WorldWideScience

Sample records for mouse mus musculus

  1. Evolution of major milk proteins in Mus musculus and Mus spretus mouse species: a genoproteomic analysis

    Directory of Open Access Journals (Sweden)

    Panthier Jean-Jacques

    2011-01-01

    Full Text Available Abstract Background Due to their high level of genotypic and phenotypic variability, Mus spretus strains were introduced in laboratories to investigate the genetic determinism of complex phenotypes including quantitative trait loci. Mus spretus diverged from Mus musculus around 2.5 million years ago and exhibits on average a single nucleotide polymorphism (SNP in every 100 base pairs when compared with any of the classical laboratory strains. A genoproteomic approach was used to assess polymorphism of the major milk proteins between SEG/Pas and C57BL/6J, two inbred strains of mice representative of Mus spretus and Mus musculus species, respectively. Results The milk protein concentration was dramatically reduced in the SEG/Pas strain by comparison with the C57BL/6J strain (34 ± 9 g/L vs. 125 ± 12 g/L, respectively. Nine major proteins were identified in both milks using RP-HPLC, bi-dimensional electrophoresis and MALDI-Tof mass spectrometry. Two caseins (β and αs1 and the whey acidic protein (WAP, showed distinct chromatographic and electrophoresis behaviours. These differences were partly explained by the occurrence of amino acid substitutions and splicing variants revealed by cDNA sequencing. A total of 34 SNPs were identified in the coding and 3'untranslated regions of the SEG/Pas Csn1s1 (11, Csn2 (7 and Wap (8 genes. In addition, a 3 nucleotide deletion leading to the loss of a serine residue at position 93 was found in the SEG/Pas Wap gene. Conclusion SNP frequencies found in three milk protein-encoding genes between Mus spretus and Mus musculus is twice the values previously reported at the whole genome level. However, the protein structure and post-translational modifications seem not to be affected by SNPs characterized in our study. Splicing mechanisms (cryptic splice site usage, exon skipping, error-prone junction sequence, already identified in casein genes from other species, likely explain the existence of multiple αs1-casein

  2. On the tear proteome of the house mouse (Mus musculus musculus in relation to chemical signalling

    Directory of Open Access Journals (Sweden)

    Romana Stopkova

    2017-07-01

    Full Text Available Mammalian tears are produced by lacrimal glands to protect eyes and may function in chemical communication and immunity. Recent studies on the house mouse chemical signalling revealed that major urinary proteins (MUPs are not individually unique in Mus musculus musculus. This fact stimulated us to look for other sexually dimorphic proteins that may—in combination with MUPs—contribute to a pool of chemical signals in tears. MUPs and other lipocalins including odorant binding proteins (OBPs have the capacity to selectively transport volatile organic compounds (VOCs in their eight-stranded beta barrel, thus we have generated the tear proteome of the house mouse to detect a wider pool of proteins that may be involved in chemical signalling. We have detected significant male-biased (7.8% and female-biased (7% proteins in tears. Those proteins that showed the most elevated sexual dimorphisms were highly expressed and belong to MUP, OBP, ESP (i.e., exocrine gland-secreted peptides, and SCGB/ABP (i.e., secretoglobin families. Thus, tears may have the potential to elicit sex-specific signals in combination by different proteins. Some tear lipocalins are not sexually dimorphic—with MUP20/darcin and OBP6 being good examples—and because all proteins may flow with tears through nasolacrimal ducts to nasal and oral cavities we suggest that their roles are wider than originally thought. Also, we have also detected several sexually dimorphic bactericidal proteins, thus further supporting an idea that males and females may have adopted alternative strategies in controlling microbiota thus yielding different VOC profiles.

  3. Coevolution of Cryptosporidium tyzzeri and the house mouse (Mus musculus)

    Czech Academy of Sciences Publication Activity Database

    Kváč, Martin; McEvoy, J.; Loudová, M.; Stenger, B.; Sak, Bohumil; Květoňová, Dana; Ditrich, Oleg; Rašková, Veronika; Moriarty, E.; Rost, M.; Macholán, Miloš; Piálek, Jaroslav

    2013-01-01

    Roč. 43, č. 10 (2013), s. 805-817 ISSN 0020-7519 R&D Projects: GA ČR GA206/08/0640; GA MŠk(CZ) LH11061 Institutional support: RVO:60077344 ; RVO:67985904 ; RVO:68081766 Keywords : Cryptosporidium tyzzeri * house mouse * hybrid zone * coevolution Subject RIV: EG - Zoology; GJ - Animal Vermins ; Diseases, Veterinary Medicine (BC-A) Impact factor: 3.404, year: 2013

  4. Host subspecific viral strains in European house mice: Murine cytomegalovirus in the Eastern (Mus musculus musculus) and Western house mouse (Mus musculus domesticus).

    Science.gov (United States)

    Čížková, Dagmar; Baird, Stuart J E; Těšíková, Jana; Voigt, Sebastian; Ľudovít, Ďureje; Piálek, Jaroslav; Goüy de Bellocq, Joëlle

    2018-06-09

    Murine cytomegalovirus (MCMV) has been reported from house mice (Mus musculus) worldwide, but only recently from Eastern house mice (M. m. musculus), of particular interest because they form a semi-permeable species barrier in Europe with Western house mice, M. m. domesticus. Here we report genome sequences of EastMCMV (from Eastern mice), and set these in the context of MCMV genomes from genus Mus hosts. We show EastMCMV and WestMCMV are genetically distinct. Phylogeny splitting analyses show a genome wide (94%) pattern consistent with no West-East introgression, the major exception (3.8%) being a genome-terminal region of duplicated genes involved in host immune system evasion. As expected from its function, this is a region of maintenance of ancestral polymorphism: The lack of clear splitting signal cannot be interpreted as evidence of introgression. The EastMCMV genome sequences reported here can therefore serve as a well-described resource for exploration of murid MCMV diversity. Copyright © 2018 Elsevier Inc. All rights reserved.

  5. Genomic resources for wild populations of the house mouse, Mus musculus and its close relative Mus spretus

    Science.gov (United States)

    Harr, Bettina; Karakoc, Emre; Neme, Rafik; Teschke, Meike; Pfeifle, Christine; Pezer, Željka; Babiker, Hiba; Linnenbrink, Miriam; Montero, Inka; Scavetta, Rick; Abai, Mohammad Reza; Molins, Marta Puente; Schlegel, Mathias; Ulrich, Rainer G.; Altmüller, Janine; Franitza, Marek; Büntge, Anna; Künzel, Sven; Tautz, Diethard

    2016-01-01

    Wild populations of the house mouse (Mus musculus) represent the raw genetic material for the classical inbred strains in biomedical research and are a major model system for evolutionary biology. We provide whole genome sequencing data of individuals representing natural populations of M. m. domesticus (24 individuals from 3 populations), M. m. helgolandicus (3 individuals), M. m. musculus (22 individuals from 3 populations) and M. spretus (8 individuals from one population). We use a single pipeline to map and call variants for these individuals and also include 10 additional individuals of M. m. castaneus for which genomic data are publically available. In addition, RNAseq data were obtained from 10 tissues of up to eight adult individuals from each of the three M. m. domesticus populations for which genomic data were collected. Data and analyses are presented via tracks viewable in the UCSC or IGV genome browsers. We also provide information on available outbred stocks and instructions on how to keep them in the laboratory. PMID:27622383

  6. Sexual selection and the rodent baculum: an intraspecific study in the house mouse (Mus musculus domesticus).

    Science.gov (United States)

    Ramm, Steven A; Khoo, Lin; Stockley, Paula

    2010-01-01

    The rapid divergence of genitalia is a pervasive trend in animal evolution, thought to be due to the action of sexual selection. To test predictions from the sexual selection hypothesis, we here report data on the allometry, variation, plasticity and condition dependence of baculum morphology in the house mouse (Mus musculus domesticus). We find that that baculum size: (a) exhibits no consistent pattern of allometric scaling (baculum size being in most cases unrelated to body size), (b) exhibits low to moderate levels of phenotypic variation, (c) does not exhibit phenotypic plasticity in response to differences in perceived levels of sexual competition and (d) exhibits limited evidence of condition dependence. These patterns provide only limited evidence in support of the sexual selection hypothesis, and no consistent support for any particular sexual selection mechanism; however, more direct measures of how genital morphology influences male fertilization success are required.

  7. THE PATTERN OF THE AGGRESSIVE BEHAVIOR IN THE LABORATORY MOUSE (MUS MUSCULUS

    Directory of Open Access Journals (Sweden)

    Maria BUNEA

    2010-01-01

    Full Text Available Nature has found solutions for decreasing the aggressive impulse, using various inhibitory mechanisms as means of balancing the forces between two fighting individuals, thus avoiding it to lead to the destruction of their own species. These nature's “ pacifyng” solutions are mostly found in animals which are armed with various potentially lethal “weapons”, while in species that live on large territoires and thus have the possibility to avoid conflict, these mechanisms are poorly developed. The purpose of this research is to study the extent of the inhibitory mechanisms against aggression in the laboratory mouse, species in which these mechanisms of diminishing aggression and of avoiding conflicts don't work the same in artificial conditions, where individuals are forced to live in small areas, and to identify the behavioral chains that form the innate manifestations of the aggressive behavior in Mus musculus sp. The results of this study show that in the circumstance of caged individuals, which are crowded so closely together, the intensity of aggression is increasing. The dominance hierarchy is well established after their first fight, but due to the spatial constraint and the fact that there is no place where to flee, the submissive individual oftenly fights back. In every single interraction the aggressive behavior follows a fixed action pattern.

  8. Micro-evolutionary divergence patterns of mandible shapes in wild house mouse (Mus musculus populations

    Directory of Open Access Journals (Sweden)

    Tautz Diethard

    2011-10-01

    Full Text Available Abstract Background Insights into the micro-evolutionary patterns of morphological traits require an assessment of the natural variation of the trait within and between populations and closely related species. The mouse mandible is a particularly suitable morphological trait for such an analysis, since it has long been used as a model to study the quantitative genetics of shape. In addition, many distinct populations, sub-species and closely related species are known for the house mouse. However, morphological comparisons among wild caught animals require an assessment in how far environmental and technical factors could interfere with the shape change measurements. Results Using geometric morphometrics, we have surveyed mandible shapes in 15 natural populations of the genus Mus, with a focus on the subspecies Mus musculus domesticus. In parallel we have carefully assessed possibly confounding technical and biological factors. We find that there are distinct differences on average between populations, subspecies and species, but these differences are smaller than differences between individuals within populations. Populations from summer-dry regions, although more ancestral, are less distinct from each other than are populations from the more recently colonized northern areas. Populations with especially distinct shapes occur in an area of sympatry of M. m. domesticus and M. spretus and on recently colonized sub-antarctic islands. We have also studied a number of inbred strains to assess in how far their mandible shapes resemble those from the wild. We find that they fall indeed into the shape space of natural variation between individuals in populations. Conclusions Although mandible shapes in natural populations can be influenced by environmental variables, these influences are insufficient to explain the average extent of shape differences between populations, such that evolutionary processes must be invoked to explain this level of diversity

  9. The role of salivary androgen-binding protein in reproductive isolation between two subspecies of house mouse: Mus musculus musculus and Mus musculus domesticus

    Czech Academy of Sciences Publication Activity Database

    Bímová, Barbora; Karn, R. C.; Piálek, Jaroslav

    2005-01-01

    Roč. 84, č. 3 (2005), s. 349-361 ISSN 0024-4066. [The genus Mus as a model for evolutionary studies - a symposium in honour of Louis Thaler. Brno, 28.07.2003-30.07.2003] R&D Projects: GA AV ČR IAA6093201; GA AV ČR IAA6045902 Grant - others:National Research Council(US) COBASE Institutional research plan: CEZ:AV0Z6093917 Keywords : assortative mating * hybrid zone * sexual selection Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.261, year: 2005

  10. Population biology of house mice (Mus musculus L.) on sub ...

    African Journals Online (AJOL)

    1993-05-03

    May 3, 1993 ... Studies on the feral house mouse Mus musculus in habitats ranging from deserts ... Previous studies on mice at Marion Island focused on ..... and food availability) may decrease the rate of development .... Wiley, New York.

  11. Early gene expression divergence between allopatric populations of the house mouse (Mus musculus domesticus).

    Science.gov (United States)

    Bryk, Jarosław; Somel, Mehmet; Lorenc, Anna; Teschke, Meike

    2013-03-01

    Divergence of gene expression is known to contribute to the differentiation and separation of populations and species, although the dynamics of this process in early stages of population divergence remains unclear. We analyzed gene expression differences in three organs (brain, liver, and testis) between two natural populations of Mus musculus domesticus that have been separated for at most 3000 years. We used two different microarray platforms to corroborate the results at a large scale and identified hundreds of genes with significant expression differences between the populations. We find that although the three tissues have similar number of differentially expressed genes, brain and liver have more tissue-specific genes than testis. Most genes show changes in a single tissue only, even when expressed in all tissues, supporting the notion that tissue-specific enhancers act as separable targets of evolution. In terms of functional categories, in brain and to a smaller extent in liver, we find transcription factors and their targets to be particularly variable between populations, similar to previous findings in primates. Testis, however, has a different set of differently expressed genes, both with respect to functional categories and overall correlation with the other tissues, the latter indicating that gene expression divergence of potential importance might be present in other datasets where no differences in fraction of differentially expressed genes were reported. Our results show that a significant amount of gene expression divergence quickly accumulates between allopatric populations.

  12. Efficacy and Palatability of Different Rodenticide Formulations Applied against House Mouse (Mus musculus L. in Plant Storage Facilities

    Directory of Open Access Journals (Sweden)

    Goran Jokić

    2008-01-01

    Full Text Available Palatability (daily intake of different rodenticide formulations based on bromadiolone was compared in experiments with house mouse (Mus musculus L. in agricultural storage facilities, and rodent numbers were assessed at the beginning and end of experiment, as well as rodenticide efficacy. The dynamic of bait intake was monitored for ten days in facilities of the Institute of Animal Husbandry in Zemun and the Agricultural Cooperatives at Starčevo and Omoljica. The experiments complied with the relevant standard method of OEPP/EPPO. Agricultural products were stored either as bulk commodities or in sacs laid on pallete racks in the treated facilities. Baits were laid in boxes on mice routes below palletes holding sacs and on places where significant damage had been observed, at 1-3 m spacing and in 10-20 g portions. Mouse abundance was estimated based on the highest and lowest daily intakes of bait by mice over a period of 10 days, which was divided by the mouse daily feed requirement. The presence of house mouse was also monitored over the next 20 days. The efficacy of test products was computed using Abbott’s formula.

  13. Genome patterns of selection and introgression of haplotypes in natural populations of the house mouse (Mus musculus.

    Directory of Open Access Journals (Sweden)

    Fabian Staubach

    Full Text Available General parameters of selection, such as the frequency and strength of positive selection in natural populations or the role of introgression, are still insufficiently understood. The house mouse (Mus musculus is a particularly well-suited model system to approach such questions, since it has a defined history of splits into subspecies and populations and since extensive genome information is available. We have used high-density single-nucleotide polymorphism (SNP typing arrays to assess genomic patterns of positive selection and introgression of alleles in two natural populations of each of the subspecies M. m. domesticus and M. m. musculus. Applying different statistical procedures, we find a large number of regions subject to apparent selective sweeps, indicating frequent positive selection on rare alleles or novel mutations. Genes in the regions include well-studied imprinted loci (e.g. Plagl1/Zac1, homologues of human genes involved in adaptations (e.g. alpha-amylase genes or in genetic diseases (e.g. Huntingtin and Parkin. Haplotype matching between the two subspecies reveals a large number of haplotypes that show patterns of introgression from specific populations of the respective other subspecies, with at least 10% of the genome being affected by partial or full introgression. Using neutral simulations for comparison, we find that the size and the fraction of introgressed haplotypes are not compatible with a pure migration or incomplete lineage sorting model. Hence, it appears that introgressed haplotypes can rise in frequency due to positive selection and thus can contribute to the adaptive genomic landscape of natural populations. Our data support the notion that natural genomes are subject to complex adaptive processes, including the introgression of haplotypes from other differentiated populations or species at a larger scale than previously assumed for animals. This implies that some of the admixture found in inbred strains of mice

  14. Cross-experimental analysis of coat color variations and morphological characteristics of the japanese wild mouse, Mus musculus.

    Science.gov (United States)

    Suzuki, Taichi A; Iwasa, Masahiro A

    2013-01-01

    There are many coat colors in the laboratory mouse, Mus musculus. On the basis of traditional genetics, there are four loci, A-D, related to coat color expressions. As shown by previous studies, Japanese wild mice have gray backs and white bellies and are assumed to carry the A(w) allele at the A (agouti) locus, which is dominant over any other alleles. However, we collected Japanese wild mice from central Honshu with black coats. To understand this black coat expression, we performed cross experiments concerning the four loci using wild-caught mice and DBA/2 laboratory mice from the standpoint of traditional genetics. The offspring of the current crosses showed the wild type, the blackish type, and the intermediate type from some combinations of parents. Considering the coat colors of the offspring, we did not obtain any evidence that the Japanese wild mice always carry the A(w) allele at the A locus. Furthermore, we were not able to explain the current coat color expressions using the traditional logic with regard to the A-D loci and concluded that it is possible for another locus (loci) to be related to the coat color expressions. On the other hand, skull characteristics and external body measurements of the captured wild mice were fundamentally different from those of DBA/2 and offspring from captured wild mice and DBA/2 combinations. Thus, we concluded that the Japanese wild mice had original criteria from a morphological viewpoint.

  15. Effect of Pasak Bumi (Eurycoma longifolia Jack) Root In Precopulation Stage to the Fertility of Female Mouse (Mus musculus L.)

    OpenAIRE

    Marlinza, Rosa

    2012-01-01

    Pasak Bumi (Eurycoma longifolia Jack) have potency to be used to increase bodyendurance, to cure malaria drug, and to act as afrodisiak. However, the effect of pasak bumi onwomen fertility, especially at pre-copulation stage was not widely known. This research seeks toreveal the effect pasak bumi extract treated at pre-copulation phase on fertility. This experimentemploy mice (Mus Musculus L.) and was undertaken at Biology and Cemistry laboratories PMIPA, andVeterinary laboratory of Jambi Uni...

  16. Subspecies-specific response to ACTH challenge test in the house mouse (Mus musculus)

    Czech Academy of Sciences Publication Activity Database

    Daniszová, Kristina; Mikula, O.; Macholán, M.; Pospíšilová, I.; Vošlajerová Bímová, Barbora; Hiadlovská, Z.

    2017-01-01

    Roč. 252, October (2017), s. 186-192 ISSN 0016-6480 R&D Projects: GA ČR GAP506/11/1792 Institutional support: RVO:68081766 Keywords : ACTH challenge * Endocrine activity * Corticosterone * Hormone metabolites * Mouse * Noninvasive monitoring Subject RIV: EG - Zoology OBOR OECD: Zoology Impact factor: 2.585, year: 2016

  17. Subspecies-specific response to ACTH challenge test in the house mouse (Mus musculus)

    Czech Academy of Sciences Publication Activity Database

    Daniszová, K.; Mikula, Ondřej; Macholán, Miloš; Pospíšilová, I.; Vošlajerová Bímová, Barbora; Hiadlovská, Zuzana

    2017-01-01

    Roč. 252, October (2017), s. 186-192 ISSN 0016-6480 R&D Projects: GA ČR GAP506/11/1792 Institutional support: RVO:67985904 Keywords : ACTH challenge * endocrine activity * corticosterone * hormone metabolities * mouse * noninvasive monitoring Subject RIV: EA - Cell Biology OBOR OECD: Biology (theoretical, mathematical, thermal, cryobiology, biological rhythm), Evolutionary biology Impact factor: 2.585, year: 2016

  18. The uncharacterized gene 1700093K21Rik and flanking regions are correlated with reproductive isolation in the house mouse, Mus musculus.

    Science.gov (United States)

    Kass, David H; Janoušek, Václav; Wang, Liuyang; Tucker, Priscilla K

    2014-06-01

    Reproductive barriers exist between the house mouse subspecies, Mus musculus musculus and M. m. domesticus, members of the Mus musculus species complex, primarily as a result of hybrid male infertility, and a hybrid zone exists where their ranges intersect in Europe. Using single nucleotide polymorphisms (SNPs) diagnostic for the two taxa, the extent of introgression across the genome was previously compared in these hybrid populations. Sixty-nine of 1316 autosomal SNPs exhibited reduced introgression in two hybrid zone transects suggesting maladaptive interactions among certain loci. One of these markers is within a region on chromosome 11 that, in other studies, has been associated with hybrid male sterility of these subspecies. We assessed sequence variation in a 20 Mb region on chromosome 11 flanking this marker, and observed its inclusion within a roughly 150 kb stretch of DNA showing elevated sequence differentiation between the two subspecies. Four genes are associated with this genomic subregion, with two entirely encompassed. One of the two genes, the uncharacterized 1700093K21Rik gene, displays distinguishing features consistent with a potential role in reproductive isolation between these subspecies. Along with its expression specifically within spermatogenic cells, we present various sequence analyses that demonstrate a high rate of molecular evolution of this gene, as well as identify a subspecies amino acid variant resulting in a structural difference. Taken together, the data suggest a role for this gene in reproductive isolation.

  19. Genetic structure and invasion history of the house mouse (Mus musculus domesticus) in Senegal, West Africa: a legacy of colonial and contemporary times.

    Science.gov (United States)

    Lippens, C; Estoup, A; Hima, M K; Loiseau, A; Tatard, C; Dalecky, A; Bâ, K; Kane, M; Diallo, M; Sow, A; Niang, Y; Piry, S; Berthier, K; Leblois, R; Duplantier, J-M; Brouat, C

    2017-08-01

    Knowledge of the genetic make-up and demographic history of invasive populations is critical to understand invasion mechanisms. Commensal rodents are ideal models to study whether complex invasion histories are typical of introductions involving human activities. The house mouse Mus musculus domesticus is a major invasive synanthropic rodent originating from South-West Asia. It has been largely studied in Europe and on several remote islands, but the genetic structure and invasion history of this taxon have been little investigated in several continental areas, including West Africa. In this study, we focussed on invasive populations of M. m. domesticus in Senegal. In this focal area for European settlers, the distribution area and invasion spread of the house mouse is documented by decades of data on commensal rodent communities. Genetic variation at one mitochondrial locus and 16 nuclear microsatellite markers was analysed from individuals sampled in 36 sites distributed across the country. A combination of phylogeographic and population genetics methods showed that there was a single introduction event on the northern coast of Senegal, from an exogenous (probably West European) source, followed by a secondary introduction from northern Senegal into a coastal site further south. The geographic locations of these introduction sites were consistent with the colonial history of Senegal. Overall, the marked microsatellite genetic structure observed in Senegal, even between sites located close together, revealed a complex interplay of different demographic processes occurring during house mouse spatial expansion, including sequential founder effects and stratified dispersal due to human transport along major roads.

  20. The screening of parasites and viral pathogens of small mammals from a farm in southern Finland, and genetic identification of the Finnish house mouse, Mus musculus

    Czech Academy of Sciences Publication Activity Database

    Laakkonen, J.; Kallio-Kokko, M.; Vapalahti, O.; Vaheri, A.; Vyskočilová, M.; Munclinger, P.; Macholán, Miloš; Henttonen, H.

    2007-01-01

    Roč. 44, - (2007), s. 202-208 ISSN 0003-455X EU Projects: European Commission(XE) 10284 - EDEN Institutional research plan: CEZ:AV0Z50450515 Keywords : Mus musculus Subject RIV: EG - Zoology Impact factor: 1.537, year: 2007

  1. A Comparison of mucosal surface area and villous histology in small intestines of the Brazilian free-tailed bat (Tadarida brasiliensis) and the mouse (Mus musculus).

    Science.gov (United States)

    Zhang, Zhi-Qiang; Brun, Antonio; Price, Edwin R; Cruz-Neto, Ariovaldo P; Karasov, William H; Caviedes-Vidal, Enrique

    2015-01-01

    Studies on birds have led to the hypothesis that increased intestinal absorption between enterocytes (paracellular) evolved as a compensation for smaller intestinal size in fliers, which was perhaps selected to minimize the mass of digesta carried. This hypothesis predicts that bats will also exhibit relatively reduced intestinal size and high paracellular absorption, compared with nonflying mammals. Published studies on three bat species indicate relatively high paracellular absorption. One mechanism for increasing paracellular absorption per cm2 small intestine (SI) is increased number of tight junctions (TJs) across which paracellular absorption occurs. To our knowledge, we provide the first comparative analysis of enterocyte size and number in flying and nonflying mammals. Intestines of insectivorous bats Tadarida brasiliensis were compared with Mus musculus using hematoxylin and eosin staining method. Bats had shorter and narrower SIs than mice, and after correction for body size difference by normalizing to mass3/4, the bats had 40% less nominal surface area than the mouse, as predicted. Villous enhancement of surface area was 90% greater in the bat than in the mouse, mainly because of longer villi and a greater density of villi in bat intestines. Bat and mouse were similar in enterocyte diameter. Bats exceeded mice by 54.4% in villous area per cm length SI and by 95% in number of enterocytes per cm2 of the nominal surface area of the SI. Therefore, an increased density of TJs per cm2 SI may be a mechanistic explanation that helps to understand the high paracellular absorption observed in bats compared to nonflying mammals. © 2014 Wiley Periodicals, Inc.

