cycles at 500 mA g−1 with a fixed capacity of 1000 mA·hour g−1 in pure CO2. Furthermore, we scaled up the reversible capacity to 1.1 A·hour in pouch-type batteries (20 × 20 cm, 10 g, 232 Wh kg−1). This study makes quasi–solid state Na-CO2 batteries an attractive prospect. PMID:28164158

  2. Influence of spectral solar radiation to the generating power of photovoltaic module; Taiyo denchi shutsuryoku eno taiyoko supekutoru eno eikyo

    Energy Technology Data Exchange (ETDEWEB)

    Minaki, S.; Ishihara, Y.; Todaka, T.; Harada, K. [Doshisha University, Kyoto (Japan); Oshiro, T.; Nakamura, H. [Japan quality Assurance Organization, Tokyo (Japan)

    1997-11-25

    As to the influence of spectral solar radiation to generating power of solar cells, a study was conducted from the aspects of season, time zone, intensity of solar radiation, etc. In the study, spectral responsive variation correction coefficients were introduced as evaluation values expressing the influence of spectral solar radiation. For the spectral distribution, an all sky spectral pyranometer by wavelength was used, and data were used which were obtained in the measurement in experimental facilities of the solar techno center. Concerning solar cell relative spectral sensitivity values, used were relative spectral sensitivity values of monocrystal and amorphous standard solar cells to the short-circuit current. Spectral response variation correction coefficients are coefficients correcting variations in conversion efficiency of solar cells due to changes in the spectral distribution. The changes of spectral responsive variation correction coefficients were studied using data obtained during April 1994 and March 1996. As a result, it was found that the coefficients showed large changes in summer and small ones in winter and that amorphous solar cells indicate this trend conspicuously. 3 refs., 6 figs., 3 tabs.

  3. Kupokelewa Zaidi Kwa Simu Ya Mkononi Kuliko Kompyuta Na ...

    African Journals Online (AJOL)

    Mtandao wa tovuti ni nyenzo ya msingi katika maendeleo ya uwanja wa mawasiliano unaounganisha watu na jamii mbalimbali katika ulimwengu wa leo unaotandawaa. Katika “ulimwengu wa kwanza na wa pili”, yaani mabara ya Amerika, Uropa na Asia, maendeleo na mapinduzi makubwa katika uwanja wa teknolojia ya ...

  4. Effects of different NaCl Concentrations on germination and ...

    African Journals Online (AJOL)

    Growth was steadily stimulated in both species at lower NaCl levels with best growth stimulation at 50 mM NaCl but was adversely affected by higher NaCl concentration levels (75, 100 and 150 mM). Both species ... Key words: Germination, early seedling growth, NaCl, salinity, Amaranthus hybridus, Celosia argentea.

  5. Ujanibishaji wa Office 2003 na Windows XP kwa Kiswahili Sanifu ...

    African Journals Online (AJOL)

    Mradi wa ujanibishaji wa Office 2003 na Windows XP kwa Kiswahili sanifu ulitekelezwa katika kipindi 2004-2005. Malengo ya mradi yalikuwa: (1) kuandaa istilahi za kompyuta kwa Kiingereza-Kiswahili, na (2) kutafsiri programu nne za kawaida za Office (Outlook, Excel, Word na PowerPoint) na Windows XP. Makala hii ina ...

  6. Mabadiliko Ya Kifonolojia Na Kimofolojia Wakati Wa Utohozi Wa ...

    African Journals Online (AJOL)

    Mwingiliano wa lugha ya Kiswahili na Kiarabu una historia ndefu kidogo. Inasemekana Waarabu walianza muwasala na 'Waswahili' tangu karne ya kwanza (BK) (Polome 1967:9). Kutokana na muwasala huo wa muda mrefu, lugha hizi mbili (Kiarabu na Kiswahili) zimeathiriana sana. Lakini kuna maoni kwamba Kiarabu ...

  7. Utata kuhusu Dhana na Chimbuko la Wahadimu katika Kisiwa cha ...

    African Journals Online (AJOL)

    Data za makala haya zimepatikana kupitia usaili na majadiliano ya majopo ya wazungumzaji wa Kimakunduchi na Unguja na kujadili kwa muhtasari chimbuko la Wahadimu. Kwa muda mrefu dhana ya Wahadimu imekuwa ikijadiliwa kwa mitazamo tofautitofauti kama inavyobainishwa na wataalamu mbalimbali wakiwemo ...

  8. O Passeio Público do Rio de Janeiro na Literatura, na Pintura e na Fotografia do Século XIX

    Directory of Open Access Journals (Sweden)

    Solange de Aragão

    2012-06-01

    Full Text Available Este artigo tem como objetivo geral e mais amplo chamar a atenção dos pesquisadores para a importância da literatura, da pintura e da fotografia como fontes documentais para a construção da História do Paisagismo no Brasil por meio de um estudo de caso muito particular: o Passeio Público do Rio de Janeiro no século XIX. São objetivos específicos apresentar e analisar o modo como esse espaço livre público aparece na literatura, na pintura e na fotografia desse período, considerando suas transformações paisagísticas.

  9. Muziki wa Hip Hop na Haki Za Kijamii: Dhima, Changamoto na ...

    African Journals Online (AJOL)

    Ni dhahiri kuwa haki za kijamii zinaweza kuwasilishwa kwa jamii pana kupitia sanaa ya hip hop. Makala haya basi, yanabainisha dhima na mchango wa muziki wa hip hop katika masuala ya haki za kijamii, yanafafanua changamoto za muziki huu katika kuwasilisha haki za kijamii na kutoa mapendekezo kwa makundi ...

  10. Regeneration of plantlets under NaCl stress from NaN3 treated ...

    African Journals Online (AJOL)

    In this experiment, mutation induction in explants using NaN3 and subsequently, callus growth and plant regeneration under NaCl stressed conditions was assessed in some sugarcane (Saccharum officinarum L.) cultivars (Thatta-10, CPF-237 and SPHS-19). Immature bases of leaf tips were cultured on MS2n (MS salts, 3.0 ...

  11. Molecular dynamics investigation of Na+ in Na2Ni2TeO6

    International Nuclear Information System (INIS)

    Sau, Kartik; Kumar, P. Padma

    2014-01-01

    An inter-atomic potential for Na 2 Ni 2 TeO 6 in the Parrinello- Rahman-Vashishta (PRV) model is parameterized empirically. The potential reproduces variety of structural and transport properties of that material in good agreement with recent experimental results. The study provides fresh insights on the migration channels and mechanism of Na + in the system

  12. NaI(Tl) electron energy resolution

    CERN Document Server

    Mengesha, W

    2002-01-01

    NaI(Tl) electron energy resolution eta sub e was measured using the Modified Compton Coincidence Technique (MCCT). The MCCT allowed detection of nearly monoenergetic internal electrons resulting from the scattering of incident 662 keV gamma rays within a primary NaI(Tl) detector. Scattered gamma rays were detected using a secondary HPGe detector in a coincidence mode. Measurements were carried out for electron energies ranging from 16 to 438 keV, by varying the scattering angle. Measured HPGe coincidence spectra were deconvolved to determine the scattered energy spectra from the NaI(Tl) detector. Subsequently, the NaI(Tl) electron energy spectra were determined by subtracting the energy of scattered spectra from the incident source energy (662 keV). Using chi-squared minimization, iterative deconvolution of the internal electron energy spectra from the measured NaI(Tl) spectra was then used to determine eta sub e at the electron energy of interest. eta sub e values determined using this technique represent va...

  13. Na/K pump inactivation, subsarcolemmal Na measurements, and cytoplasmic ion turnover kinetics contradict restricted Na spaces in murine cardiac myocytes.

    Science.gov (United States)

    Lu, Fang-Min; Hilgemann, Donald W

    2017-07-03

    Decades ago, it was proposed that Na transport in cardiac myocytes is modulated by large changes in cytoplasmic Na concentration within restricted subsarcolemmal spaces. Here, we probe this hypothesis for Na/K pumps by generating constitutive transsarcolemmal Na flux with the Na channel opener veratridine in whole-cell patch-clamp recordings. Using 25 mM Na in the patch pipette, pump currents decay strongly during continuous activation by extracellular K (τ, ∼2 s). In contradiction to depletion hypotheses, the decay becomes stronger when pump currents are decreased by hyperpolarization. Na channel currents are nearly unchanged by pump activity in these conditions, and conversely, continuous Na currents up to 0.5 nA in magnitude have negligible effects on pump currents. These outcomes are even more pronounced using 50 mM Li as a cytoplasmic Na congener. Thus, the Na/K pump current decay reflects mostly an inactivation mechanism that immobilizes Na/K pump charge movements, not cytoplasmic Na depletion. When channel currents are increased beyond 1 nA, models with unrestricted subsarcolemmal diffusion accurately predict current decay (τ ∼15 s) and reversal potential shifts observed for Na, Li, and K currents through Na channels opened by veratridine, as well as for Na, K, Cs, Li, and Cl currents recorded in nystatin-permeabilized myocytes. Ion concentrations in the pipette tip (i.e., access conductance) track without appreciable delay the current changes caused by sarcolemmal ion flux. Importantly, cytoplasmic mixing volumes, calculated from current decay kinetics, increase and decrease as expected with osmolarity changes (τ >30 s). Na/K pump current run-down over 20 min reflects a failure of pumps to recover from inactivation. Simulations reveal that pump inactivation coupled with Na-activated recovery enhances the rapidity and effectivity of Na homeostasis in cardiac myocytes. In conclusion, an autoregulatory mechanism enhances cardiac Na/K pump activity when

  14. Anion-coupled Na efflux mediated by the human red blood cell Na/K pump

    International Nuclear Information System (INIS)

    Dissing, S.; Hoffman, J.F.

    1990-01-01

    The red cell Na/K pump is known to continue to extrude Na when both Na and K are removed from the external medium. Because this ouabain-sensitive flux occurs in the absence of an exchangeable cation, it is referred to as uncoupled Na efflux. This flux is also known to be inhibited by 5 mM Nao but to a lesser extent than that inhibitable by ouabain. Uncoupled Na efflux via the Na/K pump therefore can be divided into a Nao-sensitive and Nao-insensitive component. We used DIDS-treated, SO4-equilibrated human red blood cells suspended in HEPES-buffered (pHo 7.4) MgSO4 or (Tris)2SO4, in which we measured 22Na efflux, 35SO4 efflux, and changes in the membrane potential with the fluorescent dye, diS-C3 (5). A principal finding is that uncoupled Na efflux occurs electroneurally, in contrast to the pump's normal electrogenic operation when exchanging Nai for Ko. This electroneutral uncoupled efflux of Na was found to be balanced by an efflux of cellular anions. (We were unable to detect any ouabain-sensitive uptake of protons, measured in an unbuffered medium at pH 7.4 with a Radiometer pH-STAT.) The Nao-sensitive efflux of Nai was found to be 1.95 +/- 0.10 times the Nao-sensitive efflux of (SO4)i, indicating that the stoichiometry of this cotransport is two Na+ per SO4=, accounting for 60-80% of the electroneutral Na efflux. The remainder portion, that is, the ouabain-sensitive Nao-insensitive component, has been identified as PO4-coupled Na transport and is the subject of a separate paper. That uncoupled Na efflux occurs as a cotransport with anions is supported by the result, obtained with resealed ghosts, that when internal and external SO4 was substituted by the impermeant anion, tartrate i,o, the efflux of Na was inhibited 60-80%. This inhibition could be relieved by the inclusion, before DIDS treatment, of 5 mM Cli,o

  15. Metallic Na formation in NaCl crystals with irradiation of electron or vacuum ultraviolet photon

    Energy Technology Data Exchange (ETDEWEB)

    Owaki, Shigehiro [Osaka Prefecture Univ., Sakai, Osaka (Japan). Coll. of Integrated Arts and Sciences; Koyama, Shigeko; Takahashi, Masao; Kamada, Masao; Suzuki, Ryouichi

    1997-03-01

    Metallic Na was formed in NaCl single crystals with irradiation of a variety of radiation sources and analyzed the physical states with several methods. In the case of irradiation of 21 MeV electron pulses to the crystal blocks, the optical absorption and lifetime measurement of positron annihilation indicated appearance of Na clusters inside. Radiation effects of electron beam of 30 keV to the crystals in vacuum showed the appearance of not only metallic Na but atomic one during irradiation with Auger electron spectroscopy. Intense photon fluxes in vacuum ultraviolet region of synchrotron radiation were used as another source and an analyzing method of ultraviolet photoelectron spectroscopy. The results showed the metallic Na layered so thick that bulk plasmon can exist. (author)

  16. Hydrolysis of Rice Straw Pretreated by Na2SO3 Over Fe-resin/NaCl

    Directory of Open Access Journals (Sweden)

    YANG Hui

    2017-05-01

    Full Text Available To increase the conversion of rice straw(RS and the yield of products, we employed three methods, which were ultrasonic wave, steam explosion and Na2SO3 pretreatment to pretreat RS(the treated RS noted as CS-RS, ZQ-RS and Na2SO3-RS, respectively and found that Na2SO3 treatment was the best pretreatment method based on XRD, SEM, elemental analysis and content of cellulose, hemicellulose and lignin. The conversion of Na2SO3-RS and the yield of total reducing sugar(TRS and levulinic acid(LA were 97.3%, 29.6% and 13.5%, respectively by 10% Fe-resin in 3.3% NaCl solution under 200 ℃.

  17. Muscle K+, Na+, and Cl- disturbances and Na+-K+ pump inactivation: implications for fatigue

    DEFF Research Database (Denmark)

    McKenna, Michael J; Bangsbo, Jens; Renaud, Jean-Marc

    2008-01-01

    (+)-ATPase activity during exercise stabilizes Na(+) and K(+) concentration gradients and membrane excitability and thus protects against fatigue. However, during intense contraction some Na(+)-K(+) pumps are inactivated and together with further ionic disturbances, likely precipitate muscle fatigue.......Membrane excitability is a critical regulatory step in skeletal muscle contraction and is modulated by local ionic concentrations, conductances, ion transporter activities, temperature, and humoral factors. Intense fatiguing contractions induce cellular K(+) efflux and Na(+) and Cl(-) influx......, causing pronounced perturbations in extracellular (interstitial) and intracellular K(+) and Na(+) concentrations. Muscle interstitial K(+) concentration may increase 1- to 2-fold to 11-13 mM and intracellular K(+) concentration fall by 1.3- to 1.7-fold; interstitial Na(+) concentration may decline by 10 m...

  18. Osmotic and ionic effects of NaCl and Na2SO4 salinity on Phragmites australis

    DEFF Research Database (Denmark)

    Pagter, Majken; Bragato, Claudia; Malagoli, Mario

    2009-01-01

    and partly Cl ions from the leaves. Incomplete exclusion of Cl from the leaves may affect aboveground biomass production, which was significantly more reduced by NaCl than Na2SO4. Stomatal conductance was negatively influenced by decreasing water potentials caused by NaCl or Na2SO4, implying that a non...

  19. Structure-function relationships of Na+, K+, ATP, or Mg2+ binding and energy transduction in Na,K-ATPase

    DEFF Research Database (Denmark)

    Jorgensen, Peter L.; Pedersen, Per Amstrup

    2000-01-01

    Na,K-ATPase; Mutagenesis; Na+ binding; K+ binding; Tl+ binding; Mg2+ binding; ATP binding; Cation binding site; Energy transduction......Na,K-ATPase; Mutagenesis; Na+ binding; K+ binding; Tl+ binding; Mg2+ binding; ATP binding; Cation binding site; Energy transduction...

  20. Long-Range Effects of Na(+) Binding in Na,K-ATPase Reported by ATP.

    Science.gov (United States)

    Middleton, David A; Fedosova, Natalya U; Esmann, Mikael

    2015-12-01

    This paper addresses the question of long-range interactions between the intramembranous cation binding sites and the cytoplasmic nucleotide binding site of the ubiquitous ion-transporting Na,K-ATPase using (13)C cross-polarization magic-angle spinning (CP-MAS) solid-state nuclear magnetic resonance. High-affinity ATP binding is induced by the presence of Na(+) as well as of Na-like substances such as Tris(+), and these ions are equally efficient promoters of nucleotide binding. CP-MAS analysis of bound ATP with Na,K-ATPase purified from pig kidney membranes reveals subtle differences in the nucleotide interactions within the nucleotide site depending on whether Na(+) or Tris(+) is used to induce binding. Differences in chemical shifts for ATP atoms C1' and C5' observed in the presence of Na(+) or Tris(+) suggest alterations in the residues surrounding the bound nucleotide, hydrogen bonding, and/or conformation of the ribose ring. This is taken as evidence of a long-distance communication between the Na(+)-filled ion sites in the membrane interior and the nucleotide binding site in the cytoplasmic domain and reflects the first conformational change ultimately leading to phosphorylation of the enzyme. Stopped-flow fluorescence measurements with the nucleotide analogue eosin show that the dissociation rate constant for eosin is larger in Tris(+) than in Na(+), giving kinetic evidence of the difference in structural effects of Na(+) and Tris(+). According to the recent crystal structure of the E1·AlF4(-)·ADP·3Na(+) form, the coupling between the ion binding sites and the nucleotide side is mediated by, among others, the M5 helix.

  1. Eletrencefalograma na síndrome parkinsoniana

    Directory of Open Access Journals (Sweden)

    José Geraldo Camargo Lima

    1973-09-01

    Full Text Available Foram estudados os eletrencefalogramas de 50 pacientes parkinsonianos livres de qualquer antecedente convulsivo, sendo registrados traçados anormais em 40% dos casos. A incidência de traçados anormais foi maior na síndrome parkinsoniana bilateral do que na unilateral (52% e 25%, respectivamente. Entre as anormalidades assinaladas foram as paroxísticas as mais freqüentes (65% dos casos, caracterizando-se predominantemente por surtos de ondas teta. O registro de anormalidades paroxísticas do tipo irritativo encontrado em três casos é salientado. Alterações da atividade de base foram assinaladas em 35% dos pacientes. A idade dos pacientes não parece ter tido importante papel na gênese das anormalidades eletrencefalográficas.

  2. Knjige o kartografskim projekcijama na internetu

    Directory of Open Access Journals (Sweden)

    Nedjeljko Frančula

    2011-12-01

    Full Text Available U ovom prikazu skrećemo pozornost na neke knjige o kartografskim projekcijama koje su prvobitno objavljene u tisku, a potom digitalizirane i besplatno stavljene na mrežu. Neke od tih knjiga nude se na mreži kao Google e-knjige. Google godinama skuplja knjige kojima su istekla autorska prava i digitalizira ih. Fotografira se svaka stranica te zatim spaja u jednu veliku fotografiju iz koje se izvlači tekst softverom OCR. Google čuva originalnu digitalnu fotografiju u svom arhivu, a izvučeni tekst pretvara u formate HTML, PDF ili EPUB. Google danas nudi više od milijun besplatnih e-knjiga (http://www.google.com/books.

  3. Tecnologia simplificada na enfermagem materno infantil

    Directory of Open Access Journals (Sweden)

    Selma Campestrini

    1991-09-01

    Full Text Available A autora apresenta três modelos de tecnologia simplificada da enfermagem materno infantil: o equipamento didático SEIO COBAIA para treinar exercícios e massagens da mama e mamilo; a peça indumentária SUPRETRAUMA - sutiã preventivo de traumatismo mamilar - usado por gestantes; e, a técnica para reverter mamilo umbilicado durante o puerperio imediato. Além de corroborar na promoção do aleitamento materno e na prevenção de desmame precoce, demonstra a possibilidade da enfermagem relacionar o saber teórico-científico com o saber tecnico-prático, na saúde da mulher e da criança, com tecnologia adequada às necessidades, à compreensão e ao bem estar da população.

  4. Hidroginástica na terceira idade

    OpenAIRE

    Paula, Karla Campos de; Paula, Débora Campos de

    1998-01-01

    O processo de envelhecimento no indivíduo saudável está relacionado com inúmeras alterações psicológicas e físicas que interferem na área motora, concorrendo para a inatividade e contribuindo para o aparecimento e agravamento de determinadas doenças, além de influenciar negativamente a realização das atividades de vida diária. Portanto, a prática de atividade física é fundamental para o idoso, não só na prevenção de doenças como na reabilitação de suas habilidades motoras, promovendo um estil...

  5. Labirintos na cidade contemporânea

    Directory of Open Access Journals (Sweden)

    Edson Luiz André de Sousa

    Full Text Available Este artigo pretende tensionar pontos de conexão e diluição de fronteiras entre as categorias público/privado, conversando com a literatura de Baudelaire e W. Benjamin, Fredric Jamenson e Marc Augé. Através da imagem do labirinto, símbolo da cidade antiga que se quis extinguir na cidade moderna, busca-se refletir sobre alguns caminhos e caminhantes considerados excedentes na cidade contemporânea. O cenário propulsor dessa reflexão é a experiência do jornal Boca de Rua, elaborado por moradores de rua na cidade de Porto Alegre.

  6. Crystal structure of a Na+-bound Na+,K+-ATPase preceding the E1P state.

    Science.gov (United States)

    Kanai, Ryuta; Ogawa, Haruo; Vilsen, Bente; Cornelius, Flemming; Toyoshima, Chikashi

    2013-10-10

    Na(+),K(+)-ATPase pumps three Na(+) ions out of cells in exchange for two K(+) taken up from the extracellular medium per ATP molecule hydrolysed, thereby establishing Na(+) and K(+) gradients across the membrane in all animal cells. These ion gradients are used in many fundamental processes, notably excitation of nerve cells. Here we describe 2.8 Å-resolution crystal structures of this ATPase from pig kidney with bound Na(+), ADP and aluminium fluoride, a stable phosphate analogue, with and without oligomycin that promotes Na(+) occlusion. These crystal structures represent a transition state preceding the phosphorylated intermediate (E1P) in which three Na(+) ions are occluded. Details of the Na(+)-binding sites show how this ATPase functions as a Na(+)-specific pump, rejecting K(+) and Ca(2+), even though its affinity for Na(+) is low (millimolar dissociation constant). A mechanism for sequential, cooperative Na(+) binding can now be formulated in atomic detail.

  7. A perda de chance na responsabilidade civil

    OpenAIRE

    Silva, Rute Eunice Andrade Teixeira da

    2017-01-01

    Resumo: O presente trabalho tem como objecto de estudo a teoria da perda de chance. Tema ainda controverso tanto na doutrina como na jurisprudência, urge fazer-se uma análise do mesmo no âmbito do direito português. Para um melhor entendimento sobre a figura da perda de chance, é necessário ter presente alguns aspectos do instituto da responsabilidade civil. Será realizada uma análise geral dos pressupostos da responsabilidade civil, versando-nos principalmente sobre o dano e o ne...

  8. O trabalho na África subsariana

    OpenAIRE

    Carneiro, Emmanuel Moreira

    2008-01-01

    A natureza do trabalho e do mercado de emprego na África subsariana está intrinsecamente ligado ao tipo de produção material dominante, à natureza das relações de produção estabelecidas, bem como ao inerente sistema de formação e distribuição do rendimento. É ainda profundamente condicionada pela evolução do processo de estruturação mundial do capitalismo, o qual se traduz, na fase actual, pelo que se convencionou designar mundialização e globalização.

  9. A TEOLOGIA LATINO-AMERICANA NA ENCRUZILHADA

    Directory of Open Access Journals (Sweden)

    Victor Codina

    1999-01-01

    Full Text Available As mudanças ocorridas no mundo, no fim dos anos 80, não podem deixar de afetar a Teologia latino-americana e, muito concretamente, a Teologia da Libertação (TdL, teologia que nasceu na América Latina na década de 701. A TdL encontra-se hoje numa encruzilhada: retroceder e dar marcha a ré? Continuar repetindo o que até agora foi dito, como se nada tivesse acontecido?

  10. A Imagem como Ruína

    Directory of Open Access Journals (Sweden)

    Míriam Volpe

    2001-12-01

    Full Text Available O dialogismo ente o filme Citizen Kane, de Orson Welles, e o poema “Kubla Khan”, de S.T. Coleridgé, é analisado, sendo evidenciados não só o tema em comum – o mito do Paraíso perdido – como também a similariedade na organização do disurso na justaposição das images, como fragmentos da memória a serem preservados.

  11. Sexualidade na velhice e qualidade de vida

    OpenAIRE

    Viana, Helena Brandão; Madruga, Vera Aparecida

    2010-01-01

    O objetivo deste trabalho, realizado por meio de uma revisão de literatura, foi abordar uma revisão literária sobre a influência da sexualidade na qualidade de vida deidosos, temática pouco discutida nas diferentes áreas de pesquisas sobre envelhecimento. Diante da escassez de bibliografia na cultura brasileira, apresentou-se uma revisão de literatura sobre envelhecimento junto à temática da sexualidade, trazendo uma trajetória histórica sobre estudos de sexualidade ao longo do tempo, discuti...

  12. E-GRADIVA NA PRIMERU OBRAVNAVE GLAGOLA

    OpenAIRE

    Kajtna, Tjaša

    2013-01-01

    Sodobne tehnologije so korenito spremenile današnji način življenja. Tako je tudi z izobraževanjem. Vedno več učiteljev ob klasičnih metodah poučevanja uporablja tudi nove pristope, ki so povezani s sodobnimi tehnologijami. V diplomskem delu je opredeljeno e-izobraževanje, predstavljene so nove tehnologije, ki se pojavljajo v povezavi z le-tem. V nadaljevanju sledi teoretična obravnava e-gradiv, ki ob podpori informacijsko komunikacijskih tehnologij predstavljajo temelj e-izobraževanja. ...

  13. ANALIZA IZGUB NA OSLABLJENEM PRENAPETOSTNEM ODVODNIKU

    OpenAIRE

    Ajdnik, Miran

    2011-01-01

    Diplomska naloga obravnava problematiko izgub električne energije na oslabljenem prenapetostnem odvodniku na transformatorski postaji Kot-Makej (0,95/0,4 kV) in neozemljenem izvoru. Omenjena transformatorska postaja se napaja iz razdelilne transformatorske postaje Ravne (RTP RAVNE) preko 20 kV daljnovoda Mežica in transformatorske postaje Kot (20/0,95/0,4 kV). Rešitev je predstavljena s programskim orodjem MATLAB/Simulink iz knjižnice PowerSystem, s katerim je izvedena simulacija pri oslablje...

  14. Vpliv tripsinizacije na celice Caco-2.

    OpenAIRE

    Cuculić, Nika

    2018-01-01

    Caco-2 celična linija se uporablja v številnih predkliničnih raziskavah. Ena izmed najbolj izraženih lastnosti celične linije Caco-2 je njihova zmožnost spontane diferenciacije. Zaradi različnega rokovanja s celično linijo Caco-2 med laboratoriji, v kar spada tudi uporaba različnih koncentracij tripsina ter čas izpostavljenosti celic tripsinu, se rezultati raziskav med laboratoriji lahko zelo razlikujejo in niso primerljivi. Preverili smo vpliv različnih koncentracij tripsina na celično viabi...

  15. Izbor i prilagodba nadogradnje na implantatima

    OpenAIRE

    Belamarić, Sara

    2017-01-01

    Implantatne nadogradnje su spojni elementi između tijela implantata, kirurški postavljenog u kost, koji predstavlja zamjenu za prirodni korijen zuba i protetske suprastrukture kojom se nadoknađuje oblik, boja i funkcija zuba koji nedostaje. One predstavljaju središte funkcijskih i estetskih aspekata implantološke terapije. Imaju direktan utjecaj na dugoročnu prognozu i uspjeh ovog terapijskog postupka. Danas na tržištu postoji čitav niz dostupnih implantatnih nadogradnji. Najčešći materijali ...

  16. Recent results and prospects from NA62

    Directory of Open Access Journals (Sweden)

    Bizzeti Andrea

    2016-01-01

    K+ → π+ vv̄ is a theoretically very clean decay where indirect effects of new physics may be detectable. The NA62 apparatus has been significantly upgraded between 2008 and 2014 in order to measure the branching ratio of this decay with 10% precision. The NA62 experiment took data with the new setup in pilot runs in 2014 and 2015, reaching the design beam intensity. Results of first data quality studies in view of the 2016-2017 physics runs are presented.

