WorldWideScience

Sample records for muuli kaarel kaas

  1. Estonia's defence dollars spent wisely? / Tony Lawrence, Kaarel Kaas ; interv. Joel Alas

    Lawrence, Tony

    2007-01-01

    Rahvusvahelise Kaitseuuringute Keskuse teadurid Tony Lawrence ja Kaarel Kaas kommenteerivad Eestis Suurbritannia kaitseatasheena töötanud kolonelleitnant Glen Granti kriitikat kaitsejõudude efektiivsuse osas, Eesti kaitsepoliitikat, küberrünnakut Eestile, kahe Eesti rahukaitseväelase surma missioonil Afganistanis ning üldsuse suhtumist Eesti osalemisele rahvusvahelistel missioonidel. Lisa: Tony Lawrence; Kaarel Kaas

  2. Raevus Iisrael valmistub pealetungiks Gazale / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2006-01-01

    Iisrael koondas eilseks oma armee Gaza lähedale ning ähvardas Palestiinat rünnata, kui ei vabastata pühapäeval palestiinlaste poolt röövitud noort Iisraeli sõdurit. Iisrael välistab läbirääkimiste alustamise

  3. Kahtlaste provokaatorite paraad Moskva moodi / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 9. okt. lk. 10. Katari pealinnas Dohas 2004. aastal toimunud Tšetšeenia endise presidendi Zelimhan Janbarbijevi pommiplahvatusega tapmise tagamaadest ja Venemaa luureagentide arreteerimisest. Gruusias lahvatanud spiooniskandaali ja Doha plahvatuse puhul toimunud sarnased reageeringud Venemaal. Gruusia võimud seostavad Vene luureorganisatsiooni grusiinide grupiga, kes olevat valmistunud riigipöördeks

  4. Robin Cook tundis Eestis kodusoojust / Kaarel Kaas

    Kaas, Kaarel, 1978-

    1999-01-01

    Suurbritannia välisministri Robin Cooki visiit kulmineerus uue saatkonna ametliku avamisega. Kommentaar kahe riigi suhetest : A. Tarand, S. Lõoke, A. Laaneots, G. Aarma. Lisa : Välisriikide ametnike visiidid Eestisse 1996-1999

  5. Kuus miljardit krooni muutus tunniga rusudeks / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2001-01-01

    Arvandmeid jaapani arhitekti Minoru Yamasaki projekteeritud World Trade Center'i (WTC) kohta New Yorgis. Kahe kõrghoone hävinemise ajakava 11. septembril 2001. Skeemid ja kaart: New Yorgi siluetis olnud tornmajade hävimine

  6. Terror määris klantspildi verega / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2005-01-01

    9. novembril toimunud pommiplahvatustes Jordaania pealinna Ammani kolmes hotellis hukkus ligi 60 inimest. Siiani on Jordaania suutnud tänu tõhusale julgeolekusüsteemile terroriaktidest hoiduda. Lisa, kaart: Plahvatused Jordaanias. Vt. samas: Al-Qaeda võitleja tappis Bagdadis 35 inimest

  7. Erasõdurid teenivad Iraagis hiigelvara / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2005-01-01

    Ajalehe Washington Post andmetel on Iraagis 36 välismaist, 16 kohalikku ja hinnanguliselt ligi 50 ebaseaduslikku julgeolekuteenuseid pakkuvat ettevõtet. Iraagis tegutsevatest Suurbritannia ja USA eraturvafirmadest. Lisa: Turvakompaniid Iraagis. Vt. samas: Eesti turvajad võivad ka Iraaki jõuda

  8. Kosovo alustas vereta lahingut oma riigi nimel / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2005-01-01

    ÜRO julgeolekunõukogu kuulutas ametlikult avatuks läbirääkimised Kosovo lõpliku saatuse üle ja määras oma eriesindajaks Kosovo küsimuses Soome endise presidendi Marti Ahtisaari. Lisa, kaart: Kosovo

  9. Sharon tekitas Iisraelis maavärina / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2005-01-01

    Ilmunud ka: Postimees : na russkom jazõke 23. nov. lk. 8. Iisraeli peaminister Ariel Sharon teatas, et lahkub enda rajatud Likudi parteist ning palub presidendil Moshe Katzavil parlamendi laiali saata ja kuulutada välja erakorralised valimised, kuhu kavatseb minna juba oma uue erakonnaga

  10. Gaza mässab Arafati valitsemise vastu / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2004-01-01

    Palestiina võitlejad ründasid Palestiina omavalitsuse julgeolekujõudusid Gaza sektoris, avaldades protesti president Yasser Arafati otsuse vastu määrata piirkonna julgeolekujuhiks lähisugulane Mussa Arafat. Peaminister Ahmed Qurei andis lahkumisavalduse. Kaart: Protestid Gazas

  11. Draakon teritab küüniseid / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2005-01-01

    Hiina-USA viimaste aastakümnete tõsisem konflikt, mis sai alguse Hainani intsidendist. Hiina suhtes 1989. a. kehtestatud relvaemargo kaotamisest. USA julgeoleku- ja Euroopa Liidu majandushuvid. Tabel: Hiina sõjaliste kulutuste ametlikud andmed

  12. President Meri näitas USA-le vabaduse ilu / Daniel Fried ; interv. Kaarel Kaas

    Fried, Daniel, 1952-

    2006-01-01

    USA abivälisminister Daniel Fried USA välispoliitika ühest eesmärgist - demokraatia levitamisest maailmas, demokraatia olukorrast Venemaal ning USA ja Venemaa vahelistest suhetest. Lisa: Daniel Fried

  13. Merkel manitses Putinit selgitama valulisi samme lähinaabritele / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 18. jaan. lk. 9. Saksa kantsler Angela Merkel kõneles kohtumisel Venemaa presidendi Vladimir Putiniga majandus- ja energiaküsimuste, sh. Vene-Saksa gaasijuhtme ning Iraani tuumaprobleemi teemadel. Vt. samas: Iraani tuumaküsimus jõuab ÜRO Julgeolekunõukogusse. Lisa: Kantsleri reisid

  14. Usbekistan säästis Saksa väebaasi sulgemisest / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2005-01-01

    Ilmunud ka: Postimees : na russkom jazõke 14. dets. lk. 8. Usbeki võimud lubasid Saksamaal ka edaspidi pikaajaliselt kasutada riigi lõunapiiri ääres asuvat sõjaväebaasi, kuigi USA samalaadne väebaas pidi riigist Tashkendi nõudel lahkuma. BBC teatel ei ole Tashkent esinenud ühegi avaliku selgitusega, miks riikidesse erinevalt suhtutakse. Lisa: Termezi õhuväebaas

  15. Rüütel pakub külalistele elegantset kamamaiust / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2003-01-01

    Ilmunud ka: Infopress (2003) 21. veebr., nr. 8 lk. 139. President Arnold Rüütel koos proua Ingrid Rüütliga pakub Eesti riigi 85. sünnipäeval eestimaiseid roogasid. OÜ Catering Service tegevjuhi Marko Meigase, Scandic Hotel Palace'i toitlustusjuhi Svea Juurikase ja presidendi pressiesindaja Ester Šanki kommentaarid

  16. Jordaania nägi esimest korda naiseneseõhkijat / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2005-01-01

    Jordaania televisioonis esines ülestunnistusega naisenesetaputerrorist Sajida Mubarak al-Rishaw, kelle ülesandeks oli end õhkida koos oma mehe Ali Hussein al-Shumariga Ammani kesklinna hotellis Radisson SAS

  17. Euroliit palus USA-l sulgeda Guantanamo vangla / Kaarel Kaas, Toomas Sildam

    Kaas, Kaarel, 1978-

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 22. juuni lk. 8. Euroopa Liidu ja USA tippkohtumisel Viinis oli arutluse all Guantanamo vangilaagri sulgemine, kõneldi Iraani tuumaprogrammist, maailmakaubandusest ning USA viisavabaduse kehtestamisest kõigile Euroopa Liidu liikmetele

  18. Gruusia sammub Eesti reformide jälgedes / Nino Burdžanadze ; intervjueerinud Kaarel Kaas

    Burdžanadze, Nino

    2006-01-01

    30. ja 31. mail Eestis viibinud Gruusia parlamendi esimehe Nino Burdžanadze sõnul võtab Gruusia uuendusi läbides eeskuju eelkõige Baltimaadest ning ta usub, et Gruusia suhted Venemaaga paranevad pärast NATO-sse astumist. Lisa: Kas teate?

  19. USA väed võivad hakata Iraagist lahkuma / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2005-01-01

    USA on Iraagis toimuvate valimiste eel saatnud sinna lisavägesid. Vägivalla tõttu võivad mõnes Iraagi piirkonnas valimised ära jääda. USA välisministri Colin Powelli sõnul võivad USA sõdurid juba sel aastal hakata järk-järgult Iraagist lahkuma, kui Iraagil endal õnnestub saada suurem roll turvalisuse tagamisel. Lisa: Kaotused Iraagis

  20. CIA salalennud varjutasid Merkeli ja Rice'i kohtumist / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2005-01-01

    Ilmunud ka: Postimees : na russkom jazõke 7. dets., lk 8. Saksamaa uue kantsleri Angela Merkeli ja USA välisministri Condoleezza Rice'i Berliini kohtumise peateemaks kerkis Ühendriikide Luure Keskagentuuri (CIA) poolt korraldatud salalennud, millega transporditi terrorismis kahtlustatavaid ülekuulamistele Ida-Euroopa riikides asuvatesse CIA salajastesse vanglatesse

  1. CIA salalendude võrk võis ulatuda 14 Euroopa riiki / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 9. juuni lk. 7. Euroopa Nõukogu aurande kohaselt olid USA Luure Keskagentuuri (CIA) salavanglate ja salalendude korraldamisega seotud neliteist Euroopa riiki. Lisa: Salajane "ämblikuvõrk"

  2. Kremlis tõstab pead tsaristlik võimuideoloogia / John Hulsman ; interv. Kaarel Kaas

    Hulsman, John

    2004-01-01

    USA uurimiskeskuse Heritage Foundation analüütiku hinnangul võtab Venemaa üha enam tsaaririigi näo ning Washington vajab Moskvaga äripartnerlusega sarnanevat suhet. Nn saja kirjast, sellega kaasneda võivatest muutustest, Ameerika varasemast Vene-poliitikast. Vt. samas: "Saja kiri" lööb häirekella Vene pärast; Kommenteerib Strateegiliste ja Rahvusvaheliste uuringute Keskuse vanemanalüütik Simon Serfaty.

  3. Solana : 9. mai sõidu otsustas iga riik ise / Javier Solana ; interv. Kaarel Kaas

    Solana, Javier

    2005-01-01

    EL-i välis- ja julgeolekupoliitika juhi sõnul on Venemaaga häid suhteid ja vastastikku kasulikku koostööd omada fundamentaalse tähendusega nii Euroopale kui ka Euroopa eesliinil asuvatele riikidele. Lisa: Javier Solana

  4. Sõja ja kaose vahele surutud tšetšeenid valisid parlamenti / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2005-01-01

    Ilmunud ka: Postimees : na russkom jazõke 29. nov. lk. 8. 27. novembril toimunud parlamendivalimistest Tšetšeenias. Kaks ja pool tundi enne valimiste lõppu oli hääletamas käinud 57,4 protsenti valijatest

  5. Bush mõistis hukka moslemite vägivaldsed meeleavaldused / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2006-01-01

    USA president Georg W. Bush ja välisminister Condoleezza Rice mõistavad hukka moslemite vägivaldsed meeleavaldused, kuid mitte nende ajendiks olnud Muhamedi pilavad karikatuurid ning leiavad, et Iraan ja Süüria kasutavad pilapiltide skandaali oma poliitiliste eesmärkide saavutamiseks

  6. Kirjavahetus Kaarel Robert Pustaga / Karl Ast Rumor

    Rumor, Karl, pseud., 1886-1971

    2009-01-01

    Kirjavahetus Rio de Janeiros elava Karl Ast Rumori ja New Yorgis elava Kaarel Robert Pusta vahel Eesti kongressi kokkukutsumise vajalikkuse, väliseesti ühingute ja nõukogude, ajakirjanduse ning üldise poliitilise olukorra teemadel

  7. Onderzoek naar de chemische en microbiologische kwaliteit van zachte kaas

    Egmond, van H.J.; Bakker, R.; Boeyen, P.; Coors, R.; Hakemulder, W.; Labrijn, J.; Herstel, H.

    1993-01-01

    Voor Konsumenten Kontakt zijn in augustus en september 1992 zevenenveertig monsters zachte kaas (Brie en Camembert) chemisch en microbiologisch onderzocht. Het chemisch onderzoek bestond uit het bepalen van de gehaltes aan vocht en vet. Het microbiologische gedeelte bestond uit een onderzoek naar de

  8. Kaarel Nurk mäletab kaameraga / Kaarel Nurk ; interv. Rivo Sarapik

    Nurk, Kaarel

    2007-01-01

    Fotograaf Kaarel Nurk - sai Pentaxi Aasta Portreefoto konkursi Grand Prix aastal 2006, ajaveeb The Supersnap valiti aasta parimaks ajaveebiks ning kes valiti Cheesemeistriks. Nurk peab lisaks portreedele lugu sõjaväefotograafiast. On fotografeerinud "Tühiranna" ja "Sügisballi" filmimist

  9. Ainult kaks küsimust / Kaarel Väli

    Väli, Kaarel

    2011-01-01

    Tallinnas toimunud 5. rahvusvahelise laste ja noorte moeteatrite festivali „Max Moda 2011" žürii liige Kaarel Väli põhjustest, miks osutus parimaks Moskva moeteater, Eesti võistlejate esinemisest

  10. Norra moslemite juht soovitab Läänel paremat nõu otsida / Mohammad Hamdad ; interv. Kaarel Kaas

    Hamdad, Mohammad

    2006-01-01

    Norra Islaminõukogu esimees Mohammad Hamdan vastab intervjuus prohvet Muhamedi karikatuuri skandaali, lääne-islami suhteid ning Norras elavate moslemite probleeme puudatavatele küsimustele. Lisa: Pilditüli

  11. George Bush peab sõjalist jõudu viimaseks valikuks / George W. Bush ; interv. Kaarel Kaas

    Bush, George W., 1946-

    2005-01-01

    Ilmunud ka: Põhjarannik 7. mai 2005, lk. 2, Severnoje Poberezhje 7. mai, 2005, lk. 2. USA president George Bush andis 5. mail Valges Majas intervjuu kuuele Euroopa ajakirjanikule. 9. mai pidustustest Moskvas, USA-Läti, Venemaa-Balti riikide suhetest, demokraatiast Venemaal, Ameerika Ühendriikide ning Baltimaade viisarežiimist, vabaduse mõistestst, kinnipeetavate kohtlemisest Guantanamo sõjaväebaasis, relvade kasutamise vajadusest, terrorismist. Vt. samas: Kuidas usutlus võimalikuks sai

  12. Urmas Paet : NATO ja Euroopa Liit olid Eestile nagu Mount Everesti vallutamine alpinistile / Urmas Paet ; interv. Kaarel Kaas

    Paet, Urmas, 1974-

    2005-01-01

    Uus välisminister Eestist kui võimalikust ÜRO Julgeolekunõukogu liikmesmaast, riigi välispoliitilistest eesmärkidest, uute saatkondade avamisest, Eesti-Vene suhetest, Iraagi-missioonist, EL-i piiridest. Lisad: CV; Ministri viis esimest tööd. Kommenteerib endine välisminister Kristiina Ojuland

  13. Kindral Clark: tehke NATOs kõva häält! / Wesley K Clark ; interv. Kaarel Kaas

    Clark, Wesley K

    2005-01-01

    NATO Euroopa liitlasvägede endine juhataja, USA erukindral 2004. aasta presidendivalimistest USA-s, võimalikust kandideerimisest presidendiks 2008. aasta valimistel, demokraatide võimalustest järgmised presidendivalimised võita, oma seisukohtadest Iraagi sõja küsimuses, diplomaatiliste vahendite kasutamisest sõjaliste konfliktide lahendamisel, NATO laienemisest ja organisatsiooni sõjalisest suutlikkusest ning intsidendist Vene hävitajaga. Lisa: Wesley K. Clark

  14. Sõjakas Hamas loodab Palestiinas võimupirukast suure tüki võtta / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2006-01-01

    25. jaanuaril Palestiinas toimuvatest parlamendivalimistest. Lähis-Ida Konsultatsiooniinstituudi poolt avalikustatud avaliku arvamuse uuringu andmetel võib islamiliikumine Hamas saada pea pooled parlamendi saadikukohtadest, võimupartei Fatah toetus on vähenenud ja ta saaks 59 kohta. Lisa: Valimiste võtmekujud

  15. Norra rahustab võõraid hea tasuva ameti ja töökaaslastega / Kaarel Kaas

    Kaas, Kaarel, 1978-

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 17. mai lk. 7. Norra sotsiaaluuringute instituudi uurimisdirektori Grete Brochmani sõnul leidub Norra 4,6 miljonilise elanikkonna seas üle 200 erineva etnilise grupi esindajaid, sisserändajate arv ulatub 360 tuhandeni. Taas kiirelt kasvav majandus soodustab tööjõu sisserännet veelgi. Lisa: Sisserändajad

  16. Millisele õpetajale kingiksite imerohu? / Karl Martin Sinijärv, Vahur Keller, Kaarel Tarand ... [jt.

    2010-01-01

    Küsimusele vastavad: Eesti kirjanike liidu esimees Karl Martin Sinijärv, nuku- ja noorsooteatri lavastaja Vahur Keller, Sirbi peatoimetaja Kaarel Tarand, kirjanik Andrus Kivirähk, ajakirjanik Juhani Püttsepp

  17. Nino Burdžanadze : revolutsioon oli jäänud rahva ainsaks võimaluseks / Nino Burdžanadze ; intervjueerinud Kaarel Kaas

    Burdžanadze, Nino

    2004-01-01

    Gruusia presidendi kohusetäitja Gruusia revolutsioonist, raskustest ja suhetest USA ning Venemaaga. Vt. samas: Presidendikantseleis hõljub hämarus ja sigaretiving; Võitluskaaslased - strateeg ja liider. Gruusia uute tipp-poliitikute tutvustus

  18. Weimari vari / Kalle Muuli

    Muuli, Kalle, 1958-

    2008-01-01

    Enne Venemaa presidendivalimisi võrdles Eesti president Toomas Hendrik Ilves praegust Venemaad kunagise Weimari vabariigiga Saksamaal, jättes mainimata, et Weimari vabariik lõppes valimistega, mis tõid võimule natsionaalsotsialistliku partei eesotsas Adolf Hitleriga. Demokraatlike valimistega seotud ohtudest vähese demokraatiakogemusega maades

  19. Gümnasistid kipuvad kooli kõrvalt tööle / Kaarel Kotkas, Mariliis Kaul, Helis Toiger, Elar Toomsalu ; küsitlenud Madde Rebane

    2007-01-01

    Intervjuu Pärnu gümnaasiumiõpilaste Kaarel Kotkasega Hansagümnaasiumist, Mariliis Kauliga Koidula Gümnaasiumist, Helis Toigeriga Ülejõe Gümnaasiumist ja Elar Toomsaluga Sütevaka Humanitaargümnaasiumist

  20. Mida teeb Narva kutseõppekeskus teie arvates Narva linna heaks? / Burkina, Irina; Patlep, Kaarel; Kaalik, Ljubov; Dolgovskaja, Tatjana; Ibragimov, Muret; Vorobjova, Anna

    2007-01-01

    Vastavad Narva Kutseõppekeskuse kutseõpetajad Irina Burkina, Tatjana Dolgovskaja ja Murat Ibragimov ning autovaldkonna juht Kaarel Patlep, projektijuht Ljubov Kaalik ja PR-spetsialist Anna Vorobjova

  1. Kaarel Irdi repertuaaripoliitilised vaated Vanemuise teatri juhina. Kaarel Ird’s Repertoire Policy as Manager of the Vanemuine Theatre

    Jaak Viller

    2012-04-01

    Full Text Available This article focuses on the meaning of ’repertoire policy’, which in a broader sense usually means the conformity of someone’s creative activities with their main target groups and the interests and expectations of these target groups. Usually, factors inside the theatre also influence repertoire policy (such as contemporary and classical texts, the relationship between local and foreign material, as well as the consideration of the artistic interests and abilities of the directors and actors involved. When analysing the Vanemuine Theatre and its long-standing manager Kaarel Ird (at Vanemuine during the years 1940–1986, a certain aspect stemming from the ideological doctrine of the totalitarian state should be taken into account: the mandatory quota of Soviet drama works (of the Russian and other Soviet nations written after the revolution of 1917, which had to be no less than two-thirds of the plays staged. One of Ird’s more distinguishable accomplishments in the formation of repertoire policy is the rehabilitation of classical Estonian drama and its legacy, which had been ostracised from the stage during the years following the war (1944–1955. Ird justified this with numerous performances and articles as well as in the choice of repertoire at the Vanemuine Theatre, which was very well received by the growing audience. Ird’s own best directed works were based on the legacy of classic Estonian drama (Lydia Koidula, Oskar Luts and others. The other tendency in Ird’s repertoire policy is the attention paid to the Estonian contemporary drama. His role in enthusing writers to create contributions for the drama genre was remarkable, as well as the care taken in order to make their plays reach the stage at Vanemuine Theatre. Something that should be pointed out in Ird’s favour is his explanation – which at the time was not at all self-evident – of the repertoire to the supervisory organs: that contemporary Estonian dramas ought

  2. Euroliidu riigijuhid kinnitasid Barroso ametisse / Marit Ruuda, Arko Olesk

    Ruuda, Marit

    2004-01-01

    Brüsselis EL-i riigijuhtide erakorralisel kohtumisel valiti Euroopa Komisjoni uueks presidendiks Portugali peaminister Jose Manuel Durao Barroso. Lisa: Jose Manuel Durao Barroso. Vt. samas Kaarel Kaas'i intervjuud: Juhan Parts kiidab ühist valikut

  3. Health risk assessment of hazardous metals for population via consumption of seafood from Ogoniland, Rivers State, Nigeria; a case study of Kaa, B-Dere, and Bodo City.

    Nkpaa, K W; Patrick-Iwuanyanwu, K C; Wegwu, M O; Essien, E B

    2016-01-01

    This study was designed to investigate the human health risk through consumption of seafood from contaminated sites in Kaa, B-Dere, and Bodo City all in Ogoniland. The potential non-carcinogenic health risk for consumers were investigated by assessing the estimated daily intake and target hazard quotients for Cr, Cd, Zn, Pb, Mn, and Fe while carcinogenic health effect from Cr, Cd, and Pb was also estimated. The estimated daily intake from seafood consumption was below the threshold values for Cr, Mn, and Zn while they exceeded the threshold for Cd, Pb, and Fe. The target hazard quotients for Zn and Cr were below 1. Target hazard quotients values for Cd, Pb, Mn, and Fe were greater than 1 except for Fe level in Liza falcipinis from Kaa. Furthermore, estimation of carcinogenic risk for Cr in all samples under study exceeded the accepted risk level of 10E-4. Also, Cd carcinogenic risk level for L. falcipinis and Callinectes pallidus collected from B-Dere and C. pallidus collected from Bodo City was 1.1E-3 which also exceeded the accepted risk level of 10E-4 for Cd. Estimation of carcinogenic risk for Pb was within the acceptable range of 10E-4. Consumers of seafood from these sites in Ogoniland may be exposed to metal pollution.

  4. 1 küsimus noorele juhile : Kuidas on kõige parem tähtsad põhimõtted töötajateni viia? / Kaarel Oja, Reet Roos, Martin Hurt... [jt.