  2. Curcumin Is Efective In Improving Folliculogenesis Profile And Oo-cytes Quality In Vitro In Ectopic Endometriosis Mouse (Mus muscu-lus Models

    Directory of Open Access Journals (Sweden)

    Aulia Firmawati

    2018-02-01

    Full Text Available Endometriosis is the presence of ectopic endometrial tissue, such as that outside the uter-ine cavity, which can cause chronic inflammatory reactions. Curcumin is one of traditional herbal med-icines that is widely used. Some experiments have managed to find a mechanism to treat an ectopic endometriosis through the mechanism of suppression of several cytokines such as TNF-alpha, NF-kB and COX-2, this study was an experimental laboratory study, with five treatments and six replications, using female mice (Mus musculus that had reached puberty. The study consisted of three phases: the first phase was the microscopic examination of in vitro oocytes quality, and the second was histopatho-logical examination of folliculogenesis profile using Hematoxillin eosin staining, the results of this study showed significant difference between positive control group (P0 with treatment and negative control (KN groups in folliculogenesis profile (p <0.05. Examination of in vitro oocytes quality showed sig-nificant difference between positive control group with treatment group and negative control group (p <0.05. Curcumin has several roles in cytokines modulation in ectopic endometriosis mouse models. Curcumin may reduce the occurrence of apoptosis of granulosa cells so that it may directly improve oocyte quality and folliculogenesis profile, in conclusion, curcumin effectively overcomes fertility prob-lems through the mechanism of cytokines modulation that plays a role in some cases of endometriosis such as: TNF-alpha, NF-kB and COX-2. Curcumin may improve folliculogenesis profile and in vitro oocytes quality.

  3. Morphofunctional evaluation of the testis, duration of spermatogenesis and spermatogenic efficiency in the Japanese fancy mouse (Mus musculus molossinus).

    Science.gov (United States)

    Costa, Guilherme M J; Leal, Marcelo C; França, Luiz R

    2017-08-01

    Japanese fancy mouse, mini mouse or pet mouse are common names used to refer to strains of mice that present with different colour varieties and coat types. Although many genetic studies that involve spotting phenotype based on the coat have been performed in these mice, there are no reports of quantitative data in the literature regarding testis structure and spermatogenic efficiency. Hence, in this study we researched testis function and spermatogenesis in the adult Japanese fancy mouse. The following values of 68 ± 6 mg and 0.94 ± 0.1% were obtained as mean testis weight and gonadosomatic index, respectively. In comparison with other investigated mice strains, the fancy mouse Leydig cell individual size was much smaller, resulting in higher numbers of these cells per gram of testis. As found for laboratory mice strains, as a result of the development of the acrosomic system, 12 stages of the seminiferous epithelium cycle have been described in this study. The combined frequencies of pre-meiotic and post-meiotic stages were respectively 24% and 64% and very similar to the laboratory mice. The more differentiated germ cell types marked at 1 h or 9 days after tritiated thymidine administration were preleptotene/leptotene and pachytene spermatocytes at the same stage (VIII). The mean duration of one spermatogenic cycle was 8.8 ± 0.01 days and the total length of spermatogenesis lasted 37.8 ± 0.01 days (4.5 cycles). A high number of germ cell apoptosis was evident during meiosis, resulting in lower Sertoli cell and spermatogenic efficiencies, when compared with laboratory mice strains.

  4. The Southeastern Asian house mouse (Mus musculus castaneus Linn.) as a new passenger host for Cryptococcus neoformans var. grubii molecular type VNI.

    Science.gov (United States)

    Singh, Karuna; Rani, Jyoti; Neelabh; Rai, Govind Kumar; Singh, Major

    2017-11-01

    We describe Mus musculus castaneus as a new mammalian host for Cryptococcus neoformans var. grubii (VNI). Eighteen apparently healthy adults and pups of the rodent were collected from human dwellings in Varanasi, a city of India. Both clinical and behavioral examinations of the rodents did not reveal any sign of the disease. Among visceral organs, histological examination of only liver exhibited the presence of single celled, encapsulated, Southgate's mucicarmine positive fungal structures consistent with C. neoformans. Nevertheless, culture of tissue homogenates of brain, lungs, liver, and kidneys yielded white colonies on Sabouraud's dextrose agar and brown mucoid colonies of C. neoformans on Staib's and Tobacco agar media. The pathogen was isolated from habitat soil as well as fresh faeces of the animals. All isolates were urease positive, nitrate and canavanine-glycine bromothymol blue negative, exhibited phenoloxidase activity and grew at 37°C. The isolates were identified as C. neoformans var. grubii with ITS primers and unique marker (GACA)4. The pathogen when inoculated in immunosuppressed mice showed low pathogenicity. To our knowledge, we for the first time report case cluster of Mus musculus castaneus as new passenger host for C. neoformans var. grubii (VNI). © The Author 2017. Published by Oxford University Press on behalf of The International Society for Human and Animal Mycology. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  5. A new chromosomal race of the house mouse, Mus musculus domesticus, in the Vulcano Island-Aeolian Archipelago, Italy.

    Science.gov (United States)

    Solano, Emanuela; Castiglia, Riccardo; Corti, Marco

    2007-07-01

    In this paper we describe a new Robertsonian (Rb) race of the house mouse from Vulcano (Aeolian archipelago) through the identification of the metacentric chromosomes. We analysed fifteen mice. All the specimens were found to have the same karyotype 2n=26. This karyotype is characterized by Rb(1.2), Rb(3.9), Rb(4.13), Rb(5.14), Rb(8.12), Rb(10.16) and Rb(15.17). The differences between the race of Vulcano and the races in a neighbour island (Lipari) consist in the presence of Rb(10.16) and Rb(15.17) in the former and Rb(6.16) and Rb(10.15) in the latter. We discuss the possible hypotheses regarding the origin between these two races including the possible occurrence of a whole arm reciprocal translocation (WART) on the Vulcano island.

  6. A role for ultrasonic vocalisation in social communication and divergence of natural populations of the house mouse (Mus musculus domesticus.

    Directory of Open Access Journals (Sweden)

    Sophie von Merten

    Full Text Available It has long been known that rodents emit signals in the ultrasonic range, but their role in social communication and mating is still under active exploration. While inbred strains of house mice have emerged as a favourite model to study ultrasonic vocalisation (USV patterns, studies in wild animals and natural situations are still rare. We focus here on two wild derived mouse populations. We recorded them in dyadic encounters for extended periods of time to assess possible roles of USVs and their divergence between allopatric populations. We have analysed song frequency and duration, as well as spectral features of songs and syllables. We show that the populations have indeed diverged in several of these aspects and that USV patterns emitted in a mating context differ from those emitted in same sex encounters. We find that females vocalize not less, in encounters with another female even more than males. This implies that the current focus of USVs being emitted mainly by males within the mating context needs to be reconsidered. Using a statistical syntax analysis we find complex temporal sequencing patterns that could suggest that the syntax conveys meaningful information to the receivers. We conclude that wild mice use USV for complex social interactions and that USV patterns can diverge fast between populations.

  7. Mottled Neuherberg (Mo sup(N)), a new male-lethal coat colour mutation of the house mouse (Mus musculus)

    International Nuclear Information System (INIS)

    Schroeder, J.H.

    1975-01-01

    A new semidominant X-chromosomal mutation, Mottled Neuherberg (Mo sup(N)), which causes coat colour variegation is described. Mo sup(N) arose in the second postirradiation generation after 2 x 200 R of X-rays (24 hours apart) to oocytes of X/O mice. Heterozygous Mo sup(N) females have irregular patches of fully and lightly coloured fur over the whole coat with curly vibrissae. Their viability is reduced, about 3% of the heterozygotes dying prenatally and 6 to 28% dying postnatally before weaning. Survivors are fertile without externally visible abnormalities. Hemizygous Mo sup(N) males die in utero after implantation. The recombination frequency between Mo sup(N) and tabby (Ta) was 3.65 +- 3.16% (with 95% -confidence limits). Therefore, it is suggested that Mo sup(N) is a new allele of the mottled (Mo) locus of the house mouse. Mo sup(N)-bearing ova seem to have a lower chance of becoming fertilized by wild-type spermatozoa than by Ta-bearing spermatozoa. (orig.) [de

  8. Passive Immunization of Anti bZP3 (Zone Pellucida3 in Wistar Rat (Rattus novergicus and Mouse (Mus musculus

    Directory of Open Access Journals (Sweden)

    Y. Pantiwati

    2012-12-01

    Full Text Available This study was aimed at comparing the influence of anti bZP3’s passive immunization on anti-anti bZP3’s titer and pregnancy level on Wistar rats and mice. This study employed factorial design experiment with completely randomized design. The first factor was immunogenic type. The treated rats were immunized with 100 L anti bZP3 in 100 L Complete Freund’s Adjuvant (CFA, while the treated mice were injected with 50 L anti bZP3 in 50 L CFA. Control Wistar rats and mice were immunized with CFA and Incomplete Freund’s Adjuvant (IFA without anti bZP3. The second factor was animal type. The third factor was the length of serum incubation, i.e. 38, 49, 63, 86, 100, and 126 d. Dot blot on the treated Wistar rats and mice showed positive response proven by blue gradation; pre-immune mice as well as control Wistar rats and mice showed negative response proven by white gradation. The highest antibody titer in treated mouse serum was shown in 63 d incubation. The pregnancy on treated mice, control mice and Wistar rat occurred 100% until day 126; while the failure percentage on the treated mice was 4.5%. The pregnancy on treated mice occurred in 86 d incubation (1 rat, 100 d incubation (1 rat, and 126 d incubation (3 rats. Effective passive immunization on similar hospes occurred until day 63; while different hospes was ineffective. Antibodi anti-bZP3 was potential as a contraception through passive immunization on similar hospes.

  9. Chromosomal heterozygosity and fertility in house mice (Mus musculus domesticus) from Northern Italy.

    OpenAIRE

    Hauffe, H C; Searle, J B

    1998-01-01

    Following the discovery of over 40 Robertsonian (Rb) races of Mus musculus domesticus in Europe and North Africa, the house mouse has been studied extensively as an ideal model to determine the chromosomal changes that may cause or accompany speciation. Current models of chromosomal speciation are based on the assumption that heterozygous individuals have a particularly low fertility, although recent studies indicate otherwise. Despite their importance, fertility estimates for the house mouse...

  10. Mitochondrial DNA in the hybrid zone between Mus musculus musculus and Mus musculus domesticus: a comparison of two transects

    Czech Academy of Sciences Publication Activity Database

    Božíková, Eva; Munclinger, P.; Teeter, K. C.; Tucker, P. K.; Macholán, Miloš; Piálek, Jaroslav

    2005-01-01

    Roč. 84, č. 3 (2005), s. 363-378 ISSN 0024-4066. [The genus Mus as a model for evolutionary studies - a symposium in honour of Louis Thaler. Brno, 28.07.2003-30.07.2003] R&D Projects: GA ČR GA206/03/0205; GA ČR GA206/01/0989 Institutional research plan: CEZ:AV0Z6093917 Keywords : allozyme * gene flow * house mouse Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.261, year: 2005

  11. Habitat use and demography of Mus musculus in a rural landscape of Argentina.

    Science.gov (United States)

    León, Vanina A; Fraschina, Jimena; Guidobono, Juan S; Busch, Maria

    2013-04-01

    The main goal of the paper was to determine the habitat distribution of the house mouse (Mus musculus) within a rural landscape of Buenos Aires province, Argentina. We also studied the seasonal variation in abundance and reproductive activity. The habitats studied were poultry farms, human houses in a small village, cropfields, pastures, cropfield and pasture edges, riparian habitats (streams), railway embankments and woodlots. We captured 817 M. musculus and 690 individuals of 5 native rodent species. M. musculus was captured in poultry farms, houses, riparian habitats, cropfield and borders, but it showed a significantly higher abundance in poultry farms compared to the other habitats. Its presence outside poultry farms was significantly related to the distance to streams and poultry farms. The mean trapping success index of M. musculus did not show significant variations between periods, but the proportion of active males was significantly higher in the spring-summer period than in the autumn-winter period. All captures of M. musculus in cropfields, borders and riparian habitats occurred in the spring-summer period. The capture of M. musculus in many types of habitats suggests that it can disperse outside poultry farms, and streams may be used as corridors. © 2012 Wiley Publishing Asia Pty Ltd, ISZS and IOZ/CAS.

  12. Teratogenic effect of yogurt in mice fetus (Mus musculus)

    OpenAIRE

    Dwisari Dillasamola; Almahdy A; Amirah Desri; Skunda Diliarosta

    2018-01-01

    Yogurt is one of the dairy products made from lactic acid fermentation by using Lactobacillus bulgaricus and Streptococcus thermophilus. A study on teratogenic effects of yogurt on the white female mice fetus (Mus musculus) has been carried out. Pregnant mice used were 20 which divided into 4 groups : the control group, D1, D2, and D3. The treatments giveThe mice were Distidelled water (control), 0.52 yogurt (D1), 1.04  yogurt (D2), and 2.08 g yogurt (D3). Data were analyzed using one-way ANO...

  13. Food preferences of wild house-mice (Mus musculus L.)*

    Science.gov (United States)

    Rowe, F. P.; Bradfield, A.; Redfern, R.

    1974-01-01

    The relative acceptance of various plain foods by wild house-mice (Mus musculus L.) was compared in laboratory choice tests. The palatability of glycerine and six oils, each included at 5% in pinhead oatmeal, was compared in a similar manner. The most favoured food was found to be whole canary seed (Phalaris canariensis). Pinhead oatmeal and wheat were also comparatively well accepted. Glycerine, corn oil, arachis oil and mineral oil were more palatable than either olive, linseed or cod-liver oils. The results of the choice tests are considered in relation to the use of poison baits for the control of free-living mice. PMID:4531454

  14. Teratogenic effect of yogurt in mice fetus (Mus musculus

    Directory of Open Access Journals (Sweden)

    Dwisari Dillasamola

    2018-04-01

    Full Text Available Yogurt is one of the dairy products made from lactic acid fermentation by using Lactobacillus bulgaricus and Streptococcus thermophilus. A study on teratogenic effects of yogurt on the white female mice fetus (Mus musculus has been carried out. Pregnant mice used were 20 which divided into 4 groups : the control group, D1, D2, and D3. The treatments giveThe mice were Distidelled water (control, 0.52 yogurt (D1, 1.04  yogurt (D2, and 2.08 g yogurt (D3. Data were analyzed using one-way ANOVA followed by Duncan multiple range test. Results showed that administration of yogurt during pregnancy could affect mother body weight of mice (P 0,05. Observations with Alizarin solution did not show skeletal defects in comparison to the control group. Observations with Bouin’s solution showed defective visceral cleft palate in fetal mice yogurt group D3. This study conclude that yogurt is safe to consume in groups D1 and D2. Yogurt has the potential to cause fetal teratogenic in group D3

  15. GAMBARAN HEMATOLOGI MENCIT (Mus musculus MODEL TOKSISITAS SUBKRONIS

    Directory of Open Access Journals (Sweden)

    Ita Nur Eka Pujiastuti

    2017-06-01

    Full Text Available Garlic commonly is consumed as medicine to prevent or heal illness or to maintain someone's health. Many societies prefer garlic (Allium sativum among other herbal remedies for cholesterol treatment. It consists of several types, and one of them is single bulb garlic used to treat hypertension. There has been, however, no published research reporting the toxicological properties of single bulb garlic. The purpose of this study was to determine subchronic toxic effects of single bulb garlic administered to mice using hematological parameters. The experiment parameters were hemoglobin and hematocrit levels, the number of erythrocytes and leukocytes. Male mice (Mus musculus strain Balb-C were treated with single bulb garlic extract for 28 days with dosage levels of 0% (N , 0.25% (P1 , 0.5% (P2 , 1% (P3 , and 2% (P4 . Single bulb garlic showed no effect on hemoglobin and hematocrit levels but increased the number of erythrocyte and leucocyte. We concluded that single bulb garlic did not cause subchronic toxic effects.

  16. KOLONISASI Mus musculus albino DI LABORATORIUM LOKA LITBANG P2B2 BANJARNEGARA

    Directory of Open Access Journals (Sweden)

    Dewi Marbawati

    2012-11-01

    Full Text Available The improvement and development of science and technologycal in health area must be followed with improvement of requirement of test animal would especially white mouse (Mus musculus albino/mencit. Usage of white mouse (mencit because of relatively easy in handling, the size relatively small, the price relatively cheap, once birth can reach 16- 18, have similiarity in circulation system of human and doesn't have ability to vomit because having spillway in bouncing up, that is why white mouse used for drug trial research. This research expected to obtain stable white mouse colony in laboratory to fulfill requirement of white mouse as subject for research.Research was started in March-November 2008 in Loka Litbang P2B2 Banjarnegara. This research was elementary research with observational design. Data were collected from white mouse growth observation. Result of observation showed reproduction of white mouse after 5 month, from 6 white mouse increased become 17 (increased 2 times more, with number of deaths 11,76%. This white mouse survive until 12 months, but the average was 6 month. Oldest mencit until research ends (November 2008 ranges from 8 months. Daily observation data showed that white mouse can bear children until 6/pregnance. According to literature study mouse can bear children average 68/pregnance. Generaly baby mouse was around 1 gram, heavily horns depend on type (strain of white mouse. Result of white mouse weight showed increase of white mouse's body weight every 2 weeks was 8,6 grams. Observation data of development white mouse showed after 4 days the white mouse hair was seen, specially moustache that was clearly seen, on 5 day whole body was white. At the age of 10 days ear opened, part of other body like external mamilla and genitals become explains looked to be. At the age of 12 days eye started opens and active walking.

  17. Molecular heterogeneity in major urinary proteins of Mus musculus subspecies: potential candidates involved in speciation

    Science.gov (United States)

    Hurst, Jane L.; Beynon, Robert J.; Armstrong, Stuart D.; Davidson, Amanda J.; Roberts, Sarah A.; Gómez-Baena, Guadalupe; Smadja, Carole M.; Ganem, Guila

    2017-01-01

    When hybridisation carries a cost, natural selection is predicted to favour evolution of traits that allow assortative mating (reinforcement). Incipient speciation between the two European house mouse subspecies, Mus musculus domesticus and M.m.musculus, sharing a hybrid zone, provides an opportunity to understand evolution of assortative mating at a molecular level. Mouse urine odours allow subspecific mate discrimination, with assortative preferences evident in the hybrid zone but not in allopatry. Here we assess the potential of MUPs (major urinary proteins) as candidates for signal divergence by comparing MUP expression in urine samples from the Danish hybrid zone border (contact) and from allopatric populations. Mass spectrometric characterisation identified novel MUPs in both subspecies involving mostly new combinations of amino acid changes previously observed in M.m.domesticus. The subspecies expressed distinct MUP signatures, with most MUPs expressed by only one subspecies. Expression of at least eight MUPs showed significant subspecies divergence both in allopatry and contact zone. Another seven MUPs showed divergence in expression between the subspecies only in the contact zone, consistent with divergence by reinforcement. These proteins are candidates for the semiochemical barrier to hybridisation, providing an opportunity to characterise the nature and evolution of a putative species recognition signal. PMID:28337988

  18. Sex reversal in the mouse (Mus musculus) is caused by a recurrent nonreciprocal crossover involving the x and an aberrant y chromosome.

    Science.gov (United States)

    Singh, L; Jones, K W

    1982-02-01

    Satellite DNA (Bkm) from the W sex-determining chromosome of snakes, which is related to sequences on the mouse Y chromosome, has been used to analyze the DNA and chromosomes of sex-reversed (Sxr) XXSxr male mice. Such mice exhibit a male-specific Southern blot Bkm hybridization pattern, consistent with the presence of Y-chromosome DNA. In situ hybridization of Bkm to chromosomes of XXSxr mice shows an aberrant concentration of related sequences on the distal terminus of a large mouse chromosome. The XYSxr carrier male, however, shows a pair of small chromosomes, which are presumed to be aberrant Y derivatives. Meiosis in the XYSxr mouse involves transfer of chromatin rich in Bkm-related DNA from the Y-Y1 complex to the X distal terminus. We suggest that this event is responsible for the transmission of the Sxr trait.

  19. Polymorphism in hybrid male sterility in wild-derived Mus musculus musculus strains on proximal chromosome 17.

    Science.gov (United States)

    Vyskocilová, Martina; Prazanová, Gabriela; Piálek, Jaroslav

    2009-02-01

    The hybrid sterility-1 (Hst1) locus at Chr 17 causes male sterility in crosses between the house mouse subspecies Mus musculus domesticus (Mmd) and M. m. musculus (Mmm). This locus has been defined by its polymorphic variants in two laboratory strains (Mmd genome) when mated to PWD/Ph mice (Mmm genome): C57BL/10 (carrying the sterile allele) and C3H (fertile allele). The occurrence of sterile and/or fertile (wild Mmm x C57BL)F1 males is evidence that polymorphism for this trait also exists in natural populations of Mmm; however, the nature of this polymorphism remains unclear. Therefore, we derived two wild-origin Mmm strains, STUS and STUF, that produce sterile and fertile males, respectively, in crosses with C57BL mice. To determine the genetic basis underlying male fertility, the (STUS x STUF)F1 females were mated to C57BL/10 J males. About one-third of resulting hybrid males (33.8%) had a significantly smaller epididymis and testes than parental animals and lacked spermatozoa due to meiotic arrest. A further one-fifth of males (20.3%) also had anomalous reproductive traits but produced some spermatozoa. The remaining fertile males (45.9%) displayed no deviation from values found in parental individuals. QTL analysis of the progeny revealed strong associations of male fitness components with the proximal end of Chr 17, and a significant effect of the central section of Chr X on testes mass. The data suggest that genetic incompatibilities associated with male sterility have evolved independently at the proximal end of Chr 17 and are polymorphic within both Mmd and Mmm genomes.

  20. Laju peningkatan konsentrasi timbal Pb dalam darah hewan uji mencit Mus musculus di bengkel otomotif

    Directory of Open Access Journals (Sweden)

    Mohammad Razif Sukatma

    2012-02-01

    Full Text Available This research was conducted in automotive workshop of VEDC Malang and the samples were taken at the automotive machineand automotive electric workshops. The parameters which examined were the Pb concentration in the mouse blood (Mus musculus in2 and 3 months years old. The measurement was run for 5 times every 10 days, and the result was mean value of the increasing rate ofPb concentration in the mouse blood. The aim of this research was to determine the increasing rate of Pb concentration in the mouseblood which has the relation with different working area, different age, and also duration of exposure. Based on the data of laboratorytest, research continued by T-test analysis, Simple regression test, and correlation, and also General Linear Model. By doing statisticanalysis with the different working area, duration of explanation, and different age.Result of this research showed that there were the differences of rapid increasing of Pb concentration in both workshop. Generallythe age which influence so much for that (in the mouse body and have the relation with the body stamina. If the mouse body absorbamount of Pb constantly, so the Pb concentration in it will increase more and more and it cause the decreasing of the body height.

  1. Chromosomal heterozygosity and fertility in house mice (Mus musculus domesticus) from Northern Italy.

    Science.gov (United States)

    Hauffe, H C; Searle, J B

    1998-11-01

    Following the discovery of over 40 Robertsonian (Rb) races of Mus musculus domesticus in Europe and North Africa, the house mouse has been studied extensively as an ideal model to determine the chromosomal changes that may cause or accompany speciation. Current models of chromosomal speciation are based on the assumption that heterozygous individuals have a particularly low fertility, although recent studies indicate otherwise. Despite their importance, fertility estimates for the house mouse are incomplete because traditional measurements, such as anaphase I nondisjunction and germ cell death, are rarely estimated in conjunction with litter size. In an attempt to bridge this gap, we have taken advantage of the house mouse hybrid zone in Upper Valtellina (Lombardy, Italy) in which five Rb races interbreed. We present data on the fertility of naturally occurring ("wild-caught") hybrids and of offspring from laboratory crosses of wild-caught mice ("laboratory-reared"), using various measurements. Wild-caught mice heterozygous for one fusion were more infertile than predicted from past studies, possibly due to genic hybridity; laboratory-reared heterozygotes carrying seven or eight trivalents at meiosis I and heterozygotes carrying one pentavalent also had low fertilities. These low fertilities are especially significant given the probable occurrence of a reinforcement event in Upper Valtellina.

  2. X-ray structure of a soluble Rieske-type ferredoxin from Mus musculus

    International Nuclear Information System (INIS)

    Levin, Elena J.; Elsen, Nathaniel L.; Seder, Kory D.; McCoy, Jason G.; Fox, Brian G.; Phillips Jr, George N.

    2008-01-01

    The X-ray crystal structure of a soluble Rieske ferredoxin from M. musculus was solved at 2.07 Å resolution, revealing an iron–sulfur cluster-binding domain with similar architecture to the Rieske-type domains of bacterial aromatic dioxygenases. The ferredoxin was also shown to be capable of accepting electrons from both eukaryotic and prokaryotic oxidoreductases. The 2.07 Å resolution X-ray crystal structure of a soluble Rieske-type ferredoxin from Mus musculus encoded by the gene Mm.266515 is reported. Although they are present as covalent domains in eukaryotic membrane oxidase complexes, soluble Rieske-type ferredoxins have not previously been observed in eukaryotes. The overall structure of the mouse Rieske-type ferredoxin is typical of this class of iron–sulfur proteins and consists of a larger partial β-barrel domain and a smaller domain containing Cys57, His59, Cys80 and His83 that binds the [2Fe–2S] cluster. The S atoms of the cluster are hydrogen-bonded by six backbone amide N atoms in a pattern typical of membrane-bound high-potential eukaryotic respiratory Rieske ferredoxins. However, phylogenetic analysis suggested that the mouse Rieske-type ferredoxin was more closely related to bacterial Rieske-type ferredoxins. Correspondingly, the structure revealed an extended loop most similar to that seen in Rieske-type ferredoxin subunits of bacterial aromatic dioxygenases, including the positioning of an aromatic side chain (Tyr85) between this loop and the [2Fe–2S] cluster. The mouse Rieske-type ferredoxin was shown to be capable of accepting electrons from both eukaryotic and prokaryotic oxidoreductases, although it was unable to serve as an electron donor for a bacterial monooxygenase complex. The human homolog of mouse Rieske-type ferredoxin was also cloned and purified. It behaved identically to mouse Rieske-type ferredoxin in all biochemical characterizations but did not crystallize. Based on its high sequence identity, the structure of the

  3. Meiotic synapsis of homogeneously staining regions (HSRs) in chromosome 1 of Mus musculus.

    Science.gov (United States)

    Winking, H; Reuter, C; Traut, W

    1993-05-01

    About 50 copies of a long-range repeat DNA family with a repeat size of roughly 100 kb and with sequence homology to mRNAs are clustered in the G-light band D of chromosome 1 of the house mouse, Mus musculus. We studied amplified versions of the cluster which are found in many wild populations of M. musculus. They are cytogenetically conspicuous as one or two C-band positive homogeneously staining regions (single- and double band HSRs) which increase the mitotic length of chromosome 1. The double band HSR was phylogenetically derived from a single band HSR by a paracentric inversion. In homozygous condition, such HSRs contribute, albeit not as much as expected from their mitotic length, to the synaptonemal complex (SC) length of chromosome 1. In HSR heterozygous animals an elongation of the SCs was not noticeable. In single band HSR heterozygous males, synapsis proceeds regularly and continuously from the distal telomere towards the centromeric end without forming buckles. Thus, the single band HSR has no adverse effect on pairing. The same straight pairing behaviour was found in the majority of double band HSR heterozygous spermatocytes. This shows that extensive nonhomologous pairing can take place in the earliest phase of synapsis. Synapsis was discontinuous, leaving the central part of the bivalent 1 asynapsed, in only 14.3% of double band HSR heterozygous cells. In such cells the chromosome 1 SC is completed at a later stage of meiosis. The delay is presumably an effect of the inversion that includes one HSR band and the segment between the two HSR bands.