  17. MEDGENERACIJSKI PRENOS ZNANJA NA DELOVNEM MESTU

    OpenAIRE

    Movern, Tina

    2015-01-01

    Prenos znanja med ljudmi igra ključno vlogo pri razvoju ter napredku človeštva. Nekaterih najbolj kompleksnih znanj kot so jeziki in kulturne norme, so lahko naučena oziroma priučena od drugih ljudi, ti pa so jih pridobili od prejšnjih generacij. Kot glavno gonilno silo razvoja neke organizacije bi prav lahko vzeli količino, kvaliteto in možnost upravljanja prenosa znanj v sami organizaciji, kar je tudi glavni predmet naše raziskave. Diplomska naloga je razdeljena na teoretični in empiri...

  18. Osteossarcoma parosteal: aspectos na radiologia convencional

    OpenAIRE

    Nanci Neto,Francisco; Marchiori,Edson; Vianna,Alberto Domingues; Aymoré,Ierecê Lins; Almeida,Ana Luiza Brito de; Irion,Klaus L.; Collares,Felipe Birchal

    2007-01-01

    OBJETIVO: Avaliar os achados clínicos mais importantes do osteossarcoma parosteal e descrever os seus aspectos mais comuns na radiologia convencional. MATERIAIS E MÉTODOS: Estudo retrospectivo com 26 pacientes com osteossarcoma parosteal, provenientes do arquivo do Clube do Osso, Rio de Janeiro, RJ, e análise dos principais achados clínicos e aspectos radiológicos. RESULTADOS: A doença predominou em pacientes do sexo feminino e teve idade média de acometimento na terceira década de vida. Os a...

  19. O problema do conhecimento verdadeiro na epidemiologia

    Directory of Open Access Journals (Sweden)

    Ayres José Ricardo de Carvalho Mesquita

    1992-01-01

    Full Text Available São examinadas as bases filosóficas da validação do conhecimento científico, com o intuito de estabelecer uma visão crítica a respeito da adoção das proposições de Popper na epidemiologia. Ressalta-se o caráter conservador que resulta das limitações técnicas implicadas na sua adoção, não obstante o evidente aumento da racionalidade e da criatividade heurística que propicia.

  20. Na+/K+-ATPase: Activity and inhibition

    Science.gov (United States)

    Čolović, M.; Krstić, D.; Krinulović, K.; Momić, T.; Savić, J.; Vujačić, A.; Vasić, V.

    2009-09-01

    The aim of the study was to give an overview of the mechanism of inhibition of Na+/K+-ATPase activity induced by some specific and non specific inhibitors. For this purpose, the effects of some ouabain like compounds (digoxin, gitoxin), noble metals complexes ([PtCl2DMSO2], [AuCl4]-, [PdCl4]2-, [PdCl(dien)]+, [PdCl(Me4dien)]+), transition metal ions (Cu2+, Zn2+, Fe2+, Co2+), and heavy metal ions (Hg2+, Pb2+, Cd2+) on the activity of Na+/K+-ATPase from rat synaptic plasma membranes (SPM), porcine cerebral cortex and human erythrocytes were discussed.

  1. Na, K-ATPase as signaling transducer

    OpenAIRE

    Li, Juan

    2007-01-01

    It is now generally agreed that Na,K-ATPase (NKA), in addition to its role in the maintenance of Na+ and K+ gradients across the cell membrane, is a signal transducer. Our group has identified a novel signaling pathway where NKA interact with IP3R to form a signaling microdomain. Ouabain, a specific ligand of NKA, activates this pathway, triggers slow Ca2+ oscillations and activates NF-κB. In current study, the molecular mechanisms and some important downstream effects of NK...

  2. Europlanet-2020 NA1 Exchange Program

    Science.gov (United States)

    Genzer, M.; Szego, K.; Haukka, H.; Harri, A.-M.

    2017-09-01

    The task of Exchange Program of NA1 is to support the activities of EPN2020 with experts and scientific exchange whenever it is needed. Short visits (up to 1 week) with the goal of improving infrastructure facilities and services offered to the scientific community are supported from this task. Since the start of the EPN2020 in September 2015 we have received and approved 14 applications for exchange program travel. More general and specifically targeted calls are planned for the future. The calls are announced on Europlanet-2020 NA1 web site.

  3. Abordagem neurologica na sindrome do X fragil

    OpenAIRE

    Marilisa Mantovani Guerreiro

    1993-01-01

    Resumo: Com o propósito de realizar a abordagem neurológica na Síndrome do X Frágil (SXF), estudaram-se 11 pacientes com este diagnóstico citogenético. A idade variou de 8 a 19 anos. Nove pacientes eram do sexo masculino e dois do feminino. Todos os indivíduos apresentaram pavilhões auriculares grandes e faces alongadas. Observou-se fronte proeminente em 63% dos casos e macrorquidia em 33% dentre aqueles do sexo masculino. Atraso na aquisição da fala, fala repetitiva, perseverativa, impulsiva...

  4. MANAGEMENT DOGODKOV NA PRIMERU NIKE KONVENCIJE

    OpenAIRE

    Kapić, Sara

    2010-01-01

    V diplomski nalogi je predstavljen potek ustvarjanja in izvedbe dogodka, ki zajema številne aktivnosti, in sicer na primeru Nike konvencije. Namen diplomske naloge je namreč podati kritično oceno izvajanja aktivnosti, z namenom ugotoviti, katere aktivnosti bi se v okviru upravljanja z dogodkom lahko izpeljale boljše in podati predloge za uspešnejšo zasnovo in organizacijo naslednje Nike konvencije. Na podlagi posnetka je ugotovljeno, da je pri organizaciji, vodenju, izvedbi in nadzoru prihaja...

  5. Alterações cognitivas na esquizofrenia

    OpenAIRE

    THEIL, Ruth Bonow

    2003-01-01

    Este estudo é uma revisão da literatura sobre o comprometimento cognitivo na esquizofrenia. Objetivou-se a análise da natureza e do padrão desse comprometimento, o estabelecimento de associações entre as variáveis clínicas e o desempenho neuropsicológico, e a determinação das correlações entre os déficits cognitivos na esquizofrenia e seus substratos neurais subjacentes. Foram inicialmente revistos os conceitos de esquizofrenia e sua evolução histórica, aspectos clínicos, cl...

  6. IDENTIDADE E CORPO NA MARCHA DAS VADIAS

    OpenAIRE

    Ribeiro Quintanilha de Souza, Aline

    2015-01-01

    O objetivo deste trabalho é analisar os temas de identidade de gênero e corporalidade na Marcha das Vadias. Esta é um movimento social que tem recebido visibilidade e experimentado um grande crescimento em adeptos e importância para as questões de gênero no Brasil. Este trabalho busca entender como práticas corporais são construídas para um objetivo político específico. Pretendo relacionar as principais reivindicações políticas desenvolvidas na manifestação com a construção da identidade "vad...

  7. Glutathionylation-Dependence of Na(+)-K(+)-Pump Currents Can Mimic Reduced Subsarcolemmal Na(+) Diffusion.

    Science.gov (United States)

    Garcia, Alvaro; Liu, Chia-Chi; Cornelius, Flemming; Clarke, Ronald J; Rasmussen, Helge H

    2016-03-08

    The existence of a subsarcolemmal space with restricted diffusion for Na(+) in cardiac myocytes has been inferred from a transient peak electrogenic Na(+)-K(+) pump current beyond steady state on reexposure of myocytes to K(+) after a period of exposure to K(+)-free extracellular solution. The transient peak current is attributed to enhanced electrogenic pumping of Na(+) that accumulated in the diffusion-restricted space during pump inhibition in K(+)-free extracellular solution. However, there are no known physical barriers that account for such restricted Na(+) diffusion, and we examined if changes of activity of the Na(+)-K(+) pump itself cause the transient peak current. Reexposure to K(+) reproduced a transient current beyond steady state in voltage-clamped ventricular myocytes as reported by others. Persistence of it when the Na(+) concentration in patch pipette solutions perfusing the intracellular compartment was high and elimination of it with K(+)-free pipette solution could not be reconciled with restricted subsarcolemmal Na(+) diffusion. The pattern of the transient current early after pump activation was dependent on transmembrane Na(+)- and K(+) concentration gradients suggesting the currents were related to the conformational poise imposed on the pump. We examined if the currents might be accounted for by changes in glutathionylation of the β1 Na(+)-K(+) pump subunit, a reversible oxidative modification that inhibits the pump. Susceptibility of the β1 subunit to glutathionylation depends on the conformational poise of the Na(+)-K(+) pump, and glutathionylation with the pump stabilized in conformations equivalent to those expected to be imposed on voltage-clamped myocytes supported this hypothesis. So did elimination of the transient K(+)-induced peak Na(+)-K(+) pump current when we included glutaredoxin 1 in patch pipette solutions to reverse glutathionylation. We conclude that transient K(+)-induced peak Na(+)-K(+) pump current reflects the effect

  8. In vivo PTH provokes apical NHE3 and NaPi2 redistribution and Na-K-ATPase inhibition

    DEFF Research Database (Denmark)

    Zhang, Y; Norian, J M; Magyar, C E

    1999-01-01

    The aim of this study was to test the hypothesis that in vivo administration of parathyroid hormone (PTH) provokes diuresis/natriuresis through redistribution of proximal tubule apical sodium cotransporters (NHE3 and NaPi2) to internal stores and inhibition of basolateral Na-K-ATPase activity....../diuresis and NHE3 and NaPi2 internalization, and that Na-K-ATPase inhibition is not secondary to depressed apical Na+ transport....

  9. Water transport by the renal Na(+)-dicarboxylate cotransporter

    DEFF Research Database (Denmark)

    Meinild, A K; Loo, D D; Pajor, A M

    2000-01-01

    This study investigated the ability of the renal Na(+)-dicarboxylate cotransporter, NaDC-1, to transport water. Rabbit NaDC-1 was expressed in Xenopus laevis oocytes, cotransporter activity was measured as the inward current generated by substrate (citrate or succinate), and water transport...... was monitored by the changes in oocyte volume. In the absence of substrates, oocytes expressing NaDC-1 showed an increase in osmotic water permeability, which was directly correlated with the expression level of NaDC-1. When NaDC-1 was transporting substrates, there was a concomitant increase in oocyte volume....... This solute-coupled influx of water took place in the absence of, and even against, osmotic gradients. There was a strict stoichiometric relationship between Na(+), substrate, and water transport of 3 Na(+), 1 dicarboxylate, and 176 water molecules/transport cycle. These results indicate that the renal Na...

  10. Intracellular Na(+) and metabolic modulation of Na/K pump and excitability in the rat suprachiasmatic nucleus neurons.

    Science.gov (United States)

    Wang, Yi-Chi; Yang, Jyh-Jeen; Huang, Rong-Chi

    2012-10-01

    Na/K pump activity and metabolic rate are both higher during the day in the suprachiasmatic nucleus (SCN) that houses the circadian clock. Here we investigated the role of intracellular Na(+) and energy metabolism in regulating Na/K pump activity and neuronal excitability. Removal of extracellular K(+) to block the Na/K pump excited SCN neurons to fire at higher rates and return to normal K(+) to reactivate the pump produced rebound hyperpolarization to inhibit firing. In the presence of tetrodotoxin to block the action potentials, both zero K(+)-induced depolarization and rebound hyperpolarization were blocked by the cardiac glycoside strophanthidin. Ratiometric Na(+) imaging with a Na(+)-sensitive fluorescent dye indicated saturating accumulation of intracellular Na(+) in response to pump blockade with zero K(+). The Na(+) ionophore monensin also induced Na(+) loading and hyperpolarized the membrane potential, with the hyperpolarizing effect of monensin abolished in zero Na(+) or by pump blockade. Conversely, Na(+) depletion with Na(+)-free pipette solution depolarized membrane potential but retained residual Na/K pump activity. Cyanide inhibition of oxidative phosphorylation blocked the Na/K pump to depolarize resting potential and increase spontaneous firing in most cells, and to raise intracellular Na(+) levels in all cells. Nonetheless, the Na/K pump was incompletely blocked by cyanide but completely blocked by iodoacetate to inhibit glycolysis, indicating the involvement of both oxidative phosphorylation and glycolysis in fueling the Na/K pump. Together, the results indicate the importance of intracellular Na(+) and energy metabolism in regulating Na/K pump activity as well as neuronal excitability in the SCN neurons.

  11. Presoja notranjih kontrol pri obračunu davka na dodano vrednost na primeru "Podjetja x"

    OpenAIRE

    Majcen, Borut

    2016-01-01

    Poslovanje podjetja si je ob odsotnosti notranjih kontrol nemogoče predstavljati. Podjetja so podvržena raznim tveganjem, še posebej v današnjih razmerah globalnega poslovanja, ko se podjetja soočajo z vedno novimi izzivi, kar prinaša tudi nova tveganja. Najučinkovitejši ukrep za obvladovanje tveganj predstavlja vzpostavitev sistema notranjih kontrol. Obvladovanje tveganj pa ne poteka samo na ravni podjetja kot celote, ampak je prisotno na vseh področjih delovanja podjetja, torej tudi na p...

  12. (1) Na-Allah et al

    African Journals Online (AJOL)

    Adeyinka Odunsi

    Na-Allah, Y., Zamnao, A. *Garba, S. and Abdullahi, A. U.. Department of Animal Science, Faculty of Agriculture,. Usmanu Danfodiyo University, P. M. B. 2346, Sokoto-Nigeria. *Corresponding author: email; sanigarba2003@yahoo.com Phone no. +234(0)8067090255. Abstract. This study evaluated the pre-‐weaning growth ...

  13. Habitus professoral na sala de aula virtual

    Directory of Open Access Journals (Sweden)

    Alexandre Marinho Pimenta

    2014-09-01

    Full Text Available Entendendo que a indiferença na ação pedagógica contribui para a reprodução das desigualdades no sistema de ensino, o presente artigo busca captar, a partir de entrevistas semiestruturadas, traços do habitus de professores supervisores de disciplinas do curso de Licenciatura em Pedagogia na modalidade a distância na Universidade de Brasília - UnB no âmbito do Sistema Universidade Aberta do Brasil - UAB. As orientações metodológicas de Bourdieu (2007 foram um dos elementos orientadores na análise das entrevistas, considerando ainda o uso heurístico do conceito de habitus. Conclui-se que o habitus professoral envolve esforços voluntários em busca de uma ação pedagógica diferenciada. No entanto, ele é ambíguo e condescendente frente aos limites do modelo de EaD no âmbito da UAB. Ao fim, os dados analisados permitem fornecer elementos para reorientação político-pedagógica que vise a um novo modelo de EaD nacional.

  14. Le Hodler d'Iéna

    OpenAIRE

    2017-01-01

    Suites de la protestation contre le bombardement de la cathédrale de Reims. Nouvelle proposition de M. Gunsburger pour le rachat du tableau de Hodler "Départ des étudiants d'Iéna pour la guerre de libération contre Napoléon en 1813".

  15. Study of deconfinement in NA50

    Indian Academy of Sciences (India)

    Corrado Cicalo

    from the forward hadronic energy measured in the very forward hadronic calorimeter. 2. Experimental setup and data selection. The NA50 apparatus [6] mainly consists of a muon spectrometer, a segmented active target and three independent centrality detectors: an electromagnetic calorimeter which measures the neutral ...

  16. Pijn tijdens of na de wortelkanaalbehandeling

    NARCIS (Netherlands)

    Wesselink, P.R.

    2012-01-01

    Een wortelkanaalbehandeling kan pijn veroorzaken tijdens en/of na de behandeling. Tijdens de behandeling moet dan onderscheid worden gemaakt tussen pijn bij een pulpitis en pijn bij een necrotische pulpa. In beide gevallen kan die pijn effectief worden bestreden, afhankelijk van de toestand waarin

  17. Leitura na escola: um barco à deriva?

    Directory of Open Access Journals (Sweden)

    Teixeira, Marlene

    2008-01-01

    Full Text Available Este artigo busca, na teoria da enunciação de É. Benveniste, elementos para repensar o trabalho com a leitura na escola. Considera que, na discussão das noções gêmeas de forma e sentido, o autor formula uma concepção de significado que, de um lado, pode deter a interpretação à deriva, implicada na visão de leitura centrada no leitor, e, de outro lado, possibilita que se transcenda a idéia de que é pela decifração mdo código que se dá o processo de construção do significado. Conclui que, no processo de leitura, é sempre de um trabalho com a língua que se trata, trabalho que se renova a cada ato de aproximação do aluno com o texto, porque a língua é submetida ao ato de enunciação

  18. NA49: lead-lead collision

    CERN Multimedia

    1996-01-01

    This is an image of an actual lead ion collision taken from tracking detectors on the NA49 experiment, part of the heavy ion project at CERN. These collisions produce a very complicated array of hadrons as the heavy ions break up. It is hoped that one of these collisions will eventually create a new state of matter known as quark-gluon plasma.

  19. Nucleotide binding to Na+/K+-ATPase

    Czech Academy of Sciences Publication Activity Database

    Kubala, Martin; Lánský, Zdeněk; Ettrich, R.; Plášek, J.; Teisinger, Jan; Amler, Evžen

    2005-01-01

    Roč. 272, č. S1 (2005), s. 191-191 E-ISSN 1742-4658. [FEBS Congress /30./ and IUBMB Conference /9./. 02.07.2005-07.07.2005, Budapest] Keywords : Na+/K+- ATPase * ATP binding * TNP-ATP Subject RIV: BO - Biophysics

  20. Therapy of hyperthyroidism with Na131I

    International Nuclear Information System (INIS)

    Kakehi, Hirotake; Furukawa, Takashi; Fukakusa, Shunichi; Futonaka, Hiroshi; Takahashi, Yuji

    1984-01-01

    Forty one patients of hyperthyroidism were treated with Na 131 I. Men and women are in the ratio 1:3.1. The ages of patients are between twenties and sixties and the forties are the highest in number. The observation period of clinical courses is between 1 and 8 years. The number of patients observed over 5 years are 51% of them and over 2 years are 83%. The treatment frequency is as follows: On 37 cases each one was treated once with Na 131 I. 2 cases twice, 1 case at 4 times in 3 years and 1 case at 5 times in 6 years. The treatment doses are between 4,000-6,000 rad (40-60 Gray). In the cases treated with the irradiation dose of 6,000 rad, we often saw hypothyroidism. In cases aiming 4,000-5,000 rad, there is a tendency of leaving hyperthyroidism unrecovered. In conclusion, the patients should be treated giving 4,000-5,000 rad or with Na 131 I doses of 3-6mCi. If the effects of the treatment are insufficient, the patients should be further treated with anti-thyroid drug or treated again with Na 131 I. As the result, there are at present 25 cases (61.0%) in normal status of the thyroid gland, 12 cases (29.2%) in hyperthyroidism and 4 cases (9.8%) in hypothyroidism totaling 41 cases in all. (author)

  1. NA48: Wiring up for Change

    CERN Multimedia

    2001-01-01

    The NA48 Collaboration is rebuilding its drift chambers ready for the experiment to start up again this coming July. An intricate task involving the soldering of over 24,000 wires! The future of the NA48 experiment is coming right down to the wire, that is, the wires which the Collaboration is installing in the clean room of Hall 887 on the Prévessin site. Six days a week, technicians are working in shifts to rebuild the experiment's drift chambers. The original chambers were damaged when a section of a vacuum tube imploded at the end of 1999. A year ago, CERN gave the green light for this essential part of the spectrometer to be rebuilt, so the NA48 experiment, which studies CP violation (see box), still has a bright future ahead of it. Three years of data-taking ahead The NA48 experiment aims to penetrate the secrets of CP (Charge Parity) violation. Charge and parity are two parameters which distinguish a particle from an antiparticle. In other words, an electron possesses a negative electric ...

  2. Study of deconfinement in NA50

    Indian Academy of Sciences (India)

    Corrado Cicalo

    The anomalous J/ψ pattern suppression observed in NA50 experiment is a clear evidence of the transition to a deconfined state of matter. Acknowledgements. This work was partially supported by Fundaç˜ao para a Ciência e a Tecnologia, by INTAS grant 96-0231 and by the Russian Foundation for Fundamental Research, ...

  3. IZOBRAŽEVANJE NA DOMU - ŠTUDIJA PRIMERA

    OpenAIRE

    Križan, Urška

    2014-01-01

    V teoretičnem delu se skozi literaturo seznanjamo z zakoni, ki na območju Republike Slovenije urejajo izobraževanje na domu, pa tudi s smernicami, ki veljajo na področju organiziranosti takega pouka. Po enem tednu, ki smo ga preživeli na domačiji skupaj s tremi šoloobveznimi otroki, ki se šolajo na domu, ugotavljamo, da je izvajanje izobraževanja na domu zmeraj v skladu z zakoni in pogosto v skladu s smernicami.

  4. Effects of non-uniform root zone salinity on water use, Na+ recirculation, and Na+ and H+ flux in cotton.

    Science.gov (United States)

    Kong, Xiangqiang; Luo, Zhen; Dong, Hezhong; Eneji, A Egrinya; Li, Weijiang

    2012-03-01

    A new split-root system was established through grafting to study cotton response to non-uniform salinity. Each root half was treated with either uniform (100/100 mM) or non-uniform NaCl concentrations (0/200 and 50/150 mM). In contrast to uniform control, non-uniform salinity treatment improved plant growth and water use, with more water absorbed from the non- and low salinity side. Non-uniform treatments decreased Na(+) concentrations in leaves. The [Na(+)] in the '0' side roots of the 0/200 treatment was significantly higher than that in either side of the 0/0 control, but greatly decreased when the '0' side phloem was girdled, suggesting that the increased [Na(+)] in the '0' side roots was possibly due to transportation of foliar Na(+) to roots through phloem. Plants under non-uniform salinity extruded more Na(+) from the root than those under uniform salinity. Root Na(+) efflux in the low salinity side was greatly enhanced by the higher salinity side. NaCl-induced Na(+) efflux and H(+) influx were inhibited by amiloride and sodium orthovanadate, suggesting that root Na(+) extrusion was probably due to active Na(+)/H(+) antiport across the plasma membrane. Improved plant growth under non-uniform salinity was thus attributed to increased water use, reduced leaf Na(+) concentration, transport of excessive foliar Na(+) to the low salinity side, and enhanced Na(+) efflux from the low salinity root.

  5. Synthesis of Na-A and/or Na-X zeolite/porous carbon composites from carbonized rice husk

    Science.gov (United States)

    Katsuki, Hiroaki; Komarneni, Sridhar

    2009-07-01

    Na-A and/or Na-X zeolite/porous carbon composites were prepared under hydrothermal conditions by NaOH dissolution of silica first from carbonized rice husk followed by addition of NaAlO 2 and in situ crystallization of zeolites i.e., using a two-step process. When a one-step process was used, both Na-A and Na-X zeolites crystallized on the surface of carbon. Na-A or Na-X zeolite crystals were prepared on the porous carbonized rice husk at 90 °C for 2-6 h by changing the SiO 2/Al 2O 3, H 2O/Na 2O and Na 2O/SiO 2 molar ratios of precursors in the two-step process. The surface area and NH 4+-cation exchange capacity (CEC) of Na-A zeolite/porous carbon were found to be 171 m 2/g and 506 meq/100 g, respectively, while those of Na-X zeolite/porous carbon composites were 676 m 2/g and 317 meq/100 g, respectively. Na-A and Na-X zeolites are well-known microporous and hydrophilic materials while carbonized rice husk was found to be mesoporous (pores of ˜3.9 nm) and hydrophobic. These hybrid microporous-mesoporous and hydrophilic-hydrophobic composites are expected to be useful for decontamination of metal cations as well as organic contaminants simultaneously.

  6. Batrachotoxin-activated Na+ channels in planar lipid bilayers. Competition of tetrodotoxin block by Na+.

    Science.gov (United States)

    Moczydlowski, E; Garber, S S; Miller, C

    1984-11-01

    Single Na+ channels from rat skeletal muscle plasma membrane vesicles were inserted into planar lipid bilayers formed from neutral phospholipids and were observed in the presence of batrachotoxin. The batrachotoxin-modified channel activates in the voltage range -120 to -80 mV and remains open almost all the time at voltages positive to -60 mV. Low levels of tetrodotoxin (TTX) induce slow fluctuations of channel current, which represent the binding and dissociation of single TTX molecules to single channels. The rates of association and dissociation of TTX are both voltage dependent, and the association rate is competitively inhibited by Na+. This inhibition is observed only when Na+ is increased on the TTX binding side of the channel. The results suggest that the TTX receptor site is located at the channel's outer mouth, and that the Na+ competition site is not located deeply within the channel's conduction pathway.

  7. High-temperature phases of NaNbO3 and NaTaO3.

    Science.gov (United States)

    Darlington; Knight

    1999-02-01

    The high-temperature phases of the perovskites sodium niobate, NaNbO(3), and sodium tantalate, NaTaO(3), have been re-examined using the high-resolution powder diffractometer HRPD at the ISIS neutron spallation source; the two materials show the same sequence of phases with tilted octahedra. Diffraction patterns were measured every 5 K allowing structural changes with temperature within a single phase to be determined for the first time. Previous structure determinations within one phase had been performed at a single temperature only. The octahedra are tilted about pseudocubic directions and are also deformed; the magnitude of the deformation is shown to be proportional to the square of the angle of tilt as expected from a phenomenological theory applied to such transitions. The structures of NaNbO(3) between 753 and 793 K and of NaTaO(3) below 758 K are not as reported in the literature.

  8. Transmural gradients in Na/K pump activity and [Na+]I in canine ventricle.

    Science.gov (United States)

    Gao, J; Wang, W; Cohen, I S; Mathias, R T

    2005-09-01

    There are well-documented differences in ion channel activity and action potential shape between epicardial (EPI), midmyocardial (MID), and endocardial (ENDO) ventricular myocytes. The purpose of this study was to determine if differences exist in Na/K pump activity. The whole cell patch-clamp was used to measure Na/K pump current (I(P)) and inward background Na(+)-current (I(inb)) in cells isolated from canine left ventricle. All currents were normalized to membrane capacitance. I(P) was measured as the current blocked by a saturating concentration of dihydro-ouabain. [Na(+)](i) was measured using SBFI-AM. I(P)(ENDO) (0.34 +/- 0.04 pA/pF, n = 17) was smaller than I(P)(EPI) (0.68 +/- 0.09 pA/pF, n = 38); the ratio was 0.50 with I(P)(MID) being intermediate (0.53 +/- 0.13 pA/pF, n = 19). The dependence of I(P) on [Na(+)](i) or voltage was essentially identical in EPI and ENDO (half-maximal activation at 9-10 mM [Na(+)](i) or approximately -90 mV). Increasing [K(+)](o) from 5.4 to 15 mM caused both I(P)(ENDO) and I(P)(EPI) to increase, but the ratio remained approximately 0.5. I(inb) in EPI and ENDO were nearly identical ( approximately 0.6 pA/pF). Physiological [Na(+)](i) was lower in EPI (7 +/- 2 mM, n = 31) than ENDO (12 +/- 3 mM, n = 29), with MID being intermediate (9 +/- 3 mM, n = 22). When cells were paced at 2 Hz, [Na(+)](i) increased but the differences persisted (ENDO 14 +/- 3 mM, n = 10; EPI 9 +/- 2 mM, n = 10; and MID intermediate, 11 +/- 2 mM, n = 9). Based on these results, the larger I(P) in EPI appears to reflect a higher maximum turnover rate, which implies either a larger number of active pumps or a higher turnover rate per pump protein. The transmural gradient in [Na(+)](i) means physiological I(P) is approximately uniform across the ventricular wall, whereas transporters that utilize the transmembrane electrochemical gradient for Na(+), such as Na/Ca exchange, have a larger driving force in EPI than ENDO.

  9. Isotope separation of 22Na and 24Na with using light induced drift effect

    International Nuclear Information System (INIS)

    Hradecny, C.; Tethal, T.; Ermolaev, I.M.; Zemlyanoj, S.G.; Zuzaan, P.