    2010-01-01

    Küsimusele vastavad Teater NO99 tegevjuht Kaarel Oja, meediaagentuuri Inspired, tööõigusbüroo ja trükikoja Digiprint omanik Reet Roos, kaitseministeeriumi asekantsler Martin Hurt, SOL Eesti personalijuht Evely Ellert ning investeerimis- ja varahalduslahendusi pakkuva Sampo Life juhatuse liige Erkki Sadam

  5. USA kaitseminister Robert Gates süüdistas liitlasvägesid oskamatuses / Evelyn Kaldoja

    Kaldoja, Evelyn, 1980-

    2008-01-01

    USA kaitseminister Robert Gates väitis ajalehes The Los Angeles Times avaldatud intervjuus, et Lõuna-Afganistani olukord on halvenenud seal võitlevate USA liitlasvägede puuduliku väljaõppe tõttu. Liitlasriikide reageeringuid. Arvamust avaldavad Jaak Aaviksoo, Kaarel Kaas

  6. Kaitseliit muutus ärimeeste käepikenduseks / Toomas Mattson, Toomas Sildam

    Mattson, Toomas, 1970-

    1999-01-01

    Bekkeri sadama ja Kaitseliidu konflikt 1999. okt. B. Leesik, P.-I. Rajamäe-Volmer, M. Alviste, E. Siff, U.Roosimägi jt. Kommenteerivad Tiit Tammsaar, Ants Laaneots, Eerik-Niiles Kross. Samas artikkel: Kaas, Kaarel. Kapten Terras võib Leesiku välja vahetada

  7. Luik : Kennan muutis mõtteviisi / Jüri Luik ; interv. Erkki Bahovski

    Luik, Jüri, 1966-

    2005-01-01

    Eesti USA suursaadiku sõnul muutis George Kennan Lääne mõtteviisi, pannes piiri demokraatiate taganemisele kommunistliku Venemaa ees. Lisa: George Frost Kennan. Vt. samas: Kaarel Kaas. Kommunismi ohjeldaja suri 101-aastasena. Vt. ka Lennart Meri. Suur ja väike : George F. Kennan 1904-2005, lk. 13

  8. Nunnufaktor korda kaks / Karri Kaas

    Kaas, Karri, 1982-

    2009-01-01

    Betty Thomase animafilmist "Alvin ja koopaoravad 2", USA 2009. Järg 2007. a. menukomöödiale. Tegelastele annavad eesti keeles oma hääled Anatoli Tafitšuk, Maarius Pärn, Veiko Anvelt, Tiit Sukk ja teised

  9. Plaadid / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2007-01-01

    Uutest heliplaatidest Kasabian "Empire", Katrin Mandel ja Lauri Saatpalu "Ei kunagi", The Hold Steady "Boys & Girls in America", "Corinne Bailey Rae", FAll Out Boy "Infinity On High", Laleh "Prinsessor", Melody Club "Scream"

  10. Meri levitas dokumente Greeni mineviku kohta / Toomas Sildam, Kalle Muuli

    Sildam, Toomas, 1961-

    2001-01-01

    Ühe jõustruktuuri ametnikud otsisid riigiarhiivi filiaalis Greeni puudutavaid dokumente ning Presidendi Kantselei saatis nende koopiad ajalehtedele avaldamiseks. President Lennart Meri õnnitluskiri Arnold Greenile 30. augustil 1995

  11. Over de vroeg beginnende gasvorming in kaas

    Galesloot, T.E.

    1946-01-01

    The early production of gas in cheese, called 'blowing' was caused chiefly by some coli-aerogenes bacteria of the aerogenes-cloacae type and intermediate types. These bacteria produced gas in a combined fermentation-curdling test both on milk and on cheese; they were called blowing-positive

  12. Valmis film parvlaev Estonia katastroofist / Imre Kaas

    Kaas, Imre

    2003-01-01

    Saksamaal on valminud poliitiline põnevusfilm "Balti torm" ("Baltic Storm"), mis kujutab parvlaev "Estonia" hukku venelaste vandenõu tulemusena. Film jõuab Eestis linale novembri alul. Produtsent ja esialgse stsenaariumi autor koosHenning Wittega on Jutta Rabe, režissöör ja üks stsenariste Reuben Leder. Kaasa teeb ka Donald Sutherland USA kindrali rollis. Eesti näitlejaist teeb kaasa Rein Oja

  13. Korruptsioon: ehitusala loomus / Kaarel Tarand

    Tarand, Kaarel, 1966-

    2005-01-01

    Korruptsioonist ehituses ja poliitikas. Transparency International avaldas aruande korruptsioonist ehituse ja riigihangete alal. Diagrammid, tabel: Korruptsioon ja erakonnad; Ehitussektori põhinäitajad; Korruptsiooni baromeeter

  14. Tüli Robert Smithsoni "Spiraalse muuli" taastamise ümber / Rael Artel

    Artel, Rael, 1980-

    2004-01-01

    Ameerika maakunstniku Robert Smithsoni (1938-1973) töö "Spiral Jetty" / "Spiraalne muul", mis on ligi 30 aastat seisnud nähtamatult Utah' osariigis Suure Soolajärve põhjas, on praegu kogu ulatuses näha. Teose omanik Dia kunstikeskus on dilemma ees, kas muul restaureerida või mitte

  15. Robert Lepikson : ohvitserid teavad tõde / Robert Lepikson ; interv. Kalle Muuli

    Lepikson, Robert, 1952-2006

    2001-01-01

    Tulistamisskandaali osaline ja tunnistaja R. Lepikson kirjeldab 1999.a. mais Nursis peaminister M. Laari jt. tulistamist E. Savisaare foto pihta. Vt. samas Peaministri intervjuu TV 3-s ja peaministri avaldus

  16. Kirjastus JI esitles uusi raamatuid / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2009-01-01

    18. veebr. Kirjanike Majas Tallinnas esitleti luulekogusid: Kaus, Jan. Miniatuurid ; fs. Alasti ja elus ; Aru, Toomas F. Tahaks keppi Jääääre saatel, ehk, Georges Charles de Heeckeren d’Anthèsi pihtimus (Pärnu : Jumalikud Ilmutused, 2009)

  17. Estonia : a tie in elections / Kaarel Lahe

    Lahe, Kaarel

    2003-01-01

    Autor analüüsib Eesti parlamendivalimiste tulemusi, Res Publica edu võimalikke põhjusi ning prognoosib loodava valitsuskoalitsiooni võimalikke osapooli. Diagramm. Vt. samas: Res Publica - a repetition of the Latvian case?

  18. Vibujahist nii ja naa / Kaarel Roht

    Roht, Kaarel, 1949-

    2005-01-01

    20. oktoobril korraldas Soome Jahimeeste Keskliit koos Soome Vibulaskurite Seltsiga riigi jahindusametnikele Laitiala Õppekeskuses ühepäevase seminari, tutvustamaks ja reklaamimaks jahipidamist vibuga

  19. Friikide kuningas Johnny Depp / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2011-01-01

    USA filminäitlejast Johnny Deppist (John Christopher Depp II), tema loomingust ja tulevikuplaanidest. Režissöör Rob Marshalli filmist "Kariibi mere piraadid 4: võõrastel vetel" (USA, 2011), Johnny Deppi osatäitmisest filmis

  20. Pilistvere rehehoones tapetakse Rasputin / Kaarel Aluoja

    Aluoja, Kaarel

    2008-01-01

    7. aug. Pilistvere vanas rehehoones esietendunud Ain Saviaugu kirjutatud ja lavastatud suvetükist "Rasputin". Suvelavastuse tõi välja Põltsamaa Teater Ellunäod koos professionaalsete näitlejatega. Nimiosas mängib näitlejast riigikogulane Indrek Saar

  1. Langevarjurid ja Pekingi part / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2010-01-01

    Kahest lühifilmist, mis linastusid 14. detsembril kinos Sõprus. Mihkel Soe dokumentaalfilmist ekstreemsportlasest Toomas Taltsist "3. 2. 1 - ilus hüpe" ja Kristin Kalamehe lühikomöödiast "Pekingi part"

  2. Diffusie van zout en water bij het zouten van kaas

    Geurts, T.J.

    1972-01-01

    In experiments on the brining of cheese, displacement of salt in cheese could be adequately described by a diffusion process. A simple model on the structure of the cheese matrix (fat globules and protein), allowing for friction and labyrinth effects, explained the lower value for the pseudo

  3. Res Publica soovib riigikogulaste kuluhüvitiste korra muutmist / Siim-Valmar Kiisler ; interv. Kalle Muuli

    Kiisler, Siim, 1965-

    2003-01-01

    Res Publica saadikud teevad Riigikogu juhatusele ettepaneku muuta kuluhüvitiste korda, teatas intervjuus Res Publica saadikurühma esimees Siim-Valmar Kiisler. Kommenteerivad: Jaanus Männik, Toomas Varek. Vt. samas: Riigikogu liikmete vastuseid küsimustele tööga seotud kulude kohta: Robert Lepikson, Reet Roos, Janno Reiljan

  4. Jungi salajane teos toodi seifist lagedale / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2009-01-01

    Carl Gustav Jungi Esimese maailmasõja järel kirjutatud teose "Liber Novus" käsikiri pannakse välja New Yorgi Rubini muuseumis. Samal päeval ilmub teos ka inglise ja saksa keeles raamatupoodidesse (kirjastaja W. W. Norton&Company)

  5. Andres Rõhu: kujundaja metsast / Andres Rõhu ; intervjueerinud Kaarel Kressa

    Rõhu, Andres, 1965-

    2010-01-01

    Maalikunstnik Andres Rõhu sellest, kuidas temast sai raamatute kujundaja, parematest enda kujundatud raamatutest, südamelähedasematest eesti raamatukujundajatest, maal elamise eelistest. Loetletud A, Rõhu kujundatud teoseid

  6. Animated Dreamsi festivali parimad said eile auhinnad / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2010-01-01

    12. animafilmide festivali Animated Dreams grand prix' pälvis Kei Oyama film "Käeseep" (Jaapan, 2008). Parima disaini preemia sai Jonas Odelli "Tussilago" (Rootsi, 2010). Parima loo jutustas Olga ja Priit Pärna "Tuukrid vihmas" (Eesti, 2009). Teistest preemiatest

  7. Prima Vistale tuleb tuntud kirjanikke mitmest Euroopa riigist / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2010-01-01

    Prima Vista kirjandusfestivali külalisi: Leonie Swann, Attila Bartis, Dmitri Bõkov, Zinaida Lindén, Mihhail Šiškin, Fay Weldon, Jason Goodwin, Rosa Maria Rodríguez Magda, Inga Gaile, Juris Kronbergs, Guntars Godinš, Liana Langa

  8. "Polli päevikud" ei vaimusta kriitikuid / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2010-01-01

    Eestlaste kaasosalusel vändatud režissöör Chris Krausi filmi "Polli päevikud" vastuvõtust Toronto rahvusvahelisel filmifestivalil. Kriitik Dan Fainaru arvamusest. Suurem osa "Polli päevikutest" filmiti 2009. a. suvel Pärnumaal Varbla vallas. Meespeaosalist kehastab Tambet Tuisk

  9. Eesti noored tulid harrastusfilmide festivalilt kolme karva medalitega / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2010-01-01

    Šveitsis Einsiedelnis toimunud 72. rahvusvahelisel sõltumatute filmide festivalil UNICA võitis kuldmedali Andrew Bond Balti Filmi- ja Meediakoolist lühimängufilmiga "Vene suurus", hõbemedali Vallo Toomla Balti Filmi- ja Meediakoolist lühimängufilmiga "Koolja" ja pronksmedali Katre Haav Eesti Kunstiakadeemiast animafilmiga "Valel poolel". Riikide arvestuses saavutas Eesti filmikava teise koha. 2011. a. ekraanile jõudvast Andrew Bondi lühifilmist "Legend vägevast seebist"

  10. Demokraatiahariduse ideaalide saavutamise võimalused / Kaarel Haav

    Haav, Kaarel, 1946-

    2009-01-01

    Meie ühiskonnaõpikutes toonitatakse, et kõikidel inimestel on võrdsed õigused, kuid jäetakse märkimata, et need võrdsete õigustega inimesed kuuluvad eri sotsiaalsetesse struktuuridesse, mis muudavad nende võimalused ebavõrdseks

  11. Uus Harry Potteri film noolib rekordeid / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2010-01-01

    19. novembril 2010 esilinastub Eestis Harry Potteri sarja uue filmi "Harry Potter ja surma vägised" (USA, Suurbritannia, 2010) 1. osa, režissöör David Yates. Filmi juba näinud kriitikute arvamusest. Filmi 2. osa linastub 2011. a. juulis

  12. 3 ilusat naist PÖFFi kavas / Kaarel Kuurmaa

    Kuurmaa, Kaarel

    2010-01-01

    14. Pimedate Ööde filmifestival: Euroopa Filmiakadeemia parima naisnäitleja auhinnale kandideerivad Zrinka Cvitešic "Teel" (Bosnia-Herzegovina jt. 2010), Sibel Kekilli "Võõras" (Saksamaa 2010) ja Lotte Verbeek"Ei midagi isiklikku" (Iiri-Holland 2009)

  13. Gerard Corbiau filmide peategelane on muusika / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2006-01-01

    Tallinna Kinomajas toimus 3.- 4. oktoobril Eesti Kinoliidu ja Balti Filmi- ja Meediakooli üritus, kus näidati nelja belgia režissööri Gerard Corbiau' mängufilmi "Muusikaõpetaja" (1987), "Farinelli" (1994), "Kasvamine" (1990) ja "Kuningas tantsib" (2000). Kohal olid ka režissöör abikaasaga ning filmide stsenarist Andree Corbiau

  14. Kakskümmend kuus tankisti ja meer / Kaarel Tarand

    Tarand, Kaarel, 1966-

    2005-01-01

    Et Riigikogu liikmed ei tohi enam paralleelselt kohalikes omavalitsustes töötada, hakkab nende asendusliikmetena Tallinna volikogus tööle massiliselt isikuid, kellest laiem avalikkus peale nende erakondliku kuuluvuse midagi ei tea

  15. Uued filmid: õiglus, õilsus ja maagiline kiiker / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2011-01-01

    Viru keskuse Katusekinos esilinastub 30. juunil Jaak Kilmi ja Kiur Aarma "Mattise martüürium". Lõppesid Eesti-Soome koostööptojekti "Rat King" võtted. Lõpevad Eesti-Läti-Valgevene ühistöö, "Peeter Simmi "Üksiku saare" võtted. Sellel aastal peaksid algama Ain Mäeotsa filmi "Deemonid", Kadri Kõusaare filmi "Euroopa psühho", Hardi Volmeri filmi "Remont" ja Kanadas Tanel Toomi filmi "Black Ice" võtted

  16. Tappa võib, pilgata mitte / Kaarel Tarand

    Tarand, Kaarel, 1966-

    2006-01-01

    Kunsti ja Taani ajalehes "Jyllands-Posten" avaldatud prohvet Muhamedi pilapiltide jõust, poliitilisest kunstist. Euroopas ja muhameedlikus maailmas toimuv on karikatuurizhanri vajalikkuse indikaator, hea argument, et "Sirbis" uuesti karikatuure avaldada

  17. Gazprom - lõks Venemaale endale / Kaarel Tarand

    Tarand, Kaarel, 1966-

    2006-01-01

    Hans Rebase Euroopa Instituudi korraldatud konverentsil tõdeti muu hulgas, et mida ulatuslikumalt Venemaa ainult ühele kaardile - maagaasile - mängib, seda hukatuslikum see talle on. Julgustades ja finantseerides laenudega Gazpromi arendamist, ehitatakse Venemaast multifunktsionaalset riiki, mille kogu elu sõltub ühe tööstuse tegevusest, ütleb autor

  18. Silvio Berlusconi kosib Juhan Partsi pimedast peast / Kaarel Tarand

    Tarand, Kaarel, 1966-

    2003-01-01

    EL-i eesistujamaa Itaalia ei esitanud tähtajaks kompromissettepanekuid EL-i uue põhiseaduse kohta, mis seab keerulisse olukorda Itaalia peaministriga kohtuva Eesti peaministri Juhan Partsi. Euroopas kritiseeritakse Itaalia kui eesistujamaa tegevust. Lisa: Eesti viis olulist nõudmist

  19. Klaasikunstnik Eili Soon austab traditsiooni / Eili Soon ; intervjueerinud Kaarel Kressa

    Soon, Eili, 1984-

    2009-01-01

    Eili Soon oma valmivast doktoritööst Kesk-Eesti klaasikodadest, üle-eestilisest õpilaste kunstikonkursist "Minu klaas", mille korraldamise eest Eili Soon pälvis 2008. a. Eesti Kultuurkapitali aastapreemia, haridusprogrammi koostamisest Järvakandi Klaasimuuseumile, tööst Järvakandi klaasistuudios, oma õpetajatest ja eeskujudest

  20. Pöffihunt ulub juba 15. korda / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2011-01-01

    15. Pimedate Ööde Filmifestivali tutvustus. Põhiprogrammist, filmiturust, animafilmide festivalist Animated Dreams, laste- ja noortefilmide festivalist Just Film. Elutööpreemia saavad Rein Raamat, Rein Maran, Aleksandr Sokurov ja Fridrik Thor Fridriksson

  1. Maailm on suur ja lunastus luurab nurga taga / Kaarel Kuurmaa

    Kuurmaa, Kaarel

    2008-01-01

    12. PÖFFi filme - "Maailm on suur ja lunastus luurab nurga taga" ("The World is Big and Salvation Lurks Around the Corner") : režissöör Stephan Komandarev : Bulgaaria - Saksamaa - Ungari - Sloveenia 2008

  2. Kuldsõduri ja ufo invasioon / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2010-01-01

    Kristina Normani isikunäitus "Me ei ole universumis üksi" Tallinna Kunstihoones 10. aprillist 9. maini 2010. Näitus hõlmab kunstniku loomingut aastatest 2007 - 2010. Installatsioonist "After-War" ja kunstiteosest, mille aluseks on ufomälestusmärk Padisel Pae külas Poosimatsi talus

  3. Kriminaalne tõsieluteos võitis preemia / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2008-01-01

    Kate Summerscale'i raamat "The Suspicions of Mr Whicher: or The Murder at Road Hill House" ("Härra Whicheri kahtlusalused ehk Road Hill House'i mõrvajuhtum") 1890. aastal toimunud tapmise uurimisest võitis Samuel Johnsoni nimelise dokumentaalkirjanduse auhinna (Samuel Johnson Prize for Non-fiction)

  4. Taanlastest saab Türgi trump / Kaarel Tarand

    Tarand, Kaarel, 1966-

    2006-01-01

    Türgi pakub end lääne ja islamimaailma peavahendajaks tsivilisatsioonide kokkupõrke ärahoidmiseks. Kui Türgi diplomaatial õnnestub pingeid leevendada, on Euroopal tema ees tänuvõlg, mida saab tasuda ainult EL-i liikmeks vastuvõtmisega, ütleb autor. Muhamedi karikatuuride avaldamise käsitlemisest Eestis

  5. Kulka kroonis aasta kümme sulesangarit / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2010-01-01

    Eesti Kultuurkapital kirjanduse sihtkapitali aastaauhinnad: parim ilukirjanduslik proosateos Kalev Kesküla "Elu sumedusest", parim luulekogu Hasso Krull "Neli korda neli", esseistika kogumik Jaan Kaplinski "Paralleele ja parallelisme", vabaauhind Jaan Unduski koostatud Friedebert Tuglase teoste kogumik "Valik proosat", parim lasteraamat Mika Keränen "Peidetud hõbedane aardelaegas", parimad tõlked: Piret Salurilt (Mika Waltari "Sinuhe"), Jean Pascal Ollivry Tammsaare tõlked (Veritee et Justice : La Collin-du-Voleur ; Indrek)

  6. Noored rakendusökoloogid: taimedele meeldib ambient / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2010-01-01

    Aednikud Jan Pankovits ja Deniss Vinogradov rajavad Tallinna Kultuuritehase Polymer katusele aeda. Noorte tegevuse majanduslikku ja juriidilist külge aitab koordineerida Sillamäel paiknev MTÜ Rakendusökoloogia Keskus

  7. Häirekellamees magas jälle / Kaarel Tarand

    Tarand, Kaarel, 1966-

    2006-01-01

    Autori sõnul poleks ilmselt olnud raske keelata tankeril Probo Koala siseneda Eesti territoriaalvetesse ning saabuda Paldiski sadamasse kuni Aafrikas toimunu asjaolude selgumiseni. Põhiküsimus on selles, kuidas Eesti ennast võõrast päritolu keskkonnakonfliktide eest ennetavalt ning neisse sattudes efektiivselt kaitsta saab

  8. Autod ja alkohol poliitika peaväljakul / Kaarel Tarand

    Tarand, Kaarel, 1966-

    2007-01-01

    Autor leiab, et Eesti on muutumas ühiskonnaks, kus tegeldakse vaid ühe probleemiga korraga ja toob näiteid selle kohta, kuidas poliitikud võiksid avalikult arutleda ja muudatusi seadustes teha selleks, et see pälviks ka heakskiidu ja sellest oleks kasu

  9. "Puhastuse" esimesed osatäitjad teada / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2011-01-01

    Eesti-Soome koostöös valmiva Antti Jokise filmis "Puhastus" mängib vana Aliidet Liisi Tandefelt, Aliidet nooruspäevil Laura Birn, Hansu Peter Franzén, Martinit Tommi Korpela, Aliide vanemaid Anne Reemann ja Elmo Nüganen

  10. Kolu mõis kaardilt ei kao / Kaarel Aluoja

    Aluoja, Kaarel

    2003-01-01

    Kolu külavanem ja sealse mõisa töödejuht Ülo Ormus näeb majandusraskustes vaevleva Concordia eraülikooli rektorile Mart Susile esitatud süüdistustes poliitilist survet. Kommenteerib haridusminister Mailis Rand

  11. Tanel Toom: teen seda, mida armastan / intervjueerinud Kaarel Kressa

    Toom, Tanel, 1982-

    2011-01-01

    Eesti režissöör Tanel Toom oma lühifilmist "Pihtimus", mis kandideeris parima lühifilmi kategoorias Oscarile, oma filmidest ja tulevikuplaanidest, lemmikutest tänavuste Oscari-nominentide hulgas, Oscarile kandideerimise tähtsusest

  12. De hydrolyse van vet bij de kaasrijping in verband met de smaak van kaas

    Stadhouders, J.J.

    1956-01-01

    Fatty acids are important as constituents of cheese flavour. In cheese made from raw milk, milk lipase probably hydrolyses cheese fat to some extent, but cheese made from aseptically drawn milk shows no piquant flavour.
    It was established that during ripening no active lipase was formed inside

  13. Religiooni kaas- ja kõrvalnähud Tartus / Andris Feldmanis

    Feldmanis, Andris, 1982-

    2007-01-01

    Tartu vabaõhu filmifestivaliga "Tartuff - armastuse mitu nägu" paralleelselt toimub rahvusvaheline konverents "Religioonitolerants - võimalus, kohustus, vastutus", millega kaasneb dokfilmide programm Athena keskuses. Artiklis tutvustatakse filme "Jeesuse laager", "Koputus", "Kuradi mängumaa". Lisatud soovitus "Muusikal "Ükskord" tARTuFFil"

  14. Onderzoek naar de gehalten aan dioxinen in monsters kaas van een melkveebedrijf te Maassluis (Lickebaertgebied)

    Liem AKD; de Jong APJM; Marsman JA; den Hartog RS; Hijman WC; den Boer AC; Hoogerbrugge R; Kootstra PR; van ' t Klooster HA

    1990-01-01

    This report describes the results of a study on the occurrence of the seventeen toxic polychlorinated dibenzo-p-dioxins and dibenzofurans in eight cheese samples of cheese from a dairy farm at Maassluis, in the Lickebaert area. The corresponding cheese batches were produced at different times in

  15. Kirjanik sõdib ühe raamatu avaldamise poolt ja teise vastu / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2008-01-01

    Ameerika kirjastuse Random House otsusest loobuda Sherry Jonesi romaani "Jewel of Medina" avaldamisest ning Salman Rushdie kohtuasjast teda solvanud Ron Evansi raamatu "On Her Majesty's service" vastu

  16. UNESCO maailmapärand täienes / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2010-01-01

    UNESCO maailmapärandi komitee lisas 3. augustil Brasiilias lõppenud istungil maailmapärandi nimekirja 15 kultuuri-, viis loodus ja ühe segamälestise (loetletud). Praegu on nimekirjas 911 paika 151 riigist. Esimest korda osales komitee töös Eesti delegatsioon Mart Kalmu juhtimisel

  17. Uus nobelist : prantslane Jean-Marie Gustave Le Clézio / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2008-01-01

    Nobeli kirjandusauhind 2008 - prantsuse romaanikirjanik Jean-Marie Gustave Le Clézio. Sisaldab autori eesti keelde tõlgitud teoste annotatsioone: Päev, mil Beaumont tegi tutvust oma valuga : [novell] / tlk. Merike Riives (kogumikust Prantsuse novell, 1973); Kõrb / tlk. Kristiina Ross (Eesti Raamat, 1990); Diego ja Frida / tlk. Sirje Keevallik (Kunst, 2007)

  18. Viasati tasuta digi-tv Kinobuss külastab Antslat / Kaarel Kutti

    Kutti, Kaarel

    2009-01-01

    Viasat Digi-TV Kinobussi tuuri raames jagatakse infot digitelevisioonile ülemineku kohta ja näidatakse viimastel aastatel valminud eesti kvaliteetfilme. Projekt toimub Viasati ja MTÜ Kinobuss koostöös

  19. Looma koht on džunglis, inimese koht tsirkuselaval / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2011-01-01

    5.-13.08.2011 Tallinnas Kadrioru pargis ja Kumu auditooriumis esimest korda toimuvast rahvusvahelisest uue tsirkuse festivalist "Tsirkusepuu". Sebastiano Toma oma trupi The Time Between Company lavastusest "The Time Between", traditsioonilise ja tänapäevase tsirkuse erinevusest. Festivali kava

  20. Eestlaste kannatustest pajatavast menuromaanist "Puhastus" vändatakse põnevusfilm / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2011-01-01

    Sofi Oksaneni romaanil "Puhastus" põhinev film valmib Taska Filmi (Eesti) ja Solar Filmsi (Soome) koostöös soomekeelsena, filmivõtted toimuvad Eestis. Režissöör Antti Jokinen, stsenaristid Antti Jokinen ja Marko Leino

  1. Põhjalik koguteos Rootsi võidust / Kaarel Vanamölder

    Vanamölder, Kaarel, 1981-

    2015-01-01

    Arvustus: Enn Küng, Margus Laidre, Ivar Leimus, Aivar Põldvee, Anti Selart, Marten Seppel, Kai Tafenau, Ülle Tarkiainen, Enn Tarvel. Eesti ajalugu III: Vene-Liivimaa sõjast Põhjasõjani. Tartu : Tartu Ülikooli Ajaloo ja arheoloogia instituut, 2013