  4. Efficacy of drugs against Giardia muris in mice Mus musculus naturally infected/
    Eficácia de drogas contra Giardia muris em camundongos Mus musculus naturalmente infectados

    OpenAIRE

    Silvia Gonzalez Monteiro; Régis Adriel Zanette; Camila Belmonte Oliveira; Marcos Kipper da Silva; Aleksandro Schafer da Silva

    2008-01-01

    This study aimed to evaluate the efficacy of metronidazole, fenbendazole and secnidazole against Giardia muris in mice naturally infected. Forty mice of the species Mus musculus were divided in four groups of ten each, being group A non treated, the control group and groups B, C and D treated with 4mg/ml of metronidazole, fenbendazole and secnidazole, respectively. Two feces collection, on day 0 and on day 10 after treatment, were done in order to evaluate the efficacy of the drugs. Samples w...

  5. FRAKSI ETANOL 96% BIJI KORO BENGUK (Mucuna pruriens L. SEBAGAI PENINGKAT KUALITAS SPERMATOZOA MENCIT (Mus musculus

    Directory of Open Access Journals (Sweden)

    Sri Winarni

    2012-11-01

    Full Text Available Background: The examination of sperm quality is the main priority for infertility diagnosis. Based on previous study with mice, active ingredient of Mucuna pruriens L. or koro benguk (Papilionaceae, the L-dopa, may affect the quality of spermatozoa.Objective: Research was to study the effect of 96% ethanol fraction Mucuna pruriens seed on spermatozoaquality of mice exposed to 2-Methoxy ethanol. L-dopa in 96% ethanol fraction of M. pruriens seed was 14.7%.Methode: This was an experimental study using complete randomized design. Subjects were BALB/C mice (Mus musculus. Five groups served as control, 3 groups received subcutaneos injection of 2-ME as muchas 100 mg/kg.bw/day for 12 days, followed with 96% ethanol fraction Mucuna pruriens seed starting from14 mg/kg.bw/day, 28 mg/kg.bw/day, and 56 mg/kg.bw/day for 51 days.Result: The 96% ethanol fraction of Mucuna pruriens seeds are significant increase motility (p<0,01 andthe percentage of normal spermatozoa morphology (p= 0,042.Conclusion: 96% ethanol fraction of Mucuna pruriens seeds are able to increase motility and the percentage of normal spermatozoa morphology in mice exposed to 2-ME. Keywords: Mucuna pruriens L., L-dopa, mouse spermatozoa

  6. Methylation patterns of repetitive DNA sequences in germ cells of Mus musculus.

    OpenAIRE

    Sanford, J; Forrester, L; Chapman, V; Chandley, A; Hastie, N

    1984-01-01

    The major and the minor satellite sequences of Mus musculus were undermethylated in both sperm and oocyte DNAs relative to the amount of undermethylation observed in adult somatic tissue DNA. This hypomethylation was specific for satellite sequences in sperm DNA. Dispersed repetitive and low copy sequences show a high degree of methylation in sperm DNA; however, a dispersed repetitive sequence was undermethylated in oocyte DNA. This finding suggests a difference in the amount of total genomic...

  7. Efficacy of drugs against Giardia muris in mice Mus musculus naturally infected/ Eficácia de drogas contra Giardia muris em camundongos Mus musculus naturalmente infectados

    Directory of Open Access Journals (Sweden)

    Silvia Gonzalez Monteiro

    2008-08-01

    Full Text Available This study aimed to evaluate the efficacy of metronidazole, fenbendazole and secnidazole against Giardia muris in mice naturally infected. Forty mice of the species Mus musculus were divided in four groups of ten each, being group A non treated, the control group and groups B, C and D treated with 4mg/ml of metronidazole, fenbendazole and secnidazole, respectively. Two feces collection, on day 0 and on day 10 after treatment, were done in order to evaluate the efficacy of the drugs. Samples were analyzed by the centrifugal-flotation method with zinc sulfate. Efficacy of 97,05% for metronidazole, 98,30% for fenbendazole and 100% for secnidazole were observed in the study. According to the results it was concluded that the tested drugs were effective for the treatment of mice parasitized by Giardia muris.Este estudo visou avaliar a eficácia do metronidazol, fenbendazole e secnidazol contra Giardia muris em camundongos naturalmente infectados. Foram utilizados 40 camundongos da espécie Mus musculus divididos em quatro grupos de 10 animais cada, sendo grupo A, grupo controle, não tratados, e grupos B, C e D tratados com 4mg/ml de metronidazol, fenbendazole e secnidazol, respectivamente. Para avaliar a eficácia dos medicamentos foram realizadas duas coletas de fezes uma no dia zero e outra 10 dias após tratamento. As amostras foram processadas e analisadas a partir do método de centrífugo-flutuação com sulfato de zinco. No estudo observou-se eficácia de 97,05% para metronidazol, 98,30% para fenbendazole e 100% para secnidazol no tratamento de giardiase murina. Com base nos resultados concluí-se que as drogas testadas apresentaram eficácia no tratamento de camundongos parasitados por Giardia muris.

  8. PEMANFAATAN Spirulina platensis SEBAGAI SUPLEMEN PROTEIN SEL TUNGGAL (PST MENCIT (Mus musculus

    Directory of Open Access Journals (Sweden)

    Haryo Kuntoro Adi

    2007-06-01

    Full Text Available The using of Spirulina platensis as Supplement of Single-Celled Protein (SCP to Mice. High protein in Spirulina platensis can be used as a source of Single-Celled Protein. By using mice (Mus musculus as a animal laboratory, the objective of this research is to know the influence of Biomass S. platensis to the increase of body weight of mice. The name of species is Mus musculus, strain is Swiss derivate. Utilized mice were male, 30-50 weighing gram, and 5-7 weeks of age. Treatment group was given by palette and given by biomass of S. Platensis, while control also fed palette but did not give biomass of S. platensis. Yielded biomass was used as food mixed with palette with composition of dry biomass S. platensis with palette was 0%, 10%, 20%, 30%, 40%, and 50%. Data analysis was conducted by using t-tes and analysis of variance. The results showed that by giving of dry biomass of S. platensis affected to the increasement of body weight from the first day until twelfth day of observation, and decrease on the thirteenth and fourteenth day. Pursuant to result of statistic, there is a significant difference (p < 0,05 between before giving and after giving of dry biomass S. platensis during 17 day. By giving dry biomass of S. platensis to mice (Mus musculus at first and second week, it was found the difference of average mice body weight among six concentrations of biomass but did not at the third week. It means that not all concentration of biomass have same effect to the increase of mice body weight as a Single-Celled Protein.

  9. The effect of electron beam radiations on testicular damage in mice, Mus musculus

    International Nuclear Information System (INIS)

    Vikram, S.; Nair, Vijay Mala Grover

    2013-01-01

    Adult male Swiss albino mice, Mus musculus (8-10 weeks old) weighing 28±2.5 gm were exposed to varying doses (2-12 Gy) of electron beam radiations and maintained in animal house at 26-28 C. The animals were sacrificed following 35 and 60 days following exposure to electron beam radiations. The LD-50 value, change in the weight and histological details of the testis, sperm count, sperm shape abnormalities and sperm motility were recorded. The data suggests that electron beam radiations is a potential inducer to cause reproductive system dysfunctions which probably may be responsible leading to infertility. (author)

  10. Methylation patterns of repetitive DNA sequences in germ cells of Mus musculus.

    Science.gov (United States)

    Sanford, J; Forrester, L; Chapman, V; Chandley, A; Hastie, N

    1984-03-26

    The major and the minor satellite sequences of Mus musculus were undermethylated in both sperm and oocyte DNAs relative to the amount of undermethylation observed in adult somatic tissue DNA. This hypomethylation was specific for satellite sequences in sperm DNA. Dispersed repetitive and low copy sequences show a high degree of methylation in sperm DNA; however, a dispersed repetitive sequence was undermethylated in oocyte DNA. This finding suggests a difference in the amount of total genomic DNA methylation between sperm and oocyte DNA. The methylation levels of the minor satellite sequences did not change during spermiogenesis, and were not associated with the onset of meiosis or a specific stage in sperm development.

  11. PENGARUH PEMBERIAN “KOMBUCHA” TEH ROSELLA TERHADAP PROFIL DARAH MENCIT (Mus musculus L)

    OpenAIRE

    Mukhani Dwi Hidayanti; Sussi Astuti; Maria Erna Kustyawati

    2015-01-01

    “Kombucha” rosella tea is a functional fermented beverage product solution from the petals of rosella tea and sugar using a microbial starter “Kombucha” (Acetobacter xylinum and several kind of yeast). The objective of the experiment was to determine the effect of “Kombucha” rosella tea on the blood profile of mice (Mus musculus L). The experiment compiled in a completely randomized design with 4 treatments dose “Kombucha” rosella tea was 0,73 ml/20 g BB mice (distilled water) (K), 0,36 ml...

  12. EFEK ANTIFERTILITAS EKSTRAK AKAR SOM JAWA (Talinum paniculatum Gaertn. PADA MENCIT (Mus musculus L. JANTAN

    Directory of Open Access Journals (Sweden)

    Tetri Widiyani

    2012-10-01

    Full Text Available Talinum paniculatum Gaertn commonly is used as aphrodisiac herb. Phytosterol, saponin, flavonoid and tannin of the herb have a certain bioactivity and may affect to the body system. The objective of this research was to examine the antifertility effects of sam jawa (Talinum paniculatum Gaertn. root extract (SJRE on male mice (Mus musculus L.. Twenty male mice were divided into 4 groups randomly with 5 replications. SJRE was dissolved in aquadest and given orally everyday for 34 days. The treatment dosages were 0 (control, 100,200, and 300 mg/kg BW. At 35th day mice were sacrificed and sectioned to remove testes and epididymis spermatozoas. Testes were sectioned using paraffin method and stained using Haematoxyllin-Eosin. Spermatogenic cells in each seminiferous tubule were counted to investigated spermatogenesis activity of testes. Epididymis sperm suspension was used to investigate sperm quality i.e: morphology, velocity and motility. Quantitatives data were analized using ANOVA and continued DMRT on 5% significance level. The result showed SJRE had antifertility effects on male mice (Mus musculus L. could inhibit spermatogenesis (decrease the spermatogenic cells count and decrease the sperm quality (increase percentage of abnormal sperm, decrease sperm motility and also decrease sperm velocity.

  13. Parâmetros morfofisiológicos testiculares de camundongos (Mus musculus suplementados com geleia real Morphophysiological parameters of mice (Mus musculus testicles supplemented with royal jelly

    Directory of Open Access Journals (Sweden)

    A.C.T. Morais

    2009-02-01

    Full Text Available Avaliaram-se os efeitos da geleia real sobre os parâmetros morfofisiológicos testiculares de camundongos (Mus musculus. Utilizaram-se 57 machos Swiss, com quatro meses de idade, distribuídos aleatoriamente em seis tratamentos: T1: solução fisiológica, via intraperitoneal; T2: 0,1mg de geleia real, via intraperitoneal; T3: 0,2mg de geleia real, via intraperitoneal; T4: água destilada, via oral; T5: 0,1mg de geleia real, via oral; e T6: 0,2mg de geleia real, via oral. Após 45 dias de suplementação com geleia real, os animais sacrificados e pesados tiveram seus testículos coletados, incluídos em parafina e corados com hematoxilina/eosina. Não houve diferença entre os tratamentos quanto aos: pesos corporal e testicular, índice gonadossomático, diâmetro tubular, altura do epitélio, comprimento total dos túbulos seminíferos, comprimento tubular por grama de testículo, índices tubulossomático e leydigossomático e valores de proporção volumétrica referentes à túnica própria, epitélio seminífero, vaso sanguíneo e vaso linfático. Foi encontrada diferença entre T1 e T3 em relação aos túbulos seminíferos e ao espaço intertubular.The effects of royal jelly on the morphophysiological parameters of mice (Mus musculus testicles were studied. Fifty-eight male Swiss mice were evaluated. They were four-month old and were randomly distributed in six treatments: T1: physiological solution, intraperitonial route; T2: 0.1mg of royal jelly, intraperitonial route; T3: 0.2mg of royal jelly, intraperitonial route; T4: distilled water, orally; T5: 0.1mg of royal jelly, orally; and T6: 0.2mg of royal jelly, orally. After 45 days of supplementation with royal jelly, the animals were weighted, slaughtered, and the testicles collected, included in paraffin, and stained with haematoxylin-eosin. No differences among treatments were observed for: body and testicular weights, gonadossomatic index, tubular diameter, epithelial height, total

  14. STRUKTUR HISTOLOGI HATI MENCIT(Mus musculus L. SETELAH PEMBERIAN EKSTRAK DAUN EKOR NAGA (Rhapidhophora pinnata Schott

    Directory of Open Access Journals (Sweden)

    Ni Komang Tia Pramesti

    2017-09-01

    Full Text Available ABSTRACT Rhapidhophora pinnata, Schott is a traditional medical plant that has been use remedy for treatment of hypertension, stroke. Aims of  this research is to determine the effect of Rhapidhophora pinnata Schott leaf extract toward  mouse (Mus musculus L liverhistological structure. This research used completely randomized  design with 28 female mice that were divide into 4 groups of  P0 (control received 0,9% NaCl, group P1, P2, and P3 received 50, 100 and 150 mg/kg bw respectively by oral administration. The treatment were given daily for 14 days. All of the mice were sacrificed by ether after 15 days. The liver were examined for their histopathological changes, namely fatty degeneration, hydropic degenaration and necrosis. Results were statistically analised by Kruskal-Wallis method. Treatment groups showed no significant differences with regard of liver histopatological changes, however hemorrhage, sinusoid congestion and inflamatory cell infiltration were found in liver.   Keyword : Rhapidhophora pinnata Schott, liver, mice

  15. The radioprotective effects of Noni (Morinda citrifolia L.) juice on the bone marrow of irradiated Mus musculus L

    International Nuclear Information System (INIS)

    Boquiren, Ryan Albert Leonard N.; Te Tan, Alvin E.

    2000-03-01

    The radioprotective effects of Noni juice on the bone marrow of irradiated Mus musculus L. (7-week old IRC strain) was studied using the micronucleus test. Five mice were used for each of the six groups; negative and positive control, 25%, 50%, 75%, 100% treatment. Both negative and positive control groups were not treated with Noni juice. However, the negative control was not irradiated. Four different concentrations, a mixture of distilled water and commercial Noni juice, were administered via oral gavage to mice in their specific groups during the 15-day feeding schedule. A day (24H) after the last treatment, the mice were irradiated (6 Gy of gamma radiation). Two days (48H) after irradiation, the mice were sacrifice and the femur were extracted. The bone marrow cells were collected and slides were prepared. One thousand polychromatic erythrocytes (PCE) were screened for the presence of micronucleus per mouse. The mean frequency of micronucleated PCE were as follows: negative control, 15; positive control, 45; 25% treatment, 21; 50% treatment, 18; 75% treatment, 11; 100% treatment, 7. The Kruskal-Wallis test showed that the groups' responses varied (α=0.05). Multiple comparison showed that there were significant differences between: (1) 25% and 100% treatment group; (2) positive control group and 75% treatment group; (3) positive control group and 100% treatment group, thus indicating that Noni juice is effective in inhibiting micronucleus formation at high concentrations. The result also showed that radioprotective potential of Noni juice follows a dose-dependent pattern. (Author)

  16. The radioprotective effects of Noni (Morinda citrifolia L.) juice on the bone marrow of irradiated Mus musculus L

    Energy Technology Data Exchange (ETDEWEB)

    Boquiren, Ryan Albert Leonard N.; Te Tan, Alvin E

    2000-03-01

    The radioprotective effects of Noni juice on the bone marrow of irradiated Mus musculus L. (7-week old IRC strain) was studied using the micronucleus test. Five mice were used for each of the six groups; negative and positive control, 25%, 50%, 75%, 100% treatment. Both negative and positive control groups were not treated with Noni juice. However, the negative control was not irradiated. Four different concentrations, a mixture of distilled water and commercial Noni juice, were administered via oral gavage to mice in their specific groups during the 15-day feeding schedule. A day (24H) after the last treatment, the mice were irradiated (6 Gy of gamma radiation). Two days (48H) after irradiation, the mice were sacrifice and the femur were extracted. The bone marrow cells were collected and slides were prepared. One thousand polychromatic erythrocytes (PCE) were screened for the presence of micronucleus per mouse. The mean frequency of micronucleated PCE were as follows: negative control, 15; positive control, 45; 25% treatment, 21; 50% treatment, 18; 75% treatment, 11; 100% treatment, 7. The Kruskal-Wallis test showed that the groups' responses varied ({alpha}=0.05). Multiple comparison showed that there were significant differences between: (1) 25% and 100% treatment group; (2) positive control group and 75% treatment group; (3) positive control group and 100% treatment group, thus indicating that Noni juice is effective in inhibiting micronucleus formation at high concentrations. The result also showed that radioprotective potential of Noni juice follows a dose-dependent pattern. (Author)

  17. No evidence for punishment in communally nursing female house mice (Mus musculus domesticus).

    Science.gov (United States)

    Ferrari, Manuela; König, Barbara

    2017-01-01

    Punishment is claimed as an important mechanism to stabilise costly cooperation in humans, but its importance in social animals has been questioned recently due to both conceptual considerations and a lack of empirical evidence (only few published studies). We empirically tested whether there is evidence for punishment in communally nursing house mice (Mus musculus domesticus, direct descendants of "wild" animals). Communally breeding females pool their litters and raise all offspring together, indiscriminately caring for own and other offspring. Such a situation resembles a public good and provides scope for exploitation if females vary in their relative contributions to the joint nest (offspring number). We allowed two females to communally breed and conducted removal experiments both in the presence and absence of pups. We aimed to test whether reduced investment by one of the females (induced through separation from the partner and their combined offspring for 4 or 12 hours) leads to increased aggression by the other female after the reunion. We found no evidence for punishment, on the contrary, females increased socio-positive behaviours. The costs of losing a partner in a communally breeding species might be too high and hinder the evolution of punishment. Our findings add to a growing list of examples questioning the role of punishment in cooperating non-human animals and emphasise the importance of empirical testing of its assumptions and predictions.

  18. Penelitian Pendahuluan Pengaruh Daun Manggis sebagai Rodentisida Nabati pada Mencit Mus musculus Strain Balepsi

    Directory of Open Access Journals (Sweden)

    Agus Kardinan

    2000-07-01

    Full Text Available Research has been conducted at Pest and Disease Laboratory, Research Institute for Spices and Medicinal Crops, Bogor, during 1997-1998. The objective was to evaluate the possibility of Mangosteen (Garcinia mangostana leaves to be used as botanical rodenticide which is tested to reproduction ability of mice Mus musculus. Eight to ten weeks old mice with the average weight of 25 gram were obtained from Research Institute for Livestock, Ciawi. Research was arranged at randomized block design, 8 treatments and 4 replications. Data was analyzed by determining the average value and their standard deviation values. Observations were done to the weight of testis, weight of embryo, number of embryo, volume of extracts drank by mice and mice behavior during experiment. Result revealed that there was no indication that the leaves extract affected the weight of testis, but it affected the number and weight of embryo. There was indication that mangosteen leaves acted as antifertility on mice. Giving leaves extract increased the total volume of extract drink. There was no abnormality at the activity of mice during experiment, included sex activity, poisonous symptoms and others.

  19. Spermatogenic structure and fertility of Mus musculus after exposure of mangosteen (Garcinia mangostana L) pericarp extract

    Science.gov (United States)

    Hayati, Alfiah; Agustin, Melia Eka; Rokhimaningrum, Farida Ayu; Adro'i, Hasan; Darmanto, Win

    2016-03-01

    This study aimed to determine the effect of mangosteen (Garcinia mangostana L.) pericarp extract on spermatogenics number, seminiferous tubules sized, profile protein of epididymal and testicular sperm, and fertility of mice (Mus musculus). Fourty two male mice strain BALB/C was divided equally into 7 groups. The control group was given 0.05 ml of 0.05% CMC solution. Three group were given mangosteen pericarp extract at various doses (75, 100 and 150 mg/kg body weight, respectively) for 7 days, while the other three groups were given the same extract dose for 35 days. Parameters evaluated on histological of spermatogonia, spermatocytes, round spermatids, seminiferous tubule diameter, and thickness of germinal epithelium, analysis of testicular and epidydimal protein profile with SDS-Page, and than fertility test on female mice. The results showed that mangosteen pericarp extract at 75 and 100 mg/kg dose for 7 days had no effect on spermatogenics number and seminiferous tubule sizes, but the treatment dose of 150 mg/kg for 7 days and all treatment (doses of 75, 100, and 150 mg/kg) for 35 days led to significant decrease on the number of spermatogenics and seminiferous tubule sizes; effect on protein profiles testicular and epididymal sperm; and lower fertilization.

  20. Effect of Physalis peruviana "tomatillo" fruit extract in Mus musculus var. swis with induced hyperlipidemi.

    Directory of Open Access Journals (Sweden)

    Julio Campos Florián

    2011-06-01

    Full Text Available The objective of this research was to determine the hypolipidemic activity of the fruit of Physalis peruviana "tomatillo" in a model of acute hyperlipidemia induced by triton. Mus musculus var. swis males as experimental animals. We worked with four groups of mice, the white group received distilled water orally and saline intraperitoneally, the control group received distilled water orally and intraperitoneally triton, the problem group 1 received orally 0.05g/100g Physalis peruviana extract intraperitoneally and triton and the problem group 2 received orally 0.2g/100g extract of Physalis peruviana and triton intraperitoneally. After 24 hours of administering the treatments were performed measurements of serum cholesterol and triglycerides. Mean levels of cholesterol (mg/dL were: 58.87 ± 11.54 (white, 121.71 ± 15.00 (control, 58.08 ± 9.21 (Problem 1 and 66 78 ± 16.77 (Problem 2. Average levels of triglycerides (g /L were: 0.48 ± 0.07 (white, 1.84 ± 0.18 (control, 0.34 ± 0.10 (Problem 1 and 0.94 ± 0.25 (Problem 2. We found significant reductions (p <0.000 concentrations of both cholesterol and triglycerides in relation to those obtained in the group treated only with Triton.

  1. Comparative analysis of Homo sapiens and Mus musculus cyclin-dependent kinase (CDK) inhibitor genes p16 (MTS1) and p15 (MTS2).

    Science.gov (United States)

    Jiang, P; Stone, S; Wagner, R; Wang, S; Dayananth, P; Kozak, C A; Wold, B; Kamb, A

    1995-12-01

    Cyclin-dependent kinase inhibitors are a growing family of molecules that regulate important transitions in the cell cycle. At least one of these molecules, p16, has been implicated in human tumorigenesis while its close homolog, p15, is induced by cell contact and transforming growth factor-beta (TGF-beta). To investigate the evolutionary and functional features of p15 and p16, we have isolated mouse (Mus musculus) homologs of each gene. Comparative analysis of these sequences provides evidence that the genes have similar functions in mouse and human. In addition, the comparison suggests that a gene conversion event is part of the evolution of the human p15 and p16 genes.

  2. New Metacentric Populations and Phylogenetic Hypotheses Involving Whole-Arm Reciprocal Translocation in Mus musculus domesticus from Sicily, Southern Italy.

    Science.gov (United States)

    Castiglia, Riccardo; Capanna, Ernesto; Bezerra, Alexandra M R; Bizzoco, Domenico; Zambigli, Emanuela; Solano, Emanuela

    2015-01-01

    The house mouse Mus musculus domesticus is characterized by more than 100 metacentric populations, due to the occurrence of Robertsonian (Rb) fusions, together with the standard all-telocentric karyotype (2n = 40). We examined G-banded karyotypes of 18 mice from 10 localities in Sicily and describe 3 new metacentric populations: 'Ragusa Ibla' (IRAG), 2n = 33-36, Rb(2.4), Rb(5.6), Rb(9.16), Rb(13.17); 'Piana degli Albanesi' (IPIA), 2n = 23, Rb(1.18), Rb(2.15), Rb(3.5), Rb(4.12), Rb(6.11), Rb(7.8), Rb(9.16), Rb(10.14), Rb(13.17); 'Trapani' (ITRA), 2n = 22, Rb(1.18), Rb(2.15), Rb(3.7), Rb(4.12), Rb(5.9), Rb(6.11), Rb(8.16), Rb(10.14), Rb(13.17). Three mice belonged to the previously reported 'Castelbuono' race (ICAS), 2n = 24, which is very similar to the nearby 'Palermo' (IPAL) race, 2n = 26. Three Rb fusions not yet observed in wild mouse populations were identified: Rb(3.5), Rb(3.7) and Rb(5.9). Rb fusions shared among 4 races (IPIA, IRAG, ICAS, and IPAL) allowed us to describe their potential phylogenetic relationships. We obtained 2 alternative phylogenetic trees. The differences between them are mainly due to various modes of formation of IPIA and ITRA. In the first hypothesis, the specific Rb fusions occurred independently. In the second, those of IRAG originated from those of IPIA via whole-arm reciprocal translocations. © 2015 S. Karger AG, Basel.