    1993-01-01

    The LIDIS (Light Drift Isotope Separation) separator without a gas flow is discussed. It is shown, that atomization degree of the separated isotopes limited real separation coefficient. The better buffer gas purification allowed to increase the experimental separation factor of 22 Na and 24 Na isotopes up to 25. The new experimental set up allow to increase the separation efficiency up to 50%. 12 refs.; 5 figs

  10. Transformation of Thematic Cartography Domain Ontology into Java Interfaces and Clasess / Transformace Doménové Ontologie Tematické Kartografie Na Java Rozhraní A Třídy

    Directory of Open Access Journals (Sweden)

    Peňáz Tomáš

    2011-12-01

    Full Text Available Článek pojednává o transformaci experimentální znalostní ontologie, soustřeďující vybrané deklarativní kartografické znalosti pro doménu tematické kartografie, na třídy a rozhraní jazyka Java. Důvodem transformace je přenos deklarativních znalostí z oblasti tematické kartografie, do podoby programového kódu v jazyce Java. Vzniklý programový kód, obsahující deklarace rozhraní a tříd, bude dále využit pro tvorbu programové aplikace inteligentního systému pro interaktivní podporu tvorby tematických map. Připravovaný pilotní projekt tohoto znalostního systému je určen pro uživatele bez potřebných kartografických znalostí, kterým umožní interaktivně vytvářet tematické mapy a poskytne jim při tom podporu. Smyslem využití takového nástroje je zamezit uživateli odchýlení od zavedených kartografických pravidel a zabránit vzniku hrubých chyb ve výsledné mapě.

  11. Intracellular Na+ regulation of Na+ pump sites in cultured vascular smooth muscle cells

    International Nuclear Information System (INIS)

    Allen, J.C.; Navran, S.S.; Seidel, C.L.; Dennison, D.K.; Amann, J.M.; Jemelka, S.K.

    1989-01-01

    Enzymatically dispersed cells from canine saphenous vein and femoral artery were grown in fetal calf serum and studied at day 0 (freshly dispersed) through confluence in primary culture. Intracellular Na levels (Nai), but not intracellular K (Ki), were increased after 24 h in culture and then decreased to a steady state by 4 days. Na+ pump site number [( 3 H] ouabain binding) increased through day 3 and remained elevated. Nai was still elevated at 2 days when the Na+ pump site number began to increase. Total pump turnover (maximum ouabain-inhibited 86 Rb uptake) reflected the increase in Na+ pump site number. These key events precede the observed increases in both protein production and cellular proliferation. If the same cells are maintained in defined medium, without fetal calf serum, Nai, Ki, and the number of [ 3 H]ouabain binding sites do not change with time. These data are consistent with the suggestion that the initial mitogenic response of vascular smooth muscle cells to fetal calf serum involves an increased Na+ influx, and a Nai accumulation, caused by low Na+ pump density. The synthesis of new pump sites effects a decrease in the accumulated Nai, which may be related to cell proliferation

  12. Na+-NQR (Na+-translocating NADH:ubiquinone oxidoreductase) as a novel target for antibiotics.

    Science.gov (United States)

    Dibrov, Pavel; Dibrov, Elena; Pierce, Grant N

    2017-09-01

    The recent breakthrough in structural studies on Na+-translocating NADH:ubiquinone oxidoreductase (Na+-NQR) from the human pathogen Vibrio cholerae creates a perspective for the systematic design of inhibitors for this unique enzyme, which is the major Na+ pump in aerobic pathogens. Widespread distribution of Na+-NQR among pathogenic species, its key role in energy metabolism, its relation to virulence in different species as well as its absence in eukaryotic cells makes this enzyme especially attractive as a target for prospective antibiotics. In this review, the major biochemical, physiological and, especially, the pharmacological aspects of Na+-NQR are discussed to assess its 'target potential' for drug development. A comparison to other primary bacterial Na+ pumps supports the contention that NQR is a first rate prospective target for a new generation of antimicrobials. A new, narrowly targeted furanone inhibitor of NQR designed in our group is presented as a molecular platform for the development of anti-NQR remedies. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  13. Active transport of Na/sup +/ by reconstituted Na,K-ATPase

    Energy Technology Data Exchange (ETDEWEB)

    Boldyrev, A.A.; Svinukhova, I.A.

    1987-02-20

    The ability of ATP, CTP, ITP, GTP, and UTP to support ouabain-sensitive accumulation of Na/sup +/ by proteoliposomes with a reconstituted Na/K-pump was investigated. At a low (Na/sup +/)/(K/sup +/) ratio in the medium (20 mM/50 mM), a correlation is observed between the proton-accepting capacity of the nucleotide and its effectiveness as a substrate of active transport. To test the hypothesis of the importance of the presence of a negative charge in the 1-position of the purine (3-pyrimidine) base of the nucleotide for mutual transitions between the Na- and K-conformations of Na,K-ATPase they used two analogs of ATP: N/sub 1/-hydroxy-ATP, possessing proton acceptor capacity, and N/sub 1/-methoxy-ATP, in the molecule of which the negative charge is quenched by a methyl group. The first substrate supports active accumulation of Na/sup +/ in proteoliposomes at the same rate as ATP, whereas the second substrate is relatively ineffective.

  14. Hidroginástica na terceira idade

    Directory of Open Access Journals (Sweden)

    Karla Campos de Paula

    1998-02-01

    Full Text Available O processo de envelhecimento no indivíduo saudável está relacionado com inúmeras alterações psicológicas e físicas que interferem na área motora, concorrendo para a inatividade e contribuindo para o aparecimento e agravamento de determinadas doenças, além de influenciar negativamente a realização das atividades de vida diária. Portanto, a prática de atividade física é fundamental para o idoso, não só na prevenção de doenças como na reabilitação de suas habilidades motoras, promovendo um estilo de vida saudável que é fator preponderante para a melhoria da qualidade de vida. Contudo, algumas precauções devem ser adotadas na prescrição da atividade direcionada para o idoso, a fim de que esta seja segura e prazerosa. Dentre os exercícios mais adequados aos idosos estão a caminhada, o ciclismo, a natação e a hidroginástica. Devido a sua grande procura, a hidroginástica vem aumentando o número de adeptos na terceira idade. Ela propicia ao idoso o aumento de sua capacidade aeróbia, força muscular, flexibilidade articular e o treinamento de habilidades específicas como equilíbrio e coordenação motora. Soma-se ainda o fato de esta atividade oferecer ambiente de relaxamento e incentivo ao contato social, atuando no combate ao estresse, depressão, na melhoria da autopercepção corporal e da auto-estima. Devemos, então, estar atentos às particularidades da hidroginástica, a fim de aproveitar todas as vantagens que esta oferece para o programa de exercícios direcionado para a terceira idade.

  15. Agmag Igbo dka Ngwar n'kwalite Ezi Nchekwa na Nkwsiike haobodo

    African Journals Online (AJOL)

    Ka Najira nwerechara onwe ya n'af 1960, olileanya tt mamala ya b na ihe ga-adz mma. Mana ka oge na-aga, a chptara na ihe na-akawanye nj. Usoro chch d iche iche daptara. Nd am na nd nkt achala mana nd gara n'ihu na-akawanye nj. O bu ihe doro anya na chch ha b nke nchgbu na fnfju akpa. N'agbanyegh na ...

  16. Transport of Na48 Drift Chambers to Dubna

    CERN Multimedia

    GOLOVATYUK, V

    2010-01-01

    On 22 July, in the occasion of the departure of the Na48 Drift Chambers from CERN, Mikhail Itkis (acting Director of the JIINR) and Rolf Heuer (CERN Director General) visited the NA62 experimental area.

  17. Angiotensin II-induced hypertension increases plasma membrane Na pump activity by enhancing Na entry in rat thick ascending limbs.

    Science.gov (United States)

    Gonzalez-Vicente, Agustin; Garvin, Jeffrey L

    2013-11-01

    Thick ascending limbs (TAL) reabsorb 30% of the filtered NaCl load. Na enters the cells via apical Na-K-2Cl cotransporters and Na/H exchangers and exits via basolateral Na pumps. Chronic angiotensin II (ANG II) infusion increases net TAL Na transport and Na apical entry; however, little is known about its effects on the basolateral Na pump. We hypothesized that in rat TALs Na pump activity is enhanced by ANG II-infusion, a model of ANG II-induced hypertension. Rats were infused with 200 ng·kg(-1)·min(-1) ANG II or vehicle for 7 days, and TAL suspensions were obtained. We studied plasma membrane Na pump activity by measuring changes in 1) intracellular Na (Nai) induced by ouabain; and 2) ouabain-sensitive oxygen consumption (QO2). We found that the ouabain-sensitive rise in Nai in TALs from ANG II-infused rats was 12.8 ± 0.4 arbitrary fluorescent units (AFU)·mg(-1)·min(-1) compared with only 9.9 ± 1.1 AFU·mg(-1)·min(-1) in controls (P Na pump expression, the number of Na pumps in the plasma membrane, or the affinity for Na. When furosemide (1.1 mg·kg(-1)·day(-1)) was coinfused with ANG II, no increase in plasma membrane Na pump activity was observed. We concluded that in ANG II-induced hypertension Na pump activity is increased in the plasma membrane of TALs and that this increase is caused by the chronically enhanced Na entry occurring in this model.

  18. Rescue of Na+ affinity in aspartate 928 mutants of Na+,K+-ATPase by secondary mutation of glutamate 314.

    Science.gov (United States)

    Holm, Rikke; Einholm, Anja P; Andersen, Jens P; Vilsen, Bente

    2015-04-10

    The Na(+),K(+)-ATPase binds Na(+) at three transport sites denoted I, II, and III, of which site III is Na(+)-specific and suggested to be the first occupied in the cooperative binding process activating phosphorylation from ATP. Here we demonstrate that the asparagine substitution of the aspartate associated with site III found in patients with rapid-onset dystonia parkinsonism or alternating hemiplegia of childhood causes a dramatic reduction of Na(+) affinity in the α1-, α2-, and α3-isoforms of Na(+),K(+)-ATPase, whereas other substitutions of this aspartate are much less disruptive. This is likely due to interference by the amide function of the asparagine side chain with Na(+)-coordinating residues in site III. Remarkably, the Na(+) affinity of site III aspartate to asparagine and alanine mutants is rescued by second-site mutation of a glutamate in the extracellular part of the fourth transmembrane helix, distant to site III. This gain-of-function mutation works without recovery of the lost cooperativity and selectivity of Na(+) binding and does not affect the E1-E2 conformational equilibrium or the maximum phosphorylation rate. Hence, the rescue of Na(+) affinity is likely intrinsic to the Na(+) binding pocket, and the underlying mechanism could be a tightening of Na(+) binding at Na(+) site II, possibly via movement of transmembrane helix four. The second-site mutation also improves Na(+),K(+) pump function in intact cells. Rescue of Na(+) affinity and Na(+) and K(+) transport by second-site mutation is unique in the history of Na(+),K(+)-ATPase and points to new possibilities for treatment of neurological patients carrying Na(+),K(+)-ATPase mutations. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  19. Characterization of Na+-linked and Na+-independent Cl-/HCO3- exchange systems in Chinese hamster lung fibroblasts

    International Nuclear Information System (INIS)

    Cassel, D.; Scharf, O.; Rotman, M.; Cragoe, E.J. Jr.; Katz, M.

    1988-01-01

    The PS120 variant of Chinese hamster lung fibroblasts which lacks Na + /H + exchange activity was used to investigate bicarbonate transport systems and their role in intracellular pH (pH/sub i/) regulation. When pH/sub i/ was decreased by acid load, bicarbonate caused pH/sub i/ increase and stimulated 36 Cl - efflux from the cells, both in a Na + -dependent manner. These results together with previous findings that bicarbonate stimulates 22 Na + uptake in PS120 cells demonstrate the presence of a Na + -linked Cl - /HCO 3 - exchange system. In cells with normal initial pH/sub i/, bicarbonate caused Na + -independent pH/sub i/ increase in Cl - -free solutions and stimulated Na + -independent 36 Cl - efflux, indicating that a Na + -independent Cl - /HCO 3 - exchanger is also present in the cell. Na + -linked and Na + -independent Cl - /HCO 3- exchange is apparently mediated by two distinct systems, since a [(tetrahydrofluorene-7-yl)oxy]acetic acid derivative selectively inhibits the Na + -independent exchanger. An additional distinctive features is a 10-fold lower affinity for chloride of the Na + -linked exchanger. The Na + -linked and Na + -independent Cl - /HCO 3 - exchange systems are likely to protect the cell from acid and alkaline load, respectively

  20. The two C-terminal tyrosines stabilize occluded Na/K pump conformations containing Na or K ions.

    Science.gov (United States)

    Vedovato, Natascia; Gadsby, David C

    2010-07-01

    Interactions of the three transported Na ions with the Na/K pump remain incompletely understood. Na/K pump crystal structures show that the extended C terminus of the Na,K-adenosine triphosphatase (ATPase) alpha subunit directly contacts transmembrane helices. Deletion of the last five residues (KETYY in almost all Na/K pumps) markedly lowered the apparent affinity for Na activation of pump phosphorylation from ATP, a reflection of cytoplasmic Na affinity for forming the occluded E1P(Na3) conformation. ATPase assays further suggested that C-terminal truncations also interfere with low affinity Na interactions, which are attributable to extracellular effects. Because extracellular Na ions traverse part of the membrane's electric field to reach their binding sites in the Na/K pump, their movements generate currents that can be monitored with high resolution. We report here electrical measurements to examine how Na/K pump interactions with extracellular Na ions are influenced by C-terminal truncations. We deleted the last two (YY) or five (KESYY) residues in Xenopus laevis alpha1 Na/K pumps made ouabain resistant by either of two kinds of point mutations and measured their currents as 10-mM ouabain-sensitive currents in Xenopus oocytes after silencing endogenous Xenopus Na/K pumps with 1 microM ouabain. We found the low affinity inhibitory influence of extracellular Na on outward Na/K pump current at negative voltages to be impaired in all of the C-terminally truncated pumps. Correspondingly, voltage jump-induced transient charge movements that reflect pump interactions with extracellular Na ions were strongly shifted to more negative potentials; this signals a several-fold reduction of the apparent affinity for extracellular Na in the truncated pumps. Parallel lowering of Na affinity on both sides of the membrane argues that the C-terminal contacts provide important stabilization of the occluded E1P(Na3) conformation, regardless of the route of Na ion entry into the

  1. The rapid-onset dystonia parkinsonism mutation D923N of the Na+, K+-ATPase alpha3 isoform disrupts Na+ interaction at the third Na+ site.

    Science.gov (United States)

    Einholm, Anja Pernille; Toustrup-Jensen, Mads S; Holm, Rikke; Andersen, Jens Peter; Vilsen, Bente

    2010-08-20

    Rapid-onset dystonia parkinsonism (RDP), a rare neurological disorder, is caused by mutation of the neuron-specific alpha3-isoform of Na(+), K(+)-ATPase. Here, we present the functional consequences of RDP mutation D923N. Relative to the wild type, the mutant exhibits a remarkable approximately 200-fold reduction of Na(+) affinity for activation of phosphorylation from ATP, reflecting a defective interaction of the E(1) form with intracellular Na(+). This is the largest effect on Na(+) affinity reported so far for any Na(+), K(+)-ATPase mutant. D923N also affects the interaction with extracellular Na(+) normally driving the E(1)P to E(2)P conformational transition backward. However, no impairment of K(+) binding was observed for D923N, leading to the conclusion that Asp(923) is specifically associated with the third Na(+) site that is selective toward Na(+). The crystal structure of the Na(+), K(+)-ATPase in E(2) form shows that Asp(923) is located in the cytoplasmic half of transmembrane helix M8 inside a putative transport channel, which is lined by residues from the transmembrane helices M5, M7, M8, and M10 and capped by the C terminus, recently found involved in recognition of the third Na(+) ion. Structural modeling of the E(1) form of Na(+), K(+)-ATPase based on the Ca(2+)-ATPase crystal structure is consistent with the hypothesis that Asp(923) contributes to a site binding the third Na(+) ion. These results in conjunction with our previous findings with other RDP mutants suggest that a selective defect in the handling of Na(+) may be a general feature of the RDP disorder.

  2. Urgências reprodutivas na cadela

    OpenAIRE

    Costa, Teresa Isabel Rodrigues da

    2010-01-01

    Dissertação de Mestrado Integrado em Medicina Veterinária As urgências reprodutivas ocorrem com frequência na prática clínica, estando o seu desfecho favorável associado a um diagnóstico e intervenção céleres. Na cadela, consideram-se urgências reprodutivas a distócia, a piómetra, o prolapso uterino, a torção uterina, a tetania puerperal, a metrite e a mastite. Esta dissertação tem por base a análise dos dados referentes à casuística de urgências reprodutivas em cadelas veri...

  3. Jogos teatrais na escola pública

    Directory of Open Access Journals (Sweden)

    Ricardo Ottoni Vaz Japiassu

    1998-07-01

    Full Text Available O artigo apresenta os resultados parciais de pesquisa etnográfica que acompanha aspectos do desenvolvimento cultural de pré-adolescentes com a linguagem teatral em classe multisseriada, através do ensino regular de Teatro, em escola de ensino fundamental da rede pública estadual de São Paulo-SP. Os dados obtidos permitem afirmar que a linguagem cênica contribui na conscientização das novas possibilidades de significação da palavra na prática discursiva.The article shows partial results of ethnographic research in which kids are observed in their cultural development process with theater classes in public school education in São Paulo/Brazil. The data colected indicates that the use of theater games in school education helps students to be aware of a word’s new meaning possibilities in human comunication.

  4. HUME E O EMPIRISMO NA MORAL

    Directory of Open Access Journals (Sweden)

    Adriano Naves de Brito

    2007-12-01

    Full Text Available O que pretendo defender neste texto é que uma posição empirista na moral é compatível com uma pretensão de validade intersubjetiva de juízos morais. Essa pretensão deve, nesse caso, estar calcada na naturalização dos fundamentos da moralidade, mas tem de conviver com limites acerca da justificação de enunciados de valor. Para defender esse ponto, sirvo-me da filosofia moral de Hume, como ele a expôs no seu texto Uma investigação sobre os princípios da moral. No que diz respeito à filosofia de Hume, o objetivo deste texto é explicitar o caráter empírico seja de seu método de investigação da moral, seja do princípio que para ela ele encontra.

  5. News from the NA61/SHINE experiment

    Science.gov (United States)

    Šuša, Tatjana

    2018-02-01

    The main goals of the NA61/SHINE experiment at the CERN SPS are the search for the critical point of strongly interacting matter and the study of the properties of the onset of deconfinement. These aims are pursued by performing a two-dimensional scan of the phase diagram of strongly interacting matter by varying the momentum and size of the colliding nuclei. This contribution summarises the latest results from the NA61/SHINE experiment, in particular, new results on spectra and yields of ϕ meson in p+p interactions at 40, 80 and 158 GeV/c and K+ and K- production in central Be+Be collisions at mid-rapidity. In addition, results on system size dependence of particle yield ratios and fluctuations are presented.

  6. NA62 experiment at CERN SPS

    Directory of Open Access Journals (Sweden)

    Kozhuharov Venelin

    2014-01-01

    Full Text Available The NA62 experiment at SPS is a continuation of the long standing CERN kaon physics program. The high statistics and the unprecedent precision allow to probe the Standard Model and test the description of the strong interactions at low energy. The final results on the the lepton universality test by measuring the ratio RK = Γ(K+ → e+ν/Γ(K+ → µ+ν and the study of the K± → π±γγ decay are presented. The major goal of the NA62 experiment is to perform a measurement of the Br(K+ → π+νν̄ with a precision of 10% in two years of data taking. The detector setup together with the analysis technique is described.

  7. Luz e tempo na melancolia I

    Directory of Open Access Journals (Sweden)

    Cláudio Soares Braga Furtado

    2009-12-01

    Full Text Available A comparação entre as artes possibilita figurar o tempo como elemento comum entre a gravura renascentista de Dürer, a escultura romana de Laocoonte e o conto de Guimarães Rosa. A partir da leitura dessas artes distantes em forma, meios, época e lugar, descobrem-se mistérios aludidos em sutis sinais, que, se ainda não despertos na consciência criativa, estimulam interpretações. O papel da luz como unificadora das entidades tempo/espaço restabelece o princípio clássico da ut pictura poesis na leitura moderna.

  8. Kaizen: Uma Metodologia Inovadora na Siderurgia

    Directory of Open Access Journals (Sweden)

    Hericson Estanislau Prata

    2017-04-01

    Full Text Available A racionalização do processo produtivo industrial, por meio da redução dos desperdícios e da modernização do processo produtivo, com a adoção do Sistema Toyota de Produção (Produção Enxuta, tem sido adotada por uma parte importante das indústrias no mundo. O objetivo deste artigo é descrever essa metodologia empregada pelo grupo de melhoria de fase intensiva adotado na Vallourec Tubos do Brasil S.A. Como resultado, verificou-se que o processo utilizado para a implantação de mudanças em curto prazo foi a semana intensiva, também conhecida como evento Kaizen na indústria automotiva.

  9. O Personal Trainer na Perspectiva do Marketing

    Directory of Open Access Journals (Sweden)

    Cibele Biehl Bossle

    2011-03-01

    Full Text Available Esse estudo apresenta mapeamento das referências dedicadas à formação do personal trainer em bases de dados eletrônicas. Essa garimpagem revelou baixa produção científica sobre o assunto e mostrou que na literatura sobre personal trainer predominam livros com linguagem corrente no mundo dos negócios. Esses achados nos levaram a indagar sobre a força do discurso físico-empresarial, especialmente o marketing, na constituição desta ocupação profissional. Jeremy Rifkin, Zygmunt Bauman, Paula Sibilia e Denise Sant'Anna permitiram visualizar que o marketing dirigido ao personal trainer tem como tarefa reinventar, ressignificar e "repaginar" esta modalidade de serviço em nome da sobrevivência no disputado mercado da vida ativa.

  10. New NA22 results on correlations

    International Nuclear Information System (INIS)

    De Wolf, E.A.

    1993-01-01

    Recent NA22 results from π + p and K + p inelastic interactions at √s = 22 GeV on invariant-mass and Q 2 -dependence of two- and three-particle factorial cumulants are discussed in relation to earlier intermittency studies. The absence of Bose-Einstein type correlations among identical particles, and too large resonance production rates, are responsible for the strong disagreements of models with intermittency data. 6 figs., 17 refs

  11. NA35: sulphur-gold collision

    CERN Multimedia

    1991-01-01

    In this image the real particles produced by the collision of a 6400 GeV sulphur ion with a gold target can be seen as they pass through a streamer chamber. Streamer chambers consist of a gas chamber through which a strong pulsed electric field is passed, creating sparks as a charged particle passes through it. The NA35 experiment, which was in operation in the 1980s, was part of CERN's ongoing heavy ion project.

  12. Die Calvinistiese Sondagbeskouing met spesiale verwysing na ...

    African Journals Online (AJOL)

    omver te werp. Aan die ander kant het die orde en vrede in die kerk dit wel ook nodig gemaak om 'n dag vir gebruik van die diens van die Here af te sonder. Calvyn se insigte in verband met die oorgang van die Sabbat na die Sondag, is die insigte wat as die eg reformatoriese behoue gebly het. Haitjema (1961:249) sê in.

  13. Sources of Na for the Io atmosphere

    Science.gov (United States)

    Burnett, D. S.; Ellis, Susan B.; Rice, A.; Epstein, S.

    1993-01-01

    The physics and geology of Io have been extensively studied, but there has been little discussion of the chemistry. Relatively little is known about Io chemistry, but there are constraints. Further, it will be a long time before improvements will result from direct observation, given the severe difficulties with the Galileo mission. Via laboratory simulation experiments, plausible thermochemical and photochemical processes which determine the nature and amounts of surface constituents of Io are explored. The well-known density of Io shows that the planet overall is rocky. Because the orbit of Io is well within the magnetosphere of Jupiter and because Io only has a thin, transient SO2 atmosphere, the surface is continually sputtered with magnetospheric ions. Complex processes ionize and accelerate the Io surface atoms to keV and MeV energies. Remarkably, only S, O, and Na ions were found by Voyager. Sputtering also produces an atomic cloud of Na and S (O not observable) with a trace of K. Both gaseous and solid SO2 are known from spectroscopic studies. A trace of H2S and possibly CO2 are present. Geologic features are interpreted in terms of elemental S, but there is no direct evidence for this constituent. We thus have a rocky planet which does not have rocks on the surface. Our general goal is to understand the cycling of Na, S, and O through the crust and atmosphere on present-day Io and to understand how Io evolved to this state. A specific objective was to determine the phases on the surface which are the source of the Na in the atmosphere of Io.

  14. The NA48 liquid krypton calorimeter

    CERN Document Server

    Gorini, B

    1997-01-01

    The NA48 collaboration goal is to measure the CP violation parameter Re(ɛl/ɛ) at the level of 2 × 10−4. The neutral Kaon decays will be reconstructed by an electromagnetic liquid Krypton calorimeter with fine granularity and a volume almost totally sensible, to obtain excellent position and energy resolution, as well as time resolution. A description of the detector, results from tests of a prototype and the status of the final calorimeter are reported.

  15. Prototype calorimeters for the NA3 experiment

    CERN Multimedia

    1975-01-01

    The NA3 Experiment was set-up on the North Area of the SPS by the CERN/ Ecole Polytechnique/College de France/ Orsay/Saclay Collaboration, to study high transverse momentum leptons and hadrons from hadron collisions. The calorimeters measured the energy of hadrons (prototype on the right) and leptons (prototype on the left). They used a new type of plastic scintillator (plexipop). (see CERN Courier of November 1975) energy (prototype on the right)

  16. Maendeleo ya Fasihi ya Kiswahili ya Watoto nchini Tanzania na ...

    African Journals Online (AJOL)

    Fasihi ya Kiswahili ya watoto kama taaluma haina muda mrefu katika historia ya fasihi ya Kiswahili. Ikilinganishwa na fasihi ya watu wazima ambayo ilianza muda mrefu, na pia tafiti nyingi kufanyika katika mataifa mengi, fasihi ya watoto inaonekana kuwa imetelekezwa kwa muda mrefu kutokana na kutokupewa umuhimu ...

  17. Dhima za Mbinu Linganishi katika Kuhusisha Lugha na Lahaja ...

    African Journals Online (AJOL)

    Lengo la makala hii ni kujadili dhima za Mbinu Linganishi katika kuhusisha lugha na lahaja. Data za makala hii zilikusanywa kwa kutumia mbinu mbalimbali ambazo ni usaili, ushuhudiaji, hojaji na majadiliano katika majopo. Utafiti ulifanyika Tanzania Bara hususan Mkoani Mtwara na Tanzania Visiwani katika maeneo ya ...

  18. Glial Na(+) -dependent ion transporters in pathophysiological conditions.

    Science.gov (United States)

    Boscia, Francesca; Begum, Gulnaz; Pignataro, Giuseppe; Sirabella, Rossana; Cuomo, Ornella; Casamassa, Antonella; Sun, Dandan; Annunziato, Lucio

    2016-10-01

    Sodium dynamics are essential for regulating functional processes in glial cells. Indeed, glial Na(+) signaling influences and regulates important glial activities, and plays a role in neuron-glia interaction under physiological conditions or in response to injury of the central nervous system (CNS). Emerging studies indicate that Na(+) pumps and Na(+) -dependent ion transporters in astrocytes, microglia, and oligodendrocytes regulate Na(+) homeostasis and play a fundamental role in modulating glial activities in neurological diseases. In this review, we first briefly introduced the emerging roles of each glial cell type in the pathophysiology of cerebral ischemia, Alzheimer's disease, epilepsy, Parkinson's disease, Amyotrophic Lateral Sclerosis, and myelin diseases. Then, we discussed the current knowledge on the main roles played by the different glial Na(+) -dependent ion transporters, including Na(+) /K(+) ATPase, Na(+) /Ca(2+) exchangers, Na(+) /H(+) exchangers, Na(+) -K(+) -Cl(-) cotransporters, and Na(+) - HCO3- cotransporter in the pathophysiology of the diverse CNS diseases. We highlighted their contributions in cell survival, synaptic pathology, gliotransmission, pH homeostasis, and their role in glial activation, migration, gliosis, inflammation, and tissue repair processes. Therefore, this review summarizes the foundation work for targeting Na(+) -dependent ion transporters in glia as a novel strategy to control important glial activities associated with Na(+) dynamics in different neurological disorders. GLIA 2016;64:1677-1697. © 2016 Wiley Periodicals, Inc.

  19. Muundo wa Mashairi katika Diwani ya Mnyampala (1965) na Nafasi ...

    African Journals Online (AJOL)

    Makala hii pia inadadisi namna mbinu za kimuundo zilivyofanikisha usawiri na ubainishaji wa falsafa ya mtunzi kuhusu ushairi wa Kiswahili na nafasi ya ushairi katika jamii. Makala imeanza kwa kugusia usuli wa historia ya ushairi wa Kiswahili, historia fupi ya maisha ya Mathias Mnyampala na nadharia yake kuhusu ...