  2. Euroopa kultuuripealik 2011 (Tallinn) lõpuks leitud / Mikko Fritze ; interv. Kaarel Tarand

    Fritze, Mikko, 1963-

    2007-01-01

    Tallinn on Euroopa 2011. a. kultuuripealinn. Intervjuu korraldava sihtasutuse tegevjuhi Mikko Fritzega. Tegevusprogrammist, ka infrastruktuuri projektidest (linnateater, Kultuurikatel, rannapromenaad, lauluväljak, linnahall) jm. SA bürool on kavatsus kolida Kultuurikatlasse

  3. Tarantino film päästis produtsendid pankrotist / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2009-01-01

    Ameerika filmirežissööri Quentin Tarantino viimase mängufilmi "Vääritud tõprad" ("Inglourious Basterds") 200 miljoni dollarine kassatulu aitas kõiki Tarantino filme produtseerinud firma Weinstein Co. pankrotist välja

  4. Vennad Coenid jäid seekord sootuks ilma / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2011-01-01

    Filmidest, mis kandideerisid mitmes kategoorias Oscarile, kuid ei saanud ühtki auhinda või said oodatust vähem auhindu. Eesti režissööri Tanel Toomi lühifilm "Pihtimus" kandideeris Oscarile parima lühifilmi kategoorias, võitis Luke Matheny "God of Love" (USA, 2010)

  5. Kultuur ja geopoliitika / Immanuel Wallestein ; interv. Rein Raud, tõlk. Kaarel Tarand

    Wallestein, Immanuel

    2008-01-01

    Intervjuu Yale'i ülikooli professoriga, kes peatub teemadel, mis puudutavad Nõukogude Liidu kokkuvarisemist, võimalikku Kirde-Aasia alianssi, Venemaa edasist arengut, etnilisuse probleeme, Euroopa kultuurilist hoiakut ja poliitilist integratsiooni

  6. Oscarid läksid Euroopa näitlejaile / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2008-01-01

    80. Oscarite galast. Joel ja Ethan Coeni mängufilm "Ei ole maad vanadele meestele" ("No Country for Old Men") võitis neli auhinda (parim film, režii, stsenaarium, meeskõrvalosa). Kõik näitlejaauhinnad läksid Euroopa näitlejatele. Lisatud võitjate nimekiri

  7. Eesti Päevaleht esitleb Eesti esimest iPhone'i-raamatut / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2009-01-01

    29. detsembril esitleb Eesti Päevalehe raamatukirjastus Solarise keskuse EMT poes e-raamatut "Milana. Eesti modelli päevik", esimest eesti raamatut, mida Apple'i nutitelefoni iPhone omanikud saavad e-poe App Store kaudu osta ja telefoni salvestada. Projekti üks osanik on EMT

  8. Archaeological excavations in Ihaste, Tartu / Tanel Moora, Rünno Vissak, Kaarel Jaanits

    Moora, Tanel, 1938-

    2006-01-01

    Ihastes pöörati koos arheoloogiliste kaevamistega suurt tähelepanu ka mullatekkeprotsesside väljaselgitamisele. Tulekivist leidudest. Kiviaja asulakohast säilmeid ei leitud, 2005. aasta kaevamistega hõlmatud ala on õigem nimetada asula perifeeriaks või tulekivi leiu- ja töötlemiskohaks

  9. Film, mis mõjub / Anne Applebaum ; tõlk. Kaarel Tarand

    Applebaum, Anne

    2008-01-01

    Ajalehes The New York Review of Books (14. II) ilmunud artikkel poola režissööri Andrzej Wajda filmist "Katõn", mis räägib Katõni massimõrvast. Andrzej Wajda pälvis sel aastal Eesti presidendilt Maarjamaa Risti III klassi teenetemärgi

  10. Tiit Ojasoo: mida igatseb tänapäeva eestlane? / intervjueerinud Kaarel Kressa

    Ojasoo, Tiit, 1977-

    2011-01-01

    23. märtsil esietendub Nokia kontserdimajas NO99 lavastus"The Rise and Fall of Estonia", mis saab olema Eesti-teemaliste lavastuste tsükli lõpp. Teatri kunstiline juht Tiit Ojasoo uuest lavastusest, sellele eelnenud lavastusest "Ühtne Eesti suurkogu", NO99 teatrist, teatri tulevikuplaanidest

  11. 4300-eurone maja peab maavärinale vastu / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2011-01-01

    Maailma vaeste majutustingimuste parandamiseks püütakse Massachusettsi Tehnoloogiainstituudi arhitektuuriteaduskonnas välja töötada tuhandedollarise maja projekti. Hiinlasest tudengi Ying-chee Chui leiutatud Tuulerattamajast ("Pinwheel House"). Saviplokkidest ja bambusest moodulmaja peab vastu maavärinale

  12. Säärane meer ehk sada vakka heinaseemet / Kaarel Tarand

    Tarand, Kaarel, 1966-

    2006-01-01

    Haljasaladest Tallinna vanalinnas, haljasala rajamisest Harju tänava äärde, ehitustegevuse planeerimisest kaitseala põhimääruse järgi haljasalaks ettenähtud Skoone bastionile. Harju tänav tuleks hoonestada

  13. Filmitudengite lõputööde huumor : leebe, absurdne, must / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2006-01-01

    Homsel kinoseansil näidatakse nelja uut TLÜ filmi ja video õppetooli tudengite filmi : "Kaks enne ühte" (Laur Tõnurist), "Tulnukas ehk Valdise pääsemine 11 osas" (Rasmus Merivoo), "Konkurss" (Margus Paju), "Roosa kleit ja nahksed püksid" (Birgit Demidova)

  14. Võib minna valjuks, lahedaks, karmiks / Dannar Leitmaa, Mart Niineste, Kaarel Kressa

    Niineste, Mart, 1983-

    2009-01-01

    PÖff-i filmidest - nukufilm "Küla nimega Paanika" (rež. Stephane Aubier ja Vincent Patar; Belgia - Prantsusmaa), mängufilm "Ajami" (rež. Scandar Copti ja Yaron Shani; Saksamaa - Iisrael), muusikaline dokfilm "Võib valjuks minna" (rež. Davis Guggenheim; USA)

  15. The Subjective Right to Environment in the General Part of the Environmental Code Act / Kaarel Relve

    Relve, Kaarel, 1975-

    2016-01-01

    1. augustil 2014 jõustunud keskkonnaseadustiku üldosa seadusest. KeÜS §-st 23 tulenevast subjektiivsest igaüheõigusest keskkonnale ja selle täitmise eeldustest. Asjakohasest Euroopa Liidu ja rahvusvahelisest õigusest

  16. Kliimamuutus ajas ürginimese rändama / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2008-01-01

    DNA abil inimeste iidseid rändeteid uuriva projekti "Geneographic" teadlased kinnitasid seni teada olnud tõde, et kõik maailma rahvad on alguse saanud kunagi Aafrikast välja rännanud eellastest. Vastavasisulise loenguga esines Rahvusraamatukogus geeniteadlane Spencer Wells

  17. Füüsiliste isikute subjektiivne avalik õigus ja põhjendatud huvi keskkonnaasjades / Kaarel Relve

    Relve, Kaarel, 1975-

    2004-01-01

    Keskkonnaalase kaebeõiguse aktuaalsuse põhjustest Euroopa regioonis, subjektiivse avaliku õiguse ja põhjendatud huvi üldisest käsitlusest, peamistest argumentidest kaebeõiguse aluste ümberhindamiseks keskkonnasjades, suunistest keskkonnna valdkonnas nende aluste tõlgendamiseks

  18. Liisa Kruusmäe juhuslikult pealt kuuldud hetked / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2011-01-01

    Liisa Kruusmäe näitus "Overheard Stories / Pealtkuuldud lood" Tallinnas Draakoni galeriis. 2010. a. Eesti Kunstiakadeemia maaliosakonna lõpetanud Liisa Kruusmägi omandab EKA-s joonistamise alal magistrikraadi

  19. Kui Liisa kirjutas kirja... / Ulrike Plath, Kaarel Vanamölder

    Plath, Ulrike, 1972-

    2016-01-01

    Liisa Pulsti elusaatusest, maakogukonnast pärit vallasemast, kes andis oma kolm last lastekodusse ning kes hiljem Riia baltisaksa perekonnas muutus armastatud perekonnaliikmeks. Artikkel tutvustab Liisa poolt 1946. aastal kirjutatud kirja

  20. Reservsõjaväelasele Leo Kunnasele anti Stalkeri romaaniauhind / Kalev Kask, Kaarel Kressa

    Kask, Kalev

    2009-01-01

    Eesti Ulmeühingu Stalkeri-nimelised auhinnad jaotusid järgmiselt: algupärase romaani auhind - Leo Kunnas (romaani "Gort Ashryn" 1. osa "Enne viimast sõda"), algupärase jutu auhind - Indrek Hargla ("Minu päevad Liinaga", ilm. Looming, 2008, nr. 8), algupärase lühijutu auhind - Laur Kraft ("Ultima Cthule", ilm. võrguajakirjas Algernon), tõlkeromaani auhind - Sergei Lukjanenko ("Öine Vahtkond"), kogumiku auhind - Poul Anderson ("Taevarahvas"), tõlkejutu auhind - Paolo Bacigalup ("Flööditüdruk")

  1. Jahindus = Hunting / Jüri Tõnisson, Kaarel Roht, Peep Männil

    Tõnisson, Jüri, 1946-

    2007-01-01

    Jahimeeste poolt loendatavate ulukite arvukus ja küttimine. Statistilised andmed 1985-2005. aasta jahihooajast. Põdra arvukus ja küttimine 1960-2005. Erinevate jahiulukite populatsioonide seisund Eesti metsades. Tabelid, diagrammid, graafikud

  2. Jahindus = Hunting / Jüri Tõnisson, Kaarel Roht, Peep Männil

    Tõnisson, Jüri, 1946-

    2008-01-01

    Jahimeeste poolt loendatavate ulukite arvukus ja küttimine. Statistilised andmed 1985-2006. aasta jahihooajast. Põdra arvukus ja küttimine 1960-2006. Erinevate jahiulukite populatsioonide seisund Eesti metsades. Tabelid, diagrammid, graafikud

  3. Sotsioloogid räägivad TLÜ suvekoolis hirmust / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2011-01-01

    11. juulil alustab esimesi kursusi Tallinna ülikooli rahvusvaheline suveülikool Tallinn Summer School. Suvekooli peakursus on "Fear: Poetics and Practices", toimub ka sotsiaalturunduse, kommunikatsiooni ning ksenofoobia seoseid analüüsiv kursus. 22.-29 juulil õpetab suveülikoolis loovkirjutamist Kanada krimikirjanik Peter Robinson, kelle teoste aines kattub hirmukultuuri teemaga

  4. Keeleinimesed muretsevad inglise keele sissetungi pärast / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2007-01-01

    Kumu auditooriumis toimunud keelefoorumil arutati eesti keele tulevikuväljavaateid. Tallinna Ülikooli õppejõud Heli Mattisen osutas faktile, et toimumas on inglise keele hiiliv sulandumine kõrgharidusse. Mati Hindile tegi muret eestikeelse muusika vähesus riigiraadios

  5. Kivisildnik võttis järgmiseks hambusse Papa Jannseni / Sven Kivisildnik ; interv. Kaarel Kressa

    Kivisildnik, Sven, pseud., 1964-

    2006-01-01

    Seoses oma näidendi "Johann Woldemar Jannsen ehk Rahvavaenlase hind" esietendusega 16. mail L. Koidula Muuseumis Mart Viisitamme nimelise Pauerpointi Teatri esituses. Arvamusi Kivisildniku kohta avaldavad Berk Vaher ja Karl Martin Sinijärv

  6. Mürgisurma on lihtne vältida / Toomas Trapido ; interv. Kaarel Tarand

    Trapido, Toomas, 1972-

    2006-01-01

    Eestimaa Looduse Fondi suunajuht vastab küsimustele, mis puudutavad ohtlikke jäätmeid vedanud tankeri Probo Koala saabumist Eesti vetesse, Eesti võimude tegevust sellega seoses, Greenpeace'i tegevuse mõju Eesti keskkonnaorganisatsioonide mainele ja tegevusele

  7. Turg, firma ja partnerlus kui efektiivsete sotsiaalsete institutsioonide süsteem / Kaarel Haav

    Haav, Kaarel

    1999-01-01

    Bibliogr. lk. 85-87. - Kokkuvõte ingl. k. lk. 98. Triaad turg, firma ja partnerlus on tõhusate sotsiaalsete institutsioonide üldine ja täielik süsteem. Turg on majandusliku arengu vajalik ja piirav institutsioon lihtsas tootmises, firma on seda kapitalimahukas ja partnerlus - teadusmahukas tootmises

  8. Näidendivõistlusel triumfeeris taas kord Martin Algus / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2009-01-01

    Eesti Teatri Agentuuri näidendivõistlusel sai esikoha Martin Algus näidendiga "Postmodernsed leibkonnad", teise koha Siim Nurliku kirjatükk "Kas ma olen nüüd elus" ja kolmanda koha Loone Otsa töö "Libuhunt"

  9. Minge vaadake väärtfilme / Andres Laasik, Kaarel Kressa

    Laasik, Andres, 1960-2016

    2008-01-01

    !". PÖFFi filme - Leedu mängufilm "Kui ma olin partisan" ("Kai as buvau partizanas"), režissöör Vytautas V. Lansbergis ja Mehhiko - Hispaania mängufilm "Tsoon" ("La Zona"), režissöör Rodrigo Pla

  10. Siim Nestor soovitab : Sola Muusika / Siim Nestor

    Nestor, Siim, 1974-

    2005-01-01

    Üritusel Sola Muusika 25. veebr. Tallinna vanalinna kohvikus Kehrwieder esinevad austraalia muusik Electroteque, shoti artist Unknown Forces ja soome muusik Good Doc, plaate mängivad Taavi Laasit, Kaarel Kattai ja Kaarel Kirikmäe

  11. [Connecting the Baltic area : the Swedish postal System in the seventeenth century] / Kaarel Vanamölder

    Vanamölder, Kaarel, 1981-

    2011-01-01

    Arvustus: Connecting the Baltic area : the Swedish postal System in the seventeenth century. Ed. by Heiko Droste. Södertörn Studies in History, 9, Södertörn Academic Studies, 42 (Huddinge: Södertörns högskola, 2011)

  12. Ökoküla on nähtamatu / Jonathan Dawson ; tõlk. Kaarel Kressa

    Dawson, Jonathan

    2008-01-01

    Ökoküla ei tähenda üksnes tuulegeneraatoreid ja murukatuseid. Ökokülas on vähemalt sama tähtis, kuidas inimesed omavahel ja loodusega suhtlevad, seletab ülemaailmse ökokogukondade võrgustiku president Jonathan Dawson Shotimaa Findhorni ökokülast

  13. Iisraeli ja Palestiina juhtide uus põlvkond toodab ainult vanu ideid / Tariq Ramadan ; tõlk. Kaarel Kressa

    Ramadan, Tariq

    2006-01-01

    Hoolimata nii Iisraeli kui ka Palestiina juhi vahetumisest on rahuprotsess katkenud ning Palestiina on lähedal sisemisele plahvatusele. Autori arvates ei ole rahu Iisraeli ja Palestiina vahel võimalik, kui nad jäetakse ilma vahendajateta vastamisi; Euroopa juhid peaksid sekkuma ja pakkuma mõne uue lähenemise

  14. Public governance institutions and their impact on delocalisation of labour intensive industries with evidences from Estonia / Kaarel Kilvits, Alari Purju

    Kilvits, Kaarel

    2007-01-01

    Hargmaiste ettevõtete tootmise üleviimine ühest riigist teise on muutumas tähtsaks teemaks erinevates majandusharudes. Ala, kus kohtuvad ettevõtete majanduslikud huvid riigi poliitiliste eesmärkidega, on tööturu regulatsioon, otseste välisinvesteeringutega seotud probleemid, väliskaubanduse olukord, innovatsioon, maksundus ja riigi toetus. Tööstuspoliitikat, tööturu suhteid, välisinvesteeringuid mõjutavate protsesside kontseptsioonid Eesti elektroonika ning rõiva- ja tekstiilitööstuse näitel

  15. Homer Simpson : kui millegi tegemine nõuab vaeva, pole see vaeva väärt / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2007-01-01

    21. juulil on joonisfilmi "Simpsonite film" ("The Simpsons Movie") maailmaesilinastus. Seriaali sünnist (loojaks Kanada päritolu Matt Groening) ja selle populaarsuse fenomenist. Lisaks tutvustus "Homer Simpson", sõnum "Simpsonite sünnilugu" ja "Tsitaate"

  16. Korrakaitse üldvolituse koosseis Saksa õiguses ja Eesti korrakaitseseaduse eesnõus [eelnõus] / Kaarel Eller

    Eller, Kaarel

    2007-01-01

    Korrakaitseseaduse eelnõu paragrahvidega 24 ja 25 loodavast korrakaitse üldvolituse instituudist Eestis võrreldes Saksa korrakaitseõiguse üldvolitusega. Üldvolituse koosseisus nimetatud kaitsehüvedest ja ohu mõistest

  17. Max Jakobson : Vene ohtu täna veel pole / Max Jakobson ; interv. Vallo Toomet, Urmet Kook, Kaarel Tarand

    Jakobson, Max, 1923-2013

    2003-01-01

    Balti riikide NATOga liitumise mõjust julgeolekule Läänemere regioonis, Euroopa Liidu kaitsepoliitikast ning Venemaa ja islamiterrorismi ohust julgeolekule. Vt. samas: Toomas Hiio ülevaade Max Jakobsoni elust ja tegevusest

  18. Influence of Article 9 (3) of the Aarhus Convention on legal standing in Estonian administrative courts / Kaarel Relve

    Relve, Kaarel, 1975-

    2009-01-01

    Aarhusi konventsioonist (Keskkonnainfo kättesaadavuse, keskkonnaasjade otsustamises üldsuse osalemise ja neis asjus kohtu poole pöördumise konventsioon) ja selle art. 9 (3) mõjust Eesti halduskohtutele

  19. Soovitus: täna PÖFF-il / Erik Aru, Dannar Leitmaa, Tanel Veenre, Mart Niineste, Kaarel Kressa

    Aru, Erik

    2009-01-01

    PÖff-i mängufilmidest - "Emma Blanki viimased päevad" (rež. Alex Van Warmerdam ; Holland), "Laul Tšingis-khaani kahest hobusest" (rež. Byambasuren Davaa; Saksamaa), "Calamari Union (Remake)" (rež. Richard Lefebvre ; USA), "Raev" (rež. Sally Potter ; Suurbritannia - USA), "Contact High" (rež. Michael Glawogger ; Austria - Saksamaa - Poola - Bulgaaria)

  20. Hinge(ga) Brand - tõhusaim relv mõrtsukate ja varaste vastu / Hinge Brand ; interv. Kaarel Kressa

    Brand, Hinge, 1940-2007

    2006-01-01

    Intervjuu 40 aastat prokuröriametit pidanud ja pensionile siirduva Hinge Brandiga. Lisatud: Hinge Brandi CV ning Põhja ringkonnaprokuratuuri erisasjade prokuröri Jüri Kasesalu, siseministeeriumi arendusjuhi Lauri Taburi ja keskkriminaalpolitsei politseijuhtivinspektori Margus Maasepa kommentaarid

  1. Archaeological test excavations at the mesolithic and iron age settlement site Jägala-Joa IV / Aivar Kriiska, Kaarel Sikk

    Kriiska, Aivar, 1965-

    2014-01-01

    Jägala jõe alamjooksul on mitmeid eriaegseid muinasjäänuseid. Vanim neist on Jägala-Joa IV asulakoht. Mesoliitiline asustuskoht annab tuge hüpoteesile, et Eesti rannikuala asustamise esimesel etapil ei asunud elupaigad vahetult mererannal, vaid veidi kaugemal jõgede kallastel ja tööriistu valmistati sellel ajal üldiselt tulekivist

  2. Kohus keelas Kõusaare Cannes'i pääsenud filmi näitamise Eestis / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2007-01-01

    Cannes'i filmifestivali kavas "Un certain regard" on tänavu ka Kadri Kõusaare mängufilm "Magnus" : produtsent Donald Fernandes : Eesti (Vitamin K Film) - Suurbritannia (Donus Films Limited). Filmi levitamisõigusega seotud kohtumäärusest

  3. Näidendivõistluse võitis lugu buumijärgsest ängist / Kaarel Kressa

    Kressa, Kaarel, 1983-

    2011-01-01

    Eesti teatriagentuuri näidendivõistluse võitis Piret Jaaks näidendiga "Näha roosat elevanti", teise koha said Jan Rahmani "Lell" ja Donald Tombergi "Andmed Liina Pihlapuust" ning kolmanda koha Paavo Piik "Keti lõpp" ja Kadri Noormets "GO NEO UND ROMANTIX". Lühinäidendi eripreemia läks Küllike Veedele "Puudutamata" eest

  4. Autentsete tunnete kunstifestival : Tartus toimunud multikultuurifestival "Ground Rush" otsis tugevat ja autentset tunnet / Kiwa

    Kiwa, pseud., 1975-

    2001-01-01

    Festival toimus Tartu Kõrgema Kunstikooli väljaehitamata osas. Enamasti tundmatute kunstnike ja kooliõpilaste loodud kohaspetsiifilised ja ruumiinstallatsioonid. Tuntud kunstnikest Kaarel Kurismaa ja Paul Rodgers

  5. Eesti õppejõudude lühielulood

    1991-01-01

    Ekslikult Ernst Kilksoni sünniaasta siin artiklis 1891, Kaarel Kirde sünniaasta 1893, Kaarel Martini surma-aasta 1953, Aleksis Ostrati sünniaasta 1916, Sergei Uusna puhul pole teada, milline surma-aasta õige on

  6. Gümnaasiumi trükkal ja keskvõimu korralduste publitseerimine 17. sajandi lõpu Tallinnas / Kaarel Vanamölder

    Vanamölder, Kaarel, 1981-

    2011-01-01

    Trükkal Christoph Brendekenist. Trükkali sissetulekutest ja töö est küsitavast tasust. Plakatite tiraažist. Kindralkuberneri kantselei publitseerimisrutiinist ning korralduste edastamise kiirusest

  7. Lääne ideaalid Venemaa tõlgenduses : ettevõtjate tootmine siirdeajal / Oksana Shmuljar Green ; tõlk. Kaarel Tarand

    Shmuljar Green, Oksana

    2008-01-01

    Venemaal tekkinud uuest majandusühiskonnast, mis ei ole enam allutatud Nõukogude riigile nagu enne 1985. aastat, kuid mis pole ka enamikes lääneriikides tuntud kapitalistlik ühiskond. Lääne tegevuse kolmest mõõtmest Venemaa ümberkujundamisel: siirde diskursus, lääne investeeringud ja eraettevõtluse käivitamine

  8. Ülevaated : [Eesti Rahva Muuseum 2015] / ERMi tegevuse ülevaated on kirjutanud Agnes Aljas, Kaarel Tarand, Sirle Puusepp ... [jt.

    2016-01-01

    Eesti Rahva Muuseumi aastaaruanne. Ülevaade uue hoone ehitusest, ettevalmistustest avamiseks, kolimisest, majandustegevusest, teadustööst, kogude osakonnast (esemekogud, raamatukogu, arhiiv, filmi- ja videokogu, fonoteek, fotokogu), säilitus- ja konserveerimisosakonnast, väljaannetest, näitustest, ERM-i näitusemajast, ERM-i Postimuuseumist, ERM-i Heimtali muuseumist, programmist, Rahvakultuuri nõuandekeskusest, muuseumiõppest, ERMi Sõprade Seltsist ja omakultuuride osakonnast.

  9. Kuidas kurat Niguliste kirikut vaatas ehk põnevad leiud Tallinnas Niguliste 6 / Jüri Türkei, Kaarel Truu

    Türkei, Jüri

    2016-01-01

    Niguliste 6 on Tallinna vanalinnale omane mitmes järgus ehitatud kaupmeheelamu. 2015. aasta uuringute käigus avati uuesti kõik huvipakkuvad piikonnad. Taasavastati dornse paarisakna sillust toetanud paesammas, millel on voluutidest välja kasvav kuradinägu

  10. Kunst.ee toimetaja: tihti mõistame teose väärtust üksnes tagantjärele / Andreas Trossek ; intervjueerinud Kaarel Kressa

    Trossek, Andreas, 1980-

    2009-01-01

    Eesti kunsti ja visuaalkultuuri ajakirja Kunst.ee peatoimetaja ajakirja toimetusepõhisele töömudelile üleminekust, ajakirja sisulistest ja vormilistest muudatustest. Kunstikriitika mahu vähenemisest Eesti meedias. Kunstnike teostest, mida iseloomustab julgus püstitada ebamugavaid küsimusi, Kristina Normani "Kuldsõdurist"

  11. Jim Ashilevi jõuab 22-aastaselt kõike. Millele ta pidama jääb? / Jim Ashilevi ; interv. Kaarel Kressa

    Ashilevi, Jim, 1984-

    2006-01-01

    Kirjanik, kelle näidendit "Nagu poisid vihma käes" valmistub lavale tooma "Endla" teater, audiovisuaalset meediat õppiv TLÜ tudeng, kel valmimas bakalaureusetööna situatsioonikomöödiaseriaali "Sireenid" pilootseeria

  12. Purpurmust Org : Urmo Mets, Allar Lepa, Martin Vabat, Marje Ingel, Carolina Pihelgas, Siim Kera, Hanna Kangro, Kaarel B Väljamäe

    2008-01-01

    Sisu: Kultuurinartsiss; "lugesin enne roostet..." ; Eravaldus ; "riik nagu..." ; "Novembri lõpu õunapuud..." ; Mis siin ikka ; "su selgroog..." ; "hommikuti jääb pori kingatalla alla..." "lauale seisma jäänud sibul haiseb nagu venelase higi..."