  3. Hubungan Hiperglikemia dengan Prothrombin Time pada Mencit (Mus musculus yang Diinduksi Aloksan

    Directory of Open Access Journals (Sweden)

    Muhammad Ibnu Malik

    2015-01-01

    . Endothelial disfungtion can be detected by activated partial thromboplastin time (APTT and prothrombin time (PT. The objective of this studi was to determine the correlation between hyperglycemia and prothrombin time in mice (Mus musculus induced with aloxan. The design of this research was a post test only control group design conducted in October 2013 until February 2014 in Central Laboratory RS Dr. M. Djamil Padang. The subject were white mice (Mus musculus who have met the inclusion and exclusion criteria. The subject were divided as hyperglycemia group (induced with aloxan and control group. After seven days of adaptation, the aloxan was injected and measurenment of blood glucose and body weight had been done, one time in every four days. Then in day 30th the termination of mice had been done to meassure the prothrombin time. The result showed the prothrombin time between group was shortened with the average prothrombin time of the control group was 7,96 second and the hiperglicemia group was 8,12 second. The result showing no correlation between hyperglycemia and prothrombin time with the degree of signification is (p 0,7 (p > 0,05.Keywords: hyperglycemia, diabetes mellitus, prothrombin time,

  4. Genotoxic effects in wild rodents (Rattus rattus and Mus musculus) in an open coal mining area.

    Science.gov (United States)

    León, Grethel; Pérez, Lyda Espitia; Linares, Juan Carlos; Hartmann, Andreas; Quintana, Milton

    2007-06-15

    Coal is a mixture of a variety of compounds containing mutagenic and carcinogenic polycyclic aromatic hydrocarbons. Exposure to coal is considered as an important non-cellular and cellular source of reactive oxygen species that can induce DNA damage. In addition, spontaneous combustion can occur in coal mining areas, further releasing compounds with detrimental effects on the environment. In this study the comet assay was used to investigate potential genotoxic effects of coal mining activities in peripheral blood cells of the wild rodents Rattus rattus and Mus musculus. The study was conducted in a coal mining area of the Municipio de Puerto Libertador, South West of the Departamento de Cordoba, Colombia. Animals from two areas in the coal mining zone and a control area located in the Municipio de Lorica were investigated. The results showed evidence that exposure to coal results in elevated primary DNA lesions in blood cells of rodents. Three different parameters for DNA damage were assessed, namely, DNA damage index, migration length and percentage damaged cells. All parameters showed statistically significantly higher values in mice and rats from the coal mining area in comparison to the animals from the control area. The parameter "DNA Damage Index" was found to be most sensitive and to best indicate a genotoxic hazard. Both species investigated were shown to be sensitive indicators of environmental genotoxicity caused by coal mining activities. In summary, our study constitutes the first investigation of potential genotoxic effects of open coal mining carried out in Puerto Libertador. The investigations provide a guide for measures to evaluate genotoxic hazards, thereby contributing to the development of appropriate measures and regulations for more careful operations during coal mining.

  5. Mitochondrial Genetic Diversity and Phylogeography of Mus musculus castaneus in Northern Punjab, Pakistan.

    Science.gov (United States)

    Bibi, Shahnaz; Nadeem, Muhammad Sajid; Wiewel, Andrew Stephen; Beg, Mirza Azhar; Hameed, Khalid; Jabeen, Musarrat; Raja, Ghazala Kaukab

    2017-12-01

    Regions of Iran, Afghanistan, Pakistan and northwestern India have been proposed as the place of origin of Mus musculus castaneus. But despite the fact that Pakistan encompasses an important part of its range, M. m. castaneus populations in Pakistan have not been the subject of intensive genetic and biogeographic studies, except for a very small number of samples included in past studies. We studied genetic variation in M. m. castaneus (CAS) from northern Punjab Province, Pakistan, by using cytochrome b (Cytb) analysis in a sample of 98 individuals. Median-joining network revealed four well differentiated CAS sub-lineages coexisting within a small geographical region; these had previously been thought to have largely non-overlapping geographic distributions. Moreover, haplotypes from Pakistan occupied a central position in the network and all identified global haplotypes were also present in Pakistan. All identified CAS sub-lineages proved to be highly diverse on the basis of haplotype and nucleotide diversity indices. Tajima's D test and Fu's Fs tests of neutrality suggest recent population expansions in all sub-lineages. Expansion times were estimated as 21,760-134,930, 10,800-64,400 and 4950-30,665 ybp using substitution rates of 2.5%, 5% and 11%, respectively. Our results support the hypothesis that northern Punjab Province in Pakistan is the most likely source area for M. m. castaneus, and that the CAS sub-lineages in this region have undergone rapid population expansion events at different time periods, which appear to have benefitted from human-mediated transport, although one of them clearly predates the establishment of human settlements in this region.

  6. Mus musculus bone fluoride concentration as a useful biomarker for risk assessment of skeletal fluorosis in volcanic areas.

    Science.gov (United States)

    Linhares, Diana; Camarinho, Ricardo; Garcia, Patrícia Ventura; Rodrigues, Armindo Dos Santos

    2018-08-01

    Fluoride is often found in elevated concentrations in volcanic areas due to the release of magmatic fluorine as hydrogen fluorine through volcanic degassing. The exposure to high levels of fluoride can affect the processes of bone formation and resorption causing skeletal fluorosis, a pathology that can easily be mistaken for other skeletal diseases. In this study, we aimed to determine if fluoride concentration in the femoral bone of wild populations of the house mouse (Mus musculus) is a good biomarker of exposure to active volcanic environments naturally enriched in fluoride, allowing their use in biomonitoring programs. The fluoride concentration of the whole femoral bone of 9 mice from Furnas (5 males and 4 females) and 33 mice from Rabo de Peixe (16 males and 17 females) was measured by the potentiometric method with a fluoride ion selective electrode. Fluoride in bones was significantly higher in the mice from Furnas when compared with the mice from Rabo de Peixe (616.5 ± 129.3 μg F/g vs. 253.8 ± 10.5 μg F/g). Accumulation rates were also significantly higher in the mice collected in Furnas when compared with Rabo de Peixe individuals (3.84 ± 0.52 μg F/day vs. 1.22 ± 0.06 μg F/day). The results demonstrate a significant association between exposure to fluoride in the active volcanic environment and fluoride content in bone, revealing that bone fluoride concentration is a suitable biomarker of chronic environmental exposure to fluoride. Copyright © 2018 Elsevier Ltd. All rights reserved.

  7. Fraksi Heksan dan Fraksi Metanol Ekstrak Biji Pepaya Muda Menghambat Spermatogonia Mencit (Mus Musculus Jantan

    Directory of Open Access Journals (Sweden)

    Bagus Komang Satriyasa

    2010-03-01

    spermatogoniaA decreased significantly (p < 0,01. It is concluded that hexan fraction and methanol fraction ofunripe carica papaya seeds extract can decrease spermatogonia A cell of male mice (mus musculus.

  8. Toxicological Evaluation of Essential Oil From the Leaves of Croton argyrophyllus (Euphorbiaceae) on Aedes aegypti (Diptera: Culicidae) and Mus musculus (Rodentia: Muridae).

    Science.gov (United States)

    Cruz, R C D; Silva, S L C E; Souza, I A; Gualberto, S A; Carvalho, K S; Santos, F R; Carvalho, M G

    2017-07-01

    Plant-derived essential oils can be used as insecticides for vector control. However, to establish their safety, it is necessary to perform toxicological studies. Herein, we evaluated the chemical composition and insecticidal activity of the essential oil from the leaves of Croton argyrophyllus on the third- and fourth-instar larvae and adult Aedes aegypti (L., 1762). We also evaluated the acute toxicity of the essential oil in adult female Mus musculus. The lethal concentration 50 (LC50) and 90 (LC90) of C. argyrophyllus essential oil on larvae of Ae. aegypti were 0.31 and 0.70 mg ml-1, respectively, and 5.92 and 8.94 mg ml-1, respectively, on Ae. aegypti adults. The major components of the essential oil were spathulenol (22.80%), (E)-caryophyllene (15.41%), α-pinene (14.07%), and bicyclogermacrene (10.43%). It also displayed acute toxicity in adults of Mus musculus; the intraperitoneal and oral lethal dose 50 (LD50) were 2,000 mg kg-1 and 2,500 mg kg-1, respectively. The results showed that the essential oil from C. argyrophyllus leaves has insecticidal activity on Ae. aegypti larvae and adults at an average lethal concentration below the median lethal dose needed to cause acute toxicity in the common mouse. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  9. Test of Fruit Extract Pare (Momordica charantia L.) to Quality of Ejaculated Spermatozoa Mice (Mus musculus L.)

    Science.gov (United States)

    Fifendy, M.; Indriati, G.

    2018-04-01

    Pare (Momordica charantia L.) can be used in the treatment of various diseases, such as influenza, cancer, anti-inflammatory, anti-HIV, antimitotic and antifertilitas. This study aimed to determine the effect of the herbal bitter (Momordica charantia L.) to ejaculated sperm quality mice (Mus musculus L.). This research was conducted using Completely Randomized Design (CRD) with 4 treatments and 6 replications, water and fed adlibitum. First treatment is given solvent extract. Second treatments extract were given 0.2 gram, third treatment were given 0.4 gram of extracts and fourth treatment were treated exstrac 0.6 gram were orally for 30 days. After the mice decapitated, dissected and take sperm from vas deferens. Then, the sperm preparation determined using the improved Neubauer. Data were analyzed by ANOVA (Analysis of Varians). The results shoured at doses of 0,2 gram, the average sperm count was 19.89. decrease significant when compared with the control in which the average number of sperm 29.13. So with this research the effective doses to decrease sperm count and can be used as a contraception medication dosage was 0,2 gram. It can be conclude that the extract of bitter (Momordica charantia L.) can decrease the quality of the ejaculated sperm of mice (Mus musculus L.)

  10. The Effect of Curry Leaves (Murayya Koenigii L. on Blood Glucose Levels In Alloxan Diabetic Mice (Mus Musculus

    Directory of Open Access Journals (Sweden)

    Fauziah Fauziah

    2014-07-01

    Full Text Available This study was conducted to determine the effect of ethanol extract of curry leaves (Murraya koenigii L. on blood glucose levels in alloxan diabetic mice (Mus musculus. The diabetic conditions were made by giving alloxan 75 mg/kg body weight (BW and the hypoglycemic effects of extract of curry leaves given with various doses.   This study used 24 male mice strain Balb/c in four groups of treatment with six replications, namely the negative control group, the ethanol extract of curry leaf tree 50% mL/10g body weight group, 70% mL/10g body weight group and 90% mL/10g body weight group. The treatment was given orally by using a gastric sonde for 14 days. Blood samples were taken through the sinus caudalis using a scissors. Blood glucose level was measured at 1st , the 8th and the 24th of treatment using blood glucose test strips and Nesco® Multicheck apparatus. Blood glucose data were analyzed by one way ANOVA (Analysis of Variants and followed by Tuckey test at significance level of 5%. The result showed that treatment of ethanol extract of curry leaves (Murraya koenigii at various doses significantly affected the decrease on blood glucose levels of mice (Mus musculus alloxan diabetic.

  11. Synaptic vesicles isolated from the electric organ of Torpedo californica and from the central nervous system of Mus musculus contain small ribonucleic acids (sRNAs

    Directory of Open Access Journals (Sweden)

    Huinan Li

    2017-06-01

    Full Text Available Synaptic vesicles (SVs are presynaptic organelles that load and release small molecule neurotransmitters at chemical synapses. In addition to classic neurotransmitters, we have demonstrated that SVs isolated from the Peripheral Nervous Systems (PNS of the electric organ of Torpedo californica, a model cholinergic synapse, and SVs isolated from the Central Nervous System (CNS of Mus musculus (mouse contain small ribonucleic acids (sRNAs; ≤50 nucleotides (Scientific Reports, 5:1–14(14918 Li et al. (2015 [1]. Our previous publication provided the five most abundant sequences associated with the T. californica SVs, and the ten most abundant sequences associated with the mouse SVs, representing 59% and 39% of the total sRNA reads sequenced, respectively. We provide here a full repository of the SV sRNAs sequenced from T. californica and the mouse deposited in the NCBI as biosamples. Three data studies are included: SVs isolated from the electric organ of T. californica using standard techniques, SVs isolated from the electric organ of T. californica using standard techniques with an additional affinity purification step, and finally, SVs isolated from the CNS of mouse. The three biosamples are available at https://www.ncbi.nlm.nih.gov/biosample/ SRS1523467, SRS1523466, and SRS1523472 respectively.

  12. Tooth Morphogenesis and FGF4 Expression During Development of Molar Tooth in Three Muroid Rodents: Calomyscus elburzensis (Calomyscidae), Mesocricetus auratus (Cricetidae) and Mus musculus (Muridae).

    Science.gov (United States)

    Hamidi, Kordiyeh; Darvish, Jamshid; Matin, Maryam M; Javanmard, Athar Sadat; Kilpatrick, C William

    2017-12-01

    To date, no studies have examined the tooth formation during developmental stages of brush-tailed mice (Calomyscidae) and true hamsters (Cricetidae). Herein, we compared the timing of tooth morphogenesis and FGF4 expression pattern during development of the first lower molar in Goodwin's brush-tailed mouse, Calomyscus elburzensis with two other muroid rodents; the house mouse, Mus musculus (Muridae), model organism for tooth morphogenesis, and the golden hamster, Mesocricetus auratus which shares great similarities in cusp pattern with brush-tailed mice. All three species were bred in captivity and developing embryos were isolated at different embryonic days (E). Histological evaluation of lower molars was performed and spatiotemporal pattern of FGF4 expression was determined by immunohistochemistry. Results indicated that morphogenesis of the tooth cusps starts at the beginning of the cap stage of the first lower molar (E14 in house mouse, about E11.5 in golden hamster and E22 in Goodwin's brush-tailed mouse). During the cap to bell stage (E15 in house mouse, E12 in golden hamster and at about E24 in Goodwin's brush-tailed mouse), a decrease in the expression of FGF4 was observed in the mesenchyme, except for the cusp tips. According to our observations, the developmental process of the first lower molar formation in Goodwin's brush-tailed mouse began much later as compared with the other two species. Despite the differences in the temporal pattern of molar development between these three members of the same superfamily (Muroidea), the correlation in the expression of FGF4 with specific stages of tooth morphogenesis supported its regulatory function. Anat Rec, 300:2138-2149, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  13. PENGARUH DOSIS DAN LAMA PERLAKUAN EKSTRAK DAUN KALIANDRA MERAH (Calliandra calothyrsus Meissn. TERHADAP STRUKTUR HISTOLOGI GINJAL MENCIT (Mus musculus L.

    Directory of Open Access Journals (Sweden)

    Nur Assiam

    2014-09-01

    Full Text Available This research aims to determine the effect of red calliandra (Calliandra calothyrsusMeissn. leaf extrac on the histological structure of the kidney of mice (Mus musculus L..Treatment was administered orally with varying doses. This research used a CompletelyRandomized Design in factorial pattern of two factors, doses (0 or control, 2, 4, and 6 mg/kgBW and length of treatment (7, 14, and 21 days, so there are 12 combination groups with 3replications of each. Organ was collected on days 8, 15, and 22 to observe histologicalstructure of the kidney. Renal histological observation of edema, Bowman’s spaceconstriction, and protein deposition, showed no correlation between both factors, but a veryreal correlation occurs in the damage of fatty degeneration, hemorrhage, and nucleuspyknotic. Histological observation of glomerular congestion and infiltration of inflammatorycells did not show any correlation between dose and duration of treatment.Keywords: red calliandra, histopathology of kidney, male mice

  14. Behavioural characterisation of wild derived male mice (Mus musculus musculus) of the PWD/Ph inbred strain

    Czech Academy of Sciences Publication Activity Database

    Fernandes, C.; Liu, L.; Paya-Cano, J. L.; Gregorová, Soňa; Forejt, Jiří; Schalkwyk, L. J.

    2004-01-01

    Roč. 34, č. 6 (2004), s. 621-630 ISSN 0001-8244 R&D Projects: GA MŠk LN00A079; GA ČR GA204/02/1373 Grant - others:EU(XE) QLRI-2000-00233; HHMI(US) 555000306 Institutional research plan: CEZ:AV0Z5052915 Keywords : mouse * behavior Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.215, year: 2004

  15. PRDM9 drives evolutionary erosion of hotspots in Mus musculus through haplotype-specific initiation of meiotic recombination.

    Science.gov (United States)

    Baker, Christopher L; Kajita, Shimpei; Walker, Michael; Saxl, Ruth L; Raghupathy, Narayanan; Choi, Kwangbom; Petkov, Petko M; Paigen, Kenneth

    2015-01-01

    Meiotic recombination generates new genetic variation and assures the proper segregation of chromosomes in gametes. PRDM9, a zinc finger protein with histone methyltransferase activity, initiates meiotic recombination by binding DNA at recombination hotspots and directing the position of DNA double-strand breaks (DSB). The DSB repair mechanism suggests that hotspots should eventually self-destruct, yet genome-wide recombination levels remain constant, a conundrum known as the hotspot paradox. To test if PRDM9 drives this evolutionary erosion, we measured activity of the Prdm9Cst allele in two Mus musculus subspecies, M.m. castaneus, in which Prdm9Cst arose, and M.m. domesticus, into which Prdm9Cst was introduced experimentally. Comparing these two strains, we find that haplotype differences at hotspots lead to qualitative and quantitative changes in PRDM9 binding and activity. Using Mus spretus as an outlier, we found most variants affecting PRDM9Cst binding arose and were fixed in M.m. castaneus, suppressing hotspot activity. Furthermore, M.m. castaneus×M.m. domesticus F1 hybrids exhibit novel hotspots, with large haplotype biases in both PRDM9 binding and chromatin modification. These novel hotspots represent sites of historic evolutionary erosion that become activated in hybrids due to crosstalk between one parent's Prdm9 allele and the opposite parent's chromosome. Together these data support a model where haplotype-specific PRDM9 binding directs biased gene conversion at hotspots, ultimately leading to hotspot erosion.

  16. Embryo quality of mice (“Mus musculus” fed royal jelly Qualidade embrionária de camundongos ("Mus musculus" suplementados com geléia real

    Directory of Open Access Journals (Sweden)

    Bruno Edésio dos Santos Melo

    2009-03-01

    Full Text Available The study was carried out to verify the effect of feeding royal jelly associated to follicle growth induction on number and quality of mice (Mus musculus embryos. Sixty Swiss females ageing from eight to ten weeks were distributed into three treatments: the first one, composed by animals fed 0.2 mL of physiological solution intraperitoneal (control group, n=20; the second and third ones, composed by females fed 0.5 and 1.0 mg of royal jelly diluted in 0.2 mL of physiological solution (n=20, respectively. Royal jelly was administered during 15 days, followed by the follicular growth induction process. Embryos were collected 68 hours after mating, by uterine flushing. No treatment effects on the number of females that answered to superovulatory process, the number of total recovery structures, the number of viable and non viable structures and the morphological quality of viable embryos (P>0.05 were observed. Therefore, royal jelly doses used were not efficient to increase the number of embryos and to improve the quality recovery from superovulated mice.Objetivou-se verificar a influência da geléia real, associada ao tratamento de indução de crescimento folicular, no número e na qualidade de embriões de camundongos (Mus musculus. Foram utilizadas 60 fêmeas da linhagem Suíço albino com idade entre oito e dez semanas, distribuídas em três tratamentos: o primeiro, composto por animais que receberam 0,2 mL de solução fisiológica, via intraperitonial (grupo controle, n=20; o segundo e terceiro, compostos de fêmeas que receberam 0,5 e 1 mg de geléia real diluídos em 0,2 mL de solução fisiológica via intraperitonial (n=20, respectivamente. Foi administrada geléia real por um período de 15 dias, segundo o processo de indução do crescimento folicular. As coletas dos embriões ocorreram 68 horas após a cobertura, utilizando-se o método da lavagem uterina. Não houve diferença no número de fêmeas que responderam ao tratamento

  17. Mouse consomic strains: Exploiting genetic divergence between Mus m. musculus and Mus m. domesticus subspecies

    Czech Academy of Sciences Publication Activity Database

    Gregorová, Soňa; Divina, Petr; Storchová, Radka; Trachtulec, Zdeněk; Fotopulosová, Vladana; Svenson, K.L.; Donahue, K.L.; Paigen, B.; Forejt, Jiří

    2008-01-01

    Roč. 18, č. 3 (2008), s. 509-515 ISSN 1088-9051 R&D Projects: GA MŠk(CZ) 1M0520; GA ČR(CZ) GA301/07/1264 Grant - others:HHMI(US) HHMI55000306; NIH(US) 1R01HG00318; EC(XE) AnEUploidy 037627 Institutional research plan: CEZ:AV0Z50520514 Keywords : complex trait loci (QTLs) * chromosome substitution strains * PWD/Ph Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 10.176, year: 2008

  18. Tissue-Specific Contributions of Paternally Expressed Gene 3 in Lactation and Maternal Care of Mus musculus.

    Directory of Open Access Journals (Sweden)

    Wesley D Frey

    Full Text Available Paternally Expressed Gene 3 (Peg3 is an imprinted gene that controls milk letdown and maternal-caring behaviors. In this study, a conditional knockout allele has been developed in Mus musculus to further characterize these known functions of Peg3 in a tissue-specific manner. The mutant line was first crossed with a germline Cre. The progeny of this cross displayed growth retardation phenotypes. This is consistent with those seen in the previous mutant lines of Peg3, confirming the usefulness of the new mutant allele. The mutant line was subsequently crossed individually with MMTV- and Nkx2.1-Cre lines to test Peg3's roles in the mammary gland and hypothalamus, respectively. According to the results, the milk letdown process was impaired in the nursing females with the Peg3 mutation in the mammary gland, but not in the hypothalamus. This suggests that Peg3's roles in the milk letdown process are more critical in the mammary gland than in the hypothalamus. In contrast, one of the maternal-caring behaviors, nest-building, was interrupted in the females with the mutation in both MMTV- and Nkx2.1-driven lines. Overall, this is the first study to introduce a conditional knockout allele of Peg3 and to further dissect its contribution to mammalian reproduction in a tissue-specific manner.

  19. Pengaruh Lendir Bekicot (Achatina fulica terhadap Jumlah Sel Fibroblas pada Penyembuhan Luka Sayat Studi Eksperimental pada Kulit Mencit (Mus musculus

    Directory of Open Access Journals (Sweden)

    Perez Wahyu Purnasari

    2012-12-01

    Design and methods: The study is an experimental research with post test only randomized control group design. The subjects were 18 Mus musculus strain mice that were divided into 3 groups. 1st group as a control group of untreated, 2nd group was given povidone iodine 10%, and 3rd group was given land snails’ mucus during 5th days. On the 6th day the mices were killed for histological study. Results: The data showed that average number of fibroblast in 1st group is 93,85; 2nd group is 126,37; and 3rd is group 217,5. The results of one way anova statistical test showed significant difference among the three groups p = 0,000. The results of post hoc test showed significant difference in all groups (p < 0,05. Conclusion: The mucus of land snail is influence the number of fibroblast in healing cuts (Sains Medika, 4(2:195-203.

  20. A survey on helminthic infection in mice (Mus musculus and rats (Rattus norvegicus and Rattus rattus in Kermanshah, Iran

    Directory of Open Access Journals (Sweden)

    Norollah Pakdel

    2013-06-01

    Full Text Available Parasitic infections of rodents can compromise scientific research as well as the health of the animals and humans. Based on previous studies, infection rate of parasitic helminths is different in various regions of Iran. The current survey was aimed to determine endoparasitic helminths infection in 138 trapped rodents of Kermanshah county, Iran. Mice and rats were trapped using metal snares from January to October 2011 and euthanized. Rodents included 110 Mus musculus (79.00%, 23 Rattus norvegicus (17.00%, and five Rattus rattus (4.00%. The gastrointestinal and respiratory tracts were removed and examined to identify parasitic helminths. The results indicated that 42.02% of examined rodents were infected with eight helminths species, i.e. Trichuris muris (14.49%, Syphacia obvelata (13.76%, Syphacia muris (2.89%, Aspicularis tetrapetra (5.07%, Heterakis spumosa (5.07%, Capillaria hepatica eggs (3.62%, Hyminolepis diminuta (12.30%, and Cystisercus fasciolaris, the larva of Taenia teanieformis (4.34%. Given the results of this study, we concluded that examined rodents were more infected with nematodes than other helminths. As rodents are usually infected with a number of zoonotic parasites, hence control of these animals has an important role in safeguarding public health.