  20. Ujitokezaji wa Viambishi Njeo na Athari zake Kifonolojia katika ...

    African Journals Online (AJOL)

    Chanzo cha data za utafiti huu ni vitabu mbalimbali vinavyohusu lugha ya Shimalila, navyo vimeandikwa na watu mbalimbali wa jamii ya Shimalila ambao malengo yao ni kutafsiri Biblia kutoka katika lugha ya Kiswahili kwenda katika lugha ya Shimalila. Pia, data nyingine zimetokana na hojaji pamoja na usaili wa moja ...

  1. BAKITA NA LUGHA YA KUFUNDISHIA | BAKITA | Kioo cha Lugha

    African Journals Online (AJOL)

    BAKITA NA LUGHA YA KUFUNDISHIA. Baraza la Kiswahili la Taifa BAKITA. Abstract. Makala haya yanatoa maelezo mafupi ya matukio muhimu kuhusu suala la kutumia Kiswahili kama lugha ya kufundishia sekondari na vyuo katika kipindi baina ya mwaka 1967 mpaka 2000. Makala yanaeleza dhima na shughuli za ...

  2. Hadhi ya Kiswahili na watumiaji wake katika utandawazi ...

    African Journals Online (AJOL)

    Katika Taifa la Tanzania, mathalani, Kiswahili kimewakusanya na kuwajumuisha pamoja watu wa makabila zaidi ya 150 – kikitumika kama lugha ya mawasiliano inayoeleweka na watu wote. Hii si ajabu, ikizingatiwa kuwa, kwa silika yake, Kiswahili ni lugha unganishi, yaani yenye hulka ya kuunganisha, na siyo ya ...

  3. Hydrophilic C terminus of Salicornia europaea vacuolar Na/H ...

    Indian Academy of Sciences (India)

    Plant vacuolar Na+/H+ antiporters play important roles in cellular ion homeostasis,vacuolar pH regulation and sequestration of Na+ ions into the vacuole. Previous research showed that hydrophilic C-terminal region of Arabidopsis AtNHX1 negatively regulates the Na+/H+ transporting activity. In this study, we truncated the ...

  4. Fanfiction: uma escrita criativa na web

    Directory of Open Access Journals (Sweden)

    Daniele Alves Alencar

    Full Text Available RESUMO Estudo das fanfictions como uma prática de incentivo à leitura e produção de textos ficcionais na web. Por meio de pesquisa exploratória, bibliográfica e qualitativa foi desenvolvido o assunto para a área daCiência da Informação. Utiliza o site “Nyah! Fanfiction” como fonte de informação sobre as fanfictions e para aplicação de questionáriocomo auxílio na investigação do comportamento dos fanfiqueiros do site. O artigo mostra o que são as fanfictions, descreve a forma diferenciada que o ficwriterl ê o texto original para a produção da história, e apresenta o site “Nyah! Fanfiction” não apenas como depositário de fanfictions, mas também informa como essa prática pode se tornar mais que um passatempo, por explorar a imaginação, estimular a criação de textos, e assim intensificar a prática de leitura e escrita entre os jovens. O assunto estudado ainda é considerado novo na área de Biblioteconomia, portanto se faz necessário o desenvolvimento de mais pesquisas abordando o tema fanfiction.

  5. Cultura Política na Antiguidade

    Directory of Open Access Journals (Sweden)

    José Petrúcio Farias Júnior

    2009-06-01

    Full Text Available

    Pretendemos discutir nesse artigo algumas implicações do termo cultura política na Antiguidade, especificamente, na sociedade romana imperial. Dessa forma, acreditamos que as considerações que apresentaremos a seguir contribuam para reflexão da utilização desse termo, produto das investigações contemporâneas, sobre os estudos das sociedades antigas. Para a historiadora Profa. Dra. Margarida Maria de Carvalho, tais reflexões representam ainda uma lacuna na historiografia concernente a essa temática. Isso posto, discorreremos, inicialmente, sobre o conceito de cultura e seus desdobramentos para, em seguida, refletirmos sobre o viés interpretativo que fundamenta estudos históricos que se desenvolvem sob o beneplácito da linha de pesquisa intitulada História e Cultura Política.

  6. NaI(Tl) response functions

    International Nuclear Information System (INIS)

    Vega C, H. R.; Ortiz R, J. M.; Benites R, J. L.; De Leon M, H. A.

    2015-09-01

    The response functions of a NaI(Tl) detector have been estimated using Monte Carlo methods. Response functions were calculated for monoenergetic photon sources (0.05 to 3 MeV). Responses were calculated for point-like sources and for sources distributed in Portland cement cylinders. The responses were used to calculate the efficiency functions in term of photon energy. Commonly, sources used for calibration are point-like, and eventually sources to be measured have different features. In order to use the calibrated sources corrections due to solid angle, self-absorption and scattering, must be carried out. However, some of these corrections are not easy to perform. In this work, the calculated responses were used to estimate the detector efficiency of point-like sources, and sources distributed in Portland type cement. Samples of Portland paste were prepared and were exposed to photoneutrons produced by a 15 MV linac. Some of the elements in the cement were activated producing γ-emitting radionuclides that were measured with a NaI(Tl) gamma-ray spectrometer, that was calibrated with point-like sources. In order to determine the specific activity in the induced radioisotopes calculated efficiencies were used to make corrections due to the differences between the solid angle, photon absorption and photon scattering in the point-like calibration sources and the sources distributed in cement. During the interaction between photoneutrons and the cement samples three radioisotopes were induced: 56 Mn, 24 Na, and 28 Al. (Author)

  7. A CPL NA SOCIEDADE DO CONHECIMENTO

    Directory of Open Access Journals (Sweden)

    Patrisia Ciancio

    2009-07-01

    online tem sido pensada pela Comunidade dos Países de Língua Portuguesa (CPLP, que registra preocupação com sua entrada na sociedade do conhecimento nas atas das reuniões de chefes de Estado, e seus desdobramentos, ocorridas a cada dois anos. No entanto, faltam projetos concretos a esta proposta. O enquadramento teórico da pesquisa que se apresenta está no terreno flutuante da Lusofonia, que em sua descontinuidade territorial e fragmentação se projeta em alternativas “tecnoculturais”. As missões colonizadoras pontilharam um trajeto invisível. Esfera que, de algum modo, persiste e pode ser restaurada na criação de comunidades virtuais com uso de novas tecnologias para refazer este percurso, agora em concepção inversa, que privilegia o mosaico cultural dos povos. Um círculo virtual que pede por ser também virtuoso. O objetivo é delimitar bases para uma proposta prática de criação de novos canais de interação. Para alcançar tais constatações, a metodologia empregada foi uma análise documental que verifica os debates ao redor da comunicação ao longo de dez anos (1996 a 2006 na CPLP.

  8. NA64 Search for Dark Photons

    CERN Document Server

    Shiakas, Christos

    2017-01-01

    The NA64 experiment, known as P348 before official approval, was proposed to the CERN SPSC on January 2014 with main goal the search for the following decay modes A′ → invisible A′ → e−e+ (1) In March 2016 P348 was granted approval by the CERN Research Board and received the title NA64. Since having been promoted, the experiment has been conducting the searches the searches for the processes mentioned above at the CERN SPS. NA64 is a fixed target experiment which utilizes the active beam dump. The detection of rare processes is based on the missing energy techniques. Such techniques are used for particles whose interaction with the detector is very small, so that they escape the detection and carry away some energy. A significant missing energy in the experiment means that such particles are produced. The method of the search for the A′ → invisible decay is as follows. If the A′ exists it could be produced via the kinetic mixing with bremsstrahlung photons in the reaction of high-energy elec...

  9. Imunossupressores na Dermatologia Immunosuppressive agents in Dermatology

    Directory of Open Access Journals (Sweden)

    Aline Lopes Bressan

    2010-02-01

    Full Text Available Os imunossupressores são drogas que agem na divisão celular e têm propriedades anti-inflamatórias. Sendo assim, são essencialmente prescritos na prevenção de rejeição de transplantes e no tratamento das doenças autoimunes e inflamatórias crônicas, que, na Dermatologia, têm a psoríase como maior representante. Nesta sessão serão descritas as principais drogas imunossupressoras, com orientações para seu manejo adequado.Immunosupressants are drugs that act in cell division and have anti-inflammatory effects. Therefore, they are essentially prescribed in the prevention of transplant rejection and in the treatment of autoimmune disorders and chronic inflammatory diseases, whose main example in Dermatology is psoriasis. In this work the most important immunosuppressive drugs and orientation to properly administer them are going to be described.

  10. Resonances production from the NA60 experiment

    Directory of Open Access Journals (Sweden)

    De Falco A.

    2012-11-01

    Full Text Available The NA60 experiment at the CERN SPS has studied light vector meson production in In-In collisions at 158A GeV. The ϕ meson was detected via both the K+K− and the μ+μ− decay channels. The yields and inverse slope parameters of the mT spectra observed in the two channels are compatible within errors, different from the large discrepancies seen in Pb-Pb collisions between the hadronic (NA49 and dimuon (NA50 decay channels. In the invariant mass region 0.2 1 GeV, the excess is found to be prompt, with remarkable differences with respect to the Drell-Yan process. The Teff slope parameter, extracted from the transverse mass spectra, shows a rise with mass up to the ρ, followed by a sudden decline for higher masses. The former is consistent with radial flow of a hadronic source, while the latter suggests a dominantly partonic emission source.

  11. Envolvimento do sistema nervoso central na cisticercose

    Directory of Open Access Journals (Sweden)

    Aristides Cheto de Queiroz

    1979-03-01

    Full Text Available No estudo do envolvimento do SNC na cisticercose, verificou-se uma freqüência de 0,3%, sempre como achado incidental no estudo de rotina de autópsias; apenas um caso mostrou boa correlação com a presença de manifestações neurológicas. Esta freqüência que é baixa em relação ao que é observado em outras regiões do Brasil, mostra que a neurocisticercose não representa um grande problema na região. As reações do hospedeiro ao embrião do cisticerco foram sempre do tipo inflamatório crônico e fibrosante. Neste estudo ficou demonstrada a importância do método de impregnação pela prata (Grocott na identificação do esqueleto do cisticerco no interior de lesões fibrosantes e/ou calcificadas.

  12. Growth mechanism of NaClO 3 and NaBrO 3 crystals from aqueous ...

    Indian Academy of Sciences (India)

    A study of growth rates of NaClO3 and NaBrO3 has been carried out using a small growth cell by in situ observation. Normal growth rates of {100} faces of NaClO3 and {111} faces of NaBrO3 along ⟨ 110 ⟩ direction are measured under relatively high supersaturation ranging from 3–8%. In the initial stages of growth, {100}, ...

  13. Growth mechanism of NaClO3 and NaBrO3 crystals from aqueous ...

    Indian Academy of Sciences (India)

    A study of growth rates of NaClO3 and NaBrO3 has been carried out using a small growth cell by in situ observation. Normal growth rates of {100} faces of NaClO3 and {111} faces of NaBrO3 along ⟨ 110 ⟩ direction are measured under relatively high supersaturation ranging from 3–8%. In the initial stages of growth, {100}, ...

  14. Route, mechanism, and implications of proton import during Na+/K+ exchange by native Na+/K+-ATPase pumps.

    Science.gov (United States)

    Vedovato, Natascia; Gadsby, David C

    2014-04-01

    A single Na(+)/K(+)-ATPase pumps three Na(+) outwards and two K(+) inwards by alternately exposing ion-binding sites to opposite sides of the membrane in a conformational sequence coupled to pump autophosphorylation from ATP and auto-dephosphorylation. The larger flow of Na(+) than K(+) generates outward current across the cell membrane. Less well understood is the ability of Na(+)/K(+) pumps to generate an inward current of protons. Originally noted in pumps deprived of external K(+) and Na(+) ions, as inward current at negative membrane potentials that becomes amplified when external pH is lowered, this proton current is generally viewed as an artifact of those unnatural conditions. We demonstrate here that this inward current also flows at physiological K(+) and Na(+) concentrations. We show that protons exploit ready reversibility of conformational changes associated with extracellular Na(+) release from phosphorylated Na(+)/K(+) pumps. Reversal of a subset of these transitions allows an extracellular proton to bind an acidic side chain and to be subsequently released to the cytoplasm. This back-step of phosphorylated Na(+)/K(+) pumps that enables proton import is not required for completion of the 3 Na(+)/2 K(+) transport cycle. However, the back-step occurs readily during Na(+)/K(+) transport when external K(+) ion binding and occlusion are delayed, and it occurs more frequently when lowered extracellular pH raises the probability of protonation of the externally accessible carboxylate side chain. The proton route passes through the Na(+)-selective binding site III and is distinct from the principal pathway traversed by the majority of transported Na(+) and K(+) ions that passes through binding site II. The inferred occurrence of Na(+)/K(+) exchange and H(+) import during the same conformational cycle of a single molecule identifies the Na(+)/K(+) pump as a hybrid transporter. Whether Na(+)/K(+) pump-mediated proton inflow may have any physiological or

  15. Route, mechanism, and implications of proton import during Na+/K+ exchange by native Na+/K+-ATPase pumps

    Science.gov (United States)

    Vedovato, Natascia

    2014-01-01

    A single Na+/K+-ATPase pumps three Na+ outwards and two K+ inwards by alternately exposing ion-binding sites to opposite sides of the membrane in a conformational sequence coupled to pump autophosphorylation from ATP and auto-dephosphorylation. The larger flow of Na+ than K+ generates outward current across the cell membrane. Less well understood is the ability of Na+/K+ pumps to generate an inward current of protons. Originally noted in pumps deprived of external K+ and Na+ ions, as inward current at negative membrane potentials that becomes amplified when external pH is lowered, this proton current is generally viewed as an artifact of those unnatural conditions. We demonstrate here that this inward current also flows at physiological K+ and Na+ concentrations. We show that protons exploit ready reversibility of conformational changes associated with extracellular Na+ release from phosphorylated Na+/K+ pumps. Reversal of a subset of these transitions allows an extracellular proton to bind an acidic side chain and to be subsequently released to the cytoplasm. This back-step of phosphorylated Na+/K+ pumps that enables proton import is not required for completion of the 3 Na+/2 K+ transport cycle. However, the back-step occurs readily during Na+/K+ transport when external K+ ion binding and occlusion are delayed, and it occurs more frequently when lowered extracellular pH raises the probability of protonation of the externally accessible carboxylate side chain. The proton route passes through the Na+-selective binding site III and is distinct from the principal pathway traversed by the majority of transported Na+ and K+ ions that passes through binding site II. The inferred occurrence of Na+/K+ exchange and H+ import during the same conformational cycle of a single molecule identifies the Na+/K+ pump as a hybrid transporter. Whether Na+/K+ pump–mediated proton inflow may have any physiological or pathophysiological significance remains to be clarified. PMID

  16. VISIBILIDADE GAY NA ESCOLA: ESTUDANTES QUEER

    Directory of Open Access Journals (Sweden)

    Aline Ferraz da Silva

    2008-03-01

    Full Text Available Nesse artigo apresento as considerações e análises presentes na pesquisa em processo, que realizo numa escola pública. Sua constituição deve seu primeiro movimento às manifestações de desconforto e homofobia com relação a um grupo específico de três estudantes gays na comunidade escolar na qual atuo como professora. Percebo que a presença desse grupo desacomoda o cotidiano escolar e desenvolvo minha argumentação com base no potencial desestabilizador desses sujeitos, na intenção de pensar o impensável no currículo escolar. Esse trabalho parte da visibilidade de uma identidade sexual que foge à norma heterossexual e desafia a tendência normalizadora e homogeneizadora da educação. A maneira como esse grupo gay se posiciona e constrói seus corpos cruza as fronteiras do masculino/feminino, desnaturalizando as identidades sexuais e de gênero que se baseiam em características biológicas e se apresentando como diferença que escapa às classificações binárias. Na construção da pesquisa utilizo como referência o pensamento de Michel Foucault, especialmente com relação à construção histórica e discursiva de conceitos como sexualidade, identidade, diferença e normalidade que têm servido para criação e manutenção de padrões de conduta. Ao levar a problematização desses conceitos para o contexto escolar, considero produtiva a teorização queer para pensar a possibilidade de uma educação não heteronormativa, produtora de diferenças, que desconstrua identidades ao invés de tentar cristalizá-las.

  17. Response of saliva Na/K ratio to changing Na supply of lactating cows under tropical conditions

    NARCIS (Netherlands)

    Thiangtum, Wandee; Schonewille, J Thomas; Verstegen, Martin Wa; Arsawakulsudhi, Supot; Rukkwamsuk, Theera; Hendriks, Wouter H

    BACKGROUND: Factorial determination of the sodium (Na) requirement of heat-stressed lactating cows is hindered by accurate estimates of the Na losses through sweat. Direct studies, therefore, may be needed requiring information on the time course of healthy animals to become Na depleted and the

  18. Response of saliva Na/K ratio to changing Na supply of lactating cows under tropical conditions

    NARCIS (Netherlands)

    Thiangtum, Wandee; Schonewille, Thomas J.; Verstegen, Martin W.A.; Arsawakulsudhi, Supot; Rukkwamsuk, Theera; Hendriks, Wouter H.

    2017-01-01

    BACKGROUND: Factorial determination of the sodium (Na) requirement of heat-stressed lactating cows is hindered by accurate estimates of the Na losses through sweat. Direct studies, therefore, may be needed requiring information on the time course of healthy animals to become Na depleted and the

  19. Polarization and collision velocity dependence of associative ionization in cold Na (3p)-Na(3p) collisions

    NARCIS (Netherlands)

    Meijer, H.A.J.

    1990-01-01

    We studied the polarization dependence of the associative ionization (AI) process Na(3p) + Na(3p) → Na2+ at collision velocities between 100 and 700 m/s (5 and 200 K), using linearly and circularly polarized light for the excitation. We found that the polarization dependence varies strongly in the

  20. Irreversible block of cardiac mutant Na+ channels by batrachotoxin.

    Science.gov (United States)

    Wang, Sho-Ya; Tikhonov, Denis B; Mitchell, Jane; Zhorov, Boris S; Wang, Ging Kuo

    2007-01-01

    Batrachotoxin (BTX) not only keeps the voltage-gated Na(+) channel open persistently but also reduces its single-channel conductance. Although a BTX receptor has been delimited within the inner cavity of Na(+) channels, how Na(+) ions flow through the BTX-bound permeation pathway remains unclear. In this report we tested a hypothesis that Na(+) ions traverse a narrow gap between bound BTX and residue N927 at D2S6 of cardiac hNa(v)1.5 Na(+) channels. We found that BTX at 5 microM indeed elicited a strong block of hNa(v)1.5-N927K currents (approximately 70%) after 1000 repetitive pulses (+50 mV/20 ms at 2 Hz) without any effects on Na(+) channel gating. Once occurred, this unique use-dependent block of hNa(v)1.5-N927K Na(+) channels recovered little at holding potential (-140 mV), demonstrating that BTX block is irreversible under our experimental conditions. Such an irreversible effect likewise developed in fast inactivation-deficient hNa(v)1.5-N927K Na(+) channels albeit with a faster on-rate; approximately 90% of peak Na(+) currents were abolished by BTX after 200 repetitive pulses (+50 mV/20 ms). This use-dependent block of fast inactivation-deficient hNa(v)1.5-N927K Na(+) channels by BTX was duration dependent. The longer the pulse duration the larger the block developed. Among N927K/W/R/H/D/S/Q/G/E substitutions in fast inactivation-deficient hNa(v)1.5 Na(+) channels, only N927K/R Na(+) currents were highly sensitive to BTX block. We conclude that (a) BTX binds within the inner cavity and partly occludes the permeation pathway and (b) residue hNa(v)1.5-N927 is critical for ion permeation between bound BTX and D2S6, probably because the side-chain of N927 helps coordinate permeating Na(+) ions.

  1. MOBILNO POSLOVANJE NA PRIMERU UPORABE MICROSOFT DYNAMICS CRM

    OpenAIRE

    Duh, Tamara

    2016-01-01

    Hitro razvijajoči se svet nas spodbuja k hitremu reagiranju na novosti, ki se pojavljajo na trgu. Prav zaradi tega je danes zelo pomembno upravljati z mobilnimi napravami, da se lahko hitro in brez težav soočimo z morebitnimi težavami oz. zagatami. Prav iz tega razloga je mobilno poslovanje ena izmed inovativnih rešitev, ki ljudem omogoča seznanjenost z informacijami na vsakem koraku in omogoča hiter odziv na spremembe. Prav ta rešitev omogoča podjetjem, da so konkurenčna in hkrati lahko hitr...

  2. Na+ channel function, regulation, structure, trafficking and sequestration

    Science.gov (United States)

    Chen-Izu, Ye; Shaw, Robin M; Pitt, Geoffrey S; Yarov-Yarovoy, Vladimir; Sack, Jon T; Abriel, Hugues; Aldrich, Richard W; Belardinelli, Luiz; Cannell, Mark B; Catterall, William A; Chazin, Walter J; Chiamvimonvat, Nipavan; Deschenes, Isabelle; Grandi, Eleonora; Hund, Thomas J; Izu, Leighton T; Maier, Lars S; Maltsev, Victor A; Marionneau, Celine; Mohler, Peter J; Rajamani, Sridharan; Rasmusson, Randall L; Sobie, Eric A; Clancy, Colleen E; Bers, Donald M

    2015-01-01

    This paper is the second of a series of three reviews published in this issue resulting from the University of California Davis Cardiovascular Symposium 2014: Systems approach to understanding cardiac excitation–contraction coupling and arrhythmias: Na+ channel and Na+ transport. The goal of the symposium was to bring together experts in the field to discuss points of consensus and controversy on the topic of sodium in the heart. The present review focuses on Na+ channel function and regulation, Na+ channel structure and function, and Na+ channel trafficking, sequestration and complexing. PMID:25772290

  3. Usando a antimatéria na medicina moderna

    OpenAIRE

    Machado,A.C.B.; Pleitez,V.; Tijero,M.C.

    2006-01-01

    Neste artigo, fazemos uma breve exposição de como um dos conceitos fundamentais da física moderna, a existência de antimatéria, tem aplicação na medicina, na chamada tomografia por emissão de pósitrons (PET na sigla em inglês). Ela consiste na produção de imagens tomográficas digitais do organismo que são obtidas pela detecção da radiação produzida na aniquilação do pósitron com o elétron.

  4. Novel regulation of cardiac Na pump via phospholemman.

    Science.gov (United States)

    Pavlovic, Davor; Fuller, William; Shattock, Michael J

    2013-08-01

    As the only quantitatively significant Na efflux pathway from cardiac cells, the Na/K ATPase (Na pump) is the primary regulator of intracellular Na. The transmembrane Na gradient it establishes is essential for normal electrical excitability, numerous coupled-transport processes and, as the driving force for Na/Ca exchange, thus setting cardiac Ca load and contractility. As Na influx varies with electrical excitation, heart rate and pathology, the dynamic regulation of Na efflux is essential. It is now widely recognized that phospholemman, a 72 amino acid accessory protein which forms part of the Na pump complex, is the key nexus linking cellular signaling to pump regulation. Phospholemman is the target of a variety of post-translational modifications (including phosphorylation, palmitoylation and glutathionation) and these can dynamically alter the activity of the Na pump. This review summarizes our current understanding of the multiple regulatory mechanisms that converge on phospholemman and govern NA pump activity in the heart. The corrected Fig. 4 is reproduced below. The publisher would like to apologize for any inconvenience caused. [corrected]. Copyright © 2013. Published by Elsevier Ltd.

  5. Synthesis of Na-A and/or Na-X zeolite/porous carbon composites from carbonized rice husk

    International Nuclear Information System (INIS)

    Katsuki, Hiroaki; Komarneni, Sridhar

    2009-01-01

    Na-A and/or Na-X zeolite/porous carbon composites were prepared under hydrothermal conditions by NaOH dissolution of silica first from carbonized rice husk followed by addition of NaAlO 2 and in situ crystallization of zeolites i.e., using a two-step process. When a one-step process was used, both Na-A and Na-X zeolites crystallized on the surface of carbon. Na-A or Na-X zeolite crystals were prepared on the porous carbonized rice husk at 90 deg. C for 2-6 h by changing the SiO 2 /Al 2 O 3 , H 2 O/Na 2 O and Na 2 O/SiO 2 molar ratios of precursors in the two-step process. The surface area and NH 4 + -cation exchange capacity (CEC) of Na-A zeolite/porous carbon were found to be 171 m 2 /g and 506 meq/100 g, respectively, while those of Na-X zeolite/porous carbon composites were 676 m 2 /g and 317 meq/100 g, respectively. Na-A and Na-X zeolites are well-known microporous and hydrophilic materials while carbonized rice husk was found to be mesoporous (pores of ∼3.9 nm) and hydrophobic. These hybrid microporous-mesoporous and hydrophilic-hydrophobic composites are expected to be useful for decontamination of metal cations as well as organic contaminants simultaneously. - Graphical Abstract: Novel Na-X zeolite/porous carbon composite.

  6. Synthesis of zeolites Na-A and Na-X from tablet compressed and calcinated coal fly ash

    Science.gov (United States)

    Hu, Tao; Gao, Wenyan; Liu, Xin; Zhang, Yifu; Meng, Changgong

    2017-10-01

    Zeolites Na-A and Na-X are important synthetic zeolites widely used for separation and adsorption in industry. It is of great significance to develop energy-efficient routines that can synthesize zeolites Na-A and Na-X from low-cost raw materials. Coal fly ash (CFA) is the major residue from the combustion of coal and biomass containing more than 85% SiO2 and Al2O3, which can readily replace the conventionally used sodium silicate and aluminate for zeolite synthesis. We used Na2CO3 to replace the expensive NaOH used for the calcination of CFA and showed that tablet compression can enhance the contact with Na2CO3 for the activation of CFA through calcination for the synthesis of zeolites Na-A and Na-X under mild conditions. We optimized the control variables for zeolite synthesis and showed that phase-pure zeolite Na-A can be synthesized with CFA at reactant molar ratio, hydrothermal reaction temperature and reaction time of 1.3Na2O: 0.6Al2O3: 1SiO2: 38H2O at 80°C for 6 h, respectively, while phase-pure zeolite Na-X can be synthesized at 2.2Na2O: 0.2Al2O3: 1SiO2: 88H2O at 100°C for 8 h, respectively. The composition, morphology, specific surface area, vibration spectrum and thermogravimetry of synthesized Na-A and Na-X were further characterized.

  7. Identidade, nação e território na escrita dos intelectuais Mapuches

    Directory of Open Access Journals (Sweden)

    Claudia Zapata Silva

    2007-12-01

    Full Text Available Este artigo tem por objetivo dar conta de um novo sujeito indígena, surgido na segunda metade do século XX: o intelectual indígena contemporâneo, formado em instituições de educação superior e que constrói discursos e representações a partir de uma disciplina do conhecimento (História, Sociologia, Literatura, Antropologia, entre outras. Abordarse- á o caso particular dos intelectuais mapuches na década de noventa, a partir de uma perspectiva de análise que os considera como autores e como atores de contornos próprios no interior do que, na atualidade, se conhece como Movimento Mapuche.

  8. Erythrocyte Na+/K+ ATPase activity measured with sup 23 Na NMR

    Energy Technology Data Exchange (ETDEWEB)

    Ouwerkerk, R.; van Echteld, C.J.; Staal, G.E.; Rijksen, G. (University Hospital, Utrecht (Netherland))

    1989-11-01

    A {sup 23}Na NMR assay for measurement of erythrocyte Na+/K+ ATPase activity is presented. Using the nonpermeant shift reagent dysprosium tripolyphosphate the signals of intra- and extracellular sodium are separated, enabling measurement of sodium fluxes nondestructively, without the need to physically separate the cells from their environment. By increasing membrane permeability with nystatin we have shown that the assay allows the detection of differences in membrane permeability. With low doses of nystatin the ouabain-sensitive sodium flux increased more than twofold. With high doses of nystatin the Na+/K+ pump could not prevent an almost total equilibration of intra- and extracellular sodium. All sodium that entered the cells remained NMR visible, proving that sodium influx can be measured quantitatively. {sup 31}P NMR spectra taken before and after the assay revealed a slight acidification of the cells and no significant change in ATP concentration. No evidence of Dy3+ entering the cell was observed.