  13. Demokraatia ja finantsstabiilsus. Õiguskantsleri taotlus Euroopa stabiilsusmehhanismi asutamislepingu artikli 4 lõike 4 põhiseadusele vastavuse kontrollimiseks / Kaarel Eller

    Eller, Kaarel

    2012-01-01

    Olulisematest põhjustest, miks õiguskantsler seab kahtluse alla Euroopa stabiilsusmehhanismi asutamislepingu (ESMAL) artikli 4 lõike 4 põhiseadusele vastavuse. Vastuväidetest, mida esitasid nimetatud põhiseaduslikkuse järelevalve kohtumenetluse käigus teised menetlusosalised

  14. Maksim Litvinov ja president Roosevelti salajane sõnum / Kaarel Piirimäe, telegrammi teksti tõlkinud Sirje Kupp Sazonov

    Piirimäe, Kaarel, 1979-

    2015-01-01

    Vestlusest on säilinud Litvinovi kokkuvõte, Ameerika üleskirjutust USA arhiividest leitud ei ole. Avadatud on seega 12. märtsil 1942. aastal Maksim Litvinovi poolt NSV Liidu välisasjade rahvakomissrile V. M. Molotovile saadetud telegrammi tekst

  15. Active Learning in the Classroom: A Muscle Identification Game in a Kinesiology Course

    McCarroll, Michele L.; Pohle-Krauza, Rachael J.; Martin, Jennifer L.

    2009-01-01

    It is often difficult for educators to teach a kinesiology and applied anatomy (KAA) course due to the vast amount of information that students are required to learn. In this study, a convenient sample of students ("class A") from one section of a KAA course played the speed muscle introduction and matching game, which is loosely based off the…

  16. High-Mannose Specific Lectin and Its Recombinants from a Carrageenophyta Kappaphycus alvarezii Represent a Potent Anti-HIV Activity Through High-Affinity Binding to the Viral Envelope Glycoprotein gp120.

    Hirayama, Makoto; Shibata, Hiromi; Imamura, Koji; Sakaguchi, Takemasa; Hori, Kanji

    2016-02-01

    We previously reported that a high-mannose binding lectin KAA-2 from the red alga Kappaphycus alvarezii, which is an economically important species and widely cultivated as a source of carrageenans, had a potent anti-influenza virus activity. In this study, the full-length sequences of two KAA isoforms, KAA-1 and KAA-2, were elucidated by a combination of peptide mapping and complementary DNA (cDNA) cloning. They consisted of four internal tandem-repeated domains, which are conserved in high-mannose specific lectins from lower organisms, including a cyanobacterium Oscillatoria agardhii and a red alga Eucheuma serra. Using an Escherichia coli expression system, an active recombinant form of KAA-1 (His-tagged rKAA-1) was successfully generated in the yield of 115 mg per liter of culture. In a detailed oligosaccharide binding analysis by a centrifugal ultrafiltration-HPLC method with 27 pyridylaminated oligosaccharides, His-tagged rKAA-1 and rKAA-1 specifically bound to high-mannose N-glycans with an exposed α1-3 mannose in the D2 arm as the native lectin did. Predicted from oligosaccharide binding specificity, a surface plasmon resonance analysis revealed that the recombinants exhibit strong interaction with gp120, a heavily glycosylated envelope glycoprotein of HIV with high association constants (1.48 - 1.61 × 10(9) M(-1)). Native KAAs and the recombinants inhibited the HIV-1 entry at IC50s of low nanomolar levels (7.3-12.9 nM). Thus, the recombinant proteins would be useful as antiviral reagents targeting the viral surface glycoproteins with high-mannose N-glycans, and the cultivated alga K. alvarezii could also be a good source of not only carrageenans but also this functional lectin(s).

  17. Eesti Ajaloomuuseumi Suurgildi hoone. Püsinäitus "Visa hing. 11 000 aastat Eesti ajalugu" = Restoration of the Estonian History Museum Great Guild Hall building, permanent exhibition "Spirit of survival. 11,000 years of Estonian history" / Margit A

    Argus, Margit, 1981-

    2012-01-01

    Suurgildi hoone renoveerimisest, sisekujundusest, ekspositsioonist. Sisearhitektid Margit Aule, Liis Lindvere, Margit Argus (Koko Arhitektid). Restaureerimisarhitekt: Mart Keskküla (Restor). Graafilise disaini autorid Jan Tomson, Indrek Sirkel, Mikk Heinsoo, Kaarel Nõmmik, Andrus Kõresaar (Produktsioonigrupp). Ekspositsiooni multimeedia ja interaktsioon: Produktsioonigrupp

  18. Objekt nr 2011 / Liina Siib, Signe Kivi, Vilen Künnapu ...[jt.

    2011-01-01

    Installatsioon "Objekt nr. 2011" Tallinnas Vabaduse väljakul 27.02.-20.03.2011. Arvamust avaldavad kuplis objektiks olnud. Installatsiooni autorid: Mart Koldits, Kaarel Oja, Iir Hermeliin, Indrek Tiigi, Kadri Tamre, Kadri Tikerpuu, Sirli Bergström

  19. Esteet Hartshenko contra mehed punases / Heili Vaus-Tamm

    Vaus-Tamm, Heili, 1961-

    2007-01-01

    Tantsuetendustest Kumu Kunstimuuseumis: "Red ain't dead", koreograaf - lavastajad Kaarel Väli, Kristjan Rohioja; tantsuteatri Zick esituses "Piaf", koreograaf - lavastaja Dmitri Harchenko. Dominiiklaste kloostri klausuuris "Reisijuht", koreograaf - lavastaja Dmitri Harchenko

  20. Näitus "Eesti kirjanik karikatuuris" = Exhibition "Estonian writers in caricature"

    2011-01-01

    Välinäitus pälvis Eesti Sisearhitektide Liidu 2010. a. näituse ja installatsiooni kujunduse preemia. Autorid: Kaarel Vahtramäe, Liina Jakobson, Mart Lankots, Janno Siimar (Velvet Creative Alliance)

  1. Tallinna Loomeinkubaator = Creative Incubator in Tallinn / Margit Mutso

    Mutso, Margit, 1966-

    2010-01-01

    Tallinnas Veerenni 24C asuva Tallinna Loomeinkubaatori sisekujundusest. Sisearhitektid Raul Tiitus, Tarmo Piirmets (Pink OÜ), graafiline kujundus: Kaarel Vahtramäe (Velvet Studio). Žürii liikme Mait Summataveti hinnang kultuurkapitali aastapreemiale esitatud sisekujundusele

  2. Hansapank is the best Baltic brand / Aigars Rungis

    Rungis, Aigars

    2003-01-01

    Eesti, Läti ja Leedu ettevõtete turundustegevusest Baltimaades. Kommenteerivad Robin K. Rindehed, Kristiina Kõiv, Margus Sameli ja Kaarel Karu. Vt. samas intervjuud Põlva Piima turundusjuhi Sven Puussepaga

  3. Mobile 1. ehk vaataja haarab kirve / Johannes Saar

    Saar, Johannes, 1965-

    2004-01-01

    Kaarel Kurismaa kureeritud kineetilise kunsti näitusest Mobile 1. Tallinna Kunstihoones, mis on osalt tagasivaade 1960.-1970. aastate kineetilisele kunstile, sulandudes ühtseks tervikuks 1995. aastal valminud installatsioonidega. Ilmunud ka ajalehes "Postimees", 1995, 8. november

  4. Tallinna Loomeinkubaator = Tallinn Creative Incubator

    2010-01-01

    Tallinnas Veerenni 24C asuva Tallinna Loomeinkubaatori sisekujundusest. Sisearhitektid: Raul Tiitus ja Tarmo Piirmets (Pink OÜ). Sisegraafika: Kaarel Vahtramäe (Velvet). Pink OÜ tähtsamate tööde loetelu

  5. Up Close and Personal / Ave Randviir

    Randviir, Ave, 1981-

    2008-01-01

    Näitused Hobusepea ja Draakoni galeriis, kuraator Marge Monko. Osalesid Adel Abidin (Soome), Jari Silomäki (Soome), Helina Kõrm, Krista Mölder, Kaarel Nurk, Krõõt Tarkmeel, Tõnu Tunnel, Sigrid Viir

  6. Pink Pungi näitusel valgub veri linale / Raimu Hanson

    Hanson, Raimu, 1957-

    2006-01-01

    Kunstirühmituse Pink Punk (Sandra Jõgeva, Kristin Kalamees, Aino Ingrid Sepp, Kaarel Sammet) näitusest Y-galeriis. Lähemalt videoinstallatsioonist "Must turg" ja ruumiinstallatsioonist "Elulähedane kogemus"

  7. Muravskaja ja Nurk Katowices

    2009-01-01

    2. Katowice biennaalil Poolas, mis toimub nime all „The European Constitution. What makes Europe?”, osalevad Eestist Tanja Muravskaja (fotoseeria "Positsioonid", video ja installatsioon "Monumendid") ja Kaarel Nurk (fotoseeria "Mehe aasta")

  8. Plaadid / Valner Valme

    Valme, Valner, 1970-

    2002-01-01

    Uutest heliplaatidest "Golden Boy With Miss Kitten", las Ketchup "Hijas Del Tomate", Patricia Kaas "Piano Bar", Charles Mingus "Finest Hour", Jimmy Somerville "The Very Best of", The Coral "The Coral", Ozzy Osbourne "Live At Budokan", Absolute "Absolute"

  9. Dicty_cDB: CHB142 [Dicty_cDB

    Full Text Available sqfh*nhtlihhllmmvihtiqla fhfkdsiemnsmlllylvmxfk*xiirvqsisls Translated Amino Acid sequence (All Frames) Fram...KAA AEESRKHKSTIFQYIMRDGKLEREFSSASWGPYSRRRLNIMKLDQYLEMFYSLNVRLDPI VYQVKAKEPSTSTF*vlkksfqilklts*pkvkkfhsqfh*nh...tlihhllmmvihtiqla fhfkdsiemnsmlllylvmxfk*xiirvqsisls Frame C: ksffllf*ifflk*kk*yyf*qyylyyylvklnhihl*nvwigilv

  10. "Kui teil on võimalik seda vältida - vältige..." : Nõukogude Liidu poliitika Ida-Euroopas ja külma sõja algus / Kaarel Piirimäe

    Piirimäe, Kaarel

    2004-01-01

    Nõukogude Liidu eesmärkidest Teise maailmasõja järgses Euroopas, rahvademokraatiarežiimide kujundamisest Ida-Euroopa riikides, USA riigisekretäri George Marshalli algatatud Euroopa Taastamise Programmist, Euroopa kommunistlike parteide uue koordinatsioonikeskuse Kominformi asutamiskonverentsist Poolas 1947. a.

  11. Kitsas silmaring on nuhtluseks endale, teistele, kogu riigile / Raivo Juurak, Kaiko Lippur

    Juurak, Raivo, 1949-

    2014-01-01

    Westholmi Gümnaasiumi riigikaitseõpetuse õppetooli juhataja Kaiko Lippur selgitab, et riigikaitseõpetus on eelkõige õpilaste silmaringi laiendamiseks. Küsimusele, mida riigikaitseõpetus annab, vastavad Westholmi gümnaasiumi õpilased Jaan Kaarel Sepp, Marie Helen Lisete Kikas ja Kaisa-Mai Kallaste ning Rocca al Mare kooli lapsevanem Katariina L. Martens

  12. Kunstimuuseumi viimane näitus Rotermanni soolalaos

    2005-01-01

    13. maist Marko Mäetamme ja Kaido Ole "Suur projekt". 18. V muusikaline live-keskkond "Museum of Sleep / Uinuv muuseum", hüvastijätt soolalaoga Ki wa, Joel Tammiku, Tanel Paliale, Masina, Porti, El Roboticos Digitablosi ja Fabrique'i ning Villu Jõgeva ja Kaarel Kurismaa objektide osavõtul

  13. Vabadus võtta vabalt / Maria-Kristiina Soomre

    Soomre, Maria-Kristiina, 1978-

    2004-01-01

    Tänavakunstinäitus "Paraad" Eesti Lähimineviku Okupatsioonide Muuseumis. Osalevad Tuukka & Kätlin Kaila ning Vaughan Baker (London), Jani Tolin ja Freeman (Helsingi), Aadam Kaarma, Anu Samarüütel, Tarrvi Laamann, Marko Mäetamm & Kaido Ole, Lazer, Väike J, Veronika Valk, Kaarel Kulbin, DJ Critical

  14. Short Outlines of Books by Estonian Authors / Janika Kronberg, Rutt Hinrikus

    Kronberg, Janika, 1963-

    2009-01-01

    Arvustus: Kaplinski, Jaan. Parallelle ja parallelisme. Tartu : Tartu Ülikooli Kirjastus, c2009 ; Hellat, Henn-Kaarel. Inimese tegemine I-V. Tallinn : Faatum, 2002-2008 ; Nõu, Helga. Elu täis üllatusi. Tartu : Atlex, 2009 ; Remsu, Olev. Musketäride muundumised. [Tallinn] : Eesti Keele Sihtasutus, 2008 ; Ristikivi, Karl. Päevaraamat 1957-1968. Tallinn : Varrak, 2008

  15. Romaanid võistu rebimas - August Jakobsonist Sass Hennoni / Jaak Urmet

    Urmet, Jaak, 1979-

    2005-01-01

    2004. a. romaanivõistluse esikoharomaan on Sass Henno "Mina olin siin", teine koht: Olavi Ruitlane "Kaval-Peeter ja Vene-Pagan", kolmas koht: Meelis Friedenthal "Kuldne aeg". Sisaldab võitjate nimekirja 1979-2004 ja andmeid noorte silmapaistvate autorite kohta: Kaarel Kressa, Toomas Verrev, Priit Kruus, Rolf Liiv, André Trinity, Jana Lepik,

  16. LIFT 11 kutsub kogemist väärt kohtadesse / Silvia Pärmann

    Pärmann, Silvia

    2011-01-01

    Installatsioonide festivalist LIFT 11 Tallinnas, kuraator Margit Aule. Margus Tamme ja Argo Peeveri installatsioonist "Face It", Raul Kalvo skulptuurist "Uurijad", Raul Kelleri installatsioonist "Tütarlaps kloaagis", Aet Aderi, Kaarel Künnapi, Grete Soosalu, Flo Kasearu, Andra Aaloe kunstiprojektist "O"

  17. Pärnu kunstnikud tagasi kodus / Sandra Jõgeva

    Jõgeva, Sandra, 1976-

    2011-01-01

    Pärnust pärit kunstnike näitus "Tagasi koju" Pärnu Linnagaleriis 13. augustini 2011. Kuraator Mari Kartau, kunstnikud Kaarel Kurismaa, Mari Kurismaa, Malle Leis, Marco Laimre, Maiu Rõõmus, Flo Kasearu, Elin Kard

  18. Lambanahka varjunud hundid / David Vseviov

    Vseviov, David, 1949-

    2006-01-01

    Vastukaja 23. märtsil Eesti Päevalehes ilmunud Kaarel Tarandi artiklile "Kommar ja nommar". Autor peab nõukogude ajajärgu käsitlemisel kommunistide ja mittekommunistide vahele minevikuhinnangulise piiri tõmbamist ohtlikuks lihtsustamiseks

  19. Eesti Kirjanike Liit praegu : ankeedivastused

    1997-01-01

    Aut.: Ain Kaalep, Juhan Habicht, Valeria Ränik, Karl Muru, Mart Velsker, Janika Kronberg, Maie Kalda, Hannes Varblane, Toomas Raudam, Priidu Beier, Kati Murutar, Dagmar Normet, Enn Vetemaa, Henn-Kaarel Hellat, Vello Lattik, Kajar Pruul, Kauksi Ülle, Ene Mihkelson, Jüri Ehlvest

  20. Püünele astuvad noored talendid

    2006-01-01

    28. ja 29. septembril alustab Kumu auditooriumis uut hooaega Sõltumatu Tantsu Ühenduse kureeritud üritustesari "Tantsukunst Kumus", kus astuvad lavale sarja "Noored talendid" esimesed tantsijad Külli Roosna ja Kaarel Väli. Ettekandele tuleb "Silence", esineb ka tantsuteater Fine 5 Matteo Molese teosega "Just"

  1. Manhattanilt Tartu tahahoovi / Vaapo Vaher

    Vaher, Vaapo, 1945-

    2008-01-01

    Tutvustus: Dos Passos, John. Manhattan Transfer / tlk. Olavi Teppan. Tallinn : Tänapäev, 2007 ; Betti Alver : usutlused. Kirjad. Päevikukatked. Mälestused / koostanud ja toimetanud Kristi Metste, Enn Lillemets. Tallinn : Tänapäev, 2007 ; Artur Alliksaar mälestustes / koostanud Henn-Kaarel Hellat. Tartu : Ilmamaa, 2007. Ka kirjastusest Ilmamaa

  2. 19.-21. IX leiab Budapesti kultuuritehases Tüzraktar aset...

    2005-01-01

    Eesti kaasaegse kultuuri invasioon "BeEST in Budapest", mis kaasab eesti kujutava kunsti, kirjanduse ja muusika. Programmis osalevad Aivar Tõnso, Joel Tammik, Muschraum, Jan Kaus ja Triin Soomets, Avangard, Marianne Männi, Kaarel Sammet jt. Projekti koordinaatorid Maarin Ektermann ja Elnara Taidre

  3. Skulptorid uurivad vormi tempot

    2002-01-01

    9. XI-8. XII Tallinna Kunstihoones Eesti Kujurite Ühenduse näitus "Tempo di scultura/sculpture agogique/skulptuuri tempo". Kuraatorid Toomas Mikk, Mari-Liis Tammi, Aili Vahtrapuu, kujundaja Mari Kurismaa, avamisel Kaarel Kurismaa performance. Kasutatud Gaston Bachelard'i teose "Kaemus hetkest" tekste

  4. Tartu noored kunstnikud salapärasuse vaimustuses / Margus Kiis

    Kiis, Margus

    2003-01-01

    Tartu Noorte Kunstnike Näitusest Tartu Kunstnike Majas. Iseloomustatud Priit Pajose, Lauri Pajose, Margus Pumpa, Andres Sütevaka, Kaie Luige, Maris Palgi, Külli Suitso, Kadri Kängsepa, Peeter Krossmani, Saimi Kalevi Makkoneni, Kaarel Vulla, Katri Kuuski, Väike Tomi, Meiu Mündi, Karol Kagovere, Meta Narusbeli, Aili Penti, Kene Triive ja Raivo Irdi töid

  5. Jumala ilmumine Pärnus. Vol. 2 : Luule / Arno Oja

    Oja, Arno, 1950-

    2016-01-01

    Arvustus: Kressa, Kaarel. Vereurmarohumesi. Pärnu : Jumalikud Ilmutused, 2011 ; Salumaa, Priit. Viimased viisteist aastat. Pärnu : Jumalikud Ilmutused, 2011 ; Belials, Veiko. Sina ja vaikus ja pajud. Pärnu : Jumalikud Ilmutused, 2011 ; Kivisildnik. Liivlased ja saurused. Valuraamatu I köide. Pärnu : Jumalikud Ilmutused, 2011

  6. Jumala ilmumine Pärnus. 2 / Arno Oja

    Oja, Arno, 1950-

    2011-01-01

    Arvustus: Kressa, Kaarel. Vereurmarohumesi. Pärnu : Jumalikud Ilmutused, 2011 ; Salumaa, Priit. Viimased viisteist aastat. Pärnu : Jumalikud Ilmutused, 2011 ; Belials, Veiko. Sina ja vaikus ja pajud. Pärnu : Jumalikud Ilmutused, 2011 ; Kivisildnik. Liivlased ja saurused. Valuraamatu I köide. Pärnu : Jumalikud Ilmutused, 2011

  7. Teatriõpilane ja -uuendaja Mati Unt Vanemuises (1966 - 1972) / Ülo Tonts

    Tonts, Ülo, 1931-2016

    2008-01-01

    Teatriloolisi meeldetuletusi ja ääremärkusi. Vaatluse all on Mati Undi tööd ja tegemised Vanemuise perioodil. Tööst lavastaja assistendi, instseneerija ja tõlkijana. Koostööst Kaarel Irdi ja Evald Hermakülaga. Algus eelmises TMKs

  8. 27. XI esitles Kanuti gildi saalis Mooste avatud ateljee MOKS video-, heli- ja tegevuskunstiprogrammi "Põhi silmab kagu"...

    2003-01-01

    Esinesid MOKSiga seotud kunstnikud ja rühmitused: John Grzinich, OPA: Slobodanka Stevceska, Denis Saraginovski (Obsessive Possessive Aggression, Makedoonia), Kaarel Vulla, Irene Roos, Jane Remm, OMP: maalikunstnikud Maris Palgi, Eva Orav ja ajakirjanik Maia Möller, Pink Punk: Kristin Kalamees, Margus Tamm, Sandra Jõgeva

  9. Suured lood või tasane tuiklemine telepurgi suunas? / Karl Martin Sinijärv

    Sinijärv, Karl Martin, 1971-

    2010-01-01

    Eesti kriminaalromaanidest: Hargla, Indrek. Apteeker Melchior ja Oleviste mõistatus. Tallinn : Varrak, 2010 ; Klaara ja Kaarel Kivi põnevikest "Mõrtsukatöö Faehlmanni tänavas" (2005), "Mõrvasügis" (2007), "Varandus seinal" (2008) ja "Ajakirjaniku surm" (2010). Kriminaalromaanide eelistest põnevusfilmide ja teleseriaalidega võrreldes

  10. "Ird, K." sai Riias preemia

    2011-01-01

    7. Balti teatrifestivalil Riias sai Tartu Uue Teatri juht Ivar Põllu auhinna lavastuse "Ird, K." kontseptsiooni ja helikujunduse eest ning näitleja Nero Urke Kaarel Irdi rolli eest. Von Krahli Teatri truppi hinnati aja ja ruumi loova käsitluse eest lavastuses "The End"

  11. Театр хочет быть авторским / Борис Тух

    Тух, Борис, 1946-

    2011-01-01

    7. Balti teatrifestivalist Riias (СКАТС-2011), lavastustest. Eestit esindanud Tartu Uue Teatri juht Ivar Põllu sai auhinna lavastuse "Ird, K." kontseptsiooni ja helikujunduse eest, näitleja Nero Urke Kaarel Irdi rolli eest samas lavastuses. Von Krahli Teatri truppi hinnati aja ja ruumi loova käsitluse eest lavastuses "The End"

  12. Tulevik on helge: noortele meeldib ettevõtlikkus / Evelin Org, Marge Rahu, Kai Isand ... [jt.

    2016-01-01

    Sokos Hotels Tallinna müügi- ja turundusdirektori Evelin Orgi, kohviku Maitsvad Muffinid omaniku Marge Rahu, Garage48 SA tegevjuhi Kai Isanda, Swedbanki juriidilise divisjoni direktori Riho Roopõllu, Nortali tegevjuhi ja juhatuse liikme Andre Kulli, Veriff tegevjuhi ja asutaja Kaarel Kotkase ning Esteloni kaasasutaja ja partneri, Eesti Era- ja Riskikapitali Assotsiatsiooni tegevjuhi Kristiina Vassilkova mõtteid edukusest

  13. Igavesti elav ja ikka uuenev "Mees ja naine" / Mark Soosaar

    Soosaar, Mark, 1946-

    2001-01-01

    Pärnu Uue Kunsti Muuseumis avatud rahvusvahelisel aktinäitusel saab vaadata Jean Cocteau (1889-1963), Robert Mapplethorpe'i (1946-1989), Kaarel Liimandi (1906-1941), Jan Sierhuisi, Vilmantas Marcinkeviciuse, Evald Okase, Joel Peter Witkini, Jan Saudeki ja Jean Rustini loomingut. Pikemalt J. Cocteau, J. Saudeki ja J. Rustini töödest

  14. "Mees ja naine" vaidlustab perverssuse piiri / Kati Murutar

    Murutar, Kati, 1967-

    2001-01-01

    3. juunil Pärnu uue kunsti muuseumis avatud näitusel "Mees ja naine" saab vaadata Kaarel Liimandi, Evald Okase, Mari Roosvalti, Ülle Kuldkepi, Jan Sierhuisi, Jean Rustini, Jean Cocteau, Jan Saudeki, Joel Peter Witkini ja Robert Mapplethorpe'i loomingut. Lähemalt Jean Rustini ja Jean Cocteau töödest