  1. Aktivitas Penyembuhan Luka Sediaan Topikal Ekstrak Bawang Merah (Allium cepa terhadap Luka Sayat Kulit Mencit (Mus Musculus (THE ACTIVITY OF TOPICAL EXTRACT OF ONIONS (ALLIUM CEPA ON WOUND HEALING PROCESS IN MICE (MUS MUSCULUS

    Directory of Open Access Journals (Sweden)

    Visa Yunanda

    2017-01-01

    Full Text Available Wound healing is a physiological response of the body to restore continuity, structure and function ofthe injured tissue. Onion is one of the plants that are empirically used by the community to heal wounds.The purpose of this study was to observe the effect of topical extract of onions (Allium cepa on woundhealing process in mice (Mus musculus strain BalbC. This study used the posttest-only control groupdesign with completely randomized design (CRD. The samples were 12 male mice with weight ranged of22-32 g divided into four treatments; i.e.: Vaseline, topical extract of onion 5%, topical extract of onion30% and topical extract of onion 55% with 3 replications. Wound healing evaluated macroscopically toobserve hyperemia, wound contraction, granulation, crusting and pus production; and microscopically bycounting the number of fibroblasts on day 10. Hyperemia, granulation, crusting and pus production wereanalyzed descriptively. Wound contraction and the number of fibroblasts were analyzed using ANOVA(p<0.05 and followed with Duncan’s test (p<0,05. Descriptive observations obtained hyperemia lasteduntil day 3, granulation in wounds used topical extract of onion 30% and 55% were faster than the other,crusting lasted until day 6 and the production of pus was not found in any treatment. Statistical testresults showed that topical extract of onion 55% significantly affected wound contraction and topicalextract of onion 30% and 55% significantly affected maturation, which characterized by the decreasednumber of fibroblasts. The results of this study showed that topical extract of onion had significant effect(p<0.05 on wound healing and the effect was in line with the increased concentration of the onion extract.

  2. Cloning, expression, purification, crystallization and X-ray analysis of inositol monophosphatase from Mus musculus and Homo sapiens

    International Nuclear Information System (INIS)

    Singh, Nisha; Halliday, Amy C.; Knight, Matthew; Lack, Nathan A.; Lowe, Edward; Churchill, Grant C.

    2012-01-01

    M. musculus and H. sapiens inositol monophosphatase 1 were cloned, expressed, purified and crystallized. Diffraction data were collected and analysed at resolutions of 2.4 and 1.7 Å, respectively, and the structures were compared in order to identify any structural differences. Inositol monophosphatase (IMPase) catalyses the hydrolysis of inositol monophosphate to inositol and is crucial in the phosphatidylinositol (PI) signalling pathway. Lithium, which is the drug of choice for bipolar disorder, inhibits IMPase at therapeutically relevant plasma concentrations. Both mouse IMPase 1 (MmIMPase 1) and human IMPase 1 (HsIMPase 1) were cloned into pRSET5a, expressed in Escherichia coli, purified and crystallized using the sitting-drop method. The structures were solved at resolutions of 2.4 and 1.7 Å, respectively. Comparison of MmIMPase 1 and HsIMPase 1 revealed a core r.m.s. deviation of 0.516 Å

  3. Pembentukan Pronukleus Jantan dan Betina pada Mencit (Mus musculus setelah Terjadinya Fertilisasi

    Directory of Open Access Journals (Sweden)

    SYAHRUDDIN SAID

    2005-11-01

    Full Text Available Pronuclei are nuclei from male or female before syngami. The information about time of fertilization in vivo in animals was limited, especially in formation of pronuclei. This study have purpose to know the timing of sperm and egg nuclei changes at the time in vivo fertilization until formed male and female pronuclei. The female mouse DDY age 6-8 weeks were super ovulated through injection 5 IU PMSG and hCG (48 h after PMSG per mouse intraperitoneally. The female mouse was mated with male from same species in proportion male: female = 1:1. The eggs were collected on 4, 6, 8, and 10 h after fertilization with 0 h is 12 h after hCG injection with shallow cut of fertilization bladder of female mouse tuba Fallopian. The shallow cut was treated in PBS media supplemented by 3% BSA and 0.1% hyaluronidase; the eggs were washed in same media without hyaluronidase. The eggs were fixed with glutaraldehyde 2.5% in PBS, the eggs were drawn in neutral formalin 10%, dehydration with ethanol 95% and stained with lacmoid 0.25% in acetic acid 45%, the eggs were washed with using acetoglycerol and then observation about development of sperm and egg nuclei morphology. Development of mouse egg nuclei achieve to female pronuclei phase 185 (95%+6 was occur on 8 h after in vivo fertilization, development of mouse sperm nuclei achieve to male pronuclei phase 185 (96%+4 was occur on 8 h after in vivo fertilization. In the present study, we found some of eggs like unfertile eggs, polysperm, and parthenogenesis at the fertilization in vivo.

  4. Mitochondrial DNA sequence variation and evolution of Old World house mice (Mus musculus)

    Czech Academy of Sciences Publication Activity Database

    Macholán, Miloš; Mrkvicová Vyskočilová, Martina; Bejček, V.; Šťastný, K.

    2012-01-01

    Roč. 61, 3-4 (2012), s. 284-307 ISSN 0139-7893 R&D Projects: GA ČR GA206/06/0707; GA ČR GA206/08/0640 Institutional support: RVO:67985904 Keywords : Bayesian skyline plot * control region * house mouse Subject RIV: EG - Zoology Impact factor: 0.494, year: 2012

  5. Toxicological evaluation of essential oil from the leaves of Croton tetradenius (Euphorbiaceae) on Aedes aegypti and Mus musculus.

    Science.gov (United States)

    Carvalho, Karine da Silva; E Silva, Sandra Lúcia da Cunha; de Souza, Ivone Antonia; Gualberto, Simone Andrade; da Cruz, Rômulo Carlos Dantas; Dos Santos, Frances Regiane; de Carvalho, Mário Geraldo

    2016-09-01

    For control of Aedes aegypti, the main vector of dengue, botanical insecticides can be a viable alternative. Herein, we evaluated the chemical composition and insecticidal activity of the essential oils of the leaves of Croton tetradenius on Ae. aegypti larvae and adults. We also evaluated the acute toxicity in Mus musculus. The essential oil chemical analysis was performed using chromatography coupled with mass spectrometry and flame ionization detection. Female mice were used for assessing toxicity according to the Organization for Economic Cooperation and Development's Test Guideline 423/2001. Doses administered to mice orally and intraperitoneally were 5, 50, 300, and 2000 mg kg(-1). There was a greater toxic effect on larvae (LC50 = 0.152 mg mL(-1) and LC90 = 0.297 mg mL(-1)) and on adults (LC50 = 1.842 mg mL(-1) and LC90 = 3.156 mg mL(-1)) of Ae. aegypti after 24 h of exposure, when compared to other periods of exposure. Chemical analysis revealed 26 components, with camphor (25.49 %) as the major component. The acute toxicity via the intraperitoneal route identified an LD50 = 200 mg kg(-1) and by the oral route an LD50 = 500 mg kg(-1). Thus, the essential oil of C. tetradenius presents insecticidal potential for Ae. aegypti and has high safety threshold at the concentrations evaluated in this study.

  6. WOUND HEALING ACTIVITY OF UNGUENTUM DOSAGE FORM OF ETHANOLIC EXTRACTS OF Areca catechu L. NUT IN Mus musculus albinus

    Directory of Open Access Journals (Sweden)

    Azizah Vonna

    2015-10-01

    Full Text Available The activity test of ethanol extract of betel nut ointment (Areca catechu L. in wound healing on mice (Mus musculus albinus has been carried out to determine the ability of the ethanol extract of betel nut ointment in wound healing and determine the concentration which was accelerate the wound healing on mice between 2 concentrations. This experimental research method used completely randomized design (CRD using 20 mices divided into 4 treatment groups ; ointment base, povidone iodine ointment, ethanol extract of betel nut ointment (SEEBP 2% and SEEBP 4%. Each treatment groups was tested in the incision which was made along the 15 mm parallel to the spine (Os. Vetebre with the depth until subcutaneous skin layers. The ointment was applied twice a day for about 21 days and observed changes every day for during the period of observation. The results showed that the average length of time of the scab formation, the scab exfoliation, and the wound healing successively are for the ointment base was 6.6; 10.2 and 18.2 days, povidone iodine ointment was 7; 11.2 and 14.8 days, SEEBP 2% was 5.75; 7.75 and 13.25 days, SEEBP 4% was 4.2; 8.8 and 12.8 days. ANOVA and LSD results of scab formation time showed a significant difference between SEEBP 4% with base ointment and povidone iodine ointment (p <0.05. Results of the exfoliation scab showed a significance difference between SEEBP 2% with base ointment and povidone iodine ointment (p <0.05. The duration of wound healing showed that there was significance difference between SEEBP 2%, SEBP 4% and povidone iodine ointment with ointment base  (p<0.05.Thus, betel nut ointment as an effect on healing process. The concentration which can accelerate wound healing in mice is SEEBP 4%.

  7. Genetic localization and phenotypic expression of X-linked cataract (Xcat) in Mus musculus.

    Science.gov (United States)

    Favor, J; Pretsch, W

    1990-01-01

    Linkage data relative to the markers tabby and glucose-6-phosphate dehydrogenase are presented to locate X-linked cataract (Xcat) in the distal portion of the mouse X-chromosome between jimpy and hypophosphatemia. The human X-linked cataract-dental syndrome, Nance-Horan Syndrome, also maps closely to human hypophosphatemia and would suggest homology between mouse Xcat and human Nance-Horan Syndrome genes. In hemizygous males and homozygous females penetrance is complete with only slight variation in the degree of expression. Phenotypic expression in Xcat heterozygous females ranges from totally clear to totally opaque lenses. The phenotypic expression between the two lenses of a heterozygous individual could also vary between totally clear and totally opaque lenses. However, a correlation in the degree of expression between the eyes of an individual was observed. A variegated pattern of lens opacity was evident in female heterozygotes. Based on these observations, the site of gene action for the Xcat locus is suggested to be endogenous to the lens cells and the precursor cell population of the lens is concluded to be small. The identification of an X-linked cataract locus is an important contribution to the estimate of the number of mutable loci resulting in cataract, an estimate required so that dominant cataract mutagenesis results may be expressed on a per locus basis. The Xcat mutation may be a useful marker for a distal region of the mouse X-chromosome which is relatively sparsely marked and the X-linked cataract mutation may be employed in gene expression and lens development studies.

  8. Struktur mikroskopis kartilago epifisialis tibia fetus mencit (Mus musculus L. dari induk dengan perlakuan kafein

    Directory of Open Access Journals (Sweden)

    Heri Budi Santoso

    2012-02-01

    Full Text Available Caffeine affects activity of enzyme of polimerase DNA, induce the mitosis of cells mammal of before replication DNA ended the perfection, and also pursue the activity of enzyme fosfodiesterase is hence anticipated by a potential caffeine generate the developmental defect, for example can pursue the process of ossification endochondralis in growth plate. This present research studied the effect of caffeine gift by oral on pregnant dam during organogenesis to structure of histologi growth plate tibia foetus. Twenty four pregnant mice (6 per group were treated by gavage with 0 (control, 40, 80, 120 mg/kg b.w caffeine from gestation day 6 to 15. On day 18 of pregnancy, fetuses was removed from dams by caecarean section.. Observation of histological structure of the tibial growth plate preparation by paraffin method (Hematoxylin-Eosin staining. The result showed that caffeine cause slightened proliferative zone, maturation zone, and cartilage calcification zone on the mouse tibial growth plate.

  9. Intraperitoneal Injection of Ethanol for the Euthanasia of Laboratory Mice (Mus musculus) and Rats (Rattus norvegicus).

    Science.gov (United States)

    Allen-Worthington, Krystal H; Brice, Angela K; Marx, James O; Hankenson, F Claire

    2015-11-01

    Compassion, professional ethics, and public sensitivity require that animals are euthanized humanely and appropriately under both planned and emergent situations. According to the 2013 AVMA Guidelines for the Euthanasia of Animals, intraperitoneal injection of ethanol is "acceptable with conditions" for use in mice. Because only limited information regarding this technique is available, we sought to evaluate ethanol by using ECG and high-definition video recording. Mice (n = 85) and rats (n = 16) were treated with intraperitoneal ethanol (70% or 100%), a positive-control agent (pentobarbital-phenytoin combination [Pe/Ph]), or a negative-control agent (saline solution). After injection, animals were assessed for behavioral and physiologic responses. Pain-assessment techniques in mice demonstrated that intraperitoneal injection of ethanol was not more painful than was intraperitoneal Pe/Ph. Median time to loss of consciousness for all mice that received ethanol or Pe/Ph was 45 s. Median time to respiratory arrest was 2.75, 2.25, and 2.63 min, and time (mean ± SE) to cardiac arrest was 6.04 ± 1.3, 2.96 ± 0.6, and 4.03 ± 0.5 min for 70% ethanol, 100% ethanol, and Pe/Ph, respectively. No mouse that received ethanol or Pe/Ph regained consciousness. Although successful in mice, intraperitoneal ethanol at the doses tested (9.2 to 20.1 g/kg) was unsuitable for euthanasia of rats (age, 7 to 8 wk) because of the volume needed and prolonged time to respiratory effects. For mice, intraperitoneal injection of 70% or 100% ethanol induced rapid and irreversible loss of consciousness, followed by death, and should be considered as "acceptable with conditions."

  10. Syphacia obvelata (Nematode, Oxyuridae) infecting laboratory mice Mus musculus (Rodentia, Muridae): phylogeny and host-parasite relationship.

    Science.gov (United States)

    Abdel-Gaber, Rewaida

    2016-03-01

    Syphacia obvelata is a pinworm nematode parasite infecting man and laboratory animals in high abundance. This parasitological study was carried out during the period of March 2014-February 2015 to investigate the helminth parasites infecting the laboratory mice Mus musculus in the Animal House at Cairo University, Egypt. The prevalence of S. obvelata in M. musculus was 75.0 %. The extent of infection with S. obvelata is analyzed according to the sex of the host mice. It was shown that the prevalence of male infection was greater than female worms. Morphological characterization revealed that the present Oxyurid species possesses a rounded cephalic end with less developed lips, esophagus divided into cylindrical corpus, and globular bulb supported internally with valvular apparatus; three mamelons are located at the ventral surface with a single chitinized spicule and a gubernaculum provided with an accessory hook in males, and ovijector apparatus opens ventrally by the vulva surrounded by protruded lips in female worms. Body of the male was 0.623-1.130 (0.830 ± 0.11) mm long and 0.092-0.130 (0.110 ± 0.01) mm wide; the esophagus was 0.164-0.280 (0.210 ± 0.01) mm long; the nerve ring and excretory pore are located at 0.035-0.132 (0.073 ± 0.01) and 0.087-0.191 (0.145 ± 0.01) mm from the anterior end, respectively, while the female measured 2.930-4.650 (3.540 ± 0.1) mm long and 0.120-0.232 (0.156 ± 0.001) mm wide; the esophagus was 0.213-0.410 (0.342 ± 0.01) mm long; the nerve ring, excretory pore, and vulval opening are located at 0.026-0.157 (0.121 ± 0.01), 0.134-0.243 (0.195 ± 0.01), and 0.323-0.632 (0.546 ± 0.11) mm from the anterior end, respectively; eggs measured 0.120-0.139 (0.129 ± 0.001) mm long and 0.030-0.052 (0.045 ± 0.001) mm wide. It compared morphometrically with other Syphacia species described previously and showed little differences in

  11. Novel laboratory mouse papillomavirus (MusPV) infection.

    Science.gov (United States)

    Ingle, A; Ghim, S; Joh, J; Chepkoech, I; Bennett Jenson, A; Sundberg, J P

    2011-03-01

    Most papillomaviruses (PVs) are oncogenic. There are at least 100 different human PVs and 65 nonhuman vertebrate hosts, including wild rodents, which have species-specific PV infections. Florid papillomatosis arose in a colony of NMRI-Foxn1(nu)/Foxn1(nu) (nude) mice at the Advanced Centre for Treatment Research and Education in Cancer in India. Lesions appeared at the mucocutaneous junctions of the nose and mouth. Histologically, lesions were classical papillomas with epidermal hyperplasia on thin fibrovascular stalks in a verrucous pattern. Koilocytotic cells were observed in the stratum granulosum of the papillomatous lesions. Immunohistochemically, these abnormal cells were positive for PV group-specific antigens. With transmission electron microscopy, virus particles were observed in crystalline intranuclear inclusions within keratinocytes. The presence of a mouse PV, designated MusPV, was confirmed by amplification of PV DNA with degenerative primers specific for PVs. This report is the first of a PV and its related disease in laboratory mice.

  12. Efecto del extracto del fruto de Physalis peruviana "tomatillo" en Mus musculus var. swis con hiperlipidemia inducida.

    Directory of Open Access Journals (Sweden)

    Julio Campos Florián

    2011-01-01

    Full Text Available El objetivo de la presente i nvestigación fue determinar la actividad hipolipidémica del fruto de Physalis peruviana “tomatillo” en un modelo de hiperlipidemia aguda inducida con tritón. Se utilizaron Mus musculus var. swis machos como animales de experimentación. Se trabajó con cuatro grupos de ratones, el grupo blanco recibió agua destilada por vía oral y solución salina fisiológica por vía intraperitoneal, el grupo control recibió agua destilada por vía oral y tritón por vía intraperitoneal, el grupo problema 1 recibió por vía oral 0.05g/100g del extracto de Physalis peruviana y tritón por vía intraperitoneal y el grupo problema 2 recibió por vía oral 0.2g/100g del extracto de Physalis peruviana y tritón por vía intraperitoneal. Luego de 24 horas de administrar los tratamientos se re alizaron las mediciones en suero de las concentraciones de colesterol y triglicéridos. Los niveles promedio de colesterol (mg/dL fueron: 58.87±11.54 (blanco, 121.71±15.00 (control, 58.08±9. 21 (problema 1 y 66.78±16.77 (problema 2. Los niveles promedio de triglicéridos (g/L fueron: 0.48±0.07 (blanco, 1.84±0.18 (control, 0.34±0.10 (problema 1 y 0.94±0.25 (problema 2. Se encontró reducciones significativas (p<0.000, tanto de las concentraciones de colesterol como de triglicéridos en relación a las o btenidas en el grupo tratado sólo con tritón.

  13. The Effect of Calcusol™ to the Plasma Free Radical and Serum Creatinin in Mus Musculus Nephrolithiasis Model

    Directory of Open Access Journals (Sweden)

    A’liyatur Rosyidah

    2013-09-01

    Full Text Available Calcusol™ is a traditional medicine (jamu made from Tempuyung (Sonchus arvensis extract and is usually used for cure kidney stone disease. However, there has not been any studies which investigate the its mechanism. The aim of this study is to know the effect of Calcusol™ to the plasma free radical and serum creatinin of Mus musculus model for renal calcium-oxalate accumulation. This study is carried out by administration of Porang (Amorphophallus muelleri tuber flour for 3 months with the doses 6 mg/100g BW to induce renal calcium oxalate accumulation and Calcusol™ treatment for 7 days with the doses of 3.3mg/g BW. Group I was used as a control group. Group II was only given porang every day for 3 months. Group III was only given Calcusol™ for 7 days. Group IV were given porang for 3 months then given Calcusol™ for 7 days. Group V were given porang and Calcusol™ simultaneously for 3 months. Porang and CalcusolTM is administrated orally. Blood was collected from the tail of the animal for serum creatinin test and plasma free radical test using TBARS method. The data was analyzed using ANOVA followed by Tukey HSD to compare the means employing SPSS 16.0 for windows. The result of the research shows that the treatment Calcusol™ on mice model for renal calcium oxalate accumulation. The content of MDA at group I, group II, group III, group IV and group V, respectivelyis 0.81±0.5 mg/ml; 2.63±0.8 mg/ml; 0.56±0.5 mg/ml; 2.09±0.9 mg/ml and 0.17±0.17 mg/ml. The content of serum creatinine are 0.15±0.04 mg/dL; 0.13±0.03 mg/dL; 0.12±0.08 mg/dL; 0.11±0.016 mg/dL and 0.14±0.015 mg/dL at group I, group II, group III, Group IV, and group V respectively. This indicates that Calcusol™ decreases plasma free radical production during renal stone formation, while serum creatinin reduced but not significantly changed. Calcusol™ has an effect to decrease free radical during renalstone formation inmice model for calcium oxalate accumulation

  14. PENGARUH TRITERPEN TOTAL PEGAGAN (Centella asiatica (L Urban TERHADAP FUNGSI KOGNITIF BELAJAR DAN MENGINGAT PADA MENCIT JANTAN ALBINO (Mus musculus YANG DIHAMBAT DENGAN SKOPOLAMIN

    Directory of Open Access Journals (Sweden)

    Herlina

    2010-11-01

    Full Text Available Pegagan (Centella asiatica (L Urban has been described to posses CNS effects such as improving cognitive function, learning and memory. The aim of the research was to evaluate the effects of total triterpen’s pegagan extract on cognitive functions as the learning and memory performance in male albino mice (Mus musculus inhibited by scopolamine. The research design was Complete Randomized Design (RAL – factorial on thirty six mice divided into 4 groups. One control group received only aquabidest (negative control. Three treatment groups received total triterpen 16 mg/kg BW, 32 mg/kg BW orally and piracetam 500 mg/kg BW by intra peritoneally (positive control for 21 days. Data indicating learning and memory process of all subjects were obtained from one-trial passive avoidance test. Data were analyzed by two way ANOVA and BNT (p0,05. In conclusion, total triterpen from pegagan (Centella asiatica (L Urban improved learning ability and memory of male albino mice (Mus musculus even though, it was inhibited by scopolamine.

  15. Peroral Echinococcus multilocularis egg inoculation in Myodes glareolus, Mesocricetus auratus and Mus musculus (CD-1 IGS and C57BL/6j)

    DEFF Research Database (Denmark)

    Woolsey, Ian David; Jensen, Per Moestrup; Deplazes, Peter

    2016-01-01

    Echinococcus multilocularis transmission predominantly occurs in Europe between the red fox (Vulpes vulpes) and various species of rodent intermediate hosts. We infected 3 species of rodent, Myodes glareolus (n = 47), Mesocricetus auratus (n = 11) and outbred Mus musculus (CD-1 IGS) (n = 9...

  16. Classical Mus musculus Igκ enhancers support transcription but not high level somatic hypermutation from a V-lambda promoter in chicken DT40 cells.

    Directory of Open Access Journals (Sweden)

    Naga Rama Kothapalli

    2011-04-01

    Full Text Available Somatic hypermutation (SHM of immunoglobulin genes is initiated by activation-induced cytidine deaminase (AID in activated B cells. This process is strictly dependent on transcription. Hence, cis-acting transcriptional control elements have been proposed to target SHM to immunoglobulin loci. The Mus musculus Igκ locus is regulated by the intronic enhancer (iE/MAR and the 3' enhancer (3'E, and multiple studies using transgenic and knock-out approaches in mice and cell lines have reported somewhat contradictory results about the function of these enhancers in AID-mediated sequence diversification. Here we show that the M. musculus iE/MAR and 3'E elements are active solely as transcriptional enhancer when placed in the context of the IGL locus in Gallus gallus DT40 cells, but they are very inefficient in targeting AID-mediated mutation events to this locus. This suggests that either key components of the cis-regulatory targeting elements reside outside the murine Igκ transcriptional enhancer sequences, or that the targeting of AID activity to Ig loci occurs by largely species-specific mechanisms.

  17. Pengaruh Ekstrak Daun Sambiloto (Andrographis paniculata terhadap Struktur Mikroanatomi Hepar dan Kadar Glutamat Piruvat Transaminase Serum Mencit (Mus musculus yang Terpapar Diazinon

    Directory of Open Access Journals (Sweden)

    TRI WULANDARI

    2007-11-01

    Full Text Available Diazinon is a pesticide which is often using by farmer to kill insect as theenemy of the plant. The over using of pesticide may result in the remaining of diazinon residue in farming product. This residue can cause the damage of body tissue, especially liver. The aim of research were to find out the effect of leaves sambiloto (Andrographis paniculata Ness. extract on microanatomic structure of liver and serum glutamate pyruvate transaminase (GPT level of mice (Mus musculus L. exposed to diazinon. The research used Compelete Random Design with five treatments. The treatment of each group were using CMC 1% (placebo control, diazinon solution 40 mg/Kg BW (negative ontrol and the leaves sambiloto extract 12,6; 25,2 and 37,8 mg /kg BW. Diazinon solution was given within 10 days and continued with extract of sambiloto leaves also within 10 days. Parameter observed was the microanatomic structure of liver and serum GPT level. The data was analyzed of Analysis of Varians (Anova and continued with DMRT at significance 5%. The result of the research showed that the giving of the extract of sambiloto leaves in some dose variation degree is significantly influential to repair the microanatomic structure of liver and to decrease the serum GPT level was 37,8 mg/Kg BW.

  18. BIOAKTIFITAS BUNGA SEPATU (Hibiscus rosa-sinensis L. TERHADAP KADAR KOLESTEROL DARAH MENCIT (Mus musculus YANG MENGALAMI HIPERKOLESTEROLEMIA DENGAN DIET TINGGI LEMAK

    Directory of Open Access Journals (Sweden)

    Rinza Rahmawati Samsudin

    2017-12-01

      Tujuan penelitian ini adalah untuk mengetahui pengaruh bioaktifitas ekstrak bunga sepatu (Hibiscus rosa-sinensis l. terhadap  kadar kolesterol darah mencit (Mus musculus yang mengalami hiperkolesterolemia dengan diet tinggi lemak. Penelitian ini merupakan penelitian eksperimental murni, dengan menggunakan rancangan randomized post-test only control group design. Bunga sepatu mengandung pigmen antosianin yang termasuk golongan flavonoid yang berperan sebagai antioksidan. Sebanyak dua puluh delapan mencit dibagi menjadi empat kelompok (K1, K2, K3 dan K4. Kelompok K1 adalah kelompok yang mendapat perlakukan pakan tinggi lemak dan aquadest setelah aklimatasi. Kelompok K2, K3, dan K4 adalah kelompok  terapi yang mendapat perlakukan pakan tinggi lemak, ekstrak bunga septum sebanyak 1 ml dan aquadest setelah aklimatasi. Pemberian pakan tinggi lemak berlangsung selama 28 hari. Selama penelitian berlangsung penimbangan berat badan tikus dilakukan sebanyak lima kali. Hasil penelitian menunjukan bahwa pemberian 1 ml ekstrak bunga sepatu selama dua puluh delapan hari dapat menurunkan kadar kolesterol mencit dimana nilai p<0.05.   Kata kunci: ekstrak bunga sepatu, kadar kolesterol, diet tinggi lemak

  19. Male meiosis and gametogenesis in wild house mice (Mus musculus domesticus) from a chromosomal hybrid zone; a comparison between "simple" Robertsonian heterozygotes and homozygotes.