  9. Benefícios da cafeína na terapêutica

    OpenAIRE

    Ribeiro, Célia Pereira

    2013-01-01

    Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz A cafeína é uma substância amplamente consumida, principalmente pelas suas propriedades estimulantes. Mas é também utilizada a nível terapêutico, e são cada vez mais os estudos que procuram aprofundar e conhecer novas aplicações terapêuticas da cafeína. Existe uma extensa literatura acerca do citrato de cafeína para o tratamento da apneia de recém-nascidos prematuros, e os estudos indicam q...

  10. Na+-K+ pump in chronic renal failure

    International Nuclear Information System (INIS)

    Deepak, K.; Kahn, T.

    1987-01-01

    This review summarizes the evidence for the defect in Na + -K + pump in chronic renal failure, considers the role of various factors in causing this defect, and discusses the clinical implications thereof. Intracellular Na is elevated in erythrocytes, leukocytes, and muscle cells from some patients with chronic renal failure (CRF). Recent evidence suggest that this elevation of cell Na may be, in large part, a consequence of decreased number of Na + -K + pump units per cell. Maintenance dialysis over a period of weeks ameliorates the defect in intracellular Na + , and this improvement is contemporaneous with an increase in the number of Na + -K + pump sites per cell. In erythrocytes with normal cell Na + , acute hemodialysis increases the rate of 22 Na + and 42 K + transport. Many factors such as the presence of retained toxic metabolite or circulating inhibitor in the uremic plasma, or biochemical changes produced by acute hemodialysis, may explain this finding. In cells with high cell Na + , the pump-mediated 42 K + transport is normalized at the expense of a raised cell Na + . The decreased muscle membrane potential in uremic subjects has been attributed to a decreased activity of Na + -K + pump. The authors discuss the role of hormonal abnormalities and circulating inhibitors, which may cause an acute inhibition of the pump and of other factors such as K + depletion, which may cause more chronic alterations. The implications of alteration of Na + and K + pump transport and raised cell Na + on other non-pump-mediated transport pathways are discussed. Raised cell Na + may be a marker for the adequacy of maintenance dialysis in patients with end-stage renal failure

  11. Study of π0 Dalitz decays in the NA62 and NA48/2 experiments

    Science.gov (United States)

    Maurice, E.; Ambrosino, F.; Antonelli, A.; Anzivino, G.; Arcidiacono, R.; Baldini, W.; Balev, S.; Bifani, S.; Biino, C.; Bizzeti, A.; Bloch-Devaux, B.; Bolotov, V.; Bucci, F.; Ceccucci, A.; Cenci, P.; Cerri, C.; Collazuol, G.; Costantini, F.; Cotta Ramusino, A.; Coward, D.; D'Agostini, G.; Dalpiaz, P.; Danielsson, H.; Dellacasa, G.; Di Filippo, D.; DiLella, L.; Doble, N.; Duk, V.; Engelfried, J.; Eppard, K.; Falaleev, V.; Fantechi, R.; Fiorini, M.; Frabetti, P. L.; Fucci, A.; Gallorini, S.; Gatignon, L.; Gersabeck, E.; Gianoli, A.; Giudici, S.; Goudzovski, E.; Goy Lopez, S.; Gushchin, E.; Hallgren, B.; Hita-Hochgesand, M.; Iacopini, E.; Imbergamo, E.; Kekelidze, V.; Kleinknecht, K.; Kozhuharov, V.; Kurshetsov, V.; Lamanna, G.; Lazzeroni, C.; Lenti, M.; Leonardi, E.; Litov, L.; Madigozhin, D.; Maier, A.; Mannelli, I.; Marchetto, F.; Massarotti, P.; Misheva, M.; Molokanova, N.; Moulson, M.; Movchan, S.; Napolitano, M.; Norton, A.; Numao, T.; Obraztsov, V.; Palladino, V.; Pepe, M.; Peters, A.; Petrucci, F.; Peyaud, B.; Piandani, R.; Piccini, M.; Pierazzini, G.; Popov, I.; Potrebenikov, Yu.; Raggi, M.; Renk, B.; Retière, F.; Riedler, P.; Romano, A.; Rubin, P.; Ruggiero, G.; Salamon, A.; Saracino, G.; Savrié, M.; Semenov, V.; Sergi, A.; Serra, M.; Shkarovskiy, S.; Sozzi, M.; Spadaro, T.; Valente, P.; Veltri, M.; Venditti, S.; Wahl, H.; Wanke, R.; Winhart, A.; Winston, R.; Yushchenko, O.; Zinchenko, A.; NA62 Collaboration; NA48/2 Collaboration

    2017-01-01

    The NA62 experiment at CERN collected a large sample of charged kaon decays with a highly efficient trigger for decays into electrons in 2007. The kaon beam represents a source of tagged neutral pion decays in vacuum. A measurement of the electromagnetic transition form factor slope of the neutral pion in the time-like region from ∼1 million fully reconstructed π0 Dalitz decay is presented. The limits on dark photon production in π0 decays from the earlier kaon experiment at CERN, NA48/2, are also reported.

  12. Fitoterápicos na odontologia: estudo etnobotânico na cidade de Manaus

    Directory of Open Access Journals (Sweden)

    S. S. Evangelista

    2013-01-01

    Full Text Available O reconhecimento oficial da fitoterapia na odontologia no Brasil veio acompanhado de diversas lacunas na pesquisa científica e na utilização de plantas medicinais, especificamente para espécies vegetais com aplicação nas doenças da cavidade oral. O estado do Amazonas, especificamente a cidade de Manaus, não possui um diagnóstico da aplicabilidade de plantas medicinais nos serviços de atenção Odontológica. Esse estudo propôs realizar um estudo do tipo quali-quantitativo, descritivo e exploratório visando o levantamento da comercialização de plantas medicinais e o estudo etnobotânico para identificação das principais plantas medicinais indicadas e utilizadas nas patologias orais nos atendimentos odontológicos ambulatoriais na cidade de Manaus. Foram entrevistados 197 usuários do serviço odontológico, 150 Cirurgiões-Dentistas, e 47 comerciantes credenciados na prefeitura Municipal de Manaus. A amostragem foi realizada por acessibilidade ou conveniência para os Cirurgiões-Dentistas, enquanto os usuários foram selecionados através de amostragem aleatória simples, e os comerciantes de plantas medicinais foram entrevistados em sua totalidade. Os resultados demonstraram a existência de comercialização de plantas medicinais para patologias orais, destacando-se as seguintes espécies: Pedra ume cãa (Aulomyrcia sphareocarpa, Crajiru (Arrabidae chica, além da planta, sem identificação botânica, conhecida popularmente como Sara tudo. Entre os Cirurgiões-Dentistas e entre os pacientes, apenas 8% e 7,61%, respectivamente, utilizaram plantas medicinais para alterações patológicas orais. Os autores concluíram que as plantas medicinais comercializadas na cidade de Manaus são utilizadas de maneira empírica e que, apesar da Política Nacional de Práticas Integrativas e Complementares (PNPIC, novas políticas públicas de saúde devem inserir plantas medicinais e fitoterápicos de uso oral na rede pública de saúde na

  13. OGLAŠEVANJE NA SOCIALNEM OMREŽJU FACEBOOK, NA PRIMERU SPLETICNA.SI

    OpenAIRE

    Reisman, Nina

    2011-01-01

    Internet je od svojega razvoja dolgo časa obstajal kot prostor za enostransko komunikacijo. Isto se je dogajalo na televiziji, radiu in časopisih, kjer je javnost sprejemala informacije, ki jih je nekdo pripravil. Tradicionalni mediji so hitro doumeli, da takšna vrsta komunikacije ni naravna in ne predstavlja najboljšega ohranjanja gledalcev in poslušalcev. Začela se je uporabljati dvosmerna komunikacija. Trenutno v svetu najbolje poznan primer dvosmerne komunikacije je socialno omrežje F...

  14. Transtorno afetivo bipolar na infância e na adolescência

    OpenAIRE

    Fu-I,Lee

    2004-01-01

    Os conhecimentos sobre transtorno afetivo bipolar com início na infância e na adolescência têm avançado muito nos últimos 15 anos. Atualmente, os esforços estão dirigidos para investigar o quadro clínico, para o desenvolvimento de instrumentos que auxiliam diagnóstico precoce e investigações de melhores formas de tratamentos de crianças e adolescentes portadores do transtorno. O presente texto tem objetivo de apresentar as principais características clínicas do transtorno em crianças e adoles...

  15. NaI(Tl) response functions

    Energy Technology Data Exchange (ETDEWEB)

    Vega C, H. R.; Ortiz R, J. M. [Universidad Autonoma de Zacatecas, Unidad Academica de Estudios Nucleares, Cipres No. 10, Fracc. La Penuela, 98068 Zacatecas, Zac. (Mexico); Benites R, J. L. [Centro Estatal de Cancerologia de Nayarit, Calz. de la Cruz 118 Sur, Tepic, Nayarit (Mexico); De Leon M, H. A., E-mail: fermineutron@yahoo.com.mx [Instituto Tecnologico de Aguascalientes, Av. Adolfo Lopez Mateos 1801 Ote., 20155 Aguascalientes, Ags. (Mexico)

    2015-09-15

    The response functions of a NaI(Tl) detector have been estimated using Monte Carlo methods. Response functions were calculated for monoenergetic photon sources (0.05 to 3 MeV). Responses were calculated for point-like sources and for sources distributed in Portland cement cylinders. The responses were used to calculate the efficiency functions in term of photon energy. Commonly, sources used for calibration are point-like, and eventually sources to be measured have different features. In order to use the calibrated sources corrections due to solid angle, self-absorption and scattering, must be carried out. However, some of these corrections are not easy to perform. In this work, the calculated responses were used to estimate the detector efficiency of point-like sources, and sources distributed in Portland type cement. Samples of Portland paste were prepared and were exposed to photoneutrons produced by a 15 MV linac. Some of the elements in the cement were activated producing γ-emitting radionuclides that were measured with a NaI(Tl) gamma-ray spectrometer, that was calibrated with point-like sources. In order to determine the specific activity in the induced radioisotopes calculated efficiencies were used to make corrections due to the differences between the solid angle, photon absorption and photon scattering in the point-like calibration sources and the sources distributed in cement. During the interaction between photoneutrons and the cement samples three radioisotopes were induced: {sup 56}Mn, {sup 24}Na, and {sup 28}Al. (Author)

  16. Linguagens na TV Languages on tv

    Directory of Open Access Journals (Sweden)

    Glaucia Guimarães

    2008-06-01

    Full Text Available Este artigo aborda questões relativas às estratégias discursivas utilizadas na produção dos textos televisivos. Com base na Análise Crítica de Discurso (ACD, nos termos em que é formulada por Norman Fairclough, o trabalho analisa os modos pelos quais as linguagens (incluindo materiais semióticos diversos são articuladas na/pela TV, sistematiza as relações entre a articulação de linguagens e a produção de efeitos de sentido, bem como os modos de sua inscrição nas tendências discursivas contemporâneas, a saber: democratização, tecnologização e comodificação. A partir das relações entre as práticas de linguagem e as tendências destacadas, o artigo tece considerações sobre as condições de produção de leituras críticas dos textos multimidiáticos, nas suas múltiplas dimensões: dos contextos e mecanismos da produção textual à pluralidade constitutiva de sua recepção.This paper deals with issues related to discursive strategies in the production of TV texts. Based on Critical Discourse Analysis (CDA, as formulated by Norman Fairclough, it analyzes the ways languages (including several semiotic materials are articulated in order to produce a range of wanted meaning effects, as well as the ways they are inscribed in the contemporary discursive trends discussed by the author, namely: democratization, technologization and commodification. Departing from the analysis of language practices and the discursive trends underlined, the paper aims at clarifying the multiple dimensions of multimedia conditions of production, focusing on both the context and the mechanisms and the diverse reception (reading possibilities.

  17. Na(+),K (+)-ATPase as a docking station: protein-protein complexes of the Na(+),K (+)-ATPase.

    Science.gov (United States)

    Reinhard, Linda; Tidow, Henning; Clausen, Michael J; Nissen, Poul

    2013-01-01

    The Na(+),K(+)-ATPase, or sodium pump, is well known for its role in ion transport across the plasma membrane of animal cells. It carries out the transport of Na(+) ions out of the cell and of K(+) ions into the cell and thus maintains electrolyte and fluid balance. In addition to the fundamental ion-pumping function of the Na(+),K(+)-ATPase, recent work has suggested additional roles for Na(+),K(+)-ATPase in signal transduction and biomembrane structure. Several signaling pathways have been found to involve Na(+),K(+)-ATPase, which serves as a docking station for a fast-growing number of protein interaction partners. In this review, we focus on Na(+),K(+)-ATPase as a signal transducer, but also briefly discuss other Na(+),K(+)-ATPase protein-protein interactions, providing a comprehensive overview of the diverse signaling functions ascribed to this well-known enzyme.

  18. Importance of Residues Outside the Cation Binding Pocket for Na+ and K+ Binding to the Na+/K+-ATPase

    DEFF Research Database (Denmark)

    Christiansen, Line; Toustrup-Jensen, Mads Schak; Einholm, Anja P.

    Mutagenesis studies have identified several oxygen-containing residues in the transmembrane region which are important for the coordination of Na+ and/or K+. These were later confirmed by the high-resolution crystal structures of the Na+/K+-ATPase with bound Na+ or K+. However, more information...... is needed to reveal the translocation pathway through the Na+/K+-ATPase. Mutagenesis studies have shown that several other transmembrane residues located outside the cation binding pocket, including Phe785 and Phe788, affect the ion binding properties of the Na+/K+-ATPase (1,2). It is well...... not significantly affect the Na+ binding properties of the Na+/K+-ATPase. 1. Vilsen, B. (1999) Biochemistry 38, 11389 2. Rodacker, V. et al (2006) JBC 281, 18539 3. Laursen M et al. (2013) PNAS 110, 10958...

  19. Effect of growth in lithium on ouabain binding, Na-K-ATPase and Na and K transport in hela cells.

    Science.gov (United States)

    Boardman, L J; Hume, S P; Lamb, J F; Polson, J

    1975-01-01

    1. HeLa cells were grown for 24 hr in growth medium in which part of the Na was replaced with Li. Ion contents, cell volumes and numbers, Na-K-ATPase and specific ouabain binding were measured. In some experiments the Na efflux and net Na transport was also measured. 2. Growth in Li caused a rise in the specific ouabain binding and membrane Na-K-ATPase of these cells. The Li concentrations in the cells necessary to produce this effect ranged up to 50 mM. 3. It is suggested that Li, like Na, acts on the genetic material of the cells to cause the production of more Na pumps within the membrane. PMID:124350

  20. The NA48 liquid krypton prototype calorimeter

    Energy Technology Data Exchange (ETDEWEB)

    Barr, G.D.; Buchholz, P.; Carosi, R.; Coward, D.; Cundy, D.; Doble, N.; Gatignon, L.; Gonidec, A.; Hallgren, B.; Kesseler, G.; Lacourt, A.; Laverriere, G.; Linser, G.; Mast, M.; Schilly, P.; Schinzel, D.; Seidl, W.; Taureg, H.; Wahl, H.; Wicht, P. (CERN, Geneva (Switzerland)); Bertanza, L.; Bigi, A.; Calafiura, P.; Casali, R.; Cerri, C.; Fantechi, R.; Gennaro, G.; Gorini, B.; Mannelli, I.; Marzulli, V.; Pierazzini, G.; Schiuma, D.; Sergiampietri, F. (INFN, Pisa (Italy) Scuola Normale, Pisa (Italy) Univ. Pisa (Italy)); Bederede, D.; Debeer, M.; Debu, P.; Peyaud, B. (CE-Saclay-DAPNIA, 91 - Gif-sur-Yvette (France)); Kreutz, A. (Univ. Gesamthochschule Siegen (Germany)); Griesmayer, E.; Markytan, M.; Neuhofer, G.; Pernicka, M.; Taurok, A.; Viehhauser, G.; Wulz, C.E. (Oesterreichische Akademie der Wissenschaften, Inst. fuer Hochenergiephysik, Vienna (Austria)); Cagliari-Cambridge-CERN-Dubna-Edingburgh-Ferrara-Mainz-Perugia-Pisa-Saclay-Siegen-Torino-Vienna Collaboration

    1992-12-01

    The NA48 experiment for a precision measurement of the CP violation parameter element of'/element of in K[sup 0][yields]2[pi] decays will require a fast electromagnetic calorimeter with excellent energy and time resolution. A quasi homogeneous calorimeter using liquid krypton and a fast readout with 40 MHz FADCs is proposed. A prototype with 400 kg of liquid krypton was built and tested in an electron beam. Results for the energy, space and time resolution of this prototype are given. (orig.).

  1. Holistična obravnava motenj hranjenja

    OpenAIRE

    Arzenšek, Pia

    2017-01-01

    Izhodišča: Stres, nepravičnost, nespoštljivost, mediji, kot socialni, ter biološko-genetski, družinski in psihološki dejavniki tveganja v kombinacijah vplivajo na razvoj različnih motenj, bolezni, tudi motenj hranjenja (MH). Najpogostejše med njimi so anorexia nervosa, bulimija nervosa in kompulzivno prenajedanje, kot duševne motnje po mednarodni klasifikaciji. V novejšem času se pojavljajo nove oblike MH (ortoreksija, bigoreksija…). O MH govorimo kadar hrana postane osrednja tema posamezniko...

  2. O estresse na atividade gerencial do enfermeiro

    OpenAIRE

    Lautert Liana; Chaves Enaura H. B.; Moura Gisela M. S. S. de

    1999-01-01

    O trabalho do enfermeiro, principalmente no âmbito hospitalar, está, conforme diversos estudos, entre os que mais geram estresse em seus profissionais. Dessa forma, o objetivo desta investigação foi identificar as fontes geradoras de estresse na atividade gerencial do enfermeiro que trabalha no hospital e as principais alterações que o estresse pode acarretar sobre a saúde desse profissional. Trata-se de uma pesquisa quantitativa com uma amostra de 207 enfermeiros, realizada em 1996 em um hos...

  3. Results on leptonic probes from NA50

    CERN Document Server

    Alessandro, B; Arnaldi, R; Atayan, M; Baglin, C; Baldit, A; Bedjidian, Marc; Beolè, S; Boldea, V; Bordalo, P; Borenstein, S R; Borges, G; Bussière, A; Capelli, L; Castanier, C; Castor, J I; Chaurand, B; Cheynis, B; Chiavassa, E; Cicalò, C; Claudino, T; Comets, M P; Constantinescu, S; Cortese, P; Cruz, J; De Falco, A; De Marco, N; Dellacasa, G; Devaux, A; Dita, S; Drapier, O; Espagnon, B; Fargeix, J; Force, P; Gallio, M; Gavrilov, Yu K; Gerschel, C; Giubellino, P; Golubeva, M B; Gonin, M; Grigorian, A A; Grigorian, S; Grossiord, J Y; Guber, F F; Guichard, A; Gulkanian, H R; Hakobyan, R S; Haroutunian, R; Idzik, M; Jouan, D; Karavitcheva, T L; Kluberg, L; Kurepin, A B; Le Bornec, Y; Lourenço, C; Macciotta, P; MacCormick, M; Marzari-Chiesa, A; Masera, M; Masoni, A; Monteno, M; Musso, A; Petiau, P; Piccotti, A; Pizzi, J R; Prado da Silva, W L; Prino, F; Puddu, G; Quintans, C; Ramello, L; Ramos, S; Rato-Mendes, P; Riccati, L; Romana, A; Santos, H; Saturnini, P; Scalas, E; Scomparin, E; Serci, S; Shahoyan, R; Sigaudo, F; Sitta, M; Sonderegger, P; Tarrago, X; Topilskaya, N S; Usai, G L; Vercellin, Ermanno; Villatte, L; Willis, N; Wu, T

    2003-01-01

    The NA50 Collaboration has performed a new measurement of the J/ psi yield in Pb-Pb collisions at 158 GeV/nucleon in improved experimental conditions. Our preliminary analysis of the year 2000 data sample, while confirming the onset of anomalous suppression and the non saturation of the J/ psi /Drell-Yan cross-section ratio, shows that peripheral Pb-Pb interactions follow the normal nuclear absorption pattern, which has in turn been established more precisely thanks to high statistics p-A data. (11 refs).

  4. Processo de pintura na Preh Portugal

    OpenAIRE

    Pontes, José Luís Pereira

    2016-01-01

    Neste estágio trabalhei no departamento de Engenharia de Processo e Automatização. Os Engenheiros que trabalham nesse departamento têm diversas funções. Desde ser responsáveis por uma linha de montagem; responsável por todas as alterações de engenharia; responsável pela parte eletrónica; responsável pela parte de pintura; entre outras. Também auxiliei na criação e atualização de Standards dentro da organização. Inicialmente, estes Standards ou estavam em formato Excel com basta...

  5. Cerenkov counter for the experiment NA3

    CERN Multimedia

    1978-01-01

    The program of the NA3 experiment included the study of hadronic interactions with a large transverse momentum pT, thus the inclusion in the set-up of three gas threshold Cerenkov counters of large acceptance. The photo shows the downstream part of the second Cerenkov (located at the output of the magnet). The yellow membrane is a temporary protection for the optics (shown in photo 7810540X) to be taken away when fixing this part to the gas tank (entering the magnet and not shown). The photomultipliers all around are heavily shielded.

  6. Sexualidade, Espiritualidade e Conjugalidades na Wicca Brasileira

    OpenAIRE

    Cordovil, Daniela

    2017-01-01

    Resumo Este artigo propõe uma análise do papel da sexualidade nas práticas da Wicca, religião neopagã surgida na Inglaterra entre 1940 e 1950. Atualmente, a Wicca é um movimento mundial multifacetado, que segue inúmeras vertentes. Esta pesquisa investiga concepções e práticas ligadas à sexualidade presentes entre grupos que praticam a Wicca publicamente em diversas capitais do Brasil. Esses grupos estão organizados em tradições (grupos religiosos com viés iniciático) que comandam associações ...

  7. Qualidade de vida na epilepsia infantil

    OpenAIRE

    SOUZA ELISABETE ABIB PEDROSO DE

    1999-01-01

    A epilepsia é desordem crônica que ocorre principalmente na infância e adolescência. Tradicionalmente, o tratamento da epilepsia enfatiza aspectos neurológicos mais do que fatores psicológicos. A aten��ão voltada simplesmente para o controle das crises no contexto clínico pode não ser suficiente para entender a grande amplitude de problemas que afetam a qualidade de vida das crianças com epilepsia. Muitas das dificuldades psicossociais dos adultos com epilepsia desenvolvem-se a partir de comp...

  8. DEPRESSÃO E ENVELHECIMENTO NA CONTEMPORANEIDADE

    Directory of Open Access Journals (Sweden)

    Delia Catullo Goldfarb

    2010-02-01

    Full Text Available RESUMO: O presente texto reproduz os trabalhos apresentados em mesa redonda sobre depressão e envelhecimento na contemporaneidade no III Congresso Ibero-americano de Psicogerontologia, realizado em novembro de 2010 em São Paulo. Estes trabalhos são resultado de reflexões precedentes em um grupo de estudos e de discussão de casos clínicos composto por psicanalistas. A depressão é uma figura psicopatológica de presença maciça nos dias de hoje. Na velhice o acúmulo de perdas e a aproximação da morte podem produzir um estado de tristeza, fundo depressivo que caracteriza um momento de recolhimento em que ocorrem os processos de luto. Em alguns sujeitos o que se verifica é a instalação de um episódio depressivo que indica a paralisação destes processos elaborativos e a progressão de um esvaziamento do sentido para a vida, restando, neste contexto, apenas a espera pela morte. Neste trabalho serão discutidos aspectos que concernem a vivência destas duas modalidades de enfrentamento da entrada na velhice, levando-se em conta as maneiras como a cultura pode favorecer a ocorrência destes percursos distintos do envelhecer, e como ela os aloja atualmente em um movimento de desconsideração da subjetividade: desanimo da velhice ou problema neuroquímico? Serão apresentadas hipóteses para a produção da depressão como psicopatologia no envelhecimento e reflexões sobre observações clínicas que derivam destes quadros clínicos, tais como: a crise da percepção da entrada na velhice, o corpo hipocondríaco, a paralisia do tempo, a vivência do desamparo. Palavras-chave: depressão, envelhecimento, cultura, corpo, tempo

  9. O mito da autoestima na aprendizagem escolar

    OpenAIRE

    Franco, Adriana de Fátima

    2009-01-01

    Este artigo analisa, nos marcos da perspectiva sócio-histórica, a construção social da autoestima e suas relações com o fracasso escolar. Fundamentada nos pressupostos de Vigotski, nega a possibilidade da valoração que o sujeito faz de si estar atrelada a atributos naturalmente humanos e presentes desde o nascimento. A compreensão do ser humano é feita a partir de uma análise de homem enquanto ser concreto, social, histórico e cultural que constrói sua humanidade na interação com outros homen...

  10. O dano pessoal na sociedade de risco

    OpenAIRE

    Hofmeister, Maria Alice Costa

    2000-01-01

    Tese (doutorado) - Universidade Federal de Santa Catarina, Centro de Ciências Jurídicas. Estudo do dano pessoal e sua indenização, sob a ótica do dano corporal. Equaciona-se a matéria a partir do homem na pós-modernidade. Conclui-se que urge repensar as normas à luz de uma interpretação constitucional para atender à função mais importante da responsabilidade hoje reconhecida: indenizar a vítima. A indenização deverá ser reorientada para priorizar as necessidades da vítima em concreto. ...

  11. O TRADICIONALISMO NA LINGUAGEM JURÍDICA

    OpenAIRE

    Eliane Simões Pereira Bulhões

    2009-01-01

    Este artigo tem como objetivo analisar alguns aspectos do discurso atual do Direito brasileiro. Apoiando-se em pressupostos teóricos do lingüista russo Mikhail Bakhtin (1895-1975), segundo os quais a linguagem é instância ideológica por excelência, presentes na obra Marxismo e filosofia da linguagem, procuramos avaliar a linguagem jurídica como expressão do componente ideológico. Para tanto utilizamos um modelo de petição jurídica colhido em um guia para advogados, o qual nos serve como corpu...

  12. O TRADICIONALISMO NA LINGUAGEM JURÍDICA

    Directory of Open Access Journals (Sweden)

    Eliane Simões Pereira Bulhões

    2009-02-01

    Full Text Available Este artigo tem como objetivo analisar alguns aspectos do discurso atual do Direito brasileiro. Apoiando-se em pressupostos teóricos do lingüista russo Mikhail Bakhtin (1895-1975, segundo os quais a linguagem é instância ideológica por excelência, presentes na obra Marxismo e filosofia da linguagem, procuramos avaliar a linguagem jurídica como expressão do componente ideológico. Para tanto utilizamos um modelo de petição jurídica colhido em um guia para advogados, o qual nos serve como corpus representativo da linguagem forense.

  13. [Effects of NaCl stress on the seedling growth and K(+)- and Na(+) -allocation of four leguminous tree species].

    Science.gov (United States)

    Mo, Hai-Bo; Yin, Yun-Long; Lu, Zhi-Guo; Wei, Xiu-Jun; Xu, Jian-Hua

    2011-05-01

    Taking the pot-cultured seedlings of four leguminous tree species (Albizia julibrissin, Robinia pseudoacacia, Sophora japonica, and Gleditsia sinensis) as test materials, this paper studied their growth indices, critical salt concentration (C50), and K+ and Na+ allocation under different levels of NaCl stress, aimed to understand the difference of test tree species in salt tolerance. NaCl stress inhibited the seedling growth of the tree species. Under NaCl stress, the dry matter accumulation decreased, while the root/shoot ratio increased, especially for A. julibrissin and G. sinensis. Quadratic regression analysis showed that the C50 of A. julibrissin, R. pseudoacacia, S. japonica, and G. sinensis was 3.0 per thousand, 5.0 per thousand, 4.5 per thousand, and 3.9 per thousand, respectively, i.e., the salt tolerance of the four tree species was in the order of R. pseudoacacia > S. japonica > G. sinensis > A. julibrissin. In the root, stem, and leaf of the four tree species seedlings, the Na+ content increased with the increase of NaCl stress, while the K+ content (except in the root of A. julibrissin) decreased after an initial increase, resulting in a larger difference in the K+/Na+ ratio in the organs. Under the same NaCl stress, the allocation of Na+ in different organs of the four tree species seedlings decreased in the order of root>stem>leaf, while that of K+ differed with tree species and NaCl stress, and leaf was the main storage organ for K+. The K+/Na+ ratio in different organs decreased in the sequence of leaf>stem>root. R. pseudoacacia under NaCl stress accumulated more K+ and less Na+ in stem and leaf, and had higher K+/Na+ ratio in all organs and higher dry mass, being assessed to be more salt-tolerant. In contrast, A. julibrissin under high NaCl stress accumulated more Na+ in stem and leaf, and had a lower K+/Na+ ratio in all organs and lower dry mass, being evaluated to be lesser salt-tolerant. The K+ accumulation in seedling stem and leaf and the Na

  14. Relationship between intracellular Na+ concentration and reduced Na+ affinity in Na+,K+-ATPase mutants causing neurological disease

    DEFF Research Database (Denmark)

    Toustrup-Jensen, Mads Schak; Einholm, Anja P.; Schack, Vivien

    was observed for the +28 mutation of α2 despite a high expression level. A significant rise of [Na+]i and reduction of [K+]i was detected in cells expressing mutants with reduced Na+ affinity and did not require a concomitant reduction of the maximal catalytic turnover rate or expression level. Moreover, two...