  15. Laulvad kirjanikud Prima Vistal

    2008-01-01

    Kirjandusfestivalist Prima Vista 8.-11. maini Tartus ja laulvate kirjanike kontsertidest: 9. mail Tõnu Trubetsky kontsert ansambliga The Flovers of Romance, 10. mail Villu Tamme, Mathura, Lauri Sommer, Kaarel B. Väljamäe, Andreas Kalkuni, Kauksi Ülle, Merca ja Aapo Ilves

  16. Kõrgeimad tipud on kättesaadavad vaid valituile / Nils Niitra

    Niitra, Nils, 1975-

    2006-01-01

    Tartu linnavalitsuse planeeringuteenistuse ja volikogu arengu- ja planeerimiskomisjoni erinevast suhtumisest ehitusfirmade Linnaehitus ja Lion House ehitusplaanidesse püstitada kõrghooneid. Vt. samas: Jüri Saare intervjuud endise abilinnapea Kaarel Sahaga: Tigutorn lisandub mitmete õigusvastaste ehitiste ritta; Jüri Saar. Linnavolinikud toimuvaga rahul

  17. Veel Konstantin Pätsist ja tema suhetest Nõukogude Liidu Tallinna saatkonnaga. Kas ainult Nõukogude diplomaatide silmade läbi? / Magnus Ilmjärv

    Ilmjärv, Magnus, 1961-

    2009-01-01

    Eesti riigivanema, Riigikogu liikme ja Eesti-Nõukogude Kaubanduskoja juhatuse esimehe Konstantin Pätsi suhetest Nõukogude Liidu Tallinna saatkonnaga 1920. aastatel ning 1930. aastate algul. Eesti-Nõukogude Kaubanduskoja loomisest, välisminister Kaarel Robert Pusta ametist tagandamisest, Eesti-Nõukogude Liidu kaubanduslepingu sõlmimisest ja Pätsi kaasamisest Naftasündikaadi juriskonsuldiks

  18. Kommunikatsiooniharidus vajab rohkem praktikuid / Anu Vahtra-Hellat, Erki Varma, Aneth Rosen ... [jt.] ; intervjueerinud Kertu Kärk

    2016-01-01

    Eesti kommunikatsioonihariduse vajalikkusest, plussidest ja miinustest üle. Arvati, et kommunikatsiooniharidus võiks muutuda praktilisemaks ja hõlmata teadmisi erinevatest valdkondadest. Vestlusringis kommunikatsioonijuhid Anu Vahtra-Hellat E-riigi Akadeemiast, Erki Varma Tallinna Tehnikaülikoolist, Aneth Rosen Kultuuriministeeriumist, Regina Hansen Erametsakeskusest ja Kaarel Kutti Elektrilevist

  19. UP Close & Personal. Ohutult lähedale / Anneli Porri

    Porri, Anneli, 1980-

    2008-01-01

    Marge Monko kureeritud näitus "Up Close & Personal" Hobusepea ja Draakoni galeriis kuni 13. IX. Jari Silomäki (Soome), Kaarel Nurga, Tõnu Tunneli, Adel Abidini (Soome), Sigrid Viiri ja Krista Möldri töödest

  20. ERKI moe ülevaatus pakkus täismajale toreda õhtu / Tiiu Oga

    Oga, Tiiu

    2007-01-01

    Eesti Kunstiakadeemia 13.01.2007 Salme kultuurikesksuses toimunud moeetendusest. Lavastaja Kaarel Väli, graafiline kujundus Eiko Ojala, videokunstnikud Taavi Varm ja Aleks Tenusaar koos RGB-ga, lavaline kujundus Ain Nurmela, valguskunstnik Meelis Lusmägi koos ET Valgusega. Korraldajad Jaanika Terasmaa ja Ester Kannelmäe

  1. Kümme teatristarti alustas suureks kasvamisega / Tiiu Laks

    Laks, Tiiu,1984-

    2010-01-01

    Tallinna Linnateater annab kümnele algajale võimaluse lavastada professionaalses teatris. 6. oktoobril esietendunud monotükist "Suur mees juba", millega jõudis lavale kolm professionaalset debüüti korraga - Kaarel B. Väljamäe esimene teatritekst, Diana Leesalu esimene lavastus ning Priit Piusi esimene suur roll

  2. Kiri saadikule / Ants Piip

    Piip, Ants, 1884-1942

    2007-01-01

    Tõenäoline adressaat Kaarel Robert Pusta. Kiri oma töö üldistest põhimõtetest ülemineku kabineti väliministri kohale asudes, rõhutades põhimõtet, et välispoliitika peab jääma üldrahvalikuks. Allikas: Rahvusarhiiv f. 1624, n. 1, s. 69

  3. Tegijad meenutavad "52 üllatust ja ideed" / Annika Maior, Ats Parve, Epp Kubu ...[jt.

    2011-01-01

    Kultuuripealinna ootussarjas osalenud räägivad, kuidas idee teostamine kulges. Projektidest "Fantaasiaaed" (Annika Maior), "Camera obscura" (Ats Parve), "Tallinna bussijaam heliseb" (Epp, Kubu, Tõnis Hiiesalu), "Tänavamiimid" (Mihkel Ernits, Kaarel Väli), "Kunstijärjekord" (Flo Kasearu, Aet Ader, Grete Soosalu, Andra Aaloe)

  4. Miks? Ehk jätkuks sellele, millest tol õhtul rääkisime = Why? Or to continue from where we left off the other night / Kadri Klementi

    Klementi, Kadri

    2011-01-01

    Külalistoimetaja Kadri Klementi Eesti arhitektuuri ajakirja "Maja" 2011. aasta kolmandast numbrist "Maja taga", mille teemaks on asjad arhitektuuri ümber. Number on pühendatud Linnalabori viiendale sünnipäevale. Graafiline disain: Kaarel Nõmmik, Indrek Sirkel

  5. Ebamäärasus kui eesmärk : "Coast Wise Europe'i" näitus ja konverents Rotermanni soolalaos / Karin Hallas

    Hallas-Murula, Karin, 1957-

    1998-01-01

    Aprillis eksponeeritud näitusest "Coast Wise Europe" ja 17. aprillil toimunud konverentsist "Ebamäärasus". David Milleri, Mart Raukase, Kaia Lehari, Inga Raukase, Kaarel Orviku ettekannetest. Ürituse korraldaja ja Eesti-poolse "Coast'i" eestvedaja Inga Raukas.

  6. From mice to men: the evolution of the large, complex human brain

    2004-12-15

    Dec 15, 2004 ... https://www.ias.ac.in/article/fulltext/jbsc/030/02/0155-0165. Keywords. Galagos; neocortex; primates; somatosensory; vision. Author Affiliations. Jon H Kaas1. Department of Psychology, Vanderbilt University, 301 Wilson Hall, 111, 21st Ave. S, Nashville, TN 37240, USA. Dates. Early published: 15 December ...

  7. Comparison of several methods of sires evaluation for total milk ...

    A total of 956 lactation records of Holstein cows kept at Kaa Albon station, Imuran Governorate, Yemen during the period from 1991 to 2003 were used to investigate the effect of some genetic and non-genetic factors (Sire, parity, season of calving, year of calving and age at first calving as covariate) on the Total Milk Yield ...

  8. Students attitude towards their university and studies / Ilze Strepmane

    Strepmane, Ilze

    2001-01-01

    Uuringust, millega püüti välja selgitada, millised on üliõpilaste suhtumine oma kõrgkooli, õpingutesse, kaasüliõpilastesse, perekonda ja sõpradesse. Küsitleti Läti Meditsiiniakadeemia Riia Stradinsi Ülikooli esimese, teise ja kolmanda kursuse üliõpilasi

  9. Trafficking In Women And Children In Yorubaland: A Pre And Post ...

    To them, there is a proverb that says that ati kekere laa ti pe kan iroko, to ba dagba tan apa ko nii kaa mo (children are better caught young, or else it would be difficult to mould them when they grow up). This informs the training of children at tender age in the business of trading and engagement in other forms of work.

  10. Õppekeele roll Eesti venekeelsete õpilaste etnokultuurilise identiteedi kujunemisel / Maie Soll, Sander Salvet, Anu Masso

    Soll, Maie

    2014-01-01

    Eesti ja eesti-vene õppekeelega ning keelekümblust kasutavate koolide ja klasside abituriente võrguintervjuude vormis küsitlusuuringust selgus, et rahvust ja õppekeelt omavahel ei seostata, kuid tähtsustati koolikeskkonda, mis pakub emotsionaalset turvalisust, arvestades kaasõpilaste ja õpetajate rahvust

  11. Geiten éénmaal daags melken : een literatuuronderzoek

    Wenum, van H.; Eekeren, van N.J.M.

    2008-01-01

    Het tweemaal daags melken van geiten kost veel tijd. Voor veel kleine zelfkazers is dit soms moeilijk te combineren met het kaasmaken en de verkoop van kaas. In Frankrijk is er om die reden veel onderzoek gedaan naar de mogelijkheden van het éénmaal daags melken van geiten. Dit rapport is het

  12. Fungal resistance to polyene antibiotics with regard to the use of natamycin as a preservative on cheese

    Voogd; C.E.; Klingeren; B.van

    1985-01-01

    Op verzoek van Ned. autoriteiten op het gebied van de gezondheidszorg (HIL) is het gebruik van natamycine als schimmelwerend middel op kaas nogmaals geevalueerd. Zowel uit oude als recente gegevens in de literatuur kan worden geconcludeerd dat bovengenoemde toepassing van natamycine bij

  13. Deciduous molar hypomineralisation, its nature and nurture

    Elfrink, M.E.C.

    2012-01-01

    Vijf tot negen procent van de Nederlandse kinderen heeft kaaskiezen in het melkgebit, blijkt uit onderzoek van Marlies Elfrink. Kaaskiezen ontstaan door een stoornis in het in het mineraalgehalte van het tandglazuur. De kiezen hebben de kleur van kaas en zijn gevoeliger dan andere kiezen, omdat de

  14. Page 1 Joornaalii Seeraa Oromiyaa [liil.6, Lakk.1] Oromia Law ...

    uun daldala seeraa alaa rakkoolee akka manca' iinsi in daldalaa maal akka ta'e hin ibsu. (nama hojii daldalaa hojjetu) irratti xiyyeeffata. Bu'uura Seera Daldalaa daldala seeraa alaa to'achu akka ulaagaa tokkootti kaa'anii turan Bu'uura yaad.

  15. From mice to men: the evolution of the large, complex human brain

    2004-12-15

    Dec 15, 2004 ... http://www.ias.ac.in/article/fulltext/jbsc/030/02/0155-0165. Keywords. Galagos; neocortex; primates; somatosensory; vision. Author Affiliations. Jon H Kaas1. Department of Psychology, Vanderbilt University, 301 Wilson Hall, 111, 21st Ave. S, Nashville, TN 37240, USA. Dates. Early published: 15 December ...

  16. The Supreme Court of Estonia constitutional judgement 3-3-1-35-10: judgment of the Supreme Court en banc : date of decision 31 August 2011

    2013-01-01

    Kohtulahendi 3-3-1-35-10 (Riigiprokuratuuri ning Politsei- ja Piirivalveameti kassatsioonkaebused Tallinna Ringkonnakohtu 16. veebruari 2010. a otsuse peale haldusasjas nr 3-08-265 Ülar Kaasi (Kaas) kaebuses Eesti Vabariigi tekitatud 254 087 krooni suuruse kahju hüvitamise nõudes) tekst inglise keeles

  17. Areen küsib : mis oli aasta kultuurishokk?

    2005-01-01

    Positiivne ja negatiivne kultuurisündmus 2005. aastal. Küsimusele vastavad Juhan Maiste, Karin Hallas-Murula, Jaan Toomik, Toivo Raidmets, Maile Grünberg, Leo Lapin, Märt Väljataga, Berk Vaher, Sergei Stadnikov, Veljo Kaasik, Margit Mutso, Erkki-Sven Tüür, Mihkel Mutt, Kaarel Tarand, Priidu Beier, Hasso Krull, Jaan Pehk, Hendrik Luuk, Karlo Funk, Kristo Rajasaare, Andres Maimik, Priit Raud, Marianne Kõrver

  18. Milleks monumenti = Why a monument? / Heie Treier

    Treier, Heie, 1963-

    2006-01-01

    2006. a. toimunud Jüri Lotmani mälestusmärgi konkursist, Mati Karmini ja Andres Lunge võidutööst. Monumentide positiivseid näiteid: Tubina plats Tartus (Aili Vahtrapuu, Veronika Valk, Louis Dandrel), ideekavandid: Estonia teatri juubelimonument Tallinnas (Tiiu Kirsipuu, Üla Koppel) ja Eesti iseseisvuse monument Pärnus Rüütli platsil (Mart Aas, Kaarel Eelma, Mikk Mutso). Bibl. lk. 73

  19. Leninskaja pravda. Iz vseh iskusstv dlja nas vazhneishim javljajetsja kino / Ilja Sundelevitsh

    Sundelevitsh, Ilja

    2001-01-01

    Kunstinäitustest Tallinnas: Tallinna XII graafikatriennaali näitused Rotermanni soolalaos (peanäitus), Kunstihoones (Johannes Saare kuraatorinäitus), Hansapanga galeriis (noortenäitus), Linnagaleriis (eelmise graafikatriennaali võitja Sang-Gon Chungi tööd), Adamson-Ericu muuseumis (eelmiste triennaalide võitjad) jm. Noorte metallikunstnike Andrus Rummu ja Kaarel Sireli töödest A-galeriis.

  20. Surm kevadises Tallinnas ehk Kunstnike valuline reaktsioon meie ajale / Reet Varblane

    Varblane, Reet, 1952-

    2006-01-01

    Mark Soosaare näitus "Aeg" Tallinna Kunstihoone galeriis kuni 23. IV, Jaan Paavle maalinäitus "1 minut" 3.-15. IV Draakoni galeriis, Sandra Jõgeva ja Kristin Kalamehe "Leave like a Lady" Draakoni galerii keldrisaalis 4.-15. IV, Marianne Männi näitus "Paradiis" Hobusepea galeriis 5.-17. IV. Maailma positiivsemale poolusele osutab 20. IV Tallinna Linnagaleriis avatud Mari ja Kaarel Kurismaa ruumiinstallatsioon "Teine süütus"

  1. Poeetilise utoopia meister Aino Bach

    2003-01-01

    28. III-11. V Adamson-Ericu muuseumis graafik Aino Bachi loomingu ülevaatenäitus. Võrdluseks on eksponeeritud Eduard Wiiralti ja Kaarel Liimandi tööd. Näha võib Mark Soosaare filmi A. Bachist "Liblikapüüdja" (1978). Kuraator Anne Lõugas, kujundaja Virge Jõekalda. Kai Tuviku juhendamisel muuseumitunnid "Kuidas joonistada inimest?". 1. IV seminaril "Naiskunstnik ja tema aeg. Aino Bach" esinejad, ettekanded

  2. Kaliningradi biennaal / Sandra Jõgeva

    Jõgeva, Sandra, 1976-

    2008-01-01

    IX rahvusvaheline graafikabiennaal "Kaliningrad-Königsberg 2008" Kaliningradi kunstigaleriis 15. IX-15. XI. Eesti väljapanek (kuraator Eha Komissarov, kujundaja Marko Nautras, osalejad: Jaanika Okk, Kaarel Kütas, Lauri Koppel, Gerda Märtens, Raul Meel, Lembe Ruben, HULA, Villem Jahu, Tiiu Pirsko, Mati Veermets, Sandra Jõgeva) sai ekspositsioonipreemia. Grand prix - Paulis Liepa, I preemia - Olrik Kohlhoff, II - Dominica Sadowska, III - Raffael Rheinsberg, eripreemia - Markus Lampinen

  3. Installation complete / Aet Ader, Kadri Klementi

    Ader, Aet

    2015-01-01

    Linnainstallatsioonidest avalikus ruumis. "Gas Pipe" Venezia Arhitektuuribiennaalil (Maarja Kask, Ralf Lõoke, Neeme Külm, Ingrid Ruudi, 2008). "Artificial Queue" (Andra Aaloe, Aet Ader, Flo Kasearu, Grete Soosalu, 2010). "To the Sea" (autorid Tomomi Hayashi, Mihkel Sagar, 2011). "Chimney" (tundmatu autor, 2011). "Straw Theatre" (Salto Arhitektid, 2011). "A Path in the Forest" (Tetsuo Kondo, Mitsuru Maekita, Mutsuro Sasaki, Yoshiyuki Hiraiwa, 2011). "O" (Aet Ader, Andra Aaloe, Kaarel Künnap, Grete Soosalu, Flo Kasearu, 2011)

  4. A simplified biomolecule attachment strategy for biosensing using a porous Si oxide interferometer

    Perelman, Loren A.; Schwartz, Michael P.; Wohlrab, Aaron M.; VanNieuwenhze, Michael S.; Sailor, Michael J.

    2008-01-01

    A simple strategy for linking biomolecules to porous Si surfaces and detecting peptide/drug binding is described. Porous Si is prepared using an electrochemical etch and then thermally oxidized by heating in ambient atmosphere. Bovine serum albumin (BSA) is then non-covalently adsorbed to the inner pore walls of the porous Si oxide (PSiO2) matrix. The BSA layer is used as a linker for covalent attachment of the peptide Ac-L-Lysine-D-Alanine-D-Alanine (KAA) using published bioconjugation chemistry. BSA-coated surfaces functionalized with KAA display specificity for the glycopeptide vancomycin while resisting adsorption of non-specific reagents. While the biomolecule attachment strategy reported here is used to bind peptides, the scheme can be generalized to the linking of any primary amine-containing molecule to PSiO2 surfaces. PMID:18458749

  5. Active learning in the classroom: a muscle identification game in a kinesiology course.

    McCarroll, Michele L; Pohle-Krauza, Rachael J; Martin, Jennifer L

    2009-12-01

    It is often difficult for educators to teach a kinesiology and applied anatomy (KAA) course due to the vast amount of information that students are required to learn. In this study, a convenient sample of students (class A) from one section of a KAA course played the speed muscle introduction and matching game, which is loosely based off the premise of the adult game of "speed dating." The game involves student's taking on a "muscle" personality when introducing themselves to potential mates. The experimental group (class A) played the game at two time points throughout the semester after a series of lectures focusing on the body's muscles. A control group (class B) from another section of the KAA course still received the series of lectures but did not play the games throughout the semester. A postgame questionnaire given to class A revealed the following scores: 1) overall perception of the game (score: 4.43 +/- 0.68), whether goals and objectives were met (score: 4.05 +/- 0.67 to 4.95 +/- 0.22), and perceptions of the organization of the game (score: 3.81 +/- 0.81 to 4.48 +/- 0.60). Overall, the game was well received by class A. When evaluating outcome scores of final grades between the two groups, class A improved final grades by 5.82% for a mean grade of 79.52 +/- 10.0; however, the final grades were not statistically significant (P > 0.05) compared with class B (73.7 +/- 15.6). The results show that an interactive game may contribute to improved final grades in a KAA course and could be an alternative means of disseminating kinesiology information.

  6. Uus plaat

    2004-01-01

    Uutest plaatidest Barry White "Love Songs", Charizma "Life in 3D", Toto Cutugno "il treno va...", "Talkin Loud 1990-1994", Delta Goodrem "Innocent Eyes", Astrud Gilberto "Astrud For Lovers", "Groove Is In The Heart", "The Last Samurai", Patricia Kaas "Sexe & Fort", Norah Jones "Feels Like Home", LeAnn Rimes "The Best Of", "Kumad Eesti hitid 2004", Thursday "War All The Time", Damageplan "New Found Power", Deep Purplr "Purpendicular", "Trance Allstars", Joseph Haydn "Symphonies 1-104", "Takorautaa", "DJ Esko. Setti2"

  7. Russian Weaponization of Information and Influence in the Baltic States

    2016-12-11

    24 Anna Bulakh et al., “Russian Soft Power and Non-Military Influence: The View from Estonia,” in Tools of...Bulakh, Anna , Julian Typay, Karel Kaas, Emmet Tuohy, Kristiina Visnapuu, and Juhan Kivirahk. “Russian Soft Power and Non-Military Influence: The View...Command and General Staff College in partial fulfillment of the requirements for the degree MASTER OF MILITARY ART AND SCIENCE Strategic Studies

  8. Kunstnike Liit

    2004-01-01

    EKLi volikogu töökoosolek 5. IV. SA ERF alllfondina loodud Olev Soansi mälestusfondi toetamisest, EKLi 2005. a. aastanäituse korraldamisest Tallinna Kunstihoones, vajalikest täiendustest ja muudatustest põhikirjas, mis puudutavad tehinguid Tallinna Kunstihoone ja selle galeriiga. Võeti vastu tööjuhised SA Tallinna Kunstihoone Fondi nõukogule. EKLi uued liikmed: Kaarel Eelma, Piret Hirv, Sandra Jõgeva, Irene Jürna, Kristin Kalamees, Kristiina Laurits, Eve Margus-Villems, Villu Plink, Lembe Ruben, Katrin Sipelgas, Margus Tamm, Tanel Veenre

  9. Vormistatud ruumid 2010 / Kai Lobjakas

    Lobjakas, Kai, 1975-

    2011-01-01

    Eesti Sisearhitektide Liidu 2010. a. preemia saanud töödest. Söögikoha interjööri preemia: kohvik Supelsaksad Pärnus (Ruth, Jaak ja Anna Huimerind), ühiskondliku interjööri preemia: ADM Interactive'i büroo Tallinnas (Tomomi Hayashi, Ahti Grünberg, Kerli Valk), ajaloolise interjööri preemia: Kihnu muuseum (Malle Jürgenson, Tea Tammelaan, Krista Lepland, Jaak Huimerind, Indrek Laos), näituse- ja installatsiooni kujunduse preemia: rändnäitus "Eesti kirjanik karikatuuris" (Janno Siimar, Kaarel Vahtramäe, Mart Lankots, Liina Jakobson), tudengipreemia - Aet Tera

  10. Parimad interjöörid: büroo, külamuuseum ja kohvik / Tiina Kolk

    Kolk, Tiina

    2011-01-01

    Eesti Sisearhitektide Liit valis 2010. aasta parimad interjöörid: kohvik Supelsaksad Pärnus (Anna ja Ruth Huimerind), ADM Interactive'i bürooruumid Tallinnas (Tomomi Hayashi, Ahti Grünberg, Kerli Valk), Kihnu muuseum (Malle Jürgenson, Tea Tammelaan, Krista Lepland, Jaak Huimerind, Indrek Laos). Näituse ja installatsiooni kujunduse preemia pälvis rändnäitus "Eesti kirjanik karikatuuris" (Janno Siimar, Kaarel Vahtramäe, Mart Lankots, Liina Jakobson). Tudengipreemia pälvis Aet Tera. Nominentide tööde põhjal avati 17. mail 2011 Arhitektuuri- ja Disanigaleriis näitus

  11. Värvikas Riigikogu / Lylian Meister

    Meister, Lylian, 1966-

    2007-01-01

    1920-1922 Herbert Johansoni ja Eugen Habermanni projekti järgi ehitatud Riigikogu hoonest. Saaliavade ja aknapõskede kujundamisel oli abiks Jaan Koort. 1935. a. rajati Alar Kotli projekti järgi lossi lõunatiib.Valge saal rekonstrueeriti 1936. a. Artur Perna ja Johann Ostrati kavandite järgi. Eesti taasiseseisvumise järel on hoonet Mart Kalmu, Leila Pärtelpoja, Mari ja Kaarel Kurismaa ning Ülar Saare juhendamisel renoveeritud. Riigikogu esimehe kabineti vaiba (1938) kavandas Adamson-Eric, kontorimööbli kujundasid 1997. a. EKA sisearhitektuuri üliõpilased L. Pärtelpoja juhendamisel. 23 ill

  12. Me aiaäärne tsivilisatsioon / Andri Ksenofontov

    Ksenofontov, Andri, 1962-

    2008-01-01

    Gerhard Richteri näitus "Ülevaade" 6. VI-17. VIII ja Eha Komissarovi kureeritud eesti kunstnike linnakeskkonna-teemaline näitus "Koht, mis paneb liikuma" 20. VI-17. VIII Kumu Kunstimuuseumis. Lühidalt Tõnis Saadoja Gerhard Richteri portreede seeriast "Mainstream" Kumu Kunstimuuseumis. Maarit Murka töödest, Kaarel Nurga fotodest, Anton Kooviti, Uku ja Remi grafititoast, Raoul Kurvitza arvutiinstallatsioonist "Pentatonic Color System II" (helilooja Ariel Lagle), Reet Ausi, Marit Ahvena,Ville Hyvöneni, Hula, EKA moedisaini ja Tartu Kõrgema Kunstikooli tekstiili- ja fotoosakonna projektist "Üle prahi", Kaido Ole installatsioonist "Koosolek"

  13. Event review: How Interesting Archaeology Is! - Captivating and Leading-Edge Student Research

    Atsushi Uemine

    2015-03-01

    Full Text Available Kyoto City Archaeological Museum situated in Kansai region, the central part of Honshu Island, Japan, has held special exhibitions in collaboration with external organizations every year since 2011. From 2011 to 2013, several universities and even a high school have participated projects, and in 2014, the Kansai Archaeological Association for Students (KAAS played an important role as partner, producing the exhibit “ここまでわかる!考古学―学生が魅せる最先端” (“How Interesting Archaeology Is! - Captivating and Leading-Edge Student Research”.