    Science.gov (United States)

    Wallace, B M; Searle, J B; Everett, C A

    1992-01-01

    Wild male house mice Mus musculus domesticus were collected from the hybrid zone between the John o'Groats race (2n = 32) and the standard race (2n = 40) in northern Scotland. Meiosis in both homozygotes (2n = 32, 36, and 40) and single Robertsonian heterozygotes (2n = 33, 35, and 37) was found to be orderly. At prophase/metaphase I in heterozygotes, a trivalent was formed from the metacentric and two homologous acrocentrics. At pachytene, this trivalent usually had a single side arm at the position of the centromeres, as a result of nonhomologous pairing of the acrocentrics. This side arm persisted into diplotene. Generally only a single chiasma was formed between each acrocentric and the metacentric. Anaphase I nondisjunction frequencies were estimated as 1.5% for the homozygotes and 2.7% for the heterozygotes. The extent of germ cell death between the pachytene and round spermatid stages was 18% greater in heterozygotes than in homozygotes. Our results concur with previous studies which indicate that single Robertsonian heterozygotes in wild house mice have near-normal fertility.

  20. Permanent magnetic field, direct electric field, and infrared to reduce blood glucose level and hepatic function in mus musculus with diabetic mellitus

    Science.gov (United States)

    Suhariningsih; Basuki Notobroto, Hari; Winarni, Dwi; Achmad Hussein, Saikhu; Anggono Prijo, Tri

    2017-05-01

    Blood contains several electrolytes with positive (cation) and negative (anion) ion load. Both electrolytes deliver impulse synergistically adjusting body needs. Those electrolytes give specific effect to external disturbance such as electric, magnetic, even infrared field. A study has been conducted to reduce blood glucose level and liver function, in type 2 Diabetes Mellitus patients, using Biophysics concept which uses combination therapy of permanent magnetic field, electric field, and infrared. This study used 48 healthy mice (mus musculus), male, age 3-4 weeks, with approximately 25-30 g in weight. Mice was fed with lard as high fat diet orally, before Streptozotocin (STZ) induction become diabetic mice. Therapy was conducted by putting mice in a chamber that emits the combination of permanent magnetic field, electric field, and infrared, every day for 1 hour for 28 days. There were 4 combinations of therapy/treatment, namely: (1) permanent magnetic field, direct electric field, and infrared; (2) permanent magnetic field, direct electric field, without infrared; (3) permanent magnetic field, alternating electric field, and infrared; and (4) permanent magnetic field, alternating electric field, without infrared. The results of therapy show that every combination is able to reduce blood glucose level, AST, and ALT. However, the best result is by using combination of permanent magnetic field, direct electric field, and infrared.

  1. Effect of Powder Leaf Breadfruit Disposals (Arthocarpus Altilis) in Oil Mandar District and Polman Against Cholesterol and Glucose Mice (Mus Musculus)

    Science.gov (United States)

    Mu'nisa, A.; Asmawati, A.; Farida, A.; FA, Fressy; Erni

    2018-01-01

    The purpose of this study was to determine the effect of powdered leaves of breadfruit (Arthocarpus altilis) on oil is mandated origin of the Polman glucose and cholesterol levels in mice (Mus musculus). This study comprised 4 treatments and each treatment consisted of 5 replicates, ie groups of mice were fed a standard (negative control); 2 groups: group of mice fed with standard and cholesterol feed (positive control); Group 3 that mice fed with standard and Selayar oil; and group 4: group of mice fed with standard and Mandar oil that has been given powdered leaves of breadfruit. Measurement of glucose and blood cholesterol levels in mice done 3 times ie 2 weeks after the adaptation period (phase 1), 2 weeks after administration of the oil (phase 2) and 2 weeks after feeding cholesterol (stage 3). Based on the analysis of data both cholesterol and glucose levels showed that in a group of 4 decreased glucose and cholesterol levels in stage 2 but at stage 3 an increase in the group of mice given only the oil while in the group of mice given the oil and powdered leaves of breadfruit indicate glucose levels and normal cholesterol. The conclusion of this study show that the addition of powdered leaves of breadfruit into cooking oil Mandar influential in glucose levels and normalize blood cholesterol levels in mice.

  2. Pengaruh Pemberian Ekstrak Etanol Daun Kecapi (Sandoricum koetjape (Burm.f. Merr. Terhadap Penurunan Kadar Kolesterol Total pada Mencit Jantan (Mus musculus

    Directory of Open Access Journals (Sweden)

    Rudi Kartika

    2016-06-01

    Full Text Available The research about utilization of ethanol extract form leafkecapi (Sandoricum koetjape (Burm.f.Merr.has been done, it proved could decrease  total cholesterol levels in male mice (Mus musculus. In this research sample macerated with ethanol 96% and then concentrated by rotary evaporator, and gained 15.6% of yield. Based on the results of phytochemical test, secondary metabolites compound that contained in bark kecapi are alkaloid, flavonoid, triterpenoid, steroid, phenolic and saponin. On antihiperkolesterolemia activity test by using male mice, there are several treatments that negative control (-, positive control (+ and three treatment with different doses i.e. a low doses (9.5 mg/kg BB, middle doses (19 mg/kg BB and high doses (38 mg/kg BB. The parameter measured was blood serum of male mice by using a Cholesterol Test Strips. From this test it showed that the effectiveness of decreased total cholesterol level doses of 19 mg/kg BB showed total cholesterol level under 100 mg/dL. Keywords:      Leaf kecapi (Sandoricum koetjape (Burm.f. Merr., Phytochemicals test, Total cholesterol levels, Cholesterol test strips.

  3. Permanent magnetic field, direct electric field, and infrared to reduce blood glucose level and hepatic function in mus musculus with diabetic mellitus

    International Nuclear Information System (INIS)

    Suhariningsih; Prijo, Tri Anggono; Notobroto, Hari Basuki; Winarni, Dwi; Hussein, Saikhu Achmad

    2017-01-01

    Blood contains several electrolytes with positive (cation) and negative (anion) ion load. Both electrolytes deliver impulse synergistically adjusting body needs. Those electrolytes give specific effect to external disturbance such as electric, magnetic, even infrared field. A study has been conducted to reduce blood glucose level and liver function, in type 2 Diabetes Mellitus patients, using Biophysics concept which uses combination therapy of permanent magnetic field, electric field, and infrared. This study used 48 healthy mice ( mus musculus ), male, age 3-4 weeks, with approximately 25-30 g in weight. Mice was fed with lard as high fat diet orally, before Streptozotocin (STZ) induction become diabetic mice. Therapy was conducted by putting mice in a chamber that emits the combination of permanent magnetic field, electric field, and infrared, every day for 1 hour for 28 days. There were 4 combinations of therapy/treatment, namely: (1) permanent magnetic field, direct electric field, and infrared; (2) permanent magnetic field, direct electric field, without infrared; (3) permanent magnetic field, alternating electric field, and infrared; and (4) permanent magnetic field, alternating electric field, without infrared. The results of therapy show that every combination is able to reduce blood glucose level, AST, and ALT. However, the best result is by using combination of permanent magnetic field, direct electric field, and infrared. (paper)

  4. Maternal-foetal genomic conflict and speciation: no evidence for hybrid placental dysplasia in crosses between two house mouse subspecies

    Czech Academy of Sciences Publication Activity Database

    Kropáčková, L.; Piálek, Jaroslav; Gergelits, Václav; Forejt, Jiří; Reifová, R.

    2015-01-01

    Roč. 28, č. 3 (2015), s. 688-698 ISSN 1010-061X R&D Projects: GA ČR GA13-08078S Institutional support: RVO:68081766 ; RVO:68378050 Keywords : hybrid placental dysplasia * genomic conflicts * speciation * X chromosome * house mouse * Mus musculus musculus * Mus musculus domesticus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 2.747, year: 2015

  5. [Autoantibody formation against the antigens of the synaptonemal complex in the syngeneic immunization of male Mus musculus].

    Science.gov (United States)

    Dadashev, S Ia; Gorach, G G; Kolomiets, O L

    1994-01-01

    Male mice were immunized with the suspension of synaptonemal complexes (SC) isolated from mouse spermatocytes nuclei. The indirect immunofluorescent analysis showed the active binding of sera obtained from immunized mice to SC of mouse spermatocyte spreads. At early and mid-pachytene, SC can be clearly identified in 19 autosome bivalents and in sex chromosome bivalent. According to the electron microscopic analysis, all structural elements of SC bind antibodies. Metaphase chromosomes were not stained with the immune sera. Specificity of interaction between SC components and antibodies was confirmed in a series of control experiments. Analysis of sera obtained from mice after their syngeneic immunization with isolated SC fraction suggested that certain mouse SC components induce the formation of autoantibodies. This, in turn, suggests that these SC components are meiosis-specific.

  6. Influence of Polysaccharide Krestin from Coriolus versicolor Extract on Nitrite and Malondialdehyde Concencentrations of Mus musculus Serum Exposed by Mycobacterium tuberculosis

    Directory of Open Access Journals (Sweden)

    Sri Puji Astuti Wahyuningsih

    2016-03-01

    Full Text Available Mycobacterium tuberculosis is a major infection agent of tuberculosis that is controlled by the response of cell-mediated immunity. It is macrophages and cytolytic T lymphocytes. Activated macrophages will produce free radicals. Excessive free radicals cause tissue damage. Polysaccharide krestin contains β-glucan. It is a scavenger of free radicals. This research aimed to identify the influence of polysaccharide krestin from C. versicolor on nitrite and malondialdehyde concentrations of mice serum exposed by M. tuberculosis. Nitrite concentration was determined by nitrite assay. Malondialdehyde concentration was determined by TBARS assay. The result showed that adding polysaccharide krestin before exposure (P1 and adding polysaccharide krestin before-after exposure (P3 had the best potential to decrease nitrite concentration. Nitrite concentrations of P1 and P3 were 1.364 ± 0.523 M and 1.456 ± 0.712 M respectively. Meanwhile, P1 group and adding polysaccharide krestin after exposure (P2 had the best potential to decrease malondialdehyde concentration. Malondialdehyde concentrations of P1 and P2 were 1125.86 ± 97.96 µM and 953.86 ± 328.16 µM respectively. Their nitrite and malondialdehyde concentrations decreased, compared to K and K- groups. The research conclusion was that adding polysaccharide krestin before exposure could decrease both nitrite and malondialdehyde concentrations.How to CiteWahyuningsih, S., Pramudya, M., & Sugiharto, S. (2016. Influence of Polysaccharide Krestin from Coriolus versicolor Extract on Nitrite and Malondialdehyde Concencentrations of Mus musculus Serum Exposed by Mycobacterium tuberculosis. Biosaintifika: Journal of Biology & Biology Education, 8(1, 12-17.

  7. The regeneration of thermal wound on mice skin (Mus Musculus) after Q-Switch Nd: YAG laser irradiation for cancer therapy candidate

    Science.gov (United States)

    Apsari, R.; Nahdliyatun, E.; Winarni, D.

    2017-09-01

    The aims of this study are to investigate the regeneration of mice skin tissue (Mus Musculus) irradiated by Q-Switch Nd: YAG laser and morphological change due to Q-Switch Nd: YAG laser irradiation compared to conventional heating (hairdryer). The 2-3 month of twenty-seven mice were used for experimental animals. Mice were incised in the dorsum by the damage effect of laser energy dose (therapeutic dose) of 29.5 J/cm2 with 10 seconds of exposure time, 10 Hz of repetition rate, and 100 pulses of the given single pulse energy. The mice skin tissue was injuried by hairdryer to get burned effect. Mice were divided into three groups, Group I (control) were not treated by anything, Group II were treated by Q-Switch Nd: YAG laser irradiation and sacrificed on (0, 1, 3, 5) days, and Group III were treated by hairdryer then sacrificed on (0, 1, 3, 5) days. Pathology examination showed that the energy of 29,5 J/cm2 dose produced the hole effect (ablation) through the hypodermic layer caused by optical breakdown and collagen coagulation. Thus, the 60 °C temperature of burn showed coagulation necrosis because piknosis discovered in the injured area. The regeneration process showed that the mice skin tissue's ability to regenerate was irradiated by fast laser because of the focus of Q-Switch Nd: YAG laser. It was showed by the scab releases on third day and completely reepithelialization formation on the fifth day. The collagen fibers distribution was same as normal skin tissue on day 5 and so did angiogenesis. Therefore, Q-Switch Nd: YAG laser can be applied for problems of dermatology medical therapies, especially melasma, nevus of ota and tatto therapy. For skin cancer therapy application, energy dose of unregenerated skin tissue is chosen because the death expected effect is permanent.

  8. Effect of bovine pellucid zone 3 monoclonal antibodies on B cell lymphoma 2 expressions of granulosa cell and mice (Mus musculus follicle diameter

    Directory of Open Access Journals (Sweden)

    Heti Ira Ayue

    2017-01-01

    Full Text Available Objective: To evaluate the effects of pellucid zone 3 monoclonal antibodies against B-cell lymphoma 2 (BCL-2 expression and mice follicle diameter at various time periods.Methods: The animal model of this study was 36 Balb/c mice (Mus musculus. A true experimental design was used with a post-test only control group approach. BCL-2 expression was observed using immunohistochemistry, while the follicle diameter was observed by haematoxylin-eosin staining. The data was analyzed using nested ANOVA to compare the results of the mean expression of BCL-2 on the 5th and 20th day of observation in the pre-antral and antral follicle between the control and treatment groups.Results: No significant differences were found in BCL-2 gene expression. There were also no significant differences in BCL-2 expression on the 10th day of pre-antral follicle analysis. Moreover, there were no significant differences between the mean follicle diameter on the 5th, 10th, and 20th day of pre-antral and antral follicle development between the control and treatment groups. The addition of bovine pellucid zone 3 (bZP3 monoclonal antibodies on the 5th and 20th day of observation did not decrease the expression of BCL-2 gene in the pre-antral and antral follicle of mice. Administering bZP3 monoclonal antibodies on the 10th day of observation did not affect BCL-2 expression in the pre-antral follicle but did decrease BCL-2 expression in the antral follicle. Supplying bZP3 monoclonal antibodies on the 5th, 10th and 20th day did not affect the diameter of pre-antral and antral follicles of the mice.Conclusion: The monoclonal antibodies bovine zona pelusida 3 has the potential to be developed as a safe immunocontraception preparation.

  9. Efeitos da música clássica como elemento de enriquecimento ambiental em Mus musculus em cativeiro (Rodentia: Muridae

    Directory of Open Access Journals (Sweden)

    José Geraldo Pereira da Cruz

    2010-04-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2010v23n2p191 No ambiente selvagem, os animais são submetidos a mudanças constantes nos estímulos sensoriais. Entretanto, o ambiente de cativeiro é muito mais pobre em termos de estímulos fornecidos aos animais alojados no seu interior. Numa tentativa de remediar esta situação e promover um melhor bem estar, camundongos (Mus musculus foram expostos a duas condições: sem estímulos auditivos e com música clássica. Em todos os experimentos foi utilizada uma bateria de testes comportamentais. Os resultados demonstram uma diminuição significativa na imobilidade no nado forçado, aumento de entradas nos braços fechados do labirinto em cruz elevado e diminuição na imobilidade no campo aberto, nos animais que haviam sido pré-expostos anteriormente a 24h de música e sugerem que a música clássica causas mudanças na atividade motora em camundongos. Este estudo leva a conclusão que o enriquecimento do ambiente causa profundos efeitos sobre o comportamento de camundongos nos testes comportamentais e a música clássica é um método relativamente simples de contribuir para o bem estar de camundongos em cativeiro, mas pode comprometer resultados de experimentos como o nado forçado.

  10. Effect of Maytenus macrocarpa“Chuchuhuasi” in the male system reproductive of mouse (Mus musculus

    Directory of Open Access Journals (Sweden)

    Láyonal G. Acosta

    2014-03-01

    Full Text Available Maytenus macrocarpa(chuchuhuasi is native tree of the Peruvian Amazon used as traditional medicine for the treatment of many diseases, but its effect on the male reproductive system has not yet been elucidated. The aim of this study is evaluate the effect of aqueous extract of M. macrocarpa in daily doses for 7 days on reproductive parameters of male mice. We used C57BL mature male mice divided into 2 groups (n= 10, Control Group (C: 0.9% NaCl and Treatment group (T: Aqueous extract of Chuchuhuasi, both supplied daily via oral gavages. At the eight day of treatment the mice were euthanized. The weight of the body and reproductive organs: testis, epididymis and vas deferens, were registered. Concentration, motility and sperm morphology were evaluated. The results showed significantly differences (t- Student test P<0.05 in the weight of the head and body epididymis (C: 19.25±1.1 vs T: 21.26±2.0, vas deferens (C: 10.61±0.7 vs T: 11.75±0.5, progressive sperm motility (C: 42.16±5.2 vs T: 25.82±8.4 and immobile sperm (C: 36.05±4.9 vs T: 48.51±7.2. No difference in sperm count was observed. The sperm normal morphology diminished with ingest of M. macrocarpa(tStudent test p <0.05 (C: 39.72±1.3 vs T: 30.78±4.9. We conclude that the aqueous extract of chuchuhuasi, has a negative effect on the male reproductive system of mice.

  11. Analysis of Adult Female Mouse (Mus musculus) Group Behavior on the International Space Station (ISS)

    Science.gov (United States)

    Solomides, P.; Moyer, E. L.; Talyansky, Y.; Choi, S.; Gong, C.; Globus, R. K.; Ronca, A. E.

    2016-01-01

    As interest in long duration effects of space habitation increases, understanding the behavior of model organisms living within the habitats engineered to fly them is vital for designing, validating, and interpreting future spaceflight studies. A handful of papers have previously reported behavior of mice and rats in the weightless environment of space. The Rodent Research Hardware and Operations Validation (Rodent Research-1; RR1) utilized the Rodent Habitat (RH) developed at NASA Ames Research Center to fly mice on the ISS (International Space Station). Ten adult (16-week-old) female C57BL/6 mice were launched on September 21st, 2014 in an unmanned Dragon Capsule, and spent 37 days in microgravity. Here we report group behavioral phenotypes of the RR1 Flight (FLT) and environment-matched Ground Control (GC) mice in the Rodent Habitat (RH) during this long-duration flight. Video was recorded for 33 days on the ISS, permitting daily assessments of overall health and well-being of the mice, and providing a valuable repository for detailed behavioral analysis. We previously reported that, as compared to GC mice, RR1 FLT mice exhibited the same range of behaviors, including eating, drinking, exploration, self- and allo-grooming, and social interactions at similar or greater levels of occurrence. Overall activity was greater in FLT as compared to GC mice, with spontaneous ambulatory behavior, including organized 'circling' or 'race-tracking' behavior that emerged within the first few days of flight following a common developmental sequence, and comprised the primary dark cycle activity persisting throughout the remainder of the experiment. Participation by individual mice increased dramatically over the course of the flight. Here we present a detailed analysis of 'race-tracking' behavior in which we quantified: (1) Complete lap rotations by individual mice; (2) Numbers of collisions between circling mice; (3) Lap directionality; and (4) Recruitment of mice into a group phenotype. This analysis contributes to the first NASA long-duration study of rodent behavior, providing evidence for the emergence of a distinctive, organized group behavior unique to the weightless space environment.

  12. A meiotic study of two translocations and a tertiary trisomic in the mouse (Mus musculus)

    NARCIS (Netherlands)

    Boer, de P.

    1975-01-01

    In this section, the order of the articles has not been closely followed. Each point ends with the number(s) of the article(s) (as given in the contents), where the conclusion is based on.

    1) Cytological meiotic studies of T(2;8)26H and T(1;13)70H heterozygotes and Ts(1

  13. Sensitivity of perianal tape impressions to diagnose pinworm (Syphacia spp.) infections in rats (Rattus norvegicus) and mice (Mus musculus).

    Science.gov (United States)

    Hill, William Allen; Randolph, Mildred M; Mandrell, Timothy D

    2009-07-01

    We determined the sensitivity of perianal tape impressions to detect Syphacia spp. in rats and mice. We evaluated 300 rat and 200 mouse perianal impressions over 9 wk. Pinworm-positive perianal tape impressions from animals with worm burdens at necropsy were considered as true positives. Conversely, pinworm-negative perianal tape impressions from animals with worm burdens were considered false negatives. The sensitivity of perianal tape impressions for detecting Syphacia muris infections in rats was 100%, and for detecting Syphacia obvelata in mice was 85.5%. Intermittent shedding of Syphacia obvelata ova is the most probable explanation for the decreased sensitivity rate we observed in mice. We urge caution in use of perianal tape impressions alone for Syphacia spp. screening in sentinel mice and rats.

  14. Evidencias empíricas de regularidades estadísticas y leyes de potencia en los genomas de Arabidopsis thaliana, Oriza sativa y Mus musculus

    Directory of Open Access Journals (Sweden)

    Martha I Almanza P.

    2010-07-01

    Full Text Available La masiva cantidad de datos biológicos provenientes de las disciplinas "ómicas" y su aprovechamiento en el mejoramiento genético vegetal requiere de nuevos abordajes teóricos y estadísticos que describan de forma satisfactoria principios generales en los genomas. El total de secuencias de los genes de los genomas vegetales de Arabidopsis thaliana y Oriza sativa y del genoma animal Mus musculus fueron extraídas y depuradas de la base de datos pública del Genebank mediante el diseño de algoritmos en lenguaje de programación Python. Se analizaron las distribuciones de las variables frecuencia de uso y tamaño de los genes, exones e intrones por cromosoma y entre genomas. Los resultados señalaron que las variables presentan patrones de comportamiento no lineales en forma de ley de potencia que difieren estadísticamente entre los genomas pero no entre los cromosomas de un mismo genoma. Además, el análisis aportó evidencias respecto al tamaño promedio constante de las secuencias de exones y de los genes simples por cromosoma y entre genomas. Los hallazgos sugieren: primero, que el genoma se auto-organiza de la misma manera en los cromosomas independientemente del tamaño o número de genes que estos contengan, y, segundo, que tanto los cromosomas como sus elementos constituyentes: genes, exones e intrones han evolucionado conjuntamente. El estudio señala que las leyes de potencia cumplen un papel amortiguador en las leyes de variación biológica y proporcionan medidas cuantitativas de la organización de las secuencias de ADN que definen la identidad de un genoma. La regularidad estadística de estas medidas genéticas tiene potenciales aplicaciones en el incremento del valor predictivo de los actuales modelos de mejoramiento genético vegetal.

  15. Dramatic changes in 67 miRNAs during initiation of first wave of spermatogenesis in Mus musculus testis: global regulatory insights generated by miRNA-mRNA network analysis.

    Science.gov (United States)

    Sree, Sreesha; Radhakrishnan, Karthika; Indu, Sivankutty; Kumar, Pradeep G

    2014-09-01

    We mapped global changes in miRNA and mRNA profiles spanning the first wave of spermatogenesis using prepubertal (Postnatal Day 8 [P8]), pubertal (P16), and adolescent (P24) Mus musculus testes and identified the differential expression of 67 miRNAs and 8226 mRNAs. These two data sets were integrated into miRNA-dependent regulatory networks based on miRWalk predictions. In a network representing the P8 to P16 transition, downregulation of four miRNAs and upregulation of 19 miRNAs were linked with 81 upregulated target mRNAs and 228 downregulated target mRNAs, respectively. Furthermore, during the P16 to P24 transition, two miRNAs were downregulated, and eight miRNAs were upregulated, which linked with 64 upregulated mRNAs and 389 downregulated mRNAs, respectively. Only three of the miRNAs present in the network (miR-34b-5p, miR-34c, and miR-449a) showed a progressive increase from P8 through P16 to P24, while the remaining miRNAs in the network showed statistically significant changes in their levels either during the P8 to P16 transition or during the P16 to P24 transition. Analysis of the chromosomal location of these differentially expressed miRNAs showed that 14 out of 25 miRNAs upregulated from P8 to P16, and 18 out of 40 miRNAs upregulated from P8 to P24 were X-linked. This is suggestive of their escape from meiotic sex chromosome inactivation and postmeiotic sex chromatin. This integrated network of miRNA-level and mRNA-level changes in mouse testis during the first wave of spermatogenesis is expected to build a base for evaluating the role of miRNA-mediated gene expression regulation in maturing mammalian testis. © 2014 by the Society for the Study of Reproduction, Inc.

  16. Evidencias empíricas de regularidades estadísticas y leyes de potencia en los genomas de Arabidopsis thaliana, Oriza sativa y Mus musculus Empirical evidences of statistical regularities and power laws in the genomes of Arabidopsis thaliana, Oriza sativa and Mus musculus

    Directory of Open Access Journals (Sweden)

    Martha I Almanza P.