  15. Adsorbed or intercalated: Na on graphene/Ir(111)

    Science.gov (United States)

    Pervan, Petar; Lazić, Predrag

    2017-09-01

    Interaction of sodium with graphene (Gr) on Ir(111) was studied with the aim to resolve the issue of Na adsorption/intercalation kinetics. The system Na/Gr/Ir(111) was studied by means of angle-resolved photoemission spectroscopy, low-energy electron diffraction, and ab initio density functional theory (DFT) calculation. It has been found that at room temperature (RT) and low concentrations Na is dominantly adsorbed on graphene. At higher concentrations, an intercalation process sets in so that it is possible to observe the coexistence of these two states. Eventually, all Na atoms are found in the intercalated state as determined by exposure to oxygen. While adsorption of Na on graphene already intercalated by Na [Na/Gr/Na/Ir(111) system] at RT was not possible, we could observe Li adsorption through the increase of Dirac point binding energy. Li coadsorption strongly affects the binding energy of the iridium surface state as well. This finding was supported by DFT calculations of adsorption energy of Na and Li on bare and fully Na intercalated graphene.

  16. Advancement of technology towards developing Na-ion batteries

    Science.gov (United States)

    Jamesh, Mohammed Ibrahim; Prakash, A. S.

    2018-02-01

    The Na-ion-batteries are considered much attention for the next-generation power-sources due to the high abundance of Na resources that lower the cost and become the alternative for the state of the art Li-ion batteries in future. In this review, the recently reported potential cathode and anode candidates for Na-ion-batteries are identified in-light-of-their high-performance for the development of Na-ion-full-cells. Further, the recent-progress on the Na-ion full-cells including the strategies used to improve the high cycling-performance (stable even up-to 50000 cycles), operating voltage (even ≥ 3.7 V), capacity (>350 mAhg-1 even at 1000 mAg-1 (based-on-mass-of-the-anode)), and energy density (even up-to 400 Whkg-1) are reviewed. In addition, Na-ion-batteries with the electrodes containing reduced graphene oxide, and the recent developments on symmetric Na-ion-batteries are discussed. Further, this paper identifies the promising Na-ion-batteries including the strategies used to assemble full-cell using hard-carbon-anodes, Na3V2(PO4)3 cathodes, and other-electrode-materials. Then, comparison between aqueous and non-aqueous Na-ion-batteries in terms of voltage and energy density has been given. Later, various types of electrolytes used for Na-ion-batteries including aqueous, non-aqueous, ionic-liquids and solid-state electrolytes are discussed. Finally, commercial and technological-developments on Na-ion-batteries are provided. The scientific and engineering knowledge gained on Na-ion-batteries afford conceivable development for practical application in near future.

  17. Apical Na+ permeability of frog skin during serosal Cl- replacement.

    Science.gov (United States)

    Leibowich, S; DeLong, J; Civan, M M

    1988-05-01

    Gluconate substitution for serosal Cl- reduces the transepithelial short-circuit current (Isc) and depolarizes short-circuited frog skins. These effects could result either from inhibition of basolateral K+ conductance, or from two actions to inhibit both apical Na+ permeability (PapNa) and basolateral pump activity. We have addressed this question by studying whole-and split-thickness frog skins. Intracellular Na+ concentration (CcNa) and PapNa have been monitored by measuring the current-voltage relationship for apical Na+ entry. This analysis was conducted by applying trains of voltage pulses, with pulse durations of 16 to 32 msec. Estimates of PapNa and CcNa were not detectably dependent on pulse duration over the range 16 to 80 msec. Serosal Cl- replacement uniformly depolarized short-circuited tissues. The depolarization was associated with inhibition of Isc across each split skin, but only occasionally across the whole-thickness preparations. This difference may reflect the better ionic exchange between the bulk medium and the extracellular fluid in contact with the basolateral membranes, following removal of the underlying dermis in the split-skin preparations. PapNa was either unchanged or increased, and CcNa either unchanged or reduced after the anionic replacement. These data are incompatible with the concept that serosal Cl- replacement inhibits PapNa and Na,K-pump activity. Gluconate substitution likely reduces cell volume, triggering inhibition of the basolateral K+ channels, consistent with the data and conclusions of S.A. Lewis, A.G. Butt, M.J. Bowler, J.P. Leader and A.D.C. Macknight (J. Membrane Biol. 83:119-137, 1985) for toad bladder. The resulting depolarization reduces the electrical force favoring apical Na+ entry. The volume-conductance coupling serves to conserve volume by reducing K+ solute loss. Its molecular basis remains to be identified.

  18. Estudo comparativo entre ropivacaína a 0,5% e bupivacaína a 0,5% ambas hiperbáricas, na raquianestesia

    OpenAIRE

    Carvalho, Afonso Cláudio dos Reis e; Machado, Jean Abreu; Nociti, José Roberto

    2002-01-01

    JUSTIFICATIVA E OBJETIVOS - Estudos clínicos e experimentais já demonstraram a eficácia e a segurança da ropivacaína aplicada a estruturas nervosas por via subaracnóidea. Por outro lado, a potência da ropivacaína em raquianestesia é aproximadamente igual à metade da potência de bupivacaína, considerando-se soluções hiperbáricas. O objetivo deste estudo foi comparar as características do bloqueio subaracnóideo com ropivacaína ou bupivacaína hiperbáricas, em doses equipotentes. MÉTODO - Vinte p...

  19. Saturation effects in Na lidar temperature measurements

    International Nuclear Information System (INIS)

    von der Gathen, P.

    1991-01-01

    Na atoms residing in the 80-110 km altitude region can be used to probe the Doppler-broadened hyperfine structure (hfs) of their D 2 resonance by ground-bases lidar and hence to deduce atmospheric temperatures. In principle, two different methods may be employed: (1) wavelength scanning of the hfs with a narrow-band laser and signal detection with a broad-band receiver, and (2) use of a broad-band laser and wavelength scanning of the hfs with a narrow-band receiver. These two methods are affected in different ways by laser-induced saturation in the Na layer, the effect on the measurements of sodium densities and of atmospheric temperatures being quite different. Density measurements are affected by the absolute level of saturation. Temperature measurements, however, are affected by the difference in saturation at the scanned wavelengths. If, additionally, observed signal levels are taken into account, method 1 is more efficient than method 2 for both types of measurements at nighttime, whereas a modified method 2 surpasses method 1 for temperature measurements at daytime

  20. ESTUDO DO EMPODERAMENTO NA PERSPECTIVA DAS MULHERES

    Directory of Open Access Journals (Sweden)

    Karoline Brasil de Oliveira

    2015-12-01

    Full Text Available Este trabalho objetivou conhecer como as mulheres que ocupam cargos de liderança, utilizam o empoderamento no exercício profissional em uma instituição de ensino e tecnologia em Criciúma, Santa Catarina, Brasil. Na revisão da literatura foram contextualizados a mulher e sua inserção no mercado de trabalho, em busca de uma concepção de empoderamento e as dimensões do empoderamento da mulher no mercado de trabalho. A metodologia utilizada teve caráter descritivo e qualitativo. O instrumento de coleta de dados consistiu num roteiro com 16 questões que abordaram o bem-estar e sucesso profissional, o reconhecimento familiar, o processo de ascensão profissional e a participação das mulheres nos processos decisórios organizacionais. A pesquisa foi realizada com 10 mulheres que ocupavam cargos de chefia em diferentes setores da instituição em análise. Os resultados obtidos na pesquisa revelaram que as entrevistadas já demonstram expressões de empoderamento em seus cotidianos e a mulher se apresenta mais confiante e preparada para participar das tomadas de decisões em níveis hierárquicos maiores, além de interferir no próprio meio.

  1. Desafios na gestão escolar

    Directory of Open Access Journals (Sweden)

    Flávia Obino Corrêa Werle

    2015-09-01

    Full Text Available Este estudo discute a avaliação em larga escala da educação básica, os processos de regulação e debate processos de gestão realizados no interior da escola pública. Seu objetivo é compreender como a equipe diretiva de duas escolas da rede pública estadual de Porto Alegre, Brasil, se apropria dos resultados do Indíce de Desenvolvimento da Educação Básica (IDEB e como lida com eles na gestão escolar. A metodologia utilizada é de cunho qualitativo com coleta de dados através de um questionário estruturado. Apresenta os resultados do IDEB das duas escolas no período de 2009 e 2011. Na prática escolar a apropriação ocorre em três dimensões (pedagógica, administrativa e participativa e promove diálogos em diferentes níveis: com a hierarquia do sistema educacional, com a comunidade externa à escola e, internamente, com os professores e demais membros da comunidade escolar.

  2. Criptococose pulmonar: aspectos na tomografia computadorizada

    Directory of Open Access Journals (Sweden)

    Silva Ana Carina Gamboa da

    2003-01-01

    Full Text Available A criptococose pulmonar é uma doença causada pelo Criptococcus neoformans, um fungo unimórfico que possui distribuição mundial, existindo na mesma forma tanto no seu habitat natural quanto em animais e humanos. A doença possui apresentações clínica e patológica variáveis e pode manifestar-se tanto em pacientes com a imunidade normal como em imunocomprometidos, que representam a maioria dos casos. Neste trabalho são analisados os aspectos encontrados nas tomografias computadorizadas do tórax de 14 pacientes com criptococose pulmonar confirmada. Os achados mais freqüentes na tomografia do tórax foram as massas e os nódulos pulmonares. Outros aspectos observados foram as áreas de escavação, as consolidações, o espessamento do interstício peribroncovascular e o reticulado difuso. Massa pulmonar foi o achado isolado mais comum (64,2%, seguido dos nódulos isolados ou múltiplos (35,7%. Doença pulmonar difusa foi vista em apenas 14,2% dos casos. Os lobos superiores foram os mais comprometidos, sendo a doença mais comum nas regiões anteriores. A tomografia do tórax permitiu avaliar com precisão o grau de comprometimento do parênquima pulmonar.

  3. Vinhos, Turismo e Pluriatividade na Agricultura

    Directory of Open Access Journals (Sweden)

    Hernanda Tonini

    2013-06-01

    Full Text Available A gastronomia, além de ter importante relação com a economia, é uma forma expressiva da cultura dos indivíduos, desde o tipo de alimentos cultivados até a maneira de seu preparo e consumo. O presente artigo propõe-se a analisar a relação entre o enoturismo – centralizado na existência do vinho enquanto elemento gastronômico – e o fenômeno da pluriatividade na agricultura familiar, vista nos últimos anos como alternativa positiva para sua reprodução econômica e social. O fluxo turístico em regiões vitivinícolas gera novas oportunidades de trabalho e faz com que agricultores e suas famílias dividam a mão de obra agrícola, até então direcionada ao cultivo da uva e outros alimentos para subsistência, com atividades não agrícolas – como o artesanato, o acolhimento de visitantes em pousadas, a atuação em restaurantes, entre outras – como chance de subsistência. Este panorama transforma as realidades do mundo rural, alterando a relação do agricultor com a produção de alimentos e a forma como o mesmo os utiliza, além de reestruturar o ambiente sociocultural no seu entorno.  

  4. Brasileiros na fronteira com o Paraguai

    Directory of Open Access Journals (Sweden)

    Marcia Anita Sprandel

    2006-08-01

    Full Text Available O ARTIGO apresenta uma cartografia da situação social dos brasileiros e seus descendentes que vivem no Paraguai. Os distintos mapas (artigos, dissertações, teses e relatórios, com suas múltiplas perspectivas, permitem que se relativizem as narrativas midiáticas e a concepção da região como "lugar difícil". Ao discorrer sobre trabalhos de diversos autores, de distintas áreas acadêmicas, o artigo aponta para a mportância de cada um deles na construção de uma análise que traduza a pluralidade de pontos de vista coexistentes na região e que são, muitas vezes, inconciliáveis.THE ARTICLE presents a cartography of the social situation of the Brazilians and its descendants who live in Paraguay. The distinct maps (articles, these and reports deconstruct the media’s narratives and the conception of the region as a "difficult place". Works of diverse authors, of distinct academic areas, demonstrate the importance of each one of them in the construction of an analysis that translates the plurality of points of view.

  5. A biotecnologia na agropecuária

    Directory of Open Access Journals (Sweden)

    João Lúcio de Azevedo

    1986-11-01

    Full Text Available This review reports the use of biotechnology in agriculture and animal husbandry. The main techniques and the most important products both in experimental stage or in commercial use are reported. The work intends to give a global vision to the theme, chronologically and spacely, showing the main lines of research and what has been obtained in this area. The techniques and products that are related to genetics and breeding are emphasized. Revisão Bibliográfica do emprego da biotecnologia na agropecuária, mostrando um levantamento das técnicas mais promissoras e de seus principais produtos, tanto em fase experimental como em uso comercial. Pretende-se dar uma visão global do assunto, cronológica e espacialmente, não se prendendo à detalhes, mostrando, em Unhas gerais, o que foi feito e o que se faz, atualmente, em biotecnologia. As técnicas e produtos que influenciam a área de genética e melhoramento genético na agropecuária, são enfatizadas.

  6. The NA62 GigaTracker

    Science.gov (United States)

    Aglieri Rinella, G.; Alvarez Feito, D.; Arcidiacono, R.; Biino, C.; Bonacini, S.; Ceccucci, A.; Chiozzi, S.; Gil, E. Cortina; Ramusino, A. Cotta; Degrange, J.; Fiorini, M.; Gamberini, E.; Gianoli, A.; Kaplon, J.; Kluge, A.; Mapelli, A.; Marchetto, F.; Minucci, E.; Morel, M.; Noël, J.; Noy, M.; Perktold, L.; Perrin-Terrin, M.; Petagna, P.; Petrucci, F.; Poltorak, K.; Romagnoli, G.; Ruggiero, G.; Velghe, B.; Wahl, H.

    2017-02-01

    The GigaTracker is a hybrid silicon pixel detector built for the NA62 experiment aiming at measuring the branching fraction of the ultra-rare kaon decay K+ →π+ ν ν bar at the CERN SPS. The detector has to track particles in a beam with a flux reaching 1.3 MHz/mm2 and provide single-hit timing with 200 ps RMS resolution for a total material budget of less than 0.5% X0 per station. The tracker comprises three 60.8 mm×27 mm stations installed in vacuum (∼10-6 mbar) and cooled with liquid C6F14 circulating through micro-channels etched inside a few hundred micron thick silicon plates. Each station is composed of a 200 μm thick silicon sensor read out by 2×5 custom 100 μm thick ASICs, called TDCPix. Each chip contains 40×45 asynchronous pixels, 300 μm×300 μm each and is instrumented with 100 ps bin time-to-digital converters. In order to cope with the high rate, the TDCPix is equipped with four 3.2 Gb/s serialisers sending out the data. We will describe the detector and the results from the 2014 and 2015 NA62 runs.

  7. The NA62 GigaTracker

    CERN Document Server

    Perrin-Terrin, Mathieu

    2015-01-01

    The GigaTracker is an hybrid silicon pixel detector built for the NA62 experiment aiming at measuring the branching fraction of the ultra-rare kaon decay K + ! p + n ̄ n at the CERN SPS. The detector has to track particles in a beam with a flux reaching 1.3 MHz/mm 2 and provide single-hit timing with 200ps RMS resolution for a total material budget of less than 1.5 X 0 . The tracker comprises three 60.8mm 27mm stations installed in vacuum ( 10$^{-6}$ mbar) and cooled with liquid C 6 F 14 circulating through micro-channels etched inside few hundred of microns thick silicon plates. Each station is composed of a 200 m m thick silicon sensor readout by 2 x 5 cus- tom 100 m m thick ASIC, called TDCPix. Each chip contains 40 x 45 asynchronous pixels, each 300 m m x 300 m m and is instrumented with 100ps bin time-to-digital converters. In order to cope with the high rate, the TDCPix is equipped with four 3.2Gb/s serialisers sending out the data. We will describe the detector and the results from the 2014 NA62 ru...

  8. Mercosul educativo na carreira de Enfermagem

    Directory of Open Access Journals (Sweden)

    Roseli Schmoeller

    2012-10-01

    Full Text Available O Mercosul, instituído com vistas à integração econômica, política, social e cultural entre os países membros, atualmente destaca-se pelas estratégias integrativas de âmbito educacional. Este artigo aborda os movimentos acerca da formação acadêmica dos cursos de Enfermagem e o trajeto histórico de integração educacional, apresentando o Sistema de Acreditação dos Cursos Universitários do Mercosul, o ARCU-SUL, além dos setores responsáveis por esse processo e as perspectivas para a Enfermagem nos países do Mercosul. Entendemos que para o desenvolvimento de profissionais críticos, reflexivos e com compromisso político-social, é fundamental investir na formação e na qualidade dos centros de ensino em Enfermagem.

  9. NA-CORDEX: Overview and Sample Results

    Science.gov (United States)

    Bukovsky, Melissa; Mearns, Linda; Arritt, Raymond; Castro, Christopher; Chang, Hsin-I.; Christensen, Jens; Christensen, Ole; Frigon, Anne; Gutowski, William; Kjellström, Erik; Laprise, René; McGinnis, Seth; Nikulin, Grigory; Scinocca, John; Sushama, Laxmi; Winger, Katje

    2017-04-01

    The North American CORDEX program (NA-CORDEX) has produced a good number of projections of climate according to the first phase of the CORDEX program. These simulations are based on a wide range of regional and global climate models, and some matrices of combinations have resulted. The RCMs involved include: WRF, CanRCM4, CRCM5, RegCM4, RCA4, and HirHam5. Driving GCMs include: EC-EARTH, CanESM2, HadGEM2-ES, GFDL-ESM2M, MPI-ESM-LR. These GCMs nicely span the equilibrium climate sensitivity of the GCMs making up the CMIP5 suite of models. Simulations have been performed both at .44 and .22 spatial resolutions and often for both RCP8.5 and 4.5. We will present an update of the status of NA-CORDEX, an overview of the simulations, and some of the results for North America, focusing on the quality of the baseline climate simulations and the projections of precipitation and temperature.

  10. NA-CORDEX: Overview and New Results

    Science.gov (United States)

    Mearns, L.; Arritt, R. W.; Bukovsky, M. S.; Castro, C. L.; Chang, H. I.; Christensen, J. H.; Christensen, O. B.; Gutowski, W. J., Jr.; Kjellstrom, E.; Laprise, R.; McGinnis, S. A.; Nikulin, G.; Scinocca, J. F.; Sushama, L.; Frigon, A.; Winger, K.

    2017-12-01

    The North American CORDEX program (NA-CORDEX) has produced a good number of projections of climate according to the first phase of the CORDEX program. These simulations are based on a wide range of regional and global climate models, and some matrices of combinations have resulted. The RCMs involved include: WRF, CanRCM4, CRCM5, RegCM4, RCA4, and HirHam5. Driving GCMs include: EC-EARTH, CanESM2, HadGEM2-ES, GFDL-ESM2M, MPI-ESM-LR, and MPI-ESM-MR. These GCMs nicely span the equilibrium climate sensitivity of the GCMs making up the CMIP5 suite of models. Simulations have been performed both at .44 and .22 spatial resolutions and often for both RCP8.5 and 4.5. The time period for all simulations is 1950-2100. We will present an update of the results of NA-CORDEX, an overview of the simulations, and some detailed results for North America, focusing on the quality of the baseline climate simulations and the projections of precipitation and temperature. We will particularly focus on a 2 by 3 experiment with 2 RCMs driven by 3 GCMs. We also introduce a new metric for comparison of regional model results driven by GCMs of different climate sensitivities, which is regional model climate sensitivity.

  11. Autonomia e vulnerabilidade na vida dos adolescentes

    Directory of Open Access Journals (Sweden)

    Renata R. de Oliveira

    2007-05-01

    Full Text Available Este trabalho foi realizado com a finalidade de estabelecer relações entre os princípios éticos da autonomia e vulnerabilidade e a vida de adolescentes, pessoas reconhecidamente passíveis de síndromes depressivas, uso abusivo de drogas ilícitas, alcoolismo e tabagismo. Famílias desestruturadas, pais ausentes, companhia de amigos que levam a diferentes vícios, facilidade de acesso a fontes desencontradas de informações e uma sociedade indiferente afetam o desenvolvimento normal dos jovens. Considera-se, ainda, o grande desafio apresentado a profissionais de saúde em agir na busca de reduzir a vulnerabilidade dos adolescentes e permitir que os mesmo usem de autonomia com responsabilidade na tomada de decisões em suas vidas pessoais. O cuidado com os mesmos deve ser mais integral e ativo e a sociedade ainda não reconheceu adequadamente a importância de cuidar do desenvolvimento saudável desse imenso contingente humano.

  12. ESCOLA NA OU DA PRISÃO?

    Directory of Open Access Journals (Sweden)

    Elionaldo Fernandes Julião

    Full Text Available RESUMO: Embora algumas experiências estaduais de educação para jovens e adultos em situação de restrição e privação de liberdade remontem há algumas décadas, somente a partir de 2005 é que se iniciam no Brasil encaminhamentos para implementação de uma política propriamente nacional, quando os Ministérios da Educação e da Justiça iniciaram uma proposta de articulação para implementação de Programa Nacional de Educação para o Sistema Penitenciário, formulando as suas diretrizes. Fundamentado em uma concepção crítica sobre o papel do sistema penitenciário na sociedade contemporânea, analisando as suas perspectivas políticas e pedagógicas, principalmente articulando os conceitos de garantias de direitos, políticas públicas, incompletude institucional e socialização, este artigo se propõe a investir na discussão sobre o papel da educação no sistema penitenciário, mais precisamente sobre a escola localizada no espaço carcerário.

  13. Direito do poeta na literatura de cordel

    Directory of Open Access Journals (Sweden)

    Sale Mário Gaudêncio

    Full Text Available Este artigo apresenta uma análise situacional dos direitos autorais na literatura de cordel, especialmente no que se refere à proteção moral e patrimonial que é dada aos poetas populares. Justifica-se o estudo em função de não haver profundas nem atuais discussões teóricas sobre a preservação moral e patrimonial em torno das obras de cordel. Utiliza-se como metodologia a pesquisa bibliográfica relacionada a um corpusque analisa os folhetos impressos por poetas da literatura de cordel. O estudo mostra como resultados o estabelecimento de um modelo alternativo de prazos para os direitos autorais na poesia popular, além da necessidade de ruptura técnica, política e cultural. Conclui informando sobre a importância de se construir um banco de dados nacional para que se tenha conhecimento pleno do quê e como se está produzindo a literatura de cordel, além de saber quem verdadeiramente está sendo beneficiado com tais produções.

  14. Mechanochemical transformations in Li(Na)AlH4-Li(Na)NH2 systems

    International Nuclear Information System (INIS)

    Dolotko, Oleksandr; Zhang Haiqiao; Ugurlu, Ozan; Wiench, Jerzy W.; Pruski, Marek; Scott Chumbley, L.; Pecharsky, Vitalij

    2007-01-01

    Mechanochemical transformations of tetrahydroaluminates and amides of lithium and sodium have been investigated using gas volumetric analysis, X-ray powder diffraction, solid-state nuclear magnetic resonance (NMR) and transmission electron microscopy. In a transformation of LiAlH 4 and LiNH 2 taken in an 1:1 molar ratio, the amount of released hydrogen (6.6 wt.% after 30 min ball milling) was higher than in any known one pot mechanochemical process involving a hydrogen-containing solid. A total of 4.3 wt.% of hydrogen is released by the NaAlH 4 -NaNH 2 system after 60 min ball milling; and 5.2 wt.% H 2 is released when LiAlH 4 and NaNH 2 or NaAlH 4 and LiNH 2 are ball milled for 90 min and 120 min, respectively. All transformations proceed at room temperature. The mechanism of the overall transformation MAlH 4 (s) + MNH 2 (s) → 2MH(s) + AlN(s) + 2H 2 (g) was identified based on detailed spectroscopic analysis of the intermediate (M 3 AlH 6 ) and final products of the ball milling process

  15. Aspectos valorizados por porfissionais de enfermagem na higiene pessoal e na higiene corporal do paciente

    Directory of Open Access Journals (Sweden)

    Elóide André Oliveira

    2003-10-01

    Full Text Available Survey descritivo, com o qual se objetivou identificar que aspectos da higiene corporal são valorizados pelos componentes da equipe de enfermagem, na higiene corporal pessoal e na higiene corporal do paciente. A pesquisa foi desenvolvida em oito instituições públicas de saúde e a amostra foi composta por 126 profissionais de enfermagem, correspondendo a 12,8% do total de 986 componentes das equipes de enfermagem destas instituições. Na higiene corporal pessoal, chamou a atenção o fato de que os cuidados com as unhas e com os cabelos tenham suplantado, no número de citações dos profissionais de enfermagem, aspectos básicos como o cuidado com as mãos. Na higiene corporal do paciente, o banho foi o aspecto considerado mais importante pelas três categorias profissionais; a higiene oral, pelas(os enfermeiras(os e auxiliares de enfermagem; e as unhas, pelas(os enfermeiras(os e técnicas(os de enfermagem.

  16. A coprecipitation technique to prepare NaNbO3 and NaTaO3

    Indian Academy of Sciences (India)

    Unknown

    (V) oxide, tantalum(V) oxide, sodium hydroxide, ethyl alcohol, am- monium carbonate and standard ammonia solution were used and all the starting materials were of AR grade. (Loba chemie). A stoichiometric amount of NaOH was dissolved ...

  17. A capoeira na escola e na Educação Física

    Directory of Open Access Journals (Sweden)

    Vinicius Thiago Melo

    2012-05-01

    Full Text Available http://dx.doi.org/10.5007/2175-8042.2011v23n37p190 Este é um ensaio de revisão bibliográfica que aborda a temática da capoeira na Escola e na Educação Física. A análise de alguns documentos oficiais demonstra que a capoeira estabelece relações concretas com a questão da educação das relações étnico-raciais e com a disciplina Educação Física. No entanto, verifica-se que nem sempre esta modalidade é reconhecida pelas suas possibilidades de participação no processo educativo, mas sim, em uma perspectiva secundária de compensação das tensões da sala de aula e auxílio no controle do comportamento e disciplina dos alunos. Assim, procurou-se refletir e fazer alguns apontamentos sobre o modo pelo qual esta prática cultural tem sido tratada na escola e na Educação Física.

  18. High-temperature phases of NaNbO3 and NaTaO3

    International Nuclear Information System (INIS)

    Darlington, C.N.W.

    1999-01-01

    The high-temperature phases of the perovskites sodium niobate, NaNbO 3 , and sodium tantalate, NaTaO 3 , have been re-examined using the high-resolution powder diffractometer HRPD at the ISIS neutron spallation source; the two materials show the same sequence of phases with tilted octahedra. Diffraction patterns were measured every 5 K allowing structural changes with temperature within a single phase to be determined for the first time. Previous structure determinations within one phase had been performed at a single temperature only. The octahedra are tilted about pseudocubic left angle 100 right angle directions and are also deformed; the magnitude of the deformation is shown to be proportional to the square of the angle of tilt as expected from a phenomenological theory applied to such transitions. The structures of NaNbO 3 between 753 and 793 K and of NaTaO 3 below 758 K are not as reported in the literature. (orig.)

  19. Na-K-Interdiffusion in Alkali Feldspars

    Science.gov (United States)

    Schaeffer, A.-K.; Petrishcheva, E.; Rhede, D.; Abart, R.