  14. Stevia rebaudiana Bertoni - chemical composition and functional properties.

    Marcinek, Katarzyna; Krejpcio, Zbigniew

    2015-01-01

    Sweetleaf (Stevia rebaudiana Bertoni), currently investigated by many researchers, has been known and used for more than a thousand years indigenous tribes of South America, who called it "kaa-hee" ("sweet herb"). Thanks to its chemical composition and processability sweetleaf may be an alternative for synthetic sweeteners. Nutritional and health-promoting aspects of Stevia rebaudiana are presently being studied in many research centres. The aim of this study is to present nutritional and health-promoting value of the still-little known sweetleaf.

  15. Nueva especie del quitón Lepidochitona (Polyplacophora: Ischnochitonidae de Puerto Rico

    Cedar I García-Ríos

    2010-06-01

    Full Text Available El género Lepidochitona Gray, 1821 tiene dos especies en el Caribe: L. liozonis (Dall & Simpson, 1901 y L. rosea Kaas, 1972. Se describe una tercera especie: Lepidochitona rufoi sp. nov. de Puerto Rico. Lepidochitona rufoi difiere de ambas por tener un tegumento finamente granuloso, menor tamaño, una rádula con dientes centrales muy finos, la forma de la valva anal y el color diferentes. También difiere de L. liozonis por tener espículas marginales más largas.A new species of the chiton Lepidochitona (Polyplacophora: Ischnochitonidae from Puerto Rico. The genus Lepidochitona Gray, 1821 has two species in the Caribbean: L. liozonis (Dall & Simpson, 1901 and L. rosea Kaas, 1972. We describe a third species: Lepidochitona rufoi sp. nov. from Puerto Rico. Lepidochitona rufoi differs from both in having a finely granulose tegmentum, smaller size, a very fine central radula tooth, and different anal plate form and color pattern. It also differs from L. liozonis in having longer marginal spicules. Rev. Biol. Trop. 58 (2: 635-644. Epub 2010 June 02.

  16. A Semantic Big Data Platform for Integrating Heterogeneous Wearable Data in Healthcare.

    Mezghani, Emna; Exposito, Ernesto; Drira, Khalil; Da Silveira, Marcos; Pruski, Cédric

    2015-12-01

    Advances supported by emerging wearable technologies in healthcare promise patients a provision of high quality of care. Wearable computing systems represent one of the most thrust areas used to transform traditional healthcare systems into active systems able to continuously monitor and control the patients' health in order to manage their care at an early stage. However, their proliferation creates challenges related to data management and integration. The diversity and variety of wearable data related to healthcare, their huge volume and their distribution make data processing and analytics more difficult. In this paper, we propose a generic semantic big data architecture based on the "Knowledge as a Service" approach to cope with heterogeneity and scalability challenges. Our main contribution focuses on enriching the NIST Big Data model with semantics in order to smartly understand the collected data, and generate more accurate and valuable information by correlating scattered medical data stemming from multiple wearable devices or/and from other distributed data sources. We have implemented and evaluated a Wearable KaaS platform to smartly manage heterogeneous data coming from wearable devices in order to assist the physicians in supervising the patient health evolution and keep the patient up-to-date about his/her status.

  17. A Baltic bio-bibliography - international lawyers of the Baltic region, past and present / Peter Macalister-Smith

    Macalister-Smith, Peter

    2005-01-01

    Eestist: Küllike Jürimäe (s. 1962, Euroopa Ühenduste Kohtu esimese astme kohtu kohtunik alates 12. maist 2004) ; Uno Lõhmus (s. 1952, Euroopa Kohtu kohtunik alates 11. maist 2004) ; Rait Maruste (s. 1953, Euroopa Inimõiguste Kohtu kohtunik) ; Rein Müllerson (s. 1944, Institut de droit international liige, valiti aastal 1995) ; Ants Piip (1884-1942, rahvusvahelise õiguse uurija) ; Kaarel Robert Pusta (1883-1964, Institut de droit international liige, valiti aastal 1932) ; Otto Strandman (1875-1941, Permanent Court of International Justice - kohtunik 1938, 1939) ; Henn-Jüri Uibopuu (s. 1929, rahvusvahelise õiguse uurija) ; Abner T. Uustal (1915-1985, rahvusvahelise õiguse uurija). Lisatud: A note on F. F. Martens (1845-1909), lk. 159-164 (Friedrich Frommhold Martens, Frederic de Martens, Fjodor Fjodorovitsh Martens)

  18. Kas nii nagu ikka? : Eesti Sisearhitektide Liidu 2010. aasta preemiad / Ene Läkk

    Läkk, Ene, 1957-

    2011-01-01

    Konkursist "Eesti interjöörid ja mööblidisain 2010". Söögikoha interjööri preemia: kohvik Supelsaksad Pärnus (Ruth ja Anna Huimerind), ühiskondliku interjööri preemia: ADM Interactive'i bürooruumid Tallinnas (Tomomi Hayashi, Ahti Grünberg, Kerli Valk), ajaloolise interjööri preemia: Kihnu muuseum (Malle Jürgenson, Tea Tammelaan, Krista Lepland, Jaak Huimerind, Indrek Laos), näituse- ja installatsiooni kujunduse preemia: rändnäitus "Eesti kirjanik karikatuuris" (Janno Siimar, Kaarel Vahtramäe, Mart Lankots, Liina Jakobson), tudengipreemia - Aet Tera. 24 nominenti loetletud

  19. Maastrichti Jan van Eyck'i akadeemia,.Kaasaegse Kunsti Eesti Keskuse ja Salzburgi kunstiühingu ühisprojekt "Trichtlinnburg"...

    2005-01-01

    Projekt käsitleb massiturismi ja linnade arengu teemat. Viru Keskuses 9.-15. V Sanja Ivekovici ja Kaarel Kurismaa tööde näitus. "Tallinna vaatleja" Hobusepea galeriis hõlmab filmiprogrammi ja Tallinna miljööteemalise fotonäituse. Raekoja platsil Silja Saarepuu ja Villu Plingi objekt "Plats" (voldiku on kujundanud Maris Lindoja, fotod on teinud Arne Maasik). Jüri Ojaveri aktsioon "Pääsla" Pikal ja Hobusepea t. Eriks Bozhise aktsioon "Astud siin". Siram publitseerib ajalehte "Ilus elu". August Künnapu ja Jasper Zoova teevad Magasini t. Tallinna vanglasse seinamaali "Kolm pühameest". Marianne Männi ja Rauno Teideri projekt "Erutav Eestimaa". Laineli Parresti "Sabatants", algus Raekoja platsil. Tiina Tammetalu "Seirajad" trammides, Hirvepargis ja Kaarli pst. Antakse välja Liina Siibi toimetatud raamat "Tallinna praktikad"

  20. Lepidochitona bullocki, una nueva especie de quitón (Polyplacophora: Ischnochitonidae del Caribe colombiano

    Cedar I. García-Ríos

    2011-09-01

    Full Text Available El género Lepidochitona (Gray 1821 se encuentra representado en el Caribe por tres especies: L. liozonis (Dall & Simpson 1901, L. rosea (Kaas 1972 y L. rufoi. Veinte ejemplares de L. bullocki sp. nov. Fueron recolectados en un recorrido a lo largo del litoral rocoso, entre el norte de la playa del Rodadero y Puerto Luz, en Santa Marta, Colombia. Los ejemplares son pequeños, hasta 7.3mm, fueron recolectados a mano, entre 0.25 y 1.5m de profundidad, a distancias entre 1 y 5m de la orilla. Esta es la cuarta especie del género que se describe para el Caribe. Las tres especies previamente descritas son L. liozonis (Dall & Simpson, 1901, L. rosea Kaas, 1972 y L. rufoi García-Ríos, 2010. L. bullocki se diferencia de L. liozonis y L. rosea por tener la superficie del tegumento irregular y de otros colores. La misma se distingue de L. rufoi por tener muchas espículas hialinas largas, mayor tamaño, dientes centrales de la rádula anchos. Es la única especie del género en el Caribe que se localiza con mayor frecuencia en la superficie iluminada de las rocas, en el sublitoral somero.Lepidochitona bullocki, a new species of chiton (Polyplacophora: Ischnochitonidae from the Colombian Caribbean. The genus Lepidochitona is one of the most diverse in the Southern Caribbean. In order to describe this new species, twenty specimens of L. bullocki sp. nov. were collected by hand on the rocky coast, from 0.25 to 1.5m depth, and a shore distance of 1 to 5m, between the Northern section of Rodadero beach and Puerto Luz, in Santa Marta, Colombia. The specimens were small, with maximum observed size of 7.3mm. This is the fourth species of the genus Lepidochitona described for the Caribbean. The previously known species were L. liozonis (Dall & Simpson 1901, L. rosea (Kaas 1972 and L. rufoi (García-Ríos 2010. L. bullocki differs from L. liozonis and L. rosea in having a rough tegmentum and color. It differs from L. rufoi in having longer and numerous hyaline

  1. Comparison of Chemical Extraction Methods for Determination of Soil Potassium in Different Soil Types

    Zebec, V.; Rastija, D.; Lončarić, Z.; Bensa, A.; Popović, B.; Ivezić, V.

    2017-12-01

    Determining potassium supply of soil plays an important role in intensive crop production, since it is the basis for balancing nutrients and issuing fertilizer recommendations for achieving high and stable yields within economic feasibility. The aim of this study was to compare the different extraction methods of soil potassium from arable horizon of different types of soils with ammonium lactate method (KAL), which is frequently used as analytical method for determining the accessibility of nutrients and it is a common method used for issuing fertilizer recommendations in many Europe countries. In addition to the ammonium lactate method (KAL, pH 3.75), potassium was extracted with ammonium acetate (KAA, pH 7), ammonium acetate ethylenediaminetetraacetic acid (KAAEDTA, pH 4.6), Bray (KBRAY, pH 2.6) and with barium chloride (K_{BaCl_2 }, pH 8.1). The analyzed soils were extremely heterogeneous with a wide range of determined values. Soil pH reaction ( {pH_{H_2 O} } ) ranged from 4.77 to 8.75, organic matter content ranged from 1.87 to 4.94% and clay content from 8.03 to 37.07%. In relation to KAL method as the standard method, K_{BaCl_2 } method extracts 12.9% more on average of soil potassium, while in relation to standard method, on average KAA extracts 5.3%, KAAEDTA 10.3%, and KBRAY 27.5% less of potassium. Comparison of analyzed extraction methods of potassium from the soil is of high precision, and most reliable comparison was KAL method with KAAEDTA, followed by a: KAA, K_{BaCl_2 } and KBRAY method. Extremely significant statistical correlation between different extractive methods for determining potassium in the soil indicates that any of the methods can be used to accurately predict the concentration of potassium in the soil, and that carried out research can be used to create prediction model for concentration of potassium based on different methods of extraction.

  2. Professor og DMI

    Kaas, Eigil

    2010-01-01

    Det er koldt, og det har det været længe. Sammen med sneen har det en selvforstærkende effekt på vintervejret, forklarer professor og meteorolog. Kulde: - Det er koldt, fordi vinden kommer fra et sted, hvor det er koldt. Det er den enkle forklaring på, at Danmark og store dele af Europa lige nu...... oplever meget lave temperaturer - og for Danmarks vedkommende en usædvanlig lang periode med vintervejr. Forklaringen kommer fra professor Eigil Kaas fra Niels Bohr Instituttet ved Københavns Universitet. Han forklarer til jp.dk, at vintervejret dog er betinget af den mere eller mindre tilfældige måde...

  3. Eesti teatri aastaauhinnad 2004

    2005-01-01

    Lavastajaauhind Tiit Ojasoo, naisnäitleja auhind Epp Eespäev, meesnäitleja Hendrik Toompere jun, naiskõrvalosatäitja Kadri Lepp, meeskõrvalosatäitja Herardo Kontreras, kunstnikuauhind Jaak Vaus, žürii eriauhind lavastaja Anne Türnpule ja kunstnik Liina Tepandile "Valgelaev ja taevakäijad" eest, kriitikuauhind Kristiina Garancis, Kristallkingakese auhind Mirtel Pohla ja Kaspar Jancis, muusikalavastuse auhind "Eesti ballaadid" kooslusele ja Heli Veskusele, tantsulavastuse auhind Maria Seletskajale ja ZUGA Ühendatud Tantsijatele, Priit Põldroosi preemia Aime Unt, Ants Lauteri preemia Indrek Saar, Liina Vahtrik, Salme Reegi preemia Peeter Tammearu, Aleksander Kurtna preemia Martin Algus, Natalie Mei preemia Eldor Renter, balleti- ja tantsulavastuse eriauhind Kaie Kõrb, Georg Otsa preemia Mati Kõrts, parima teatritöötaja auhind : Riina Roose, Jane Kaas, Ott Mölter, Eda Kaljo, Aino Kartul, Kaja Kupp, Ain Jürisson, Jelena Oleinikova, Kalle Kuningas ja Moonika Lausvee

  4. Diversidad y microestructura de quitones (Mollusca: Polyplacophora del Caribe de Costa Rica

    Cedar I García-Ríos

    2011-03-01

    Full Text Available Los poliplacóforos asociados a los arrecifes de coral en la costa caribeña de Costa Rica han sido poco estudiados. El examen del cascajo de coral acumulado en el sublitoral somero, en cuatro estaciones de colección, localizadas en la Provincia de Limón reveló una diversidad de quitones mayor a la documentada. Anteriormente se habían registrado ocho especies para el Caribe costaricense: Ischnochiton erythronotus (C.B. Adams, 1845; Ischnoplax pectinata (Sowerby 1840; Stenoplax boogii (Haddon, 1886; S. purpurascens (C.B. Adams, 1845; Acanthopleura granulata (Gmelin, 1791; Chiton marmoratus Gmelin, 1791; C. tuberculatus Linnaeus, 1758; Acanthochitona rhodea (Pilsbry, 1893. Otras cinco se registran aquí por primera vez: Callistochiton portobelensis Ferreira 1976; Ischnochiton kaasi Ferreira 1987; I. pseudovirgatus Kaas 1972; Acanthochitona balesae Abbott 1954; Cryptoconchus floridanus (Dall 1889.

  5. Diversidad y microestructura de quitones (Mollusca: Polyplacophora del Caribe de Costa Rica

    Cedar I García-Ríos

    2011-03-01

    Full Text Available Los poliplacóforos asociados a los arrecifes de coral en la costa caribeña de Costa Rica han sido poco estudiados. El examen del cascajo de coral acumulado en el sublitoral somero, en cuatro estaciones de colección, localizadas en la Provincia de Limón reveló una diversidad de quitones mayor a la documentada. Anteriormente se habían registrado ocho especies para el Caribe costaricense: Ischnochiton erythronotus (C.B. Adams, 1845; Ischnoplax pectinata (Sowerby 1840; Stenoplax boogii (Haddon, 1886; S. purpurascens (C.B. Adams, 1845; Acanthopleura granulata (Gmelin, 1791; Chiton marmoratus Gmelin, 1791; C. tuberculatus Linnaeus, 1758; Acanthochitona rhodea (Pilsbry, 1893. Otras cinco se registran aquí por primera vez: Callistochiton portobelensis Ferreira 1976; Ischnochiton kaasi Ferreira 1987; I. pseudovirgatus Kaas 1972; Acanthochitona balesae Abbott 1954; Cryptoconchus floridanus (Dall 1889.Diversity and microstructure of quitons (Mollusca: Polyplacophora from the Caribbean of Costa Rica. The polyplacophorans of the coral reef on the Caribbean coast of Costa Rica have been insufficiently studied. The examination of coral rubble accumulated in the shallow sublitoral waters on four collection stations in Provincia Limón revealed a higher diversity of chitons than was documented. From the country eight species were previously known: Ischnochiton erythronotus (C.B. Adams 1845; Ischnoplax pectinata (Sowerby 1840; Stenoplax boogii (Haddon 1886; S. purpurascens (C.B. Adams 1845; Acanthopleura granulate (Gmelin 1791; Chiton marmoratus Gmelin 1791; C. tuberculatus Linnaeus 1758 and Acanthochitona rhodea (Pilsbry 1893. This study added five more species that are reported here for the first time: Callistochiton portobelensis Ferreira 1976; Ischnochiton kaasi Ferreira 1987; I. pseudovirgatus Kaas 1972; Acanthochitona balesae Abbott 1954 and Cryptoconchus floridanus (Dall 1889. Rev. Biol. Trop. 59 (1: 129-136. Epub 2011 March 01.

  6. Semi-Lagrangian methods in air pollution models

    A. B. Hansen

    2011-06-01

    Full Text Available Various semi-Lagrangian methods are tested with respect to advection in air pollution modeling. The aim is to find a method fulfilling as many of the desirable properties by Rasch andWilliamson (1990 and Machenhauer et al. (2008 as possible. The focus in this study is on accuracy and local mass conservation.

    The methods tested are, first, classical semi-Lagrangian cubic interpolation, see e.g. Durran (1999, second, semi-Lagrangian cubic cascade interpolation, by Nair et al. (2002, third, semi-Lagrangian cubic interpolation with the modified interpolation weights, Locally Mass Conserving Semi-Lagrangian (LMCSL, by Kaas (2008, and last, semi-Lagrangian cubic interpolation with a locally mass conserving monotonic filter by Kaas and Nielsen (2010.

    Semi-Lagrangian (SL interpolation is a classical method for atmospheric modeling, cascade interpolation is more efficient computationally, modified interpolation weights assure mass conservation and the locally mass conserving monotonic filter imposes monotonicity.

    All schemes are tested with advection alone or with advection and chemistry together under both typical rural and urban conditions using different temporal and spatial resolution. The methods are compared with a current state-of-the-art scheme, Accurate Space Derivatives (ASD, see Frohn et al. (2002, presently used at the National Environmental Research Institute (NERI in Denmark. To enable a consistent comparison only non-divergent flow configurations are tested.

    The test cases are based either on the traditional slotted cylinder or the rotating cone, where the schemes' ability to model both steep gradients and slopes are challenged.

    The tests showed that the locally mass conserving monotonic filter improved the results significantly for some of the test cases, however, not for all. It was found that the semi-Lagrangian schemes, in almost every case, were not able to outperform the current ASD scheme

  7. Influence of Diet Balanced with Essential Amino Acids / Keto Acid Analogs and High-Nutrient Blend on the Progression of Renal Failure in Patients in the Pre-Dialysis Stage of Chronic Kidney Disease Caused by Systemic Autoimmune Diseases

    I.I. Aleksandrova

    2013-09-01

    Full Text Available The aim of the study was to evaluate the effect of a low protein diet (LPD balanced with essential amino acids (EAA / keto acid analogs (KAA and protein “SUPRO-XT 219D” in the composition of the high-energy nutrient blend (HENB for slow down of renal failure in patients in the pre-dialysis stage of chronic kidney disease (CKD induced by systemic autoimmune diseases (SAD.Material and Methods: In this study, 46 patients (35 with systemic lupus erythematosus and 15 with various forms of systemic vasculitis with CKD in stages 3-4 were randomized into three groups. Group 1 (18 patients: 10 with CKD stage 3 and 8 with CKD stage 4 was given LPD (0.6 g protein per kg of body weight per day comprising 0.3 g of vegetable protein and 0.3 g of animal protein balanced with EAA/KAA (Diet #1; Group 2 (18 patients: 9 with CKD stage 3 and 9 with CKD stage 4 was given the same LPD, but with an increased vegetable protein content (purified soy protein SUPRO-XT 219D up to 0.4 g/kg/day in the composition of HENB (Diet #2; Group 3, comparison group, (10 patients: 7 with CKD stage 3 and 3 with CKD stage 4 was given a free diet (Diet #3 based on the patient’s personal preferences. Both options of LPD were offered to all the patients of Groups 1 and 2 regardless of their baseline nutritional status (NS. The duration of the observation was 24-48 months. The NS was evaluated based on the bioelectrical impedance analysis. The protein and calorie intake was calculated from the 3-day food diary.Results: Among the 46 patients with CKD stages 3-4, NS impairment was detected in almost half the patients (45.7%. Both forms of LPD were well tolerated. The correction of the nutritive impairment was achieved in patients with baseline impaired NS; the remaining patients of Groups 1 and 2 demonstrated the safety of NS against LPD. At the same time, among Group 3 patients, during the progression of renal disorders, the NS rate was observed to increase by 1.5 times (from 40% to 60

  8. Microbiological characteristics of "androlla", a Spanish traditional pork sausage.

    García Fontán, María C; Lorenzo, José M; Parada, Ana; Franco, Inmaculada; Carballo, Javier

    2007-02-01

    Counts of total aerobic mesophilic microflora, lactic acid bacteria, salt-tolerant microflora, Enterobacteriaceae, enterococci, moulds and yeasts, and staphylococci, and some physico-chemical parameters (total solids, NaCl and nitrate contents and pH and aw values) were determined in 20 units of "androlla", a traditional dry-fermented sausage made in the NW of Spain. In general, high counts of all the investigated microbial groups were observed, with average values of 8.99 +/- 0.46 log cfu/g for the total aerobic mesophilic microflora, 9.11 +/- 0.16 log cfu/g for the lactic acid bacteria, 6.87 +/- 0.68 log cfu/g for the salt-tolerant microflora, 2.80+/-1.85 log cfu/g for the Enterobacteriaceae, 3.25 +/- 1.86 log cfu/g for the enterococci, 4.30 +/- 1.73 log cfu/g for the moulds and yeasts, and 3.62 +/- 0.60 log cfu/g for the staphylococci. From MRS agar, SPC agar + 7.5% NaCl, VRBG agar, and KAA agar, 10 colonies were randomly taken from each androlla unit and from each culture medium. A total of 200 strains per culture medium were then identified using the classical methods. Among the isolates from MRS agar, Lactobacillus sakei predominated, followed by Lactobacillus curvatus, Lactobacillus alimentarius and Lactobacillus plantarum. Of the 200 isolates obtained from SPC agar + 7.5% NaCl, only 56 strains belonged to the Staphylococcaceae or Micrococcaceae families. Among the Staphylococcaceae, Staphylococcus xylosus was the main species, followed by Staph. epidermidis; Staph. equorum, Staph. capitis and Staph. saprophyticus were isolated in very low proportions. Among the Micrococcaceae, Micrococcus luteus predominated, followed by Micrococcus lylae, Kocuria varians and Kocuria kristinae. Of the 150 isolates obtained from VRBG agar, Hafnia alvei was the main species, followed by Serratia liquefaciens and Enterobacter amnigenus; six isolates were identified as Salmonella. Among the 190 isolates obtained from KAA agar, 122 were considered enterococci; 20 isolates were

  9. KONTROLÖR ALAN AĞI ESASLI BİR ATM ALAN TAŞITININ TASARLANMASI

    Mahmut TENRUH

    2006-03-01

    Full Text Available Kontrolör Alan Ağı (KAA taşıtı başlangıçta otomotiv uygulamaları için önerilmiş fakat düşük maliyeti yüksek hızı ve güvenilirliği sayesinde endüstriyel dağılımlı gerçek zamanlı kontrol uygulamalarında da bir standart haline gelmiştir. ATM veri, ses ve görüntü gibi tüm haberleşme türlerini bir network yapısı içerisinde birleştirmeyi hedefleyen hızlı bir ağ teknolojisidir. Ethernet ve Token Ring gibi mevcut ağ türlerinin ATM ile bağlanması için çeşitli çalışmalar sürdürülmüştür. Kontrol Taşıtı haberleşmesinin de bu çerçevede ele alınması önem taşımaktadır. Bu çalışma ATM teknolojisinin Kontrol Taşıtı haberleşmesi ile birlikte kullanılmasını amaçlamaktadır. Bu kapsamda KAA esaslı ATM Taşıt yapısı sunulmaktadır. Bu yapı aynı zamanda Kontrol Taşıt ağlarının ATM ağları ile doğrudan bağlanabilmesi için de bir imkan sunmaktadır. Önerilen modelin geçerliliğini görmek amacıyla simülasyon çalışmaları yürütülmüş ve sonuçlar sistemin ek avantajlarla uygulanabilir olduğunu göstermiştir.

  10. Kuidas sünnib pealkiri? / Pärt Lias

    Lias, Pärt

    2002-01-01

    Pealkiri, pühendus, moto, joonealune märge, ees- ja järelsõna on teose teksti manused, mis ei kuulu otse teksti, kuid selgitavad, täiendavad ja täpsustavad seda. Gerard Genette on need teksti lisandid koondanud üldnimetuse paratekstid alla. Eesti kirjanikud vastavad Pärt Liase küsimusele oma teoste pealkirjade saamisloo kohta: Aimee Beekman, Henn-Kaarel Hellat, Joel Sang ja Arvo Mägi (4); Lennart Meri, Heino Kiik ja Fanny de Sivers (5); Helga Nõu, Ülle Kauksi, Maie Kalda ja Cornelius Hasselblatt (6); Debora Vaarandi, Vaino Vahing, Arved Viirlaid ja Wimberg (7); Vahur Afanasjev, Matt Barker, Andrus Kivirähk, Jürgen Rooste ja Contra (8); Elin Toona, Jaak Rähesoo, Enn Soosaar, Juhan Peegel ja Toomas Kall (9); Kerttu Rakke, Aare Pilv, Aarne Ruben, Indrek Hargla, Jan Kaus ja Karen Orlau (10); Ene Mihkelson, Mats Traat ja Boriss Baljasnõi (11); Maimu Berg, Ain Kaalep, Enn Nõu ja Madis Kõiv (12)

  11. In memoriam 1999

    2000-01-01

    Leopold Ennosaar (10. VI 1920-21. I), Silva Jaanberg (6. III 1922-5. X), Hilja Jõgi (31. X 1927-4. III), Lydia Jõõts (22. II 1911-27. XII), Ludvig Kruusmaa (19. XII 1920-7. XII), Ilmar Laasi (29. VII 1907-15. VIII), Urmas Mikk (25. XII 1957-15. I), Kaarel Pedak (12. V 1914-4. XII), Voldemar Peil (5. XI 1907-17. X), Aulin Rimm (27. VII 1930-21. IX), Igor Roosaar (6. XI 1915-17. X), Elle Tikerpäe (30. XI 1935-7. III), Aurora Tippe (23. I 1913-2. I), Ilmar Torn (1. I 1921-10. I), Tõnu Tulev (26. V 1955-26. VII), Voldemar Vaga (29. VI 1899-22. II), Ingi Vaher (31. V 1930-24. X), Aksel Vallaste (6. VI 1918-13. XII), Bernard Buffet (10. VII 1928-4. X), Raimo Kanerva (22. VIII 1941-17. IX).