    2010-07-01

    Full Text Available La masiva cantidad de datos biológicos provenientes de las disciplinas "ómicas" y su aprovechamiento en el mejoramiento genético vegetal requiere de nuevos abordajes teóricos y estadísticos que describan de forma satisfactoria principios generales en los genomas. El total de secuencias de los genes de los genomas vegetales de Arabidopsis thaliana y Oriza sativa y del genoma animal Mus musculus fueron extraídas y depuradas de la base de datos pública del Genebank mediante el diseño de algoritmos en lenguaje de programación Python. Se analizaron las distribuciones de las variables frecuencia de uso y tamaño de los genes, exones e intrones por cromosoma y entre genomas. Los resultados señalaron que las variables presentan patrones de comportamiento no lineales en forma de ley de potencia que difieren estadísticamente entre los genomas pero no entre los cromosomas de un mismo genoma. Además, el análisis aportó evidencias respecto al tamaño promedio constante de las secuencias de exones y de los genes simples por cromosoma y entre genomas. Los hallazgos sugieren: primero, que el genoma se auto-organiza de la misma manera en los cromosomas independientemente del tamaño o número de genes que estos contengan, y, segundo, que tanto los cromosomas como sus elementos constituyentes: genes, exones e intrones han evolucionado conjuntamente. El estudio señala que las leyes de potencia cumplen un papel amortiguador en las leyes de variación biológica y proporcionan medidas cuantitativas de la organización de las secuencias de ADN que definen la identidad de un genoma. La regularidad estadística de estas medidas genéticas tiene potenciales aplicaciones en el incremento del valor predictivo de los actuales modelos de mejoramiento genético vegetal.The huge quantity of biological data arising from the omics disciplines and their benefit in plant breeding require of new theoretical and statistical approaches in order to get a satisfactory

  17. Effect of human ZP3 monoclonal antibody on expression of GDF-9 and number of theca cells in ovary of mice (Mus musculus

    Directory of Open Access Journals (Sweden)

    Lilik Indahwati, M.Sc.

    2018-06-01

    the expression of growth differentiation factor-9 (GDF-9 and number of theca cells in the ovaries of mice (Mus musculus. Methods: Our study employed a true experiment posttest-only control group design of 48 mice that were divided into the control and three mAb hZP3-treatment groups (20, 40, and 60 μg. Mice in each group were terminated on days 10, 15, and 20. GDF-9 expression was measured by immunohistochemistry and the number of theca cells was counted. Results: Analysis of the effects of mAb hZP3 (at 20–60 μg on the expression of GDF-9 and amount of theca cells did not show significant differences. Similar findings were observed throughout the study period (at 10–20 days. Therefore, mAb hZP3 had no effect on GDF-9 expression and theca cells. Conclusion: This study showed that mAb hZP3 can be considered to be an effective and safe immunocontraception. الكلمات المفتاحية: ج د ف-٩, عوامل النمو, الأجسام المضادة أحادية المنشأ, خلايا ثيكا, Keywords: GDF-9, Growth factors, Monoclonal antibody, Theca cells

  18. Helminth Infections of House Mouse (Mus musulus and Wood Mouse (Apodemus sylvaticus from the Suburban Areas of Hamadan City, Western Iran.

    Directory of Open Access Journals (Sweden)

    Ali Yousefi

    2014-12-01

    Full Text Available To determine the prevalence and intensity of helminths and their zoonotic importance in small rodents inhabiting in the suburban areas of Hamadan City, Iran.The present survey was conducted on the helminth infections of two species of rodents Apodemus sylvaticus (n=60 and Mus musculus(n=72 in the suburban areas of Hamadan City during 2010-2012. Rodents were collected and examined for helminth in the different organs. The nematodes were collected in 5% formalin solution and cleared in lactophenol, cestodes and trematodes collected from intestine fixed in AFA solution and stained by acetocarmine, cleared in xylol for identification.Helminths found in A. sylvaticus and M. musculus and their prevalence for the first time in suburban areas of Hamadan City were as follows; In A. sylvaticus: Cysticercus fasciolaris(3.33%, Syphacia fredrici(26.67%, S. stroma(8.33%, Anoplocephalidae sp. (1.67%, Skrjabinotaenia lobata(5%, Plagiorchis muris(1.67% and in M. musculus:Hymenolepis nana (16.67%, H.diminuta (5.55%, S. obvelata(30.56%, S. ohtarom (9.72%, Rodentolepis crassa (1.39%, C. fasciolaris (1.39%. Among 11 species in two rodents 4 species including S. obvelata, H. nana, H.diminuta,and P. muris have zoonotic importance. Statistically the relation between gender and their helminth infections was not significant in either M. musculus or A. sylvaticus (P>0.05.This study reports 11 species of helminths and on the other hand 3 species were identified for the first time in Iran and 5 species of them have potential health importance for public health and cat.

  19. Histometría de la glándula sublingual de ratones (Mus musculus machos y hembras infectados con la cepa RAL del parásito de Chagas, Trypanosoma cruzi

    Directory of Open Access Journals (Sweden)

    Sérgio de Albuquerque

    2008-06-01

    Full Text Available Analizamos morfológica e histométricamente la glándula sublingual de ratones infectados con la cepa RAL del Trypanosoma cruzi, en machos y hembras. Usamos ratones albinos (Mus musculus, variedad Swiss, inoculados con 2x104 tripomastigotes sanguíneos de la cepa RAL del T. cruzi.. Sacrificamos los animales en el pico de la parasitemia (12º día y fijamos las glándulas sublinguales en ALFAC. Los cortes histológicos teñidos con HE fueron evaluados histométricamente (cariometría y estereología. La parasitemia fue más elevada en las hembras. Histopatológicamente, los "ácinos" (acini de los animales infectados eran menores, con escasa secreción, y conductos estriados menores. Los núcleos de las "medialunas" eran menores y había nidos de amastigotes en el citoplasma. Cariométricamente, los núcleos de los ácinos, medialunas y conductos estriados eran menores en los ratones infectados. Estereológicamente, los volúmenes relativos ocupados por ácinos y conductos estriados fueron menores e, inversamente, fue mayor el volumen para el tejido conjuntivo de los machos infectados. Las densidades de superficie de ácinos y conductos fueron mayores, y el diámetro y el espesor de la pared menores, en este grupo. Por otro lado, la densidad de ácinos fue menor, y las de los conductos estriados y tejido conjuntivo, fueron mayores en las hembras infectadas. Las densidades de superficie de ácinos y conductos estriados fueron mayores, mientras que el diámetro y espesor de la pared de los ácinos fueron menores (y las de los conductos estriados mayores, en este grupo. La cepa RAL del T. cruzi causó un cuadro general de atrofia general en la glándula sublingual, con numerosos nidos de parásitos.Histometry of the sublingual gland in male and female mice (Mus musculus infected with the RAL strain of the Chagas parasite, Trypanosoma cruzi. The aim of this work was to analyze histologically and histometrically the sublingual gland of mice infected

  20. XY females do better than the XX in the African pygmy mouse, Mus minutoides.

    Science.gov (United States)

    Saunders, Paul A; Perez, Julie; Rahmoun, Massilva; Ronce, Ophélie; Crochet, Pierre-André; Veyrunes, Frédéric

    2014-07-01

    All therian mammals have a similar XY/XX sex-determination system except for a dozen species. The African pygmy mouse, Mus minutoides, harbors an unconventional system in which all males are XY, and there are three types of females: the usual XX but also XX* and X*Y ones (the asterisk designates a sex-reversal mutation on the X chromosome). The long-term evolution of such a system is a paradox, because X*Y females are expected to face high reproductive costs (e.g., meiotic disruption and loss of unviable YY embryos), which should prevent invasion and maintenance of a sex-reversal mutation. Hence, mechanisms for compensating for the costs could have evolved in M. minutoides. Data gathered from our laboratory colony revealed that X*Y females do compensate and even show enhanced reproductive performance in comparison to the XX and XX*; they produce significantly more offspring due to (i) a higher probability of breeding, (ii) an earlier first litter, and (iii) a larger litter size, linked to (iv) a greater ovulation rate. These findings confirm that rare conditions are needed for an atypical sex-determination mechanism to evolve in mammals, and provide valuable insight into understanding modifications of systems with highly heteromorphic sex chromosomes. © 2014 The Author(s). Evolution © 2014 The Society for the Study of Evolution.

  1. Anti-cholesterol activity in vivo test of multifunction herbs extract in the water using in vivo method in mice (Mus musculus L.) DDY-strain

    Science.gov (United States)

    Tristantini, Dewi; Christina, Diana

    2018-02-01

    Atherosclerosis is the hardening of the arteries due to cholesterol accumulation in the blood vessels. The occurrence of cardiovascular disease can be reduced by lowering cholesterol levels in the blood. Nevertheless, using some pharmaceutical synthetic medicine for lowering the cholesterol has several side effects that dangerous for human body. There are 3 plants, tanjung leaf (Mimusops elengi L.), star fruit leaf (Averrhoa carambola L.), and curcuma (Curcuma xanthorrhiza L.), which are combined empirically believed would serve as multifunction herbs. Tanjung leaf has been known to have antioxidant, anti-cholesterol, and anti-platelet activity, also star fruit leaf have anti-hyperglycemia activity. Furthermore, curcuma has been known as a hepatoprotection agent. In this study, the combination of all three simplicias were used as anti-cholesterol. Anti-cholesterol activity test by in vivo method using mice (Mus muculus L.) result in decreased cholesterol as much as 47% for 250 mL human dosage in 7 days. This performance equals to 73% of simvastatin activity in decreased cholesterol. In this study, we can conclude the multifunction herbs that were combination of tanjung (M. elengi) leaf, star fruit leaf (Averrhoa carambola L.), and curcuma (Curcuma xanthorrhiza L.) extract can be used as cholesterol decreasing medicine.

  2. Clinical Chemistry Reference Intervals for C57BL/6J, C57BL/6N, and C3HeB/FeJ Mice (Mus musculus).

    Science.gov (United States)

    Otto, Gordon P; Rathkolb, Birgit; Oestereicher, Manuela A; Lengger, Christoph J; Moerth, Corinna; Micklich, Kateryna; Fuchs, Helmut; Gailus-Durner, Valérie; Wolf, Eckhard; Hrabě de Angelis, Martin

    2016-01-01

    Although various mouse inbred strains are widely used to investigate disease mechanisms and to establish new therapeutic strategies, sex-specific reference intervals for laboratory diagnostic analytes that are generated from large numbers of animals have been unavailable. In this retrospective study, we screened data from more than 12,000 mice phenotyped in the German Mouse Clinic from January 2006 through June 2014 and selected animals with the genetic background of C57BL/6J, C57BL/6N, or C3HeB/FeJ. In addition, we distinguished between the C57BL/6NTac substrain and C57BL/6N mice received from other vendors. The corresponding data sets of electrolytes (sodium, potassium, calcium, chloride, inorganic phosphate), lipids (cholesterol, triglyceride), and enzyme activities (ALT, AST, ALP, α-amylase) and urea, albumin, and total protein levels were analyzed. Significant effects of age and sex on these analytes were identified, and strain- or substrain- and sex-specific reference intervals for 90- to 135-d-old mice were calculated. In addition, we include an overview of the literature that reports clinical chemistry values for wild-type mice of different strains. Our results support researchers interpreting clinical chemistry values from various mouse mutants and corresponding wild-type controls based on the examined strains and substrains.

  3. Radiation-induced heterogeneity of chymotrypsin of mus musculus. On the characterization of structurally and functionally in vitro modified enzyme forms

    International Nuclear Information System (INIS)

    Amneus, H.

    1976-01-01

    The distribution of in vitro induced 60 Co-γ (structural heterogeneity of mouse chymotrypsin has been studied in terms of molecular weight, catalytic activity and net charge distribution. It was found that the enzyme stucture, with retained molecular weight, could partly accumulate structural changes subsequently not leading to modification of catalytic properties. Loss of petide fragments (0 < Mw (lt 6000) the enzyme showed native function but also modified as well as total loss of function. Further loss of peptide fragments results in modified function and total loss of function. These results indicate the capability of the enzyme to accumulate in vitro changes partly without a total loss of function. (author)

  4. Identification of a QTL in Mus musculus for alcohol preference, withdrawal, and Ap3m2 expression using integrative functional genomics and precision genetics.

    Science.gov (United States)

    Bubier, Jason A; Jay, Jeremy J; Baker, Christopher L; Bergeson, Susan E; Ohno, Hiroshi; Metten, Pamela; Crabbe, John C; Chesler, Elissa J

    2014-08-01

    Extensive genetic and genomic studies of the relationship between alcohol drinking preference and withdrawal severity have been performed using animal models. Data from multiple such publications and public data resources have been incorporated in the GeneWeaver database with >60,000 gene sets including 285 alcohol withdrawal and preference-related gene sets. Among these are evidence for positional candidates regulating these behaviors in overlapping quantitative trait loci (QTL) mapped in distinct mouse populations. Combinatorial integration of functional genomics experimental results revealed a single QTL positional candidate gene in one of the loci common to both preference and withdrawal. Functional validation studies in Ap3m2 knockout mice confirmed these relationships. Genetic validation involves confirming the existence of segregating polymorphisms that could account for the phenotypic effect. By exploiting recent advances in mouse genotyping, sequence, epigenetics, and phylogeny resources, we confirmed that Ap3m2 resides in an appropriately segregating genomic region. We have demonstrated genetic and alcohol-induced regulation of Ap3m2 expression. Although sequence analysis revealed no polymorphisms in the Ap3m2-coding region that could account for all phenotypic differences, there are several upstream SNPs that could. We have identified one of these to be an H3K4me3 site that exhibits strain differences in methylation. Thus, by making cross-species functional genomics readily computable we identified a common QTL candidate for two related bio-behavioral processes via functional evidence and demonstrate sufficiency of the genetic locus as a source of variation underlying two traits. Copyright © 2014 by the Genetics Society of America.

  5. The effect of multiple simple Robertsonian heterozygosity on chromosome pairing and fertility of wild-stock house mice (Mus musculus domesticus).

    Science.gov (United States)

    Wallace, B M N; Searle, J B; Everett, C A

    2002-01-01

    The influence of Robertsonian (Rb) heterozygosity on fertility has been the subject of much study in the house mouse. However, these studies have been largely directed at single simple heterozygotes (heterozygous for a single Rb metacentric) or complex heterozygotes (heterozygous for several to many metacentrics which share common chromosome arms). In this paper we describe studies on male multiple simple heterozygotes, specifically the F(1) products of crosses between wild-stock mice homozygous for four or seven metacentrics and wild-stock mice with a standard all-acrocentric karyotype; these F(1) products were characterized by four and seven trivalents at meiosis I, respectively. Mice with the same karyotype, but two different genetic backgrounds were examined. Although a range of meiotic and fertility studies were conducted, particular emphasis was paid to analysis of chromosome pairing, previously not well-described in multiple simple heterozygous mice. The progression of spermatocytes through prophase I was followed by electron microscopy of surface spread material. As previously shown for single simple Rb heterozygotes, the trivalents that characterize multiple simple heterozygotes initially showed delayed pairing of the centromeric region and later showed side arm formation, resulting from non-homologous pairing by the centromeric ends of the acrocentric chromosomes. In the four trivalent groups of mice, 15 and 32% of trivalents showed unpairing in the centromeric region at mid pachytene; equivalent values were 29 and 39% for the seven trivalent groups. Pairing abnormalities (largely attachments and interlocks between trivalents and between a trivalent and the XY configuration) were observed in 18 and 23% of mid pachytene cells in the four trivalent groups and 36 and 49% of cells in the seven trivalent groups. The greater level of pachytene irregularity (unpairing and pairing abnormalities) in seven versus four trivalent heterozygotes was mirrored in terms

  6. Murine cytomegalovirus is not restricted to the house mouse Mus musculus domesticus: prevalence and genetic diversity in the European house mouse hybrid zone

    Czech Academy of Sciences Publication Activity Database

    Goüy de Bellocq, Joëlle; Baird, Stuart J. E.; Albrechtová, Jana; Sobeková, Karolina; Piálek, Jaroslav

    2015-01-01

    Roč. 89, č. 1 (2015), s. 406-414 ISSN 0022-538X R&D Projects: GA ČR GA206/08/0640; GA ČR(CZ) GA14-35009S Institutional support: RVO:68081766 Keywords : maximum likelihood * viral antibodies * wild mice * strains * recombination * mitochondrial * Australia * evolution * virus * model Subject RIV: EG - Zoology Impact factor: 4.606, year: 2015

  7. Context dependence of acorn handling by the Algerian mouse (Mus spretus)

    Science.gov (United States)

    Gallego, D.; Morán-López, T.; Torre, I.; Navarro-Castilla, Á.; Barja, I.; Díaz, M.

    2017-10-01

    Perceived predation risk and competition for acorns are expected to affect scatter-hoarding decisions by Algerian mice (Mus spretus). We manipulated both factors by means of predator fecal scents and ungulate exclosures. We hypothesized that high-risk perception and ungulate presence would promote acorn dispersal. In the former case, it would stimulate acorn mobilization to safe microhabitats rather than in situ consumption. In the latter, increased competition for acorns would promote their storage for later consumption. We also expected that mice would adapt their foraging behavior to previous experience modulating the strength of these effects. In the presence of ungulates, mice focused their foraging activities on food acquisition at the expenses of vigilant behaviors. However, a more efficient foraging did not entail enhanced dispersal services. Lack of anti-predatory cover in tree surroundings may have deterred mice from transporting seeds outside canopies. Increased risk interacted with previous experience. In control trees (no predator odor), mice confidence increased throughout the night resulting in decreased vigilance and enhanced acorn mobilization rates. In contrast, in risky conditions (trees with predator odor) mice maintained a base-line vigilant behavior. Contrary to our expectations, increased risk did not result in higher acorn mobilization, but the opposite. Again, the scarcity of safe microhabitats for mobilization may have been the underlying cause of this behavior. Our results show that successful acorn dispersal depends, at least partly, on plant-animal relationships that are beyond the oak-rodent mutualism. Thus, any conservation policy aimed at restoring natural regeneration of oaks should take into account the interaction network in which oak-rodent encounters are embedded. In addition, they suggest that mice incorporate direct and indirect cues of risks (habitat structure) through recent experience. A better understanding of this process

  8. Detailed ordering of markers localizing to the Xq26-Xqter region of the human X chromosome by the use of an interspecific Mus spretus mouse cross

    International Nuclear Information System (INIS)

    Avner, P.; Amar, L.; Arnaud, D.; Hanauer, A.; Cambrou, J.

    1987-01-01

    Five probes localizing to the Xq26-Xqter region of the human X chromosome have been genetically mapped on the mouse X chromosome using an interspecific cross involving Mus spretus to a contiguous region lying proximally to the Tabby (Ta) locus. Pedigree and recombinational analysis establish the marker order as being Hprt-FIX-c11-G6PD-St14-1. The size of this contiguous region is such that the X-linked muscular dystrophy (mdx) mouse mutation probably maps within this segment. This in turn suggests that it is highly improbable that the mouse mdx locus represents a model for Duchenne muscular dystrophy (DMD). It is, however, compatible with the idea that this mutation may correspond in man to Emery Dreifuss muscular dystrophy. The high frequency of restriction fragment length polymorphisms found in this interspecific system for all the human cross-reacting probes examined up until now, using only a limited number of restriction enzymes, suggests that the Mus spretus mapping system may be of great potential value for establishing the linkage relationships existing in man when conserved chromosomal regions are concerned and human/mouse cross-reacting probes are available or can be obtained

  9. Genetic conflict outweighs heterogametic incompatibility in the mouse hybrid zone?

    Directory of Open Access Journals (Sweden)

    Dufková Petra

    2008-10-01

    Full Text Available Abstract Background The Mus musculus musculus/M. m. domesticus contact zone in Europe is characterised by sharp frequency discontinuities for sex chromosome markers at the centre of wider clines in allozyme frequencies. Results We identify a triangular area (approximately 330 km2 where the musculus Y chromosome introgresses across this front for up to 22 km into domesticus territory. Introgression of the Y chromosome is accompanied by a perturbation of the census sex ratio: the sex ratio is significantly female biased in musculus localities and domesticus localities lacking Y chromosome introgression. In contrast, where the musculus Y is detected in domesticus localities, the sex ratio is close to parity, and significantly different from both classes of female biased localities. The geographic position of an abrupt cline in an X chromosome marker, and autosomal clines centred on the same position, seem unaffected by the musculus Y introgression. Conclusion We conclude that sex ratio distortion is playing a role in the geographic separation of speciation genes in this section of the mouse hybrid zone. We suggest that clines for genes involved in sex-ratio distortion have escaped from the centre of the mouse hybrid zone, causing a decay in the barrier to gene flow between the two house mouse taxa.

  10. Comparison ecological characteristics of mound-building mouse (mus spicilegus in two natural hotbeds of tularemia at North-West coast of the Black sea

    Directory of Open Access Journals (Sweden)

    І. T. Rusev

    2011-03-01

    Full Text Available The analysis of ecology-epizootic monitoring of North-West coast of the Black sea carried out in wintering seasons of 2004, 2005 and 2011 testifies the basic role of the Mound-building mouse (Mus spicilegus Petenyi, 1882 as a carrier of Francisella tularensis. Spatial distribution of the Mound-building mouse strongly dependson a biotope, geographical region and weather conditions of a specific season. Mice nests in the storage mounds are located normally at a depth of 20–40 cm under the food storage chamber. Average number of the mice in storage mounds is 3.08 ± 1.54 in the south of investigated region and 3.88 ± 2.63 – in the NE of the region.

  11. 2.45-GHz microwave irradiation adversely affects reproductive function in male mouse, Mus musculus by inducing oxidative and nitrosative stress.

    Science.gov (United States)

    Shahin, S; Mishra, V; Singh, S P; Chaturvedi, C M

    2014-05-01

    Electromagnetic radiations are reported to produce long-term and short-term biological effects, which are of great concern to human health due to increasing use of devices emitting EMR especially microwave (MW) radiation in our daily life. In view of the unavoidable use of MW emitting devices (microwaves oven, mobile phones, Wi-Fi, etc.) and their harmful effects on biological system, it was thought worthwhile to investigate the long-term effects of low-level MW irradiation on the reproductive function of male Swiss strain mice and its mechanism of action. Twelve-week-old mice were exposed to non-thermal low-level 2.45-GHz MW radiation (CW for 2 h/day for 30 days, power density = 0.029812 mW/cm(2) and SAR = 0.018 W/Kg). Sperm count and sperm viability test were done as well as vital organs were processed to study different stress parameters. Plasma was used for testosterone and testis for 3β HSD assay. Immunohistochemistry of 3β HSD and nitric oxide synthase (i-NOS) was also performed in testis. We observed that MW irradiation induced a significant decrease in sperm count and sperm viability along with the decrease in seminiferous tubule diameter and degeneration of seminiferous tubules. Reduction in testicular 3β HSD activity and plasma testosterone levels was also noted in the exposed group of mice. Increased expression of testicular i-NOS was observed in the MW-irradiated group of mice. Further, these adverse reproductive effects suggest that chronic exposure to nonionizing MW radiation may lead to infertility via free radical species-mediated pathway.

  12. The uncharacterized gene 1700093K21Rik and flanking regions are correlated with reproductive isolation in the house mouse, Mus musculus

    Czech Academy of Sciences Publication Activity Database

    Kass, D. H.; Janoušek, Václav; Wang, L.; Tucker, P. K.

    2014-01-01

    Roč. 25, 5-6 (2014), s. 223-234 ISSN 0938-8990 R&D Projects: GA MŠk EE2.3.20.0303 Institutional support: RVO:68081766 Keywords : hybrid male-sterility * X-chromosome * placental development * sex chromosomes * zone * mice * speciation * differentiation * protein Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.068, year: 2014

  13. PWD/Ph and PWK/Ph inbred mouse strains of Mus .I.m. musculus ./I.Subspecies - a Valuable Resource of Phenotypic Variations and Genomic Polymorphisms

    Czech Academy of Sciences Publication Activity Database

    Gregorová, Soňa; Forejt, Jiří

    2000-01-01

    Roč. 46, č. 1 (2000), s. 31-42 ISSN 0015-5500 R&D Projects: GA ČR GV204/98/K015; GA ČR GA301/99/0354; GA AV ČR IAA5052709; GA AV ČR KSK2052601; GA AV ČR IPP2020702 Institutional research plan: CEZ:AV0Z5052915 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 0.351, year: 2000

  14. Effects of 60Co gamma irradiation on Eimeria falciformis (Eimer 1870) Schneider 1875, a protozoan parasite of the mouse, Mus musculus L

    International Nuclear Information System (INIS)

    Wright, A.C.

    1976-01-01

    Oocysts of an E. falciformis strain first isolated in Wuppertal, Germany were exposed to cobalt-60 gamma radiation under different conditions of oocyst age and development. In order to construct survival curves for oocysts irradiated in the unsporulated state, normalized percent sporulation was plotted as a function of radiation dose. Oocysts irradiated in the sporulated state never caused infection after receiving doses of 50 krads or more. Rarely, oocysts which had received 40 krads produced infection and completed their life cycle in susceptible hosts, but usually the doses beyond which infection did not occur ranged from 30 to 35 krads. Immunity was shown best by hosts which had received unirradiated oocysts in vaccinations prior to challenge. When irradiated sporulated oocysts were used in attempts to immunize susceptible hosts against coccidiosis, the most positive results were obtained from oocysts which had been exposed to 20 krads. Animals receiving vaccinations of oocysts exposed to 20 krads always survived the minimal infections caused by vaccination and also exhibited good immunity to challenge

  15. Assay for the detection of non-lethal changes that are expressed as a proliferative disadvantage in mouse (Mus musculus) embryo aggregation chimberas

    International Nuclear Information System (INIS)

    Obasaju, M.F.

    1986-01-01

    This study demonstrates the potential utility of the chimera embryo assay in measuring the effects of a variety of non-lethal, potentially hazardous environmental agents on normal mammalian embryonic cells. The two major findings to have emerged from this investigation are, (1) relative cellular contribution per embryo in chimeras was found to depend on the strain of the partner embryo and this relationship apparently does not require cell to cell contact between the partner embryos of the chimera and is already apparent after only two cell cycles; and (2) within the same outbred strain, exposure of one partner embryo in the chimera to either X-irradiation or chlorpromazine, at dose levels that were lower than those previously found to be embryotoxic; such toxicity was revealed as a proliferative disadvantage that was also evident after only 2 cell cycles. Partner embryos in the chimera were distinguished by labelling one of them with the fluorescent dye, fluorescein isothiocyanate (FITC), which was shown to have no detrimental effects on the proliferation rate of the labelled embryos

  16. XY pair associates with the synaptonemal complex of autosomal male-sterile translocations in pachytene spermatocytes of the mouse (Mus musculus).