    2012-04-01

    Exchange experiments between crystallographically oriented plates of gem-quality alkali feldspar (XOr 0.85) with NaCl/KCl melts have been conducted at 850° and 920° C. The melt composition was varied systematically between XKCl 0.6 and 1 to induce a shift of the feldspar composition towards more Na-rich as well as K-rich compositions (XOr 0.74 to 1). We applied 40-times molar excess of cations in the melt to ensure constant concentration boundary conditions for cation exchange. Depending on the direction of the composition shift diffusion profiles with different geometries develop. After a shift towards more K-rich compositions the diffusion profile shows two plateaus representing the unexchanged core and the exchanged rim in equilibrium with the melt, respectively. The exchange front between the two plateaus has an inflection point and propagates through the crystal with t1/2. Its width depends on the composition difference between the exchanged and unexchanged domains of the grain as well as crystallographic direction. The profiles that develop during a shift towards more Na-rich compositions lack an inflection point. If XOr is shifted by more than 10 mole-% crack systems begin to develop due to composition strain associated with the substitution of K+ by the smaller Na+ion. While the propagation rate of the fronts is roughly equal in all crystallographic directions, the profiles measured in the direction normal to (001) are always narrower than those normal to (010). This indicates a marked anisotropy in interdiffusion which appears fastest in the direction perpendicular to (001), i.e. c*. The observed geometry of the diffusion fronts can be explained by a composition dependence of the interdiffusion coefficient. This dependence was first described by Christoffersen et al. (1983) but these authors used a different experimental setup and only had reliable data for intermediate compositions. From our data we could extract the interdiffusion coefficient for high

  20. Efeito do plasma de oxigênio na dentina previamente exposta ao NaOCl

    Directory of Open Access Journals (Sweden)

    Maíra do PRADO

    Full Text Available Resumo Introdução O tratamento de plasma é uma tecnologia eficaz que pode manter as propriedades internas dos materiais inalteradas após o tratamento, modificando apenas a superfície. Objetivo Avaliar o efeito do plasma de oxigênio na dentina previamente exposta ao NaOCl 6%. Material e método Foram utilizados 60 incisivos bovinos. A coroa foi removida, a raiz foi dividida e as faces planificadas, totalizando 120 segmentos referentes ao terço cervical. As amostras foram divididas em dois grupos: controle (imersa em NaOCl 6%, lavada com água destilada, seca, imersa em EDTA 17%, lavada e seca e plasma de oxigênio (após tratamento descrito no grupo controle, plasma de oxigênio foi aplicado por 30 s. As amostras foram avaliadas qualitativamente em relação à topografia por microscopia eletrônica de varredura, utilizando-se microfotografias com ampliação de 1.000×. O goniômetro Ramé-hart foi utilizado para a mensuração do ângulo de contato entre as superfícies e as seguintes soluções foram utilizadas: água, etilenoglicol e di-iodometano. Em seguida, a energia de superfície, representada pelas componentes polar e dispersiva, foi calculada. Avaliou-se também o escoamento dos cimentos Pulp Canal Sealer EWT (PCS e Real Sal SE (RS na superfície dentinária. Os dados foram analisados estatisticamente utilizando os testes Kruskal-Wallis e Mann-Whitney U (p<0,05. Resultado O tratamento com plasma levou à formação de uma camada semelhante à smear layer na superfície dentinária. Este tratamento levou a um aumento da energia de superfície e da componente polar, favorecendo a hidrofilicidade da superfície. Entretanto, desfavoreceu o escoamento do cimento PCS e não influenciou no escoamento do cimento RS. Conclusão O plasma de oxigênio ocasionou mudanças topográficas na superfície dentinária, favorecendo a hidrofilicidade desta. Contudo, não favoreceu o escoamento dos cimentos endodônticos na dentina.

  1. Diffusion of Na+ AND Sr2+ tracers in compacted, saturated Na-bentonite: a predictive model

    International Nuclear Information System (INIS)

    Bourg, I.C.; Sposito, G.; Bourg, A.C.M.

    2005-01-01

    Full text of publication follows: A key characteristic of the porosity of compacted bentonite is that it is composed not only of macro- and meso-pores, but also of nanometer-thin interlayer pores. The interlayer pore water is in intimate contact with the negatively charged clay, and has a high cation concentration. Anions are strongly excluded from this region. The fluids present in interlayer pores and in the larger pores of compacted, saturated bentonite or montmorillonite have been described as distinct aqueous phases. This distinction has allowed successful explanations of, e.g., chemo-mechanical coupling in clays. However, it is not used in current models of the diffusion of tracers in compacted, saturated bentonite. We have developed a model of the diffusion of tracers in compacted, saturated Na-bentonite in which the interlayers and larger pores are described as parallel diffusion paths [1]. This model has allowed us to successfully describe the mean principal value of the apparent diffusivity tensor of water tracers in several one-dimensionally compacted, saturated Na-bentonites, in a broad range of partial montmorillonite dry density, using the direction-averaged tortuosity (τ = 1.9 ± 0.6) as a single fitted parameter [2]. We report on the application of the same model to the diffusion of Na + and Sr 2+ tracers in compacted, saturated Na-bentonite. Our model successfully predicts the ratio of the apparent diffusivities of cationic and water tracers, with no fitted parameters, as a function of both partial montmorillonite dry density and ionic strength. Furthermore, we show that a relation between the activation energy of diffusion of Na+ tracers and the partial montmorillonite dry density of Na-bentonite can be derived from our model, and can be fit to experimental data. [1] Diffusion of Water and Inorganic Ions in Compacted Saturated Bentonite, I.C. Bourg (2004), Ph.D. thesis, University of California, Berkeley; [2] Diffusion of Water Tracers in

  2. Stimulation of Na+/K+ ATPase activity and Na+ coupled glucose transport by β-catenin

    International Nuclear Information System (INIS)

    Sopjani, Mentor; Alesutan, Ioana; Wilmes, Jan; Dermaku-Sopjani, Miribane; Lam, Rebecca S.; Koutsouki, Evgenia; Jakupi, Muharrem; Foeller, Michael; Lang, Florian

    2010-01-01

    Research highlights: → The oncogenic transcription factor β-catenin stimulates the Na + /K + -ATPase. → β-Catenin stimulates SGLT1 dependent Na + , glucose cotransport. → The effects are independent of transcription. → β-Catenin sensitive transport may contribute to properties of proliferating cells. -- Abstract: β-Catenin is a multifunctional protein stimulating as oncogenic transcription factor several genes important for cell proliferation. β-Catenin-regulated genes include the serum- and glucocorticoid-inducible kinase SGK1, which is known to stimulate a variety of transport systems. The present study explored the possibility that β-catenin influences membrane transport. To this end, β-catenin was expressed in Xenopus oocytes with or without SGLT1 and electrogenic transport determined by dual electrode voltage clamp. As a result, expression of β-catenin significantly enhanced the ouabain-sensitive current of the endogeneous Na + /K + -ATPase. Inhibition of vesicle trafficking by brefeldin A revealed that the stimulatory effect of β-catenin on the endogenous Na + /K + -ATPase was not due to enhanced stability of the pump protein in the cell membrane. Expression of β-catenin further enhanced glucose-induced current (Ig) in SGLT1-expressing oocytes. In the absence of SGLT1 Ig was negligible irrespective of β-catenin expression. The stimulating effect of β-catenin on both Na + /K + ATPase and SGLT1 activity was observed even in the presence of actinomycin D, an inhibitor of transcription. The experiments disclose a completely novel function of β-catenin, i.e. the regulation of transport.

  3. Recent results and prospects for NA62 experiment

    Science.gov (United States)

    Martellotti, Silvia; Aglieri Rinella, G.; Aliberti, R.; Ambrosino, F.; Ammendola, R.; Angelucci, B.; Antonelli, A.; Anzivino, G.; Arcidiacono, R.; Azhinenko, I.; Balev, S.; Barbanera, M.; Bendotti, J.; Biagioni, A.; Bician, L.; Biino, C.; Bizzeti, A.; Blazek, T.; Blik, A.; Bloch-Devaux, B.; Bolotov, V.; Bonaiuto, V.; Boretto, M.; Bragadireanu, M.; Britton, D.; Britvich, G.; Brunetti, M. B.; Bryman, D.; Bucci, F.; Butin, F.; Capitolo, E.; Capoccia, C.; Capussela, T.; Cassese, A.; Catinaccio, A.; Cecchetti, A.; Ceccucci, A.; Cenci, P.; Cerny, V.; Cerri, C.; Checcucci, B.; Chikilev, O.; Chiozzi, S.; Ciaranfi, R.; Collazuol, G.; Conovaloff, A.; Cooke, P.; Cooper, P.; Corradi, G.; Cortina Gil, E.; Costantini, F.; Cotorobai, F.; Cotta Ramusino, A.; Coward, D.; D'Agostini, G.; Dainton, J.; Dalpiaz, P.; Danielsson, H.; Degrange, J.; De Simone, N.; Di Filippo, D.; Di Lella, L.; Di Lorenzo, S.; Dixon, N.; Doble, N.; Dobrich, B.; Duk, V.; Elsha, V.; Engelfried, J.; Enik, T.; Estrada, N.; Falaleev, V.; Fantechi, R.; Fascianelli, V.; Federici, L.; Fedotov, S.; Fiorini, M.; Fry, J.; Fu, J.; Fucci, A.; Fulton, L.; Gallorini, S.; Galeotti, S.; Gamberini, E.; Gatignon, L.; Georgiev, G.; Gianoli, A.; Giorgi, M.; Giudici, S.; Glonti, L.; Goncalves Martins, A.; Gonnella, F.; Goudzovski, E.; Guida, R.; Gushchin, E.; Hahn, F.; Hallgren, B.; Heath, H.; Herman, F.; Husek, T.; Hutanu, O.; Hutchcroft, D.; Iacobuzio, L.; Iacopini, E.; Imbergamo, E.; Jamet, O.; Jarron, P.; Jones, E.; Kampf, K.; Kaplon, J.; Kekelidze, V.; Kholodenko, S.; Khoriauli, G.; Khotyantsev, A.; Khudyakov, A.; Kiryushin, Yu.; Kleimenova, A.; Kleinknecht, K.; Kluge, A.; Koval, M.; Kozhuharov, V.; Krivda, M.; Kucerova, Z.; Kudenko, Y.; Kunze, J.; Lamanna, G.; Latino, G.; Lazzeroni, C.; Lehmann-Miotto, G.; Lenci, R.; Lenti, M.; Leonardi, E.; Lichard, P.; Lietava, R.; Litov, L.; Lollini, R.; Lomidze, D.; Lonardo, A.; Lupi, M.; Lurkin, N.; McCormick, K.; Madigozhin, D.; Maire, G.; Mandeiro, C.; Mannelli, I.; Mannocchi, G.; Mapelli, A.; Marchetto, F.; Marchevski, R.; Martellotti, S.; Massarotti, P.; Massri, K.; Matak, P.; Maurice, E.; Mefodev, A.; Menichetti, E.; Minucci, E.; Mirra, M.; Misheva, M.; Molokanova, N.; Morant, J.; Morel, M.; Moulson, M.; Movchan, S.; Munday, D.; Napolitano, M.; Neri, I.; Newson, F.; Norton, A.; Noy, M.; Nuessle, G.; Numao, T.; Obraztsov, V.; Ostankov, A.; Padolski, S.; Page, R.; Palladino, V.; Paoluzzi, G.; Parkinson, C.; Pedreschi, E.; Pepe, M.; Perez Gomez, F.; Perrin-Terrin, M.; Peruzzo, L.; Petrov, P.; Petrucci, F.; Piandani, R.; Piccini, M.; Pietreanu, D.; Pinzino, J.; Polenkevich, I.; Pontisso, L.; Potrebenikov, Yu.; Protopopescu, D.; Raffaelli, F.; Raggi, M.; Riedler, P.; Romano, A.; Rubin, P.; Ruggiero, G.; Russo, V.; Ryjov, V.; Salamon, A.; Salina, G.; Samsonov, V.; Santoni, C.; Saracino, G.; Sargeni, F.; Semenov, V.; Sergi, A.; Serra, M.; Shaikhiev, A.; Shkarovskiy, S.; Skillicorn, I.; Soldi, D.; Sotnikov, A.; Sougonyaev, V.; Sozzi, M.; Spadaro, T.; Spinella, F.; Staley, R.; Sturgess, A.; Sutcliffe, P.; Szilasi, N.; Tagnani, D.; Trilov, S.; Valdata-Nappi, M.; Valente, P.; Vasile, M.; Vassilieva, T.; Velghe, B.; Veltri, M.; Venditti, S.; Vicini, P.; Volpe, R.; Vormstein, M.; Wahl, H.; Wanke, R.; Wertelaers, P.; Winhart, A.; Winston, R.; Wrona, B.; Yushchenko, O.; Zamkovsky, M.; Zinchenko, A.; NA62 Collaboration

    2017-04-01

    The K+ →π+ ν ν ‾ decay is theoretically one of the cleanest meson decays and so a good place to look for indirect effects of new physics complementary to LHC searches. The NA62 experiment at CERN is designed to measure the branching ratio of this decay with 10% precision. NA62 was commissioned in October 2014, took data in pilot runs in 2014 and 2015. The NA62 experimental setup is illustrated and data quality is reported.

  4. RAZVOJ APLIKACIJE PRETOČNEGA VIDEA NA MOBILNEM TELEFONU

    OpenAIRE

    Horvat, Jernej

    2012-01-01

    Diplomsko delo obravnava prenos video signala iz mobilnega telefona na TV. Prenos poteka preko Wi-Fi omrežja. Na mobilnem telefonu je nameščena ustrezna Android aplikacija, ki omogoča direkten prenos video signala in nalaganje na TV sprejemnik. Pomemben dejavnik, ki prispeva, da je ta proces mogoč, je sistem IMS (IP multimedijski podsistem), ki predstavlja omrežja naslednje generacije.

  5. Transcriptional regulators of Na, K-ATPase subunits

    OpenAIRE

    Zhiqin eLi; Sigrid A Langhans

    2015-01-01

    The Na,K-ATPase classically serves as an ion pump creating an electrochemical gradient across the plasma membrane that is essential for transepithelial transport, nutrient uptake and membrane potential. In addition, Na,K-ATPase also functions as a receptor, a signal transducer and a cell adhesion molecule. With such diverse roles, it is understandable that the Na,K-ATPase subunits, the catalytic alpha-subunit, the beta-subunit and the FXYD proteins, are controlled extensively during developme...

  6. Sociologia na complexidade Sociology in complexity

    Directory of Open Access Journals (Sweden)

    Gilson Lima

    2006-06-01

    Full Text Available O artigo se propõe a fazer uma introdução didática e informativa e, ao mesmo tempo, aprofundada sobre as conseqüências da emergência do paradigma da complexidade para a Sociologia. No desenrolar da narrativa, faz comparações, o que permite ao leitor não familiarizado com a temática da ciência identificar as diferenças macroparadigmáticas pré-modernas, da modernidade simples e da emergência do paradigma da complexidade. Define e exemplifica, sempre que possível, os termos, afirmações e princípios significativos para uma melhor compreensão do tema. Faz, também, inúmeras indicações, no interior da narrativa, de autores e obras, para que aqueles que desejarem continuar, possam mergulhar mais intensamente nos caminhos da sociologia da complexidade. O artigo inicia com uma introdução que define, a partir de Thomas Kuhn, o conceito de paradigma. A seguir, desenvolve de modo comparado, os princípios mais importantes do paradigma da complexidade. E, por fim, chama a atenção para alguns desafios da Sociologia na complexidade, alertando para os riscos da paralisação da complexidade na difícil tarefa de religarmos os saberes diante da hiperespecialização presente na crise do paradigma da modernidade simples.The article is a simultaneously didactic and informative deep introduction on the emergence of the paradigm of complexity for sociology. Along the narrative, we make comparisons, which allows the reader who is not familiar with the themes of science to identify the macro-paradigmatic pre-modern differences from simple modernity and the emergence of the paradigm of complexity. Whenever it is possible, we define and exemplify the terms, assertions, and principles that are significant for an understanding of the theme. We have also made numerous indications of authors and works within the narrative, thus those willing might take a deeper dive in the pathways of sociology of complexity. The article starts with an

  7. RAHNER NA BERLINDA PÓS-CONCILIAR

    Directory of Open Access Journals (Sweden)

    Luciano Campos Lavall

    2004-01-01

    Full Text Available O artigo analisa algumas críticas negativas feitas ao pensamento teológico de Karl Rahner, após sua morte, que tentam desqualificar a sua importância para a ortodoxia católica e o seu distanciamento dos fundamentos do Concílio Vaticano II. Na discussão, enfocada sobretudo no ponto de vista da eclesiologia rahneriana, retoma importante entrevista do mesmo, no ano de sua morte, na qual aparece a sua preocupação com as chances futuras da Igreja, sobretudo na Europa Ocidental, a partir da qual abordam-se as relações entre Cristianismo e Igreja. As estratégias para a organização pastoral do mundo católico são a tônica desta reflexão. Para justificar suas posturas, o artigo termina com uma avaliação global de todo o conjunto teológico de Karl Rahner, redescobrindo nele os pilares mais fundamentais que justificam sua ortodoxia a serviço da fé cristã e católica, mas também a serviço da tomada de consciência de uma fé vivenciada e comprometida por parte da humanidade marcadamente secularizada. ABSTRACT: The article analyses negative criticisms against Rahner’s theological views after his death with the intention of discrediting him and his role in Catholic orthodoxy by distancing him from the fundamentals of Vatican Council II. In the discussion, primarily focused on Rahner’s ecclesiology, the article retakes a significant interview made the same year of Rahner’s death. In this interview his concern for the Church’s future chances, especially regarding Eastern Europe, embarking on relations between Christianity and Church. The strategies for world-wide organization of Catholic ministry predominate this reflection. Justifying its postures, the article concludes with a global evaluation of Rahner’s theology, rediscovering the fundamental pillars which justify his orthodoxy at the service of the Christian and Catholic faith, but also at the service of a conscientious living of a committed faith on behalf of a notably

  8. Characterization of ZnAl cast alloys with Na addition

    Energy Technology Data Exchange (ETDEWEB)

    Gancarz, Tomasz, E-mail: t.gancarz@imim.pl [Institute of Metallurgy and Materials Science, Polish Academy of Sciences, Krakow (Poland); Cempura, Grzegorz [AGH University of Science and Technology, International Centre of Electron Microscopy for Materials Science, Faculty of Metals Engineering and Industrial Computer Science, Krakow (Poland); Skuza, Wojciech [Institute of Metallurgy and Materials Science, Polish Academy of Sciences, Krakow (Poland)

    2016-01-15

    This study was aimed at evaluating the microstructural change and thermal, electrical and mechanical properties with the addition of Na to eutectic ZnAl alloys. Solders based on eutectic ZnAl containing 0.2 to 3.0 (wt.%) of Na were developed for high temperature solder. Differential scanning calorimetry (DSC) measurements were performed to determine the melting temperatures of the alloys. Thermal linear expansion and electrical resistivity measurements were performed over − 50 °C to 300 °C and 30 °C to 300 °C temperature ranges, respectively. The microstructure of the specimens was analyzed using scanning (SEM) and transmission electron microscopy (TEM) techniques. Chemical microanalysis was performed by energy-dispersive X-ray spectroscopy (EDS) on SEM and TEM. The precipitates of NaZn{sub 13} were confirmed by X-ray diffraction (XRD) measurements and selected area electron diffraction (SAED) techniques. The addition of Na to eutectic ZnAl alloy increased the electrical resistivity and reduced the coefficient of thermal expansion; however, the melting point did not change. The mechanical properties, strain and microhardness increased with Na content in alloys. - Highlights: • High temperature soldering materials of ZnAl with Na were designed and characterized. • Precipitates of NaZn{sub 13}were observed and confirmed using TEM and XRD. • Addition of Na to eutectic ZnAl cussed increased mechanical properties. • NaZn{sub 13} caused increased electrical resistivity and microhardness, and reduced the CTE.

  9. Dejavniki psihološkega nasilja na delovnem mestu

    OpenAIRE

    Ilc, Teja

    2011-01-01

    Raziskave na področju delovnih razmer kažejo, da je danes pereč problem ravno psihološko nasilje na delovnem mestu. Posebna oblika psihološkega nasilja na delovnem mestu je mobing, s katerim se v praksi srečujemo vsak dan, vendar se ga pogosto ne zavedamo. Namen magistrske naloge je pojasniti pojem in pomen mobinga v delovnih organizacijah, poiskati možne vzroke in posledice, ki vplivajo na ta pojav, ter predlagati rešitve. Poznavanje mehanizmov, ki povzročajo mobing, njegovih vzrokov in...

  10. VLOGA ETIKE PRI PREPREČEVANJU NADLEGOVANJA NA DELOVNEM MESTU

    OpenAIRE

    Sambolec, Katja

    2013-01-01

    V diplomskem seminarju smo obravnavali temo z naslovom Vpliv etike pri preprečevanju nadlegovanja na delovnem mestu. Tema o nadlegovanju na delovnem mestu, je aktualna že desetletja in glede na gospodarsko krizo, ki ji še ni videti konca, je aktualna še danes. Zaradi prenasičenosti trga s ponudniki iste branže, se posledično v posameznih podjetjih izvajajo pritiski na zaposlene, ki v različnih situacijah vodijo do nadlegovanja. Pri pisanju diplomskega seminarja smo se najprej osredotoči...

  11. Influenza virus neuraminidase (NA): a target for antivirals and vaccines.

    Science.gov (United States)

    Jagadesh, Anitha; Salam, Abdul Ajees Abdul; Mudgal, Piya Paul; Arunkumar, Govindakarnavar

    2016-08-01

    Influenza, the most common infectious disease, poses a great threat to human health because of its highly contagious nature and fast transmissibility, often leading to high morbidity and mortality. Effective vaccination strategies may aid in the prevention and control of recurring epidemics and pandemics associated with this infectious disease. However, antigenic shifts and drifts are major concerns with influenza virus, requiring effective global monitoring and updating of vaccines. Current vaccines are standardized primarily based on the amount of hemagglutinin, a major surface antigen, which chiefly constitutes these preparations along with the varying amounts of neuraminidase (NA). Anti-influenza drugs targeting the active site of NA have been in use for more than a decade now. However, NA has not been approved as an effective antigenic component of the influenza vaccine because of standardization issues. Although some studies have suggested that NA antibodies are able to reduce the severity of the disease and induce a long-term and cross-protective immunity, a few major scientific issues need to be addressed prior to launching NA-based vaccines. Interestingly, an increasing number of studies have shown NA to be a promising target for future influenza vaccines. This review is an attempt to consolidate studies that reflect the strength of NA as a suitable vaccine target. The studies discussed in this article highlight NA as a potential influenza vaccine candidate and support taking the process of developing NA vaccines to the next stage.

  12. O grotesco na imagem publicitária

    OpenAIRE

    Silva, Maria João Barros

    2013-01-01

    O significado da palavra grotesco teve um começo puramente artístico numa descoberta, de imagens de figuras humanas deformadas e alteradas. No entanto, este foi evoluindo e adotando novos significados mais amplos e concretos na atualidade. É possível encontrar vários exemplos do grotesco em várias plataformas, como no cinema, na televisão e na literatura. Neste sentido, para se poder proceder ao estudo desta temática é fundamental a conquista do conhecimento sobre o estatuto do grotesco na pu...

  13. Cafeína e desempenho em atividade de endurance?

    OpenAIRE

    Souza Junior, Tácito Pessoa de; Capitani, Caroline Dario; Loturco Filho, Irineu; Viveiros, Luis; Aoki, Marcelo Saldanha

    2012-01-01

    A cafeína é frequentemente consumida por atletas, por causa dos seus possíveis efeitos ergogênicos. É preconizado que a cafeína maximize a performance por agir, independentemente, ou concomitamente, através de 3 mecanismos: 1) aumento da mobilização do cálcio intracelular, 2) aumento na oxidação de ácidos graxos livres e 3) antagonista do receptor de adenosina no sistema nervoso central. Estudos iniciais sugeriram que o efeito ergogênico da cafeína estava relacionado ao aumento da oxidaçã...

  14. Transcriptional regulators of Na, K-ATPase subunits

    Directory of Open Access Journals (Sweden)

    Zhiqin eLi

    2015-10-01

    Full Text Available The Na,K-ATPase classically serves as an ion pump creating an electrochemical gradient across the plasma membrane that is essential for transepithelial transport, nutrient uptake and membrane potential. In addition, Na,K-ATPase also functions as a receptor, a signal transducer and a cell adhesion molecule. With such diverse roles, it is understandable that the Na,K-ATPase subunits, the catalytic alpha-subunit, the beta-subunit and the FXYD proteins, are controlled extensively during development and to accommodate physiological needs. The spatial and temporal expression of Na,K-ATPase is partially regulated at the transcriptional level. Numerous transcription factors, hormones, growth factors, lipids and extracellular stimuli modulate the transcription of the Na,K-ATPase subunits. Moreover, epigenetic mechanisms also contribute to the regulation of Na,K-ATPase expression. With the ever growing knowledge about diseases associated with the malfunction of Na,K-ATPase, this review aims at summarizing the best-characterized transcription regulators that modulate Na,K-ATPase subunit levels. As abnormal expression of Na,K-ATPase subunits have been observed in many carcinoma, we will also discuss transcription factors that are associated with epithelial-to-mesenchymal transition, a crucial step in the progression of many tumors to malignant disease.

  15. Cathode Dependence of Liquid-Alloy Na-K Anodes.

    Science.gov (United States)

    Xue, Leigang; Gao, Hongcai; Li, Yutao; Goodenough, John B

    2018-03-07

    Alkali ions can be plated dendrite-free into a liquid alkali-metal anode. Commercialized Na-S battery technology operates above 300 °C. A low-cost Na-K alloy is liquid at 25 °C from 9.2 to 58.2 wt% of sodium; sodium and/or potassium can be plated dendrite-free in the liquid range at room temperature. The co-existence of two alkali metals in an anode raises a question: whether the liquid Na-K alloy acts as a Na or a K anode. Here we show the alkali-metal that is stripped from the liquid Na-K anode is dependent on the preference of the cathode host. It acts as the anode of a sodium rechargeable cell if the cathode host structure selectively accepts only Na + ions; as the anode of a potassium rechargeable cell if the cathode accepts K + ions in preference to Na + ions. This dual-anode behavior means the liquid Na-K alkali-alloy can be applied as a dendrite-free anode in Na-metal batteries as well as K-metal batteries.

  16. Scintillation efficiency measurement of Na recoils in NaI(Tl) below the DAMA/LIBRA energy threshold

    Energy Technology Data Exchange (ETDEWEB)

    Xu, Jingke; Shields, Emily; Calaprice, Frank; Westerdale, Shawn; Froborg, Francis; Suerfu, Burkhant; Alexander, Thomas; Aprahamian, Ani; Back, Henning O.; Casarella, Clark; Fang, Xiao; Gupta, Yogesh K.; Ianni, Aldo; Lamere, Edward; Lippincott, W. Hugh; Liu, Qian; Lyons, Stephanie; Siegl, Kevin; Smith, Mallory; Tan, Wanpeng; Kolk, Bryant Vande

    2015-07-01

    The dark matter interpretation of the DAMA modulation signal depends on the NaI(Tl) scintillation efficiency of nuclear recoils. Previous measurements for Na recoils have large discrepancies, especially in the DAMA/LIBRA modulation energy region. We report a quenching effect measurement of Na recoils in NaI(Tl) from 3 to 52 keVnr, covering the whole DAMA/LIBRA energy region for dark matter-Na scattering interpretations. By using a low-energy, pulsed neutron beam, a double time-of-flight technique, and pulse-shape discrimination methods, we obtained the most accurate measurement of this kind for NaI(Tl) to date. The results differ significantly from the DAMA reported values at low energies but fall between the other previous measurements. We present the implications of the new quenching results for the dark matter interpretation of the DAMA modulation signal.

  17. Na/K Pump and Beyond: Na/K-ATPase as a Modulator of Apoptosis and Autophagy.

    Science.gov (United States)

    Felippe Gonçalves-de-Albuquerque, Cassiano; Ribeiro Silva, Adriana; Ignácio da Silva, Camila; Caire Castro-Faria-Neto, Hugo; Burth, Patrícia

    2017-04-21

    Lung cancer is a leading cause of global cancer deaths. Na/K-ATPase has been studied as a target for cancer treatment. Cardiotonic steroids (CS) trigger intracellular signalling upon binding to Na/K-ATPase. Normal lung and tumour cells frequently express different pump isoforms. Thus, Na/K-ATPase is a powerful target for lung cancer treatment. Drugs targeting Na/K-ATPase may induce apoptosis and autophagy in transformed cells. We argue that Na/K-ATPase has a role as a potential target in chemotherapy in lung cancer treatment. We discuss the effects of Na/K-ATPase ligands and molecular pathways inducing deleterious effects on lung cancer cells, especially those leading to apoptosis and autophagy.