  12. Remarkable Anti-Trichomonas vaginalis Activity of Plants Traditionally Used by the Mbyá-Guarani Indigenous Group in Brazil

    Clara Lia Costa Brandelli

    2013-01-01

    Full Text Available Trichomonas vaginalis, a flagellate protozoan, is the causative agent of trichomonosis, the most common nonviral sexually transmitted disease worldwide. Taking into account the increased prevalence of metronidazole-resistant isolates, alternative drugs are essential for the successful treatment. Natural products are the source of most new drugs, and popular wisdom about the use of medicinal plants is a powerful tool in this search. In this study, the activity of 10 medicinal plants extensively used in daily life by Mbyá-Guarani indigenous group was evaluated against seven different T. vaginalis isolates. Among the aqueous extracts tested, Verbena sp. (Guachu ka'a in Mbyá-Guarani language and Campomanesia xanthocarpa (Guavira in Mbyá-Guarani language showed the highest activity against T. vaginalis with MIC value of 4.0 mg/mL reaching 100% of efficacy against the parasite. The kinetic growth assays showed that the extracts promoted complete growth abolishment after 4 h of incubation. In addition, the extracts tested did not promote a significant hemolytic activity against human erythrocytes. Our results show for the first time the potential activity of Verbena sp. and C. xanthocarpa against T. vaginalis. In addition, this study demonstrates that indigenous knowledge is an important source of new prototype antiprotozoal agents.

  13. Remarkable anti-trichomonas vaginalis activity of plants traditionally used by the Mbyá-Guarani indigenous group in Brazil.

    Brandelli, Clara Lia Costa; Vieira, Patrícia de Brum; Macedo, Alexandre José; Tasca, Tiana

    2013-01-01

    Trichomonas vaginalis, a flagellate protozoan, is the causative agent of trichomonosis, the most common nonviral sexually transmitted disease worldwide. Taking into account the increased prevalence of metronidazole-resistant isolates, alternative drugs are essential for the successful treatment. Natural products are the source of most new drugs, and popular wisdom about the use of medicinal plants is a powerful tool in this search. In this study, the activity of 10 medicinal plants extensively used in daily life by Mbyá-Guarani indigenous group was evaluated against seven different T. vaginalis isolates. Among the aqueous extracts tested, Verbena sp. (Guachu ka'a in Mbyá-Guarani language) and Campomanesia xanthocarpa (Guavira in Mbyá-Guarani language) showed the highest activity against T. vaginalis with MIC value of 4.0 mg/mL reaching 100% of efficacy against the parasite. The kinetic growth assays showed that the extracts promoted complete growth abolishment after 4 h of incubation. In addition, the extracts tested did not promote a significant hemolytic activity against human erythrocytes. Our results show for the first time the potential activity of Verbena sp. and C. xanthocarpa against T. vaginalis. In addition, this study demonstrates that indigenous knowledge is an important source of new prototype antiprotozoal agents.

  14. Mining the Proteome of subsp. ATCC 25586 for Potential Therapeutics Discovery: An Approach

    Abdul Musaweer Habib

    2016-12-01

    Full Text Available The plethora of genome sequence information of bacteria in recent times has ushered in many novel strategies for antibacterial drug discovery and facilitated medical science to take up the challenge of the increasing resistance of pathogenic bacteria to current antibiotics. In this study, we adopted subtractive genomics approach to analyze the whole genome sequence of the Fusobacterium nucleatum, a human oral pathogen having association with colorectal cancer. Our study divulged 1,499 proteins of F. nucleatum, which have no homolog's in human genome. These proteins were subjected to screening further by using the Database of Essential Genes (DEG that resulted in the identification of 32 vitally important proteins for the bacterium. Subsequent analysis of the identified pivotal proteins, using the Kyoto Encyclopedia of Genes and Genomes (KEGG Automated Annotation Server (KAAS resulted in sorting 3 key enzymes of F. nucleatum that may be good candidates as potential drug targets, since they are unique for the bacterium and absent in humans. In addition, we have demonstrated the three dimensional structure of these three proteins. Finally, determination of ligand binding sites of the 2 key proteins as well as screening for functional inhibitors that best fitted with the ligands sites were conducted to discover effective novel therapeutic compounds against F. nucleatum.

  15. Distributed Data Service for Data Management in Internet of Things Middleware

    Ruben Cruz Huacarpuma

    2017-04-01

    Full Text Available The development of the Internet of Things (IoT is closely related to a considerable increase in the number and variety of devices connected to the Internet. Sensors have become a regular component of our environment, as well as smart phones and other devices that continuously collect data about our lives even without our intervention. With such connected devices, a broad range of applications has been developed and deployed, including those dealing with massive volumes of data. In this paper, we introduce a Distributed Data Service (DDS to collect and process data for IoT environments. One central goal of this DDS is to enable multiple and distinct IoT middleware systems to share common data services from a loosely-coupled provider. In this context, we propose a new specification of functionalities for a DDS and the conception of the corresponding techniques for collecting, filtering and storing data conveniently and efficiently in this environment. Another contribution is a data aggregation component that is proposed to support efficient real-time data querying. To validate its data collecting and querying functionalities and performance, the proposed DDS is evaluated in two case studies regarding a simulated smart home system, the first case devoted to evaluating data collection and aggregation when the DDS is interacting with the UIoT middleware, and the second aimed at comparing the DDS data collection with this same functionality implemented within the Kaa middleware.

  16. Distributed Data Service for Data Management in Internet of Things Middleware

    Cruz Huacarpuma, Ruben; de Sousa Junior, Rafael Timoteo; de Holanda, Maristela Terto; de Oliveira Albuquerque, Robson; García Villalba, Luis Javier; Kim, Tai-Hoon

    2017-01-01

    The development of the Internet of Things (IoT) is closely related to a considerable increase in the number and variety of devices connected to the Internet. Sensors have become a regular component of our environment, as well as smart phones and other devices that continuously collect data about our lives even without our intervention. With such connected devices, a broad range of applications has been developed and deployed, including those dealing with massive volumes of data. In this paper, we introduce a Distributed Data Service (DDS) to collect and process data for IoT environments. One central goal of this DDS is to enable multiple and distinct IoT middleware systems to share common data services from a loosely-coupled provider. In this context, we propose a new specification of functionalities for a DDS and the conception of the corresponding techniques for collecting, filtering and storing data conveniently and efficiently in this environment. Another contribution is a data aggregation component that is proposed to support efficient real-time data querying. To validate its data collecting and querying functionalities and performance, the proposed DDS is evaluated in two case studies regarding a simulated smart home system, the first case devoted to evaluating data collection and aggregation when the DDS is interacting with the UIoT middleware, and the second aimed at comparing the DDS data collection with this same functionality implemented within the Kaa middleware. PMID:28448469

  17. Variable elasticity of substituition in a discrete time Solow–Swan growth model with differential saving

    Brianzoni, Serena; Mammana, Cristiana; Michetti, Elisabetta

    2012-01-01

    Highlights: ► One dimensional piecewise smooth map: border collision bifurcations. ► Numerical simulations: complex dynamics. ► Ves production function in the solow–swan growth model and comparison with the ces production function. - Abstract: We study the dynamics shown by the discrete time neoclassical one-sector growth model with differential savings as in Bohm and Kaas while assuming VES production function in the form given by Revankar . It is shown that the model can exhibit unbounded endogenous growth despite the absence of exogenous technical change and the presence of non-reproducible factors if the elasticity of substitution is greater than one. We then consider parameters range related to non-trivial dynamics (i.e. the elasticity of substitution in less than one and shareholders save more than workers) and we focus on local and global bifurcations causing the transition to more and more complex asymptotic dynamics. In particular, as our map is non-differentiable in a subset of the states space, we show that border collision bifurcations occur. Several numerical simulations support the analysis.

  18. Bounds for Asian basket options

    Deelstra, Griselda; Diallo, Ibrahima; Vanmaele, Michèle

    2008-09-01

    In this paper we propose pricing bounds for European-style discrete arithmetic Asian basket options in a Black and Scholes framework. We start from methods used for basket options and Asian options. First, we use the general approach for deriving upper and lower bounds for stop-loss premia of sums of non-independent random variables as in Kaas et al. [Upper and lower bounds for sums of random variables, Insurance Math. Econom. 27 (2000) 151-168] or Dhaene et al. [The concept of comonotonicity in actuarial science and finance: theory, Insurance Math. Econom. 31(1) (2002) 3-33]. We generalize the methods in Deelstra et al. [Pricing of arithmetic basket options by conditioning, Insurance Math. Econom. 34 (2004) 55-57] and Vanmaele et al. [Bounds for the price of discrete sampled arithmetic Asian options, J. Comput. Appl. Math. 185(1) (2006) 51-90]. Afterwards we show how to derive an analytical closed-form expression for a lower bound in the non-comonotonic case. Finally, we derive upper bounds for Asian basket options by applying techniques as in Thompson [Fast narrow bounds on the value of Asian options, Working Paper, University of Cambridge, 1999] and Lord [Partially exact and bounded approximations for arithmetic Asian options, J. Comput. Finance 10 (2) (2006) 1-52]. Numerical results are included and on the basis of our numerical tests, we explain which method we recommend depending on moneyness and time-to-maturity.

  19. Distributed Data Service for Data Management in Internet of Things Middleware.

    Cruz Huacarpuma, Ruben; de Sousa Junior, Rafael Timoteo; de Holanda, Maristela Terto; de Oliveira Albuquerque, Robson; García Villalba, Luis Javier; Kim, Tai-Hoon

    2017-04-27

    The development of the Internet of Things (IoT) is closely related to a considerable increase in the number and variety of devices connected to the Internet. Sensors have become a regular component of our environment, as well as smart phones and other devices that continuously collect data about our lives even without our intervention. With such connected devices, a broad range of applications has been developed and deployed, including those dealing with massive volumes of data. In this paper, we introduce a Distributed Data Service (DDS) to collect and process data for IoT environments. One central goal of this DDS is to enable multiple and distinct IoT middleware systems to share common data services from a loosely-coupled provider. In this context, we propose a new specification of functionalities for a DDS and the conception of the corresponding techniques for collecting, filtering and storing data conveniently and efficiently in this environment. Another contribution is a data aggregation component that is proposed to support efficient real-time data querying. To validate its data collecting and querying functionalities and performance, the proposed DDS is evaluated in two case studies regarding a simulated smart home system, the first case devoted to evaluating data collection and aggregation when the DDS is interacting with the UIoT middleware, and the second aimed at comparing the DDS data collection with this same functionality implemented within the Kaa middleware.

  20. High-Resolution Modelling of Health Impacts from Air Pollution for Denmark using the Integrated Model System EVA

    Brandt, Jørgen; Andersen, Mikael S.; Bønløkke, Jakob; Christensen, Jesper H.; Hansen, Kaj M.; Hertel, Ole; Im, Ulas; Jensen, Steen S.; Ketzel, Matthias; Nielsen, Ole-Kenneth; Plejdrup, Marlene S.; Sigsgaard, Torben; Geels, Camilla

    2015-04-01

    , J., J. D. Silver, L. M. Frohn, C. Geels, A. Gross, A. B. Hansen, K. M. Hansen, G. B. Hedegaard, C. A. Skjøth, H. Villadsen, A. Zare, and J. H. Christensen, 2012: An integrated model study for Europe and North America using the Danish Eulerian Hemispheric Model with focus on intercontinental transport. Atmospheric Environment, Volume 53, June 2012, pp. 156-176, doi:10.1016/j.atmosenv.2012.01.011 Brandt, J., J. D. Silver, J. H. Christensen, M. S. Andersen, J. Bønløkke, T. Sigsgaard, C. Geels, A. Gross, A. B. Hansen, K. M. Hansen, G. B. Hedegaard, E. Kaas and L. M. Frohn, 2013a: "Contribution from the ten major emission sectors in Europe to the Health-Cost Externalities of Air Pollution using the EVA Model System - an integrated modelling approach". Atmospheric Chemistry and Physics, Vol. 13, pp. 7725-7746, 2013. www.atmos-chem-phys.net/13/7725/2013/, doi:10.5194/acp-13-7725-2013. Brandt, J., J. D. Silver, J. H. Christensen, M. S. Andersen, J. Bønløkke, T. Sigsgaard, C. Geels, A. Gross, A. B. Hansen, K. M. Hansen, G. B. Hedegaard, E. Kaas and L. M. Frohn, 2013b: "Assessment of Past, Present and Future Health-Cost Externalities of Air Pollution in Europe and the contribution from international ship traffic using the EVA Model System". Atmospheric Chemistry and Physics. Vol. 13, pp. 7747-7764, 2013. www.atmos-chem-phys.net/13/7747/2013/. doi:10.5194/acp-13-7747-2013. Plejdrup, M.S., Gyldenkærne, S., 2011. Spatial distribution of pollutants to air - the SPREAD model. NERI Technical Report No. 823.

  1. Kahua A';o--A Learning Foundation: Using Hawaiian Language Newspaper Articles for Science and Science Education

    Chinn, P. W.; Businger, S.

    2013-12-01

    Kahua A';o, an NSF OEDG project, utilizes Hawaiian language newspaper articles written between 1843 and 1948 in lessons and professional development intended to increase participation of underrepresented Native Hawaiian students in earth science. Guided by sociocultural theories that view learning as experiential and culturally situated, geoscientists (Steven Businger, Scott Rowland, Floyd McCoy, UG student Kelly Lance); Hawaiian translators (M. Puakea Nogelmeier, GRAs Kapomaikai Stone and Iasona Ellinwood); science educators (Pauline Chinn, graduate student Lindsey Spencer), utilize articles to develop place-based meteorology and geology curricula for middle school teachers. Articles are valuable to science and science education: Native Hawaiians are citizen scientists who recorded, interpreted, and communicated findings to potentially critical audiences, while dated, descriptive, eye witness reports provide data on events unrecorded by westerners. Articles reveal Hawaiian intellectual tradition placed great value on environmental knowledge. Moolelo (traditional stories) e.g., Kuapākaa (Nakuina, 1905), translated as The Wind Gourd of Laamaomao, tells of Kuapākaa controlling all the winds of Hawai';i by chanting their names--a metaphor for the power of knowledge of winds, rains and their patterns. In the moolelo of Kalapana, a boy hero challenges and defeats the king of Kauai to a life-and-death riddling contest (Nakuina, 1902). Maly's (2001) translation of a riddle involving 22 zones spanning mountaintop to deep-sea underscores the knowledge base informing sustainable practices. Articles provide insight into indigenous maps (Nogelmeier, personal communication) while riddling contests (Beckwith, 1940/1970) establish demonstrations of knowledge as central to power, identity, and status. Eight field-based lessons have been presented to formal and informal science educators, with teachers adapting lessons for 3rd-12th grade students. Graduate students Spencer, Stone

  2. Distribution of cortical neurons projecting to the superior colliculus in macaque monkeys

    Cerkevich CM

    2014-09-01

    Full Text Available Christina M Cerkevich,1 David C Lyon,2 Pooja Balaram,3 Jon H Kaas3 1Department of Neurobiology, University of Pittsburgh School of Medicine, Systems Neuroscience Institute, Pittsburgh, PA, USA; 2Department of Anatomy and Neurobiology, University of California, Irvine, CA, USA; 3Department of Psychology, Vanderbilt University, Nashville, TN, USA Abstract: To better reveal the pattern of corticotectal projections to the superficial layers of the superior colliculus (SC, we made a total of ten retrograde tracer injections into the SC of three macaque monkeys (Macaca mulatta. The majority of these injections were in the superficial layers of the SC, which process visual information. To isolate inputs to the purely visual layers in the superficial SC from those inputs to the motor and multisensory layers deeper in the SC, two injections were placed to include the intermediate and deep layers of the SC. In another case, an injection was placed in the medial pulvinar, a nucleus not known to be strongly connected with visual cortex, to identify possible projections from tracer spread past the lateral boundary of the SC. Four conclusions are supported by the results: 1 all early visual areas of cortex, including V1, V2, V3, and the middle temporal area, project to the superficial layers of the SC; 2 with the possible exception of the frontal eye field, few areas of cortex outside of the early visual areas project to the superficial SC, although many do, however, project to the intermediate and deep layers of the SC; 3 roughly matching retinotopy is conserved in the projections of visual areas to the SC; and 4 the projections from different visual areas are similarly dense, although projections from early visual areas appear somewhat denser than those of higher order visual areas in macaque cortex. Keywords: visual cortex, superior colliculus, frontal eye field, posterior parietal cortex, visual system

  3. Patchy distributions of myelin and vesicular glutamate transporter 2 align with cytochrome oxidase blobs and interblobs in the superficial layers of the primary visual cortex

    Rockoff EC

    2014-09-01

    Full Text Available Emily C Rockoff,1 Pooja Balaram,1 Jon H Kaas1,2 1Department of Psychology, 2Department of Cell and Molecular Biology, Vanderbilt University, Nashville, TN, USA Abstract: Blobs are a modular component of the primary visual cortex (area 17 of all primates, but not of other mammals closely related to primates. They are characterized as an even distribution of patches, puffs, or blobs of dense cytochrome oxidase (CO expression in layer III of area 17, and are now known to differ from surrounding, nonblob cortex in thalamic, intrinsic, and extrastriate connections. Previous studies have also recognized a blob-like pattern of myelin-dense patches in layer III of area 17 of primates, and more recently the vesicular glutamate transporter (VGLUT-2 isoform of the VGLUT family has been found to selectively distribute to layer III patches in a similar blob-like pattern. Here, we sought to determine if the blob-like patterns all identify the same modular structures in area 17 of primates by staining alternate brain sections cut parallel to the surface of area 17 of a prosimian primate (Otolemur garnettii for CO, myelin, and VGLUT2. By aligning the sections from the three preparations, we provide clear evidence that the three preparations all identify the same modular blob structures. The results provide a further understanding of the functional nature of the blobs by demonstrating that their higher level of CO activity is related to thalamic inputs from the lateral geniculate nucleus that use VGLUT2 as their main glutamate transporter, and via myelinated axons. Keywords: columns, modules, visual cortex, primates, prosimians

  4. Identification of putative drug targets in Vancomycin-resistant Staphylococcus aureus (VRSA) using computer aided protein data analysis.

    Hasan, Md Anayet; Khan, Md Arif; Sharmin, Tahmina; Hasan Mazumder, Md Habibul; Chowdhury, Afrin Sultana

    2016-01-01

    Vancomycin-resistant Staphylococcus aureus (VRSA) is a Gram-positive, facultative aerobic bacterium which is evolved from the extensive exposure of Vancomycin to Methicillin resistant S. aureus (MRSA) that had become the most common cause of hospital and community-acquired infections. Due to the emergence of different antibiotic resistance strains, there is an exigency to develop novel drug targets to address the provocation of multidrug-resistant bacteria. In this study, in-silico genome subtraction methodology was used to design potential and pathogen specific drug targets against VRSA. Our study divulged 1987 proteins from the proteome of 34,549 proteins, which have no homologues in human genome after sequential analysis through CD-HIT and BLASTp. The high stringency analysis of the remaining proteins against database of essential genes (DEG) resulted in 169 proteins which are essential for S. aureus. Metabolic pathway analysis of human host and pathogen by KAAS at the KEGG server sorted out 19 proteins involved in unique metabolic pathways. 26 human non-homologous membrane-bound essential proteins including 4 which were also involved in unique metabolic pathway were deduced through PSORTb, CELLO v.2.5, ngLOC. Functional classification of uncharacterized proteins through SVMprot derived 7 human non-homologous membrane-bound hypothetical essential proteins. Study of potential drug target against Drug Bank revealed pbpA-penicillin-binding protein 1 and hypothetical protein MQW_01796 as the best drug target candidate. 2D structure was predicted by PRED-TMBB, 3D structure and functional analysis was also performed. Protein-protein interaction network of potential drug target proteins was analyzed by using STRING. The identified drug targets are expected to have great potential for designing novel drugs against VRSA infections and further screening of the compounds against these new targets may result in the discovery of novel therapeutic compounds that can be

  5. Structural and Function Prediction of Musa acuminata subsp. Malaccensis Protein

    Anum Munir

    2016-03-01

    Full Text Available Hypothetical proteins (HPs are the proteins whose presence has been anticipated, yet in vivo function has not been built up. Illustrating the structural and functional privileged insights of these HPs might likewise prompt a superior comprehension of the protein-protein associations or networks in diverse types of life. Bananas (Musa acuminata spp., including sweet and cooking types, are giant perennial monocotyledonous herbs of the order Zingiberales, a sister grouped to the all-around considered Poales, which incorporate oats. Bananas are crucial for nourishment security in numerous tropical and subtropical nations and the most prominent organic product in industrialized nations. In the present study, the hypothetical protein of M. acuminata (Banana was chosen for analysis and modeling by distinctive bioinformatics apparatuses and databases. As indicated by primary and secondary structure analysis, XP_009393594.1 is a stable hydrophobic protein containing a noteworthy extent of α-helices; Homology modeling was done utilizing SWISS-MODEL server where the templates identity with XP_009393594.1 protein was less which demonstrated novelty of our protein. Ab initio strategy was conducted to produce its 3D structure. A few evaluations of quality assessment and validation parameters determined the generated protein model as stable with genuinely great quality. Functional analysis was completed by ProtFun 2.2, and KEGG (KAAS, recommended that the hypothetical protein is a transcription factor with cytoplasmic domain as zinc finger. The protein was observed to be vital for translation process, involved in metabolism, signaling and cellular processes, genetic information processing and Zinc ion binding. It is suggested that further test approval would help to anticipate the structures and functions of other uncharacterized proteins of different plants and living being.

  6. Histological features of layers and sublayers in cortical visual areas V1 and V2 of chimpanzees, macaque monkeys, and humans

    Balaram P

    2014-09-01

    Full Text Available Pooja Balaram, Nicole A Young, Jon H Kaas Department of Psychology, Vanderbilt University, Nashville, TN, USA Abstract: The layers and sublayers of primary visual cortex, or V1, in primates are easily distinguishable compared to those in other cortical areas, and are especially distinct in anthropoid primates – monkeys, apes, and humans – where they also vary in histological appearance. This variation in primate-specific specialization has led to a longstanding confusion over the identity of layer 4 and its proposed sublayers in V1. As the application of different histological markers relate to the issue of defining and identifying layers and sublayers, we applied four traditional and four more recent histological markers to brain sections of V1 and adjoining secondary visual cortex (V2 in macaque monkeys, chimpanzees, and humans in order to compare identifiable layers and sublayers in both cortical areas across these species. The use of Nissl, neuronal nuclear antigen (NeuN, Gallyas myelin, cytochrome oxidase (CO, acetylcholinesterase (AChE, nonphosphorylated neurofilament H (SMI-32, parvalbumin (PV, and vesicular glutamate transporter 2 (VGLUT2 preparations support the conclusion that the most popular scheme of V1 lamination, that of Brodmann, misidentifies sublayers of layer 3 (3Bβ and 3C as sublayers of layer 4 (4A and 4B, and that the specialized sublayer of layer 3 in monkeys, 3Bβ, is not present in humans. These differences in interpretation are important as they relate to the proposed functions of layer 4 in primate species, where layer 4 of V1 is a layer that receives and processes information from the visual thalamus, and layer 3 is a layer that transforms and distributes information to other cortical areas. Keywords: area 17, area 18, cortical layers, histology, immunohistochemistry

  7. GC-MS profile of antimicrobial and antioxidant fractions from Cordia rothii roots.

    Khan, Kehkashan; Firdous, Sadiqa; Ahmad, Aqeel; Fayyaz, Nida; Nadir, Muhammad; Rasheed, Munawwer; Faizi, Shaheen

    2016-11-01

    An ethnobotanical survey of Cordia rothii Roem. & Schult. (Boraginaceae) reveals it as a medicinal plant. Antimicrobial and antioxidant potential evaluation and identification of chemical constituents via GC-MS of C. rothii roots fractions. To the best of our knowledge, this is the first systematic investigation of the roots exploiting GC-MS. Extraction and fractionation of C. rothii roots furnished various fractions using solvents of varying polarity, i.e., n-hexane, chloroform, ethyl acetate, acetone and methanol. In vitro antimicrobial and antioxidant screening was performed using disk diffusion and DPPH methods, respectively. MIC of active fractions was also determined using disk diffusion method. GC-MS was used to identify constituents which may be responsible for these activities. Among various fractions from C. rothii roots, fraction KA-C showed strong antibacterial activity against 17 microorganisms tested, with MIC ranging from 250-31.25 μg/mL. Fractions KA-A, KM and KM-A exhibited significant antioxidant potential with EC 50 46.875 μg/mL, while fractions KEA-PE, KM-PE and KM-M were good with EC 50 93.750 μg/mL. Forty-five phytochemicals were identified in GC-MS studies including eight hydrocarbons, six free fatty acids, 11 fatty acids esters, two phenylpropanoids, four aromatics, four terpenoid quinones/hydroquinones, three triterpenes, four phytosterols, two hexose metabolites and a DNA base. Of these, 32 constituents have been reported for the first time from C. rothii, 24 from genus Cordia and 15 from Boraginaceae. Strong antibacterial and antioxidant potential of C. rothii roots may be due to the contribution of phytoconstituents identified through GC-MS studies.