  18. Na/K Pump and Beyond: Na/K-ATPase as a Modulator of Apoptosis and Autophagy

    Directory of Open Access Journals (Sweden)

    Cassiano Felippe Gonçalves-de-Albuquerque

    2017-04-01

    Full Text Available Lung cancer is a leading cause of global cancer deaths. Na/K-ATPase has been studied as a target for cancer treatment. Cardiotonic steroids (CS trigger intracellular signalling upon binding to Na/K-ATPase. Normal lung and tumour cells frequently express different pump isoforms. Thus, Na/K-ATPase is a powerful target for lung cancer treatment. Drugs targeting Na/K-ATPase may induce apoptosis and autophagy in transformed cells. We argue that Na/K-ATPase has a role as a potential target in chemotherapy in lung cancer treatment. We discuss the effects of Na/K-ATPase ligands and molecular pathways inducing deleterious effects on lung cancer cells, especially those leading to apoptosis and autophagy.

  19. The NA49 large acceptance hadron detector

    CERN Document Server

    Afanasiev, S V; Appelshäuser, H; Bächler, J; Barna, D; Barnby, L S; Bartke, Jerzy; Barton, R A; Betev, L; Bialkowska, H; Bieser, F; Billmeier, A; Blyth, C O; Böck, R K; Bormann, C; Bracinik, J; Brady, F P; Brockmann, R; Brun, R; Buncic, P; Caines, H L; Cebra, D; Cooper, G E; Cramer, J G; Csató, P; Cyprian, M; Dunn, J; Eckardt, V; Eckhardt, F; Empl, T; Eschke, J; Ferguson, M I; Fessler, H; Fischer, H G; Flierl, D; Fodor, Z; Frankenfeld, Ulrich; Foka, P Y; Freund, P; Friese, V; Ftácnik, J; Fuchs, M; Gabler, F; Gál, J; Ganz, R E; Gazdzicki, M; Gladysz-Dziadus, E; Grebieszkow, J; Günther, J; Harris, J W; Hegyi, S; Henkel, T; Hill, L A; Hlinka, V; Huang, I; Hümmler, H; Igo, G; Irmscher, D; Ivanov, M; Janik, R; Jacobs, P; Jones, P G; Kadija, K; Kolesnikov, V I; Kowalski, M; Lasiuk, B; Lévai, Peter; Liebicher, K; Lynen, U; Malakhov, A I; Margetis, S; Markert, C; Marks, C; Mayes, B W; Melkumov, G L; Mock, A; Molnár, J; Nelson, J M; Oldenburg, M; Odyniec, Grazyna Janina; Pálla, G; Panagiotou, A D; Pestov, Yu N; Petridis, A; Pikna, M; Pimpl, W; Pinsky, L; Piper, A; Porter, R J; Poskanzer, A M; Poziombka, S; Prindle, D J; Pühlhofer, F; Rauch, W; Reid, J G; Renfordt, R E; Retyk, W; Ritter, H G; Röhrich, D; Roland, C; Roland, G; Rudolph, H; Rybicki, A; Sammer, T; Sandoval, A; Sann, H; Schäfer, E; Schmidt, R; Schmischke, D; Schmitz, N; Schönfelder, S; Semenov, A Yu; Seyboth, J; Seyboth, P; Seyerlein, J; Siklér, F; Sitár, B; Skrzypczak, E; Squier, G T A; Stelzer, H; Stock, Reinhard; Strmen, P; Ströbele, H; Struck, C; Susa, T; Szarka, I; Szentpétery, I; Szymanski, P; Sziklai, J; Toy, M; Trainor, T A; Trentalange, S; Ullrich, T S; Vassiliou, Maria; Veres, G I; Vesztergombi, G; Vranic, D; Wang, F; Weerasundara, D D; Wenig, S; Whitten, C; Wieman, H H; Wienold, T; Wood, L; Yates, T A; Zimányi, J; Zhu, X Z; Zybert, R

    1999-01-01

    The NA49 detector is a wide acceptance spectrometer for the study of hadron production in p+p, p+A, and A+A collisions at the CERN SPS. The main components are 4 large volume TPCs for tracking and particle identification via $dE/dx$. TOF scintillator arrays complement particle identification. Calorimeters for transverse energy determination and triggering, a detector for centrality selection in p+A collisions, and beam definition detectors complete the set-up. A description of all detector components is given with emphasis on new technical realizations. Performance and operational experience are discussed in particular with respect to the high track density environment of central Pb+Pb collisions.

  20. Sexo e sexualidade na terceira idade

    OpenAIRE

    Nery, Valeria Alves da Silva; UESB; Valença, Tatiane Dias Casimiro; UESB

    2014-01-01

    Muitos idosos ainda encaram o envelhecer como sinônimo de decadência e isolamento, doenças e peso social, sendo que a sociedade impõe aos idosos, tabus, privando-lhe de re-pensar a sexualidade, o corpo, o prazer, a prática do sexo, levando-os a enfrentar várias dificuldades de adaptação a esse estágio da vida. O objetivo geral deste estudo foi Analisar as percepções sobre sexo e sexualidade na terceira idade. Quanto aos objetivos específicos, busca-se: averiguar se os idosos continuam tendo v...

  1. Bullying: ato esburacado na angústia

    Directory of Open Access Journals (Sweden)

    Maria de Lourdes Soares Ornellas

    2012-04-01

    Full Text Available A noção de afeto está no campo do (desprazer, resultante de uma experiência afetiva de satisfação ou insatisfação, e que se manifesta nas necessidades do sujeito. Pode-se dizer que o afeto envolve a ambivalência de sentimentos, do mais agradável ao mais insuportável, e desempenha um papel estruturante para que o sujeito reencontre sua estrutura psíquica, exercendo uma ação mediadora e decisiva sobre a constituição do sujeito do desejo, orientando o seu projeto de vida, sua profissão, sua opção sexual, etc. Essa ambivalência de afetos deve ser exercitada na educação familiar e escolar, na fala e na escuta que o afeto (desprazeroso tem relevância e parece ser silenciado. O desprazer pode ser escandido pelos sintomas medo, depressão, irritabilidade, ansiedade, humilhação. Assim posto o bullying é também conhecido como a síndrome da humilhação. O objetivo da humilhação é a tentativa de destruição do sujeito; a perda da identificação revela um fantasma, na medida em que própria vítima se sente culpada por sofrer ou por estar sofrendo um ato esburacado porque uma das peças não é encontrada e, em lugar do encaixe, o que se mostra é um buraco, o que provoca a angústia entre quem perde e aquele que ganha. ABSTRACT: The notion of affect is thus in the field of (dis pleasure, resulting from an affective experience of satisfaction or dissatisfaction, and that manifests itself on the needs of the subject. You could say that the affection involves the ambivalence of feelings, the more enjoyable the more unbearable, and plays a structural role for the subject to rediscover his psychic structure, exerting a mediator and decisive action on the constitution of the subject of desire, directing the its design life, your profession, your sexual orientation, etc.. This ambivalence of feelings should be exercised in family education and school, talking and listening that affect (dis pleasure is relevant and appears to be

  2. Redes sociais na internet: Sociabilidades emergentes

    OpenAIRE

    Amaral, Inês

    2016-01-01

    Na actual era da cultura digital é imperativo identificar e compreender os tipos de sociabilidade que emergem das novas práticas e relações que ocorrem no ciberespaço, para que seja possível teorizar sobre realidades sociais que são desenhadas em torno da apropriação do conteúdo e materializadas em plataformas que se assumem como o termómetro de uma sociedade sem determinismo geográfico. A sociabilização em contexto digital reporta-se ao princípio de que um mundo de informação (conteúdos, ...

  3. O retorno do religioso na contemporaneidade

    Directory of Open Access Journals (Sweden)

    Tiago Ribeiro Nunes

    2008-12-01

    Full Text Available O presente trabalho pretende analisar os novos modos de relação, entre a civilização e o sagrado, que emergem no contexto da contemporaneidade. Partindo principalmente das formulações freudianas e lacanianas sobre o tema, nosso objetivo primordial ao longo deste artigo é estabelecer parâmetros para compreender a ocorrência do "retorno ao sagrado no exato momento em que a humanidade enfrenta crises cada vez mais profundas e permanentes. Tal empreendimento nos permitirá verificar até que ponto o fortalecimento dos movimentos religiosos pode ser considerado como uma das conseqüências da queda dos referenciais que se realiza na contemporaneidade.

  4. Topicos na classe dos grafos clique

    OpenAIRE

    Luis Arturo Perez Lozada

    1996-01-01

    Resumo: Uma dique de um grafo G é um conjunto de vértices que induz um subgrafo completo maximal de G. O grafo dique K(G) de um grafo G é o grafo interseção das diques de G. Indutivamente define-se o i-ésimo grafo dique iterado de G como Ki(G) = K(Ki-l(G)). Apresenta-se de maneira organizada uma compilação de pesquisas realizadas nos últimos anos a respeito de diversos tópicos na dasse dos grafos dique, entre eles: o estudo das propriedades dos grafos dique de conhecidas dasses de grafos; a c...

  5. A TATUAGEM: NO CORPO E NA ESCRITA

    OpenAIRE

    Coito, Roselene de Fátima

    2007-01-01

    Entendendo a narrativa como uma negociação de sentidos, faremos uma reflexão sobre identidade a partir de marcas. A identidade na construção discursiva, no conto A hora e a vez de Augusto Matraga, de Guimarães Rosa, vale-se de dois olhares nesta reflexão: da marca tatuada no corpo de Matraga e de Matraga como marca circular da narrativa, pois Matraga é a marca da brasa que queima com ferro o corpo e também a página em branco tatuada pela escrita, o que faz do corpo, a escrita e da escrita, o ...

  6. Solubility of NaNd(CO3)2.6H2O(c) in concentrated Na2CO3 and NaHCO3 solutions

    International Nuclear Information System (INIS)

    Rao, L.; Rai, D.; Felmy, A.R.; Fulton, R.W.; Novak, C.F.

    1996-01-01

    NaNd(CO 3 ) 2 x 6 H 2 O(c) was identified to be the final equilibrium solid phase in suspensions containing concentrated sodium carbonate (0.1 to 2.0 M) and sodium bicarbonate (0.1 to 1.0 M), with either NaNd(CO 3 ) 2 x 6 H 2 O(c) or Nd 2 (CO 3 ) 3 x xH 2 O(s) as initial solids. A thermodynamic model, based on Pitzer's specific into-interaction approach, was developed to interpret the solubility of NaNd(CO 3 ) 2 x 6 H 2 O(c) as functions of sodium carbonate and sodium bicarbonate concentrations. In this model, the solubility data of NaNd(CO 3 ) 2 x 6 H 2 O(c) were explained by assuming the formation of NdCO 3 + , Nd(CO 3 ) 2 - and Nd(CO 3 ) 3 3- species and invoking the specific ion interactions between Na + and Nd(CO 3 ) 3 3- . Ion interaction parameters for Na + -Nd(CO 3 ) 3 3- were developed to fit the solubility data. Based on the model calculations, Nd(CO 3 ) 3 3- was the predominant aqueous neodymium species in 0.1 to 2 M sodium carbonate and 0.1 to 1 M sodium bicarbonate solutions. The logarithm of the NaNd(CO 3 ) 2 x 6 H 2 O solubility product (NaNd(CO 3 ) 2 x 6 H 2 O(c)=Na + +Nd 3+ +2 CO 3 2- +6 H 2 O) was calculated to be -21.39. This model also provided satisfactory interpretation of the solubility data of the analogous Am(III) system in less concentrated carbonate and bicarbonate solutions. (orig.)

  7. Porta-enxertos utilizados na citricultura

    Directory of Open Access Journals (Sweden)

    Schäfer Gilmar

    2001-01-01

    Full Text Available A muda cítrica é o insumo mais importante na formação de um pomar. As características mais importantes da muda cítrica são a origem do enxerto e do porta-enxerto, a qualidade do sistema radicular e a sua sanidade. Os porta-enxertos são capazes de influenciar várias características horticulturais e sanitárias nas árvores e nos frutos cítricos, como: sólidos solúveis totais, tamanho da copa e do fruto, resistência a moléstias e ao frio, distribuição da raízes, etc. O principal porta-enxerto utilizado no Brasil (cerca de 80% é o limoeiro ?Cravo? (Citrus limonia Osbeck cv. Cravo. No Rio Grande do Sul, mais especificamente, destaca-se o Poncirus trifoliata (L. Raf em mais de 90% dos pomares. Isso torna a citricultura vulnerável ao surgimento de moléstias que afetem estes porta-enxertos, como ocorreu na década de 40 em todo o Brasil com a 'Tristeza' dos citros em plantas enxertadas sobre laranjeira azeda, e, mais recentemente, com o 'declínio'. Assim, o conhecimento das características dos diversos porta-enxertos e de algumas particularidades do uso destes é de grande importância para a diversificação e escolha do porta-enxerto a ser utilizado pelo citricultor.

  8. Videogames e o aprender na complexidade

    Directory of Open Access Journals (Sweden)

    Paula Cristina Turcatto

    2016-06-01

    Full Text Available Ao conceber-se esta pesquisa, levou-se em consideração que cada ser humano aprende do seu modo pessoal e único, portanto, a proposta é pensar os videogames na sua relação com o Paradigma da Complexidade. Esta pesquisa teve como objetivo proporcionar um ambiente de encontro com diversos jogos de videogame, buscando instaurar a experimentação do novo, a abertura para o conhecer, ao habitar espaços inventivos, que valorizam a plasticidade e flexibilidade. Trata-se de uma pesquisa qualitativa, pois se propôs a trabalhar com os aspectos subjetivos como uma dimensão inseparável do conhecer. Foram 8 sujeitos de pesquisa – adolescentes – com os quais foram realizados 15 encontros, nos quais os mesmos estiveram em contato com diversos jogos de videogame. Foram utilizados diários de bordo para o registro das vivências, ancorados na metodologia cartográfica para tratamento dos registros. Os videogames propiciaram espaços para a emergência de diferentes formas de vivenciar a narrativa. Apesar de os jogos serem pré-moldados, os percursos produzidos, assim como as produções simbólicas frente ao contexto do jogo foram individuais. Jogar videogame relacionou-se ao posicionamento criador, de escrever as circunstâncias sob as quais as ações do jogo refletiram nas experiências vivenciadas pelo jogador.

  9. Insulin regulation of (Na+, K+)-ATPase

    International Nuclear Information System (INIS)

    Lytton, J.

    1985-01-01

    This thesis describes an investigation into the mechanism of insulin stimulation of (Na + ,K + )=ATPase in rat adipocytes. Two molecular forms of the catalytic subunit of the enzyme were identified and denoted α and α(+), due to their similarity to those isozymes previously described from rat brain. Insulin specifically stimulated the α(+) form of the enzyme. The two forms of the enzyme had quite different affinities for intracellular sodium ion; insulin affected only the lower affinity of α(+), shifting it toward a higher value. However, the sodium affinity of (Na + ,K + )-ATPase activity in isolated membranes was equally high for both forms of the enzyme. This suggests that the difference in sodium affinity between the two forms observed in the cell is not inherent within the structure of the sodium pump, but must depend upon a selective interaction with another molecule which has been lost upon membrane isolation. Immunoprecipitation of both the catalytic subunits either from extracts of whole cells which had been labelled with [ 32 P] orthophosphate, or from membranes which had been labelled with γ-[ 32 P]ATP demonstrated that less than 1 in 100 molecules had a covalently bound phosphate insulin had no influence on this value. The amino terminal sequences of the first 4 amino acids of the catalytic subunits of both α (isolated from rat kidney) and α(+) (from rat brainstem axolemma) were determined. The result shows two highly homologous but clearly different molecules. It can thus be concluded that the insulin sensitive version of the enzyme is not derived from the common α form by a post-translational modification

  10. LUZ, MELATONINA E ESTRESSE OXIDATIVO NA PISCICULTURA

    Directory of Open Access Journals (Sweden)

    Claudio Alberto Gellis de Mattos Dias

    2013-12-01

    Full Text Available Em peixes, como nos mamíferos, partes do sistema nervoso estão envolvidas em mecanismos para regulação dos sistemas corporais em sintonia com o meio. O fotoperíodo é traduzido em informações fisiológicas a partir da secreção de melatonina.Parece não haver barreiras morfofisiológicas para esta indolamina, isto é, a melatonina perfunde-se rapidamente em cada célula do organismo e em alguns casos interage com receptores e membrana situados na superfície celular, e parece estar ligada à ingestão de alimentos, crescimento e atividade locomotora de peixes. São moléculas importantes metabolizando espécies reativas de oxigênio a produtos inativos e, portanto, reduzindo o dano oxidativo.Este trabalho tem por objetivo fazer um breve levantamento em artigos recentes sobre luminosidade, melatonina e o estresse oxidativo em peixes, e correlaciona-los com piscicultura. Concluímos que a luminosidade parece estar ligada a produção de melatonina, e esta molécula antioxidante, que favorece a redução do estresse oxidativo, parecem melhorar o desempenho na produção de peixes em criadouros. Palavras-chave: Melatonina, estresse oxidativo, piscicultura. DOI: http://dx.doi.org/10.18561/2179-5746/biotaamazonia.v3n3p169-176

  11. Vogais na amazônia paraense

    Directory of Open Access Journals (Sweden)

    Regina Cruz

    2012-01-01

    Full Text Available Este artigo trata essencialmente de uma apresentação das ações do projeto institucional Norte Vogais vinculado ao Diretório Nacional PROBRAVO. O artigo fornece uma ideia precisa de como a equipe da UFPA vinculada ao PROBRAVO está conduzindo suas investigações sobre a variedade do português falada no Pará. O projeto Norte Vogais conta com amostras de fala de trezentos e dezoito informantes nativos do Pará no seu banco de dados. As descrições sociolinguísticas empreendidas pela equipe da UFPA priorizaram a investigação de três aspectos fonéticos em particular: a a variação das vogais médias pretônicas; b a variação das vogais médias postônicas mediais e; c a nasalidade alofônica. Os resultados obtidos reforçam a hipótese de Silva Neto (1957 de que o Pará compreenderia uma ilha dialetal na classificação de Antenor Nascente entre os dialetos do Norte do Brasil. Com o objetivo de refinar as descrições sociolingüísticas, duas novas ações se impuseram: a o mapeamento da situação sociolinguística das áreas de contato interdialetal no Pará e; b a análise acústica do sistema vocálico do português falado na Amazônia Paraense.

  12. VOGAIS NA AMAZÔNIA PARAENSE

    Directory of Open Access Journals (Sweden)

    Regina Fernandes Cruz

    2012-12-01

    Full Text Available Este artigo trata essencialmente de uma apresentação das ações do projeto institucional Norte Vogais vinculado ao Diretório Nacional PROBRAVO. O artigo fornece uma ideia precisa de como a equipe da UFPA vinculada ao PROBRAVO está conduzindo suas investigações sobre a variedade do português falada no Pará. O projeto Norte Vogais conta com amostras de fala de trezentos e dezoito informantes nativos do Pará no seu banco de dados. As descrições sociolinguísticas empreendidas pela equipe da UFPA priorizaram a investigação de três aspectos fonéticos em particular: a a variação das vogais médias pretônicas; b a variação das vogais médias postônicas mediais e; c a nasalidade alofônica. Os resultados obtidos reforçam a hipótese de Silva Neto (1957 de que o Pará compreenderia uma ilha dialetal na classificação de Antenor Nascente entre os dialetos do Norte do Brasil. Com o objetivo de refinar as descrições sociolingüísticas, duas novas ações se impuseram: a o mapeamento da situação sociolinguística das áreas de contato interdialetal no Pará e; b a análise acústica do sistema vocálico do português falado na Amazônia Paraense.

  13. Mercury's Na Exosphere from MESSENGER Data

    Science.gov (United States)

    Killen, Rosemary M.; Burger, M. H.; Cassidy, T. A.; Sarantos, M.; Vervack, R. J.; McClintock, W. El; Merkel, A. W.; Sprague, A. L.; Solomon, S. C.

    2012-01-01

    MESSENGER entered orbit about Mercury on March 18, 2011. Since then, the Ultraviolet and Visible Spectrometer (UWS) channel of MESSENGER's Mercury Atmospheric and Surface Composition Spectrometer (MASCS) has been observing Mercury's exosphere nearly continuously. Daily measurements of Na brightness were fitted with non-uniform exospheric models. With Monte Carlo sampling we traced the trajectories of a representative number of test particles, generally one million per run per source process, until photoionization, escape from the gravitational well, or permanent sticking at the surface removed the atom from the simulation. Atoms were assumed to partially thermally accommodate on each encounter with the surface with accommodation coefficient 0.25. Runs for different assumed source processes are run separately, scaled and co-added. Once these model results were saved onto a 3D grid, we ran lines of sight from the MESSENGER spacecraft :0 infinity using the SPICE kernels and we computed brightness integrals. Note that only particles that contribute to the measurement can be constrained with our method. Atoms and molecules produced on the nightside must escape the shadow in order to scatter light if the excitation process is resonant-light scattering, as assumed here. The aggregate distribution of Na atoms fits a 1200 K gas, with a PSD distribution, along with a hotter component. Our models constrain the hot component, assumed to be impact vaporization, to be emitted with a 2500 K Maxwellian. Most orbits show a dawnside enhancement in the hot component broadly spread over the leading hemisphere. However, on some dates there is no dawn/dusk asymmetry. The portion of the hot/cold source appears to be highly variable.

  14. RNA adducts with Na 2SeO 4 and Na 2SeO 3 - Stability and structural features

    Science.gov (United States)

    Nafisi, Shohreh; Manouchehri, Firouzeh; Montazeri, Maryam

    2011-12-01

    Selenium compounds are widely available in dietary supplements and have been extensively studied for their antioxidant and anticancer properties. Low blood Se levels were found to be associated with an increased incidence and mortality from various types of cancers. Although many in vivo and clinical trials have been conducted using these compounds, their biochemical and chemical mechanisms of efficacy are the focus of much current research. This study was designed to examine the interaction of Na 2SeO 4 and Na 2SeO 3 with RNA in aqueous solution at physiological conditions, using a constant RNA concentration (6.25 mM) and various sodium selenate and sodium selenite/polynucleotide (phosphate) ratios of 1/80, 1/40, 1/20, 1/10, 1/5, 1/2 and 1/1. Fourier transform infrared, UV-Visible spectroscopic methods were used to determine the drug binding modes, the binding constants, and the stability of Na 2SeO 4 and Na 2SeO 3-RNA complexes in aqueous solution. Spectroscopic evidence showed that Na 2SeO 4 and Na 2SeO 3 bind to the major and minor grooves of RNA ( via G, A and U bases) with some degree of the Se-phosphate (PO 2) interaction for both compounds with overall binding constants of K(Na 2SeO 4-RNA) = 8.34 × 10 3 and K(Na 2SeO 3-RNA) = 4.57 × 10 3 M -1. The order of selenium salts-biopolymer stability was Na 2SeO 4-RNA > Na 2SeO 3-RNA. RNA aggregations occurred at higher selenium concentrations. No biopolymer conformational changes were observed upon Na 2SeO 4 and Na 2SeO 3 interactions, while RNA remains in the A-family structure.

  15. Growth mechanism of NaClO3 and NaBrO3 crystals from aqueous ...

    Indian Academy of Sciences (India)

    Unknown

    tamura (1978) developed a sophisticated apparatus for in situ observation and studied the growth of NaClO3 crys- tals. Tsukamoto and Sunagawa (1990) made a systematic study of the growth of KCl in the presence of Pb ions. Though we have reported studies on growth of NaClO3 and NaBrO3 crystals, they were largely ...

  16. Anisotropy and polarization in charge changing collisions of C4+ with Na(3s) and laser aligned Na(3p)

    NARCIS (Netherlands)

    Hoekstra, R; Morgenstern, R; Olson, RE

    1996-01-01

    Absolute cross sections for C3+(6-->5) emission at 465.7 nm after collisions of C4+ ions with ground state Na(3s) and laser excited aligned Na(Sp) atoms are measured over the collision energy range of 3-7 keV amu(-1). For Na(3s) polarizations are observed by measuring the linear polarization of the

  17. Crystal structure of polyphosphates NaCd(PO3)3 and NaMn(PO3)3

    International Nuclear Information System (INIS)

    Murashova, E.V.; Chudinova, N.N.

    1997-01-01

    Crystal structure of NaCd(PO 3 ) 3 (1) and NaMn(PO 3 ) 3 (2) isostructural polyphosphates was determined for twin samples. Rhombic lattice parameters of (1): a = 14.678, b = 14.669, c = 14.705 A, sp. gr. P2 1 2 1 2 1 , Z = 16. The structure of compounds is of frame type. Polyphosphate chain with repetition period of 24 PO 4 tetrahedrons contacts with NaO 6 and M 2 O 6 octahedrons by means of common oxygen vertices. Similarities and differences in structure of mentioned polyphosphates and earlier analyzed NaMg(PO 3 ) 3 polyphosphate are noted [ru

  18. 43. Calmodulin regulating calcium sensitivity of Na channels

    Directory of Open Access Journals (Sweden)

    R. Vegiraju

    2016-07-01

    Full Text Available By extrapolating information from existing research and observing previous assumptions regarding the structure of the Na Channel, this experiment was conducted under the hypothesis that the Na Channel is in part regulated by the calmodulin protein, as a result proving calcium sensitivity of the Na Channel. Furthermore, we assume that there is a one to one stoichiometry between the Na Channel and the Calmodulin. There has been extensive research into the functionality and structure of sodium ion channels (Na channels, as several diseases are associated with the lack of regulation of sodium ions, that is caused by the disfunction of these Na channels. However, one highly controversial matter in the field is the importance of the protein calmodulin (CaM and calcium in Na channel function. Calmodulin is a protein that is well known for its role as a calcium binding messenger protein, and that association is believed to play an indirect role in regulating the Na channel through the Na channel’s supposed calcium sensitivity. While there are proponents for both sides, there has been relatively little research that provides strong evidence for either case. In this experiment, the effect of calmodulin on NaV 1.5 is tested by preparing a set of cardiac cells (of the human specie with the NaV 1.5 C-Termini and CaM protein, which were then to be placed in solutions with varying concentrations of calcium. We took special care to test multiple concentrations of calcium, as previous studies have tested very low concentrations, with Manu Ben-Johny’s team from the John Hopkins laboratory in particular testing up to a meager 50 micromolar, despite producing a well-respected paper (By comparison, the average Na channel can naturally sustain a concentration of almost 1-2 millimolar and on some occasions, reaching even higher concentrations. After using light scattering and observing the signals given off by the calcium interacting with these Nav1.5/Ca

  19. Estratégias na Terapêutica Transfusional na Malária e Drepanocitose

    OpenAIRE

    Barra, A

    2017-01-01

    Um mesmo mundo, diferentes realidades Apesar dos casos de malária, no mundo, terem diminuído de aproximadamente 40 milhões entre 2000 e 2015, neste último ano o número estimado de mortes por malária ainda rondou os 438.000, sendo 88% destas na região africana.(1) Em 2011 os casos de morte por malária aconteceram maioritariamente em crianças com menos de 5 anos de idade na África subsaariana.(2) As grávidas, são um grupo, com um risco aumentado de morbilidade e mortalidade, que se es...

  20. Sliding wear behaviour of steel carburized using Na2CO3-NaCl

    Directory of Open Access Journals (Sweden)

    Liew Willey Y. H.

    2017-01-01

    Full Text Available Experiments have been carried out to investigate the effect of carburization process on the sliding wear resistance of mild steel. The carburization process was conducted in carbonate salts mixtures of Na2CO3-NaCl. Carburization followed by water quenching resulted in the formation of martensite with a hardness of 900 HV in the subsurface, up to the depth of 400 μm. This hardness value was substantially higher than the non-carburized steel which had a hardness of 520 HV. In the initial stage of sliding in air, abrasive wear and cluster of fine cavities due to adhesion were formed. This was followed by the formation of large-scale fracture at the cavities. The high hardness of the carburized steel reduced the severity of adhesive wear and thus the tendency of the worn surface to fracture.