  8. Supramolecular Properties of Triazole-containing Two Armed Peptidomimetics: From Organogelators to Nucleotide-binding Tweezers

    Chui, Tin Ki

    This thesis described the development of a new type of branched peptidomimetics using a class of previously reported triazole-containing peptidomimetics as the structural motif. The propensity of these new branched peptiomimetics in being an organogelator, forming supramolecular assemblies and recognizing anions and biomolecules was investigated. The quest began with the preparation of two different series of branched peptidomimetics, namely 69-K-aa3 (aa = V or L) and 70-B-aa3. The former series made use of the flexible L-lysine (K) as the branching unit while the latter series was composed of the relatively rigid 3,5-diminobenzoate (B). In each series, the peptidomimetic arms were composed of solely valine (V) or leucine (L). The effects of the identity of the amino acids and the branching units on the gelation and self-assembling properties of these branched bis(tripeptidomimetic)s were investigated. The 69-K-aa3 series was found to exhibit poor solubility in common organic solvents yet it was able to form strong and stable gels in aromatic solvents. The 70-B-aa3 series, on the other hand, was a poor organogelator despite its excellent solubility. Morphological studies using scanning electron microscopy (SEM) and transmission electron microscopy (TEM) revealed the ability of the former to form a hyperbranched 3D network whereas the latter was only capable of forming isolated spherical lumps. Nevertheless, the latter displayed the ability in forming supramolecular polymers as shown from viscometric studies. Solution-to-gel transition temperature measurement of the gels formed by the 69-K-aa3 series and association constants determination by 1H NMR titration experiments for the supramolecular polymerization of the 70-B-aa3 series both suggested that peptidomimetic arms comprised of valine performed better than those made up of leucine in terms of association strength, and such a difference was attributed to the bulkier nature of the leucine side chain. In order to

  9. Lasteaia ja lõbumaja vahel : eesti proosa 2008 / Vaapo Vaher

    Vaher, Vaapo, 1945-

    2009-01-01

    Ülevaade 2008. aasta eesti proosast. Pikemalt käsitletakse järgmisi autoreid ja nende teoseid: Mihkel Raud "Musta pori näkku", Olev Remsu "Musketäride muundumised", Rein Põder "Juba olnud", Juhan Nurme "Ligimene", Jaan Tangsoo "Méduse'i parv", Esta Aksli "Tare poole tõttaja", Mari Saat "Lasnamäe lunastaja", Peeter Morgen "Sõnum", Mait Raun "Dr. Mööbi seiklused Inglismaal", Andrei Hvostov "Võõrad lood" ja "Projektijuht Posse", Chaneldior "Kontrolli alt väljas", Vahur Afanasjev "Kosmos", Egon Ilisson "Isased", Jaak Leer "Kaks kabanossi ja Maaja", Kärt Hellerma "Sinine missa", Elo Viiding "Püha Maama", Toomas Raudam "Miks ma ei taha olla kirjanik?", Mart Kivastik "Kurb raamat", Jüri Tuulik "Räim, pisike kena kala", Tarmo Teder "12 jõulujuttu", Dagmar Lamp (koostaja) "Tule, ma jutustan sulle loo", Eia Uus "Kahe näoga jumal", Barthol Lo Mejor "Popdada 2007-2008", Anti Saar "Nemad kaks", Ketlin Priilinn "Liiseli võti" ja "Vaim", Aita Kivi "Lähedal", Marje Ernits "Hoia mu kätt", Kati Murutar "Naisena sündinud : kakskümmend aastat hiljem", Tuule Lind "Pööratud tuul", Siiri Laidla "Lihtne lugu, ehk, Senta suvepuhkus", Kätlin Padesaar "Veel üks paradiis", Aimée Beekman "Proovielu", Lehte Hainslau "Kolmkõla, ehk, 3 kõla", Ira Lember "Ööviiulid", Tamur Kusnets "Hundipäikese aeg : metsiku jahi algus", Kaupo Pähkel "Ehatähe rüütel", Arvo Valton "Ülemiste vanake", Tiit Aleksejev "Palveränd", Ants Eret "Afgaanide vang", Mario Merirand "Afganistani päevik", Leo Kunnas "Gort Ashryn", Rein Raud "Vend", Peeter Sauter "Beibi bluu", Marion Andra "Pimend", Kristjan Sander "13 talvist hetke", Helga Nõu "Peaaegu geenius, ehk, Schrödingeri kassi otsimas", Tiit Sepa "Eefa hüüdnimega Siug", Kaarel ja Klaara Kivi "Varandus seinal", Merike Jürjo "Mälestusteta maja", Rein Vahisalu "Viies kabinet", Aarne Biin "Mees otsib naist", Erik Tohvri "Ümberasujad" ja "Sulasest sai peremees", Arnold Laugus "Elav maa", Jüri v. Grauberg "Selguse poole", J

  10. Lasteaia ja lõbumaja vahel : Eesti proosa 2008 / Vaapo Vaher

    Vaher, Vaapo, 1945-

    2012-01-01

    Ülevaade 2008. aasta eesti proosast. Pikemalt käsitletakse järgmisi autoreid ja nende teoseid: Mihkel Raud "Musta pori näkku", Olev Remsu "Musketäride muundumised", Rein Põder "Juba olnud", Juhan Nurme "Ligimene", Jaan Tangsoo "Méduse'i parv", Esta Aksli "Tare poole tõttaja", Mari Saat "Lasnamäe lunastaja", Peeter Morgen "Sõnum", Mait Raun "Dr. Mööbi seiklused Inglismaal", Andrei Hvostov "Võõrad lood" ja "Projektijuht Posse", Chaneldior "Kontrolli alt väljas", Vahur Afanasjev "Kosmos", Egon Ilisson "Isased", Jaak Leer "Kaks kabanossi ja Maaja", Kärt Hellerma "Sinine missa", Elo Viiding "Püha Maama", Toomas Raudam "Miks ma ei taha olla kirjanik?", Mart Kivastik "Kurb raamat", Jüri Tuulik "Räim, pisike kena kala", Tarmo Teder "12 jõulujuttu", Dagmar Lamp (koostaja) "Tule, ma jutustan sulle loo", Eia Uus "Kahe näoga jumal", Barthol Lo Mejor "Popdada 2007-2008", Anti Saar "Nemad kaks", Ketlin Priilinn "Liiseli võti" ja "Vaim", Aita Kivi "Lähedal", Marje Ernits "Hoia mu kätt", Kati Murutar "Naisena sündinud : kakskümmend aastat hiljem", Tuule Lind "Pööratud tuul", Siiri Laidla "Lihtne lugu, ehk, Senta suvepuhkus", Kätlin Padesaar "Veel üks paradiis", Aimée Beekman "Proovielu", Lehte Hainslau "Kolmkõla, ehk, 3 kõla", Ira Lember "Ööviiulid", Tamur Kusnets "Hundipäikese aeg : metsiku jahi algus", Kaupo Pähkel "Ehatähe rüütel", Arvo Valton "Ülemiste vanake", Tiit Aleksejev "Palveränd", Ants Eret "Afgaanide vang", Mario Merirand "Afganistani päevik", Leo Kunnas "Gort Ashryn", Rein Raud "Vend", Peeter Sauter "Beibi bluu", Marion Andra "Pimend", Kristjan Sander "13 talvist hetke", Helga Nõu "Peaaegu geenius, ehk, Schrödingeri kassi otsimas", Tiit Sepa "Eefa hüüdnimega Siug", Kaarel ja Klaara Kivi "Varandus seinal", Merike Jürjo "Mälestusteta maja", Rein Vahisalu "Viies kabinet", Aarne Biin "Mees otsib naist", Erik Tohvri "Ümberasujad" ja "Sulasest sai peremees", Arnold Laugus "Elav maa", Jüri v. Grauberg "Selguse poole", J

  11. Mastimännid ja muu mets : mitmekülgsuse võlu Eesti proosast aastal 2007 / Sirje Olesk

    Olesk, Sirje, 1954-

    2008-01-01

    Ülevaade 2007. aasta eesti proosast. Käsitletakse järgimisi autoreid ja nende teoseid: Ene Mihkelson "Katkuhaud", Andrus Kivirähk "Mees, kes teadis ussisõnu", Jaan Kaplinski "Seesama jõgi", Tõnu Õnnepalu "Flandria päevik", Toomas Vint "Mäluauguga naine", Indrek Hargla "French ja Koulu Tarbatus", Kalle Käsper "Buridanid IV", Jaan Tooming "Teekond mäe südamesse", Ustav Mikelsaar "Tunnimehed", Henn Mikelsaar "Teema variatsioonidega", Reet Kudu "Pidupäevad võõrsil", Mara Maret Aronovich "Tagasikäiguga edasi", Aimée Beekman "Proovielu", Valentine Nõlvak "Ellujääja : mälestused", Mehis Heinsaar "Rändaja õnn", Maimu Berg "Unustatud inimesed", Mats Traat "Sarviku armastus : valik kultuuriloolisi novelle", Mihkel Mutt "Siseemigrant : novellid Rui taevalike kommentaaridega", Paavo Kivine "Kaks kavaleri", Kärt Hellerma "Ma armastasin David Copperfieldi", Piret Bristol "Paralleelmeri", Imre Siil "Mereröövlite loss", Kalju Saaber "Issanda loomaaed. Viru sektor", Veiko Märka "Lendas üle marmortahvli", Vahur Afanasjev "Kaadrid otsustavad, ehk, Sööbik ja Pisik seiklevad jälle, ehk, Eesti rahva lühike, kuid õnnelik ajalugu, Ehk kirjalik komejant tühjusest", Aarne Ruuben "Lugusid Anveltist ja Kingissepast", Epp Annus "Sina, Matilda", Peeter Helme "Puudutus", Ivar Sild "Tantsiv linn", Tui Hirv "Tähe tänav. Per musica ad astra", Tiina Laanem "Väikesed vanamehed", Angela Hofberg (pseud.) "Päev nagu elu", Marion Andra "Vähemalt...", Olle Lauli "Niguliste õpilased", Aarne Biin "Linna valitsemine", Erik Tohvri "Mürgiliblikas", Riina Kangur "Elisa", Kerttu Rakke "Küpsiseparadiis", Epp Petrone ja Dagmar Reintam "Õun ära süüa?", Elme Väljaste "Päriselu Proletariaadi puiesteel", Ketlin Priilinn "Hõbeingel", Ira Lember "Kohvik pärnade all", Paul Pajos "Krimijutud edasijõudnuile", Andres Anvelt "Punane elavhõbe", Klaara ja Kaarel Kivi "Mõrvasügis", Tiit Sepa "Hommik ühele", Lembit Uustulnd "Ruutuemanda sündroom : rahvusvaheline

  12. Genome-wide analysis of regulatory proteases sequences identified through bioinformatics data mining in Taenia solium.

    Yan, Hong-Bin; Lou, Zhong-Zi; Li, Li; Brindley, Paul J; Zheng, Yadong; Luo, Xuenong; Hou, Junling; Guo, Aijiang; Jia, Wan-Zhong; Cai, Xuepeng

    2014-06-04

    Cysticercosis remains a major neglected tropical disease of humanity in many regions, especially in sub-Saharan Africa, Central America and elsewhere. Owing to the emerging drug resistance and the inability of current drugs to prevent re-infection, identification of novel vaccines and chemotherapeutic agents against Taenia solium and related helminth pathogens is a public health priority. The T. solium genome and the predicted proteome were reported recently, providing a wealth of information from which new interventional targets might be identified. In order to characterize and classify the entire repertoire of protease-encoding genes of T. solium, which act fundamental biological roles in all life processes, we analyzed the predicted proteins of this cestode through a combination of bioinformatics tools. Functional annotation was performed to yield insights into the signaling processes relevant to the complex developmental cycle of this tapeworm and to highlight a suite of the proteases as potential intervention targets. Within the genome of this helminth parasite, we identified 200 open reading frames encoding proteases from five clans, which correspond to 1.68% of the 11,902 protein-encoding genes predicted to be present in its genome. These proteases include calpains, cytosolic, mitochondrial signal peptidases, ubiquitylation related proteins, and others. Many not only show significant similarity to proteases in the Conserved Domain Database but have conserved active sites and catalytic domains. KEGG Automatic Annotation Server (KAAS) analysis indicated that ~60% of these proteases share strong sequence identities with proteins of the KEGG database, which are involved in human disease, metabolic pathways, genetic information processes, cellular processes, environmental information processes and organismal systems. Also, we identified signal peptides and transmembrane helices through comparative analysis with classes of important regulatory proteases

  13. Absorption and emission behaviour of trans- p-coumaric acid in aqueous solutions and some organic solvents

    Putschögl, M.; Zirak, P.; Penzkofer, A.

    2008-01-01

    The absorption and fluorescence behaviour of trans- p-coumaric acid ( trans-4-hydroxycinnamic acid) is investigated in buffered aqueous solution over a wide range from pH 1 to pH 12, in un-buffered water, and in some organic solvents. Absorption cross-section spectra, fluorescence quantum distributions, fluorescence quantum yields, and degrees of fluorescence polarisation are measured. p-Coumaric acid exists in different ionic forms in aqueous solution depending on the pH. There is an equilibrium between the neutral form ( p-CAH 2) and the single anionic form ( p-CAH -) at low pH (p Kna ≈ 4.9), and between the single anionic and the double anionic form ( p-CA 2-) at high pH (p Kaa ≈ 9.35). In the organic solvents studied trans- p-coumaric acid is dissolved in its neutral form. The fluorescence quantum yield of trans- p-coumaric acid in aqueous solution is ϕF ≈ 1.4 × 10 -4 for the neutral and the single anionic form, while it is ϕF ≈ 1.3 × 10 -3 for the double anionic form. For trans- p-coumaric acid in organic solvents fluorescence quantum yields in the range from 4.8 × 10 -5 (acetonitrile) to 1.5 × 10 -4 (glycerol) were measured. The fluorescence spectra are 7700-10,000 cm -1 Stokes shifted in aqueous solution, and 5400-8200 cm -1 Stokes shifted in the studied organic solvents. Decay paths responsible for the low fluorescence quantum yields are discussed (photo-isomerisation and internal conversion for p-CA 2-, solvent-assisted intra-molecular charge-transfer or ππ ∗ to nπ ∗ transfer and internal conversion for p-CAH 2 and p-CAH -). The solvent dependence of the first ππ ∗ electronic transition frequency and of the fluorescence Stokes shift of p-CAH 2 is discussed in terms of polar solute-solvent interaction effects. Thereby the ground-state and excite-state molecular dipole moments are extracted.

  14. Functional annotation and pathway analysis of genes differentially expressed in different stages of Plasmodium falciparum using RNA-Seq Data

    Sanjay Kumar Singh

    2017-12-01

    Full Text Available Plasmodium falciparum, the deadly protozoan parasite, causes malaria. Malaria remains one of the deadliest infectious diseases in the world. The RNA-Seq data sets were downloaded from NCBI Short Read Archive under accession number SRP009370 for our analysis. Differentially expressed genes (DEGs between Ring (R and early trophozoite (ET, late trophozoite (LT, schizont (Sc, gametocyte stages (GII, gametocyte stages (GV, ookinete (Oo stages are 2442, 2796, 2935, 2807, 2180, 2895 respectively. There are total 4594 unique DEGs in the samples. DAVID was used to categorize enriched biological themes in the list of DEGs. It can be seen that main functions related to GO term ‘Biological Process’ are antigenic variation, pathogenesis, single organismal cell-cell adhesion, GO term ‘Cellular Component’ are host cell plasma membrane, infected host cell surface knob and GO term ‘Molecular Function’ are cell adhesion molecule binding, ATP-dependent RNA helicase activity. We found that PF3D7_1000400, PF3D7_1000600, PF3D7_0900500, PF3D7_0901500, PF3D7_0937400 were most up regulated and PF3D7_0632800, PF3D7_0711700, PF3D7_0712400, PF3D7_0712600, PF3D7_0712900, PF3D7_0808600 and PF3D7_0808700 were most down regulated genes involved in antigenic variation. Also PF3D7_0930300 was most up-regulated in Sc, LT and Oo stages and PF3D7_0936500 was most up-regulated in GV stage and PF3D7_0632800, PF3D7_0711700, PF3D7_0712400, PF3D7_0712600, PF3D7_0712900, PF3D7_0808600, PF3D7_0808700 were most down regulated genes involved in pathogenesis. A total of 300 pathways were predicted using KAAS server. Majority of the DEGs were found to be associated with important biological pathways such as metabolic pathways, biosynthesis of secondary metabolites, ribosome, spliceosome, biosynthesis of antibiotics, purine metabolism.

  15. High-resolution modelling of health impacts from air pollution using the integrated model system EVA

    Brandt, Jørgen; Andersen, Mikael S.; Bønløkke, Jakob; Christensen, Jesper H.; Geels, Camilla; Hansen, Kaj M.; Jensen, Steen S.; Ketzel, Matthias; Plejdrup, Marlene S.; Sigsgaard, Torben; Silver, Jeremy D.

    2014-05-01

    we have used a coupling of two chemistry transport models to calculate the air pollution concentration at different scales; the Danish Eulerian Hemispheric Model to calculate the air pollution levels with a resolution down to 5.6 km x 5.6 km and the Urban Background Model to further calculate the air pollution at 1 km x 1 km resolution using results from DEHM as boundary conditions. Both the emission data as well as the population density has been represented in the model system with the same high resolution. Previous health impact assessments related to air pollution have been made on a lower resolution. In this study, the integrated model system, EVA, has been used to estimate the health impacts and related external cost for Denmark over a 20 year period (1990-2010) at a 1 km x 1 km resolution. Furthermore, a sensitivity study of the health impact using coarse and fine resolutions in the model system has been carried out to evaluate the effect of improved description of the geographical population distribution with respect to location of local emissions. Brandt, J., J. D. Silver, J. H. Christensen, M. S. Andersen, J. Bønløkke, T. Sigsgaard, C. Geels, A. Gross, A. B. Hansen, K. M. Hansen, G. B. Hedegaard, E. Kaas and L. M. Frohn, 2013. Contribution from the ten major emission sectors in Europe to the Health-Cost Externalities of Air Pollution using the EVA Model System - an integrated modelling approach. Atmospheric Chemistry and Physics, Vol. 13, pp. 7725-7746, 2013. Brandt, J., J. D. Silver, J. H. Christensen, M. S. Andersen, J. Bønløkke, T. Sigsgaard, C. Geels, A. Gross, A. B. Hansen, K. M. Hansen, G. B. Hedegaard, E. Kaas and L. M. Frohn, 2013. Assessment of Past, Present and Future Health-Cost Externalities of Air Pollution in Europe and the contribution from international ship traffic using the EVA Model System. Atmospheric Chemistry and Physics. Vol. 13, pp. 7747-7764, 2013.

  16. Observing a Burst with Sunglasses

    2003-11-01

    factor by which the lines in the spectrum of an object are shifted towards longer wavelengths. Since the redshift of a cosmological object increases with distance, the observed redshift of a remote galaxy also provides an estimate of its distance. [2]: Members of the team include Jochen Greiner, Arne Rau (Max-Planck-Institut für extraterrestrische Physik, Germany), Sylvio Klose, Bringfried Stecklum (Thüringer Landessternwarte Tautenburg, Germany), Klaus Reinsch (Universitätssternwarte Göttingen, Germany), Hans Martin Schmid (Institut für Astronomie Zürich, Switzerland ), Re'em Sari (California Institute of Technology, USA), Dieter H. Hartmann (Clemson University, USA), Chryssa Kouveliotou (NSSTC, Huntsville, Alabama, USA), Eliana Palazzi (Istituto di Astrofisica Spaziale e Fisica Cosmica, Bologna, Italy), Christian Straubmeier (Physikalisches Institut Köln, Germany), Sergej Zharikov, Gaghik Tovmassian (Instituto de Astronomia Ensenada, Mexico), Otto Bärnbantner, Christop Ries (Wendelstein-Observatorium München, Germany), Emmanuel Jehin, Andreas Kaufer (European Southern Observatory, Chile), Arne Henden (USNO Flagstaff, USA), Anlaug A. Kaas (NOT, La Palma, Spain), Tommy Grav (University of Oslo, N), Jens Hjorth, Holger Pedersen (Astronomical Observatory Copenhagen, Denmark), Ralph A.M.J. Wijers (Astronomical Institute Anton Pannekoek, Amsterdam, The Netherlands), Hye-Sook Park (Lawrence Livermore Nat. Laboratory, USA), Grant Williams (MMT Observatory, Tucson, USA), Olaf Reimer (Theoretische Weltraum- und Astrophysik Universität Bochum, Germany) [3]: When electrons - which are electrically charged - move through a magnetic field, they spiral around an axis defined by the local magnetic field. Electrons of high energy spiral very rapidly, at speeds near the speed of light. Under such conditions, the electrons emit highly polarised electromagnetic radiation. The intensity of this radiation is related to the strength of the magnetic field and the number and energy

  17. Selected Abstracts of the 1st Congress of joint European Neonatal Societies (jENS 2015; Budapest (Hungary; September 16-20, 2015; Session “Other”

    Various Authors

    2015-09-01

    , P.G. DavisABS 8. PERCEPTION OF NEONATAL SIMULATION AMONGST DIFFERENT PROFESSIONALS IN A LEVEL 3 NEONATAL UNIT: A 2-YEAR EXPERIENCE IN LUTON AND DUNSTABLE • D. Wari-Pepple, H. Doyle, S. Shanmugalingam, C. Chetcuti-GanadoABS 9. SUCCESS IN NEONATAL SKILLS & SCENARIO TEACHING IN NORTHERN IRELAND • C. Duncan, D. Leemon, D.L. ArmstrongABS 10. STRATEGIES FOR EFFECTIVE LEARNING AT THE INAUGURAL NEONATAL CRANIAL ULTRASOUND WORKSHOP • M.V. Fortier, D.K.L. Chan, V.R. BaralABS 11. FIRST DAYS IN NICU – ARE GRADUATES WELL PREPARED FOR WORK? • P. Ostrogórska, K. Lorenc, A. Dziad, A. Suder, A. Kulig, I. Opach, A. GniadekABS 12. A TWO SECOND VISUAL METRONOME IMPROVES CARDIAC COMPRESSIONS DURING NEWBORN RESUSCITATION SIMULATION • C. Henry, S. Coleman, E. Murphy, S. Tan, C. Tamakloe, P. Blanchfield, D. SharkeyABS 13. A NEW SURVEY IN NEONATAL RESUSCITATION IN SPAIN • M. Izquierdo, M. Iriondo, M. ThioABS 14. UMBILICAL ARTERY INSERTION IN NEWBORN INFANTS: ACCURACY OF 11 AVAILABLE FORMULAE TO GUIDE CATHETER TIP PLACEMENT • W.L. Lean, J.A. Dawson, C. Theda, P.G. Davis, M. ThioABS 15. THE INTEGRATION OF EFFECTIVE PERINATAL AND NEONATAL CARE IN KYRGYZSTAN • S. Abduvalieva, K. Uzakbaev, C. Rakhmanova, A. AskerovABS 16. NEONATAL VIDEOLARYNGOSCOPY AS A TEACHING AID – THE TRAINEES’ PERSPECTIVE • J.E. O’Shea, M. Thio, C.O.F. Kamlin, L. McGrory, C. Wong, M. Campbell, J. John, C. Roberts, C. Kuschel, P.G. DavisABS 17. STANDARDIZED PROCEDURAL SKILLS TRAINING WITH A DOCUMENTED LEARNING OUTCOME • K.J. Kyng, T. Skajaa, R. Kaa, S. Kerrn-Jespersen, K. Bennedsgaard, B. Høst, S. Rubak, T.B. HenriksenABS 18. ACCURACY OF METHODS TO ESTIMATE THE INSERTION LENGTH OF UMBILICAL VENOUS CATHETERS IN NEWBORN INFANTS • W.L. Lean, J.A. Dawson, C. Theda, P.G. Davis, M. ThioABS 19. OXYGEN SATURATION LEVELS IN PRETERM INFANTS IN DELIVERY ROOM • S. Uslu, U. Zubarioglu, S. Sozeri, A. Bulbul, M. Dursun, E. TurkogluABS 20. PRE-HOSPITAL TRANSPORT OF THE NEWBORN: AN UNKNOWN ENTITY? • L