    Science.gov (United States)

    Forejt, J; Gregorová, S; Goetz, P

    1981-01-01

    Analysis of the chromosome behaviour at pachytene has been performed by means of the silver staining technique visualizing the synaptonemal complexes (SCs) in male mice heterozygous for the male-sterile translocations T(5;12)31Hm T(16;17)43H and T(7;19)145H, respectively. the T(9;17)138Ca male heterozygotes and T43H/T43H homozygous males were used as fertile controls. The sterile mice displayed a high frequency (about 60%) of pachytene spermatocytes with autosomal translocation configuration located in close vicinity of the XY pair. The dense round body (XAB), normally located near the X-chromosome axis in fertile males, exhibited abnormal affinity to translocation configuration in the sterile translocation heterozygotes. The incomplete synapsis of autosomes involved in translocation configuration was observed in more than 70% of the pachytene spermatocytes with the male-sterile translocations but less than 20% of the cells from T138Ca fertile male.s. A hypothesis relating the spermatogenic arrest of carriers of male-sterile rearrangements to the presumed interference with X chromosome inactivation in male meiosis is discussed.

  17. Development and characterization of multiplex panels of microsatellite markers for Syphacia obvelata, a parasite of the house mouse (Mus musculus), using a high throughput DNA sequencing approach

    Czech Academy of Sciences Publication Activity Database

    Wasimuddin, Wasimuddin; Čížková, Dagmar; Ribas, Alexis; Piálek, Jaroslav; Goüy de Bellocq, Joëlle; Bryja, Josef

    2012-01-01

    Roč. 185, č. 2 (2012), s. 154-156 ISSN 0166-6851 R&D Projects: GA ČR GA206/08/0640; GA MŠk LC06073 Institutional support: RVO:68081766 Keywords : Microsatellites * Next-generation sequencing * Nematoda * Population genetics Subject RIV: EG - Zoology Impact factor: 2.734, year: 2012

  18. Two genetic determinants acquired late in Mus evolution regulate the inclusion of exon 5, which alters mouse APOBEC3 translation efficiency.

    Directory of Open Access Journals (Sweden)

    Jun Li

    2012-01-01

    Full Text Available Mouse apolipoprotein B mRNA-editing enzyme catalytic polypeptide-like editing complex 3 (mA3, an intracellular antiviral factor, has 2 allelic variations that are linked with different susceptibilities to beta- and gammaretrovirus infections among various mouse strains. In virus-resistant C57BL/6 (B6 mice, mA3 transcripts are more abundant than those in susceptible BALB/c mice both in the spleen and bone marrow. These strains of mice also express mA3 transcripts with different splicing patterns: B6 mice preferentially express exon 5-deficient (Δ5 mA3 mRNA, while BALB/c mice produce exon 5-containing full-length mA3 mRNA as the major transcript. Although the protein product of the Δ5 mRNA exerts stronger antiretroviral activities than the full-length protein, how exon 5 affects mA3 antiviral activity, as well as the genetic mechanisms regulating exon 5 inclusion into the mA3 transcripts, remains largely uncharacterized. Here we show that mA3 exon 5 is indeed a functional element that influences protein synthesis at a post-transcriptional level. We further employed in vitro splicing assays using genomic DNA clones to identify two critical polymorphisms affecting the inclusion of exon 5 into mA3 transcripts: the number of TCCT repeats upstream of exon 5 and the single nucleotide polymorphism within exon 5 located 12 bases upstream of the exon 5/intron 5 boundary. Distribution of the above polymorphisms among different Mus species indicates that the inclusion of exon 5 into mA3 mRNA is a relatively recent event in the evolution of mice. The widespread geographic distribution of this exon 5-including genetic variant suggests that in some Mus populations the cost of maintaining an effective but mutagenic enzyme may outweigh its antiviral function.

  19. Where are the wormy mice? A re-examination of hybrid parasitism in the European house mouse hybrid zone

    Czech Academy of Sciences Publication Activity Database

    Baird, Stuart J. E.; Ribas, Alexis; Macholán, Miloš; Albrecht, Tomáš; Piálek, Jaroslav; Goüy de Bellocq, Joëlle

    2012-01-01

    Roč. 66, č. 9 (2012), s. 2757-2772 ISSN 0014-3820 R&D Projects: GA ČR GA206/08/0640 Institutional support : RVO:68081766 ; RVO:67985904 Keywords : helminths * Mus musculus domesticus * Mus musculus musculus * resistance * immune gene transitive compatibility Subject RIV: EG - Zoology Impact factor: 4.864, year: 2012

  20. Is water really a barrier for the house mouse? A comparative study of two mouse subspecies

    Czech Academy of Sciences Publication Activity Database

    Hiadlovská, Zuzana; Strnadová, Markéta; Macholán, Miloš; Vošlajerová Bímová, Barbora

    2012-01-01

    Roč. 61, 3-4 (2012), s. 319-329 ISSN 0139-7893 R&D Projects: GA ČR GA206/08/0640; GA ČR GAP506/11/1792 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : dispersal * Mus musculus domesticus * Mus musculus musculus * swimming * water barrier Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 0.494, year: 2012

  1. Analysis of Copy Number Variation in the Abp Gene Regions of Two House Mouse Subspecies Suggests Divergence during the Gene Family Expansions.

    Science.gov (United States)

    Pezer, Željka; Chung, Amanda G; Karn, Robert C; Laukaitis, Christina M

    2017-06-01

    The Androgen-binding protein ( Abp ) gene region of the mouse genome contains 64 genes, some encoding pheromones that influence assortative mating between mice from different subspecies. Using CNVnator and quantitative PCR, we explored copy number variation in this gene family in natural populations of Mus musculus domesticus ( Mmd ) and Mus musculus musculus ( Mmm ), two subspecies of house mice that form a narrow hybrid zone in Central Europe. We found that copy number variation in the center of the Abp gene region is very common in wild Mmd , primarily representing the presence/absence of the final duplications described for the mouse genome. Clustering of Mmd individuals based on this variation did not reflect their geographical origin, suggesting no population divergence in the Abp gene cluster. However, copy number variation patterns differ substantially between Mmd and other mouse taxa. Large blocks of Abp genes are absent in Mmm , Mus musculus castaneus and an outgroup, Mus spretus , although with differences in variation and breakpoint locations. Our analysis calls into question the reliance on a reference genome for interpreting the detailed organization of genes in taxa more distant from the Mmd reference genome. The polymorphic nature of the gene family expansion in all four taxa suggests that the number of Abp genes, especially in the central gene region, is not critical to the survival and reproduction of the mouse. However, Abp haplotypes of variable length may serve as a source of raw genetic material for new signals influencing reproductive communication and thus speciation of mice. © The Author 2017. Published by Oxford University Press on behalf of the Society for Molecular Biology and Evolution.

  2. Aspects of the life history of Muspicea borreli (Nematoda: Muspiceidae, parasite of the house mouse (Mus domesticus in Australia

    Directory of Open Access Journals (Sweden)

    Spratt D.M.

    2002-09-01

    Full Text Available Prevalence of Muspicea borreli (Nematoda infection in wild populations of Mus domesticus in forests in southeastern New South Wales and in rural Canberra, Australia was variable, relatively low and the parasite occurred predominantly in male mice. Experimental infection of BALB/c mice occurred only via subcutaneous inoculation but was achieved using i adults containing embryonating eggs, ii adults containing active larvae and iii active larvae dissected from the uterus of female worms. Experimental infection was not established using adults containing unembryonated eggs and was not established via intraperitoneal, percutaneous nor oral routes. Evidence indicates that larvae develop to the infective stage in the uterus of the adult worm, suggests that an obligate developmental phase on the host skin does not occur and that autoinfection is possible. Experimental infection predominated in males; females rarely became infected. When male BALB/c mice were inoculated subcutaneously with M. borreli, immediately paired with an uninoculated female and permitted to breed for 90 days, infection was found in male and female offspring only of the second and subsequent litters or in the breeding female partner. Transmission to the young occurred within 21 days of birth and fifth-stage M. borreli were found in offspring of the second and subsequent litters only after 35 or more days. However, when a male was inoculated but mating delayed for 23 days, infection was found in progeny of the first and second litters. The life cycle is direct and the prepatent period in BALB/c mice is estimated at 50-60 days. The precise mode of transmission of the parasite in breeding pairs of mice was not determined but larvae remained active for approximately an hour in balanced saline solutions (pH = 7.2 and in human saliva but died under conditions emulating free-living (tap water pH = 7.1 and stomach (pepsin solution pH = 2 environments. Transmission was not effected by

  3. Avaliação de possível interferência do tabagismo na ovoposição de larvas de Calliphoridae (Díptera em carcaça de Mus musculus L. (Rodentia: Muriade em São Paulo, SP

    Directory of Open Access Journals (Sweden)

    Thais Souza Guerra

    2016-04-01

    Full Text Available A estimativa do intervalo post-mortem (IPM é uma das principais utilizações de insetos na perícia, que pode ser fundamentado no ciclo biológico, ecologia e distribuição geográfica de uma determinada espécie, bem como o comportamento de toda fauna presente em um corpo a fim de estimar o menor intervalo possível da ocorrência da morte. Diversos fatores podem interferir no ciclo de vida de um inseto, tais como temperatura, umidade e presença de substâncias nos tecidos de uma carcaça, promovendo, em certos casos, aceleração ou retardo neste ciclo afetando diretamente na estimativa do IPM. O presente estudo teve como objetivo avaliar a possível interferência do tabagismo na ovoposição de larvas de Calliphoridae (Díptera em carcaça de Mus musculus L. (Rodentia: Muridae, na zona leste de São Paulo, SP, correlacionando os estágios de decomposição da carcaça e o desenvolvimento larval de moscas. A captura das larvas foi realizada durante o mês de outubro de 2014, as quais as carcaças foram acondicionadas em aparato adequado para coleta de insetos imaturos e adultos: uma contendo a carcaça tabagista e outra com a carcaça não fumante. No curso da decomposição da carcaça não fumante, foram capturados 37 indivíduos adultos da família Calliphoridae emergidos durante o processo de decomposição, ao passo que, na carcaça com fumígeno, não foi coletado nenhuma espécie emergida deste substrato, porém, a mesma apresentou uma decomposição até a fase de esqueletização em menor tempo comparado á carcaça controle, sugerindo assim, uma possível interferência do ato de tabagismo na estimativa do IPM.

  4. Efecto de las nanopartículas industriales TiO 2 , SiO 2 y ZnO sobre la viabilidad celular y expresión génica en médula ósea roja de mus musculus

    Directory of Open Access Journals (Sweden)

    Jacquelyne Zarria-Romero

    Full Text Available RESUMEN Objetivos Evaluar el efecto de las nanopartículas de ZnO, TiO2 y SiO2 sobre la viabilidad celular y la expresión génica de las interleuquinas 7 y 3 y del factor estimulante de colonias de granulocito - macrófago (GM-CSF en Mus musculus. Materiales y métodos Se extrajo médula ósea roja de cinco roedores (Balb/c para el estudio de viabilidad celular mediante la prueba de MTT. Por otro lado, grupos cinco roedores fueron inoculados vía intraperitoneal con dosis de 0,5; 1; 2,5; 5 y 10 mg/kg de nanopartículas de ZnO y SiO2 y de 5; 10; 15; 20 y 25 mg/kg de nanopartículas de TiO2, 30 h después, se obtuvo el ARN a partir de la médula ósea roja para los análisis de expresión génica empleando las técnicas de PCR y RT-PCR cuantitativa. Resultados Las nanopartículas de ZnO y SiO2 redujeron la viabilidad celular de una manera dosis-dependiente en un 37 y 26%, respectivamente, a partir de una dosis de 1 mg/kg. En cuanto al efecto sobre la expresión génica, a las dosis 5 y 10 mg/kg, las nanopartículas de TiO2 redujeron en mayor porcentaje la expresión de las interleuquinas 7 y 3 (55,3 y 70,2% respectivamente, con respecto a la expresión del GM-CSF, el mayor porcentaje de reducción lo produjo las nanopartículas de SiO2 (91%. Las nanopartículas de ZnO redujeron a partir de las dosis de 20 y 25 mg/kg. Conclusiones Las nanopartículas de ZnO, SiO2 y TiO2 alteran la viabilidad celular y la expresión génica en la médula ósea de ratón.

  5. Embriotoxicidad del bromato de potasio en raton (Mus musculus)

    OpenAIRE

    Grecia Landeo; José L. Pino

    2013-01-01

    Se evaluó in vivo los efectos de bromato de potasio (KBr0 3 ) sobre el desarrollo de embriones pre- implantacionales de ratón. Ratonas preñadas fueron tratadas con una dosis única de KBr0 3 (68,5 mg/kg de peso corporal; n= 8) y un grupo control (C) tratado con agua destilada (n= 7) en el día 1; al cuarto día de preñez, las hembras fueron sacrifi cadas, los embriones fueron extraidos de los oviductos y de los cuernos uterinos para la evaluación. El KBr0 3 produjo un retraso en el desar- rollo ...

  6. Embriotoxicidad del bromato de potasio en raton (Mus musculus)

    OpenAIRE

    Gonzales, José M; Pino, José L

    2007-01-01

    Se evaluó in vivo los efectos de bromato de potasio (KBr0(3)) ()sobre el desarrollo de embriones preimplantacionales de ratón. Ratonas preñadas fueron tratadas con una dosis única de KBr0(3) (68,5 mg/kg de peso corporal; n= 8) y un grupo control (C) tratado con agua destilada (n= 7) en el día 1; al cuarto día de preñez, las hembras fueron sacrificadas, los embriones fueron extraidos de los oviductos y de los cuernos uterinos para la evaluación. El KBr0(3) produjo un retraso en el desarrollo e...

  7. Embriotoxicidad del bromato de potasio en raton (Mus musculus

    Directory of Open Access Journals (Sweden)

    Grecia Landeo

    2013-04-01

    Full Text Available Se evaluó in vivo los efectos de bromato de potasio (KBr0 3 sobre el desarrollo de embriones pre- implantacionales de ratón. Ratonas preñadas fueron tratadas con una dosis única de KBr0 3 (68,5 mg/kg de peso corporal; n= 8 y un grupo control (C tratado con agua destilada (n= 7 en el día 1; al cuarto día de preñez, las hembras fueron sacrifi cadas, los embriones fueron extraidos de los oviductos y de los cuernos uterinos para la evaluación. El KBr0 3 produjo un retraso en el desar- rollo embrionario, encontrándose un 76,9±7,8 y 11,2±5,5 en porcentaje de blastocistos y mórulas respectivamente en el C en comparación de un 34,8±11,2 y 49,3±11,9 de la misma relación en el grupo tratado, mostrando diferencias signifi cativas(p<0,05. En cuanto a la calidad embrionaria, se observó un incremento en el porcentaje de embriones de baja calidad (grado III y degenerados en el grupo tratado, pero esta diferencia no es estadísticamente signifi cativa (p>0,05. En conclusión podemos decir que el KBr0 3 produce un efecto dañino sobre el embrión, causando retraso en su desarrollo.

  8. PENGARUH LINAMARIN TERHADAP PENAMPILAN REPRODUKSI INDUK MENCIT (Mus musculus L.

    Directory of Open Access Journals (Sweden)

    Fitra Wahyuni

    2017-12-01

    Full Text Available ABSTRACTThis study was performed to observe the effect of linamarin on reproductive performance, that consist of the number of live fetuses, reabsorption embryo or fetal, fetal death and fetal body weight together with length. Pregnant mice were divided into one control group with administration of distilled water (0 mg/kgb.w/days and six treatment groups linamarin dose is 0.36; 0.72; 1.26 mg; 2; 4; and 8 mg/kgb.w./days. Linamarin dosing and control begins at 5th to 16th gestation days, at 17-days of gestation caesarean section were performed to pregnant mice to remove foetuses. Statistical analysis used was a variation analysis by ANOVA followed by comparisons between treatments HSD test (Tukey. Giving linamarin observed in the parent mice led to a decrease in average weight gain of the mother during pregnancy compared with controls. In linamarin dose 8 mg/kgb.w/day an increase in embryo reabsorption and fetal death, as well as the observed decrease in fetal body weight and length, but after statistical analysis of the decrease was not significantly different. Linamarin with the doses given in this study is not expected to interfere with pregnancy based on reproductive performance were observed. Keywords: Linamarin, reproductive performance, fetal weight, fetal body length ABSTRAKPenelitian ini dilaksanakan bertujuan untuk mengamati pengaruh linamarin pada penampilan reproduksi yang meliputi jumlah fetus hidup, embrio resorpsi, fetus mati dan berat beserta panjang badan fetus. Induk mencit yang bunting dikelompokkan ke dalam satu kelompok kontrol dengan pemberian akuades (0 mg/kgb.b./hari dan enam kelompok perlakuan dosis linamarin yaitu 0,36; 0,72; 1,26 mg; 2; 4; dan 8 mg/kgb.b./hari. Pemberian dosis linamarin dan kontrol dimulai pada umur kebuntingan 5 sampai 16 hari, setelah itu pada umur kebuntingan 17 hari mencit dikorbankan nyawanya untuk pengambilan fetus. Analisis statistik yang digunakan adalah analisis variasi dengan ANOVA dan dilanjutkan dengan uji perbandingan antar perlakuan HSD (Tukey. Pemberian linamarin pada induk mencit diamati menyebabkan penurunan rata-rata pertambahan berat badan induk selama kebuntingan dibandingkan dengan kontrol. Pada dosis linamarin 8 mg/kgb.b./hari terjadi peningkatan embrio resorpsi dan fetus yang mati, serta diamati penurunan berat dan panjang badan fetus, namun setelah dilakukan analisis statistik penurunan tersebut tidak berbeda nyata. Linamarin dengan dosis yang diberikan pada penelitian ini diduga tidak mengganggu kebuntingan berdasarkan penampilan reproduksi yang diamati. Kata kunci: Linamarin, penampilan reproduksi, berat badan fetus, panjang badan fetus

  9. Tristania Sumatrana Effect On Female Mus Musculus Fertility

    Science.gov (United States)

    Syamsurizal, S.

    2018-04-01

    The use of traditional medicinal plants are generally based on empirical experience, therefore it is necessary scientific approach in order to bring traditional medicine into medical practice and the formal health services. Tristania sumatrana Miq. is one of the traditional medicinal plants are often used as a contraceptive for women in West Sumatra Tristania sumatrana Miq. extract can prolong the estrous cycle in mice to eleven days. This study aimed to influence Tristania sumatrana Miq. extract treatment on fertility of female mice. Experiments conducted a randomized block design 5x2. Five dose groups: control with no treatment, placebo, treatment with doses of 600, 900 and 1200 mg/kgbw and the old two treatment groups: 10 and 20 days. Fertility parameters studied were ovarian weight follicle Graaf number, the corpus luteum and fetal life. The research proves of Tristania sumatrana Miq. extract treatment causes a decrease very significantly the ovarian weight (treatment of 900 mg/kgbw for 10 days), follicles Graaf number (900 mg/kgbw for 20 days), the corpus luteum (600 mg/kgbw for 10 days) and live fetuses (900 mg/kgbw for 10 days). Tristania sumatrana Miq. extract treatment can lead to decreased fertility of female mice.

  10. Radioautographic DNA synthesis study on mice Mus musculus gingival epithelium

    International Nuclear Information System (INIS)

    Silveira Tarelho, Z.V. da; Hetem, S.

    1984-01-01

    The DNA-synthetizing cells frequency in the gingival epithelium basal layer of the first lower molar region in young and adult mice were studied. The 3H-thymidine and radioautography were used. The labeled cells frequency was determined by calculating their proportions. The data were statiscally analysed. (M.A.C.) [pt

  11. Geographic phenetic variation of two eastern-Mediterranean non-commensal mouse species, Mus macedonicus and M. cypriacus (Rodentia: Muridae) based on traditional and geometric approaches to morphometrics

    Czech Academy of Sciences Publication Activity Database

    Macholán, Miloš; Mikula, Ondřej; Vohralík, V.

    2008-01-01

    Roč. 247, - (2008), s. 67-80 ISSN 0044-5231 R&D Projects: GA AV ČR IAA6045307; GA ČR GA206/06/0707 Grant - others:GA ČR(CZ) GA206/05/2334 Institutional research plan: CEZ:AV0Z50450515 Keywords : Mus macedonicus * Mus cypriacus * phenotypic variation Subject RIV: EG - Zoology Impact factor: 1.319, year: 2008

  12. Identification of an active ID-like group of SINEs in the mouse.

    Science.gov (United States)

    Kass, David H; Jamison, Nicole

    2007-09-01

    The mouse genome consists of five known families of SINEs: B1, B2, B4/RSINE, ID, and MIR. Using RT-PCR we identified a germ-line transcript that demonstrates 92.7% sequence identity to ID (excluding primer sequence), yet a BLAST search identified numerous matches of 100% sequence identity. We analyzed four of these elements for their presence in orthologous genes in strains and subspecies of Mus musculus as well as other species of Mus using a PCR-based assay. All four analyzed elements were identified either only in M. musculus or exclusively in both M. musculus and M. domesticus, indicative of recent integrations. In conjunction with the identification of transcripts, we present an active ID-like group of elements that is not derived from the proposed BC1 master gene of ID elements. A BLAST of the rat genome indicated that these elements were not in the rat. Therefore, this family of SINEs has recently evolved, and since it has thus far been observed mainly in M. musculus, we refer to this family as MMIDL.

  13. A candidate subspecies discrimination system involving a vomeronasal receptor gene with different alleles fixed in M. m. domesticus and M. m. musculus.

    Directory of Open Access Journals (Sweden)

    Robert C Karn

    2010-09-01

    Full Text Available Assortative mating, a potentially efficient prezygotic reproductive barrier, may prevent loss of genetic potential by avoiding the production of unfit hybrids (i.e., because of hybrid infertility or hybrid breakdown that occur at regions of secondary contact between incipient species. In the case of the mouse hybrid zone, where two subspecies of Mus musculus (M. m. domesticus and M. m. musculus meet and exchange genes to a limited extent, assortative mating requires a means of subspecies recognition. We based the work reported here on the hypothesis that, if there is a pheromone sufficiently diverged between M. m. domesticus and M. m. musculus to mediate subspecies recognition, then that process must also require a specific receptor(s, also sufficiently diverged between the subspecies, to receive the signal and elicit an assortative mating response. We studied the mouse V1R genes, which encode a large family of receptors in the vomeronasal organ (VNO, by screening Perlegen SNP data and identified one, Vmn1r67, with 24 fixed SNP differences most of which (15/24 are nonsynonymous nucleotide substitutions between M. m. domesticus and M. m. musculus. We observed substantial linkage disequilibrium (LD between Vmn1r67 and Abpa27, a mouse salivary androgen-binding protein gene that encodes a proteinaceous pheromone (ABP capable of mediating assortative mating, perhaps in conjunction with its bound small lipophilic ligand. The LD we observed is likely a case of association rather than residual physical linkage from a very recent selective sweep, because an intervening gene, Vmn1r71, shows significant intra(subspecific polymorphism but no inter(subspecific divergence in its nucleotide sequence. We discuss alternative explanations of these observations, for example that Abpa27 and Vmn1r67 are coevolving as signal and receptor to reinforce subspecies hybridization barriers or that the unusually divergent Vmn1r67 allele was not a product of fast positive

  14. The mouse hybrid zone in Central Europe: from morphology to molecules

    Czech Academy of Sciences Publication Activity Database

    Ďureje, Ľudovít; Macholán, Miloš; Baird, Stuart J. E.; Piálek, Jaroslav

    2012-01-01

    Roč. 61, 3-4 (2012), s. 308-318 ISSN 0139-7893 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : geography * introgression * mtDNA * Mus musculus musculus * Mus musculus domesticus * X chromosome * Y chromosome Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 0.494, year: 2012

  15. Transgressive segregation in a behavioural trait? Explorative strategies in two house mouse subspecies and their hybrids

    Czech Academy of Sciences Publication Activity Database

    Hiadlovská, Zuzana; Vošlajerová Bímová, Barbora; Mikula, Ondřej; Piálek, Jaroslav; Macholán, Miloš

    2013-01-01

    Roč. 108, č. 1 (2013), s. 225-235 ISSN 0024-4066 R&D Projects: GA ČR GA206/08/0640; GA ČR GAP506/11/1792; GA AV ČR KJB600930701 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : dispersion * exploration * hybridization * Mus musculus domesticus * Mus musculus musculus * open field test Subject RIV: EG - Zoology; EB - Genetics ; Molecular Biology (UZFG-Y) Impact factor: 2.535, year: 2013

  16. Repeat associated mechanisms of genome evolution and function revealed by the Mus caroli and Mus pahari genomes.

    Science.gov (United States)

    Thybert, David; Roller, Maša; Navarro, Fábio C P; Fiddes, Ian; Streeter, Ian; Feig, Christine; Martin-Galvez, David; Kolmogorov, Mikhail; Janoušek, Václav; Akanni, Wasiu; Aken, Bronwen; Aldridge, Sarah; Chakrapani, Varshith; Chow, William; Clarke, Laura; Cummins, Carla; Doran, Anthony; Dunn, Matthew; Goodstadt, Leo; Howe, Kerstin; Howell, Matthew; Josselin, Ambre-Aurore; Karn, Robert C; Laukaitis, Christina M; Jingtao, Lilue; Martin, Fergal; Muffato, Matthieu; Nachtweide, Stefanie; Quail, Michael A; Sisu, Cristina; Stanke, Mario; Stefflova, Klara; Van Oosterhout, Cock; Veyrunes, Frederic; Ward, Ben; Yang, Fengtang; Yazdanifar, Golbahar; Zadissa, Amonida; Adams, David J; Brazma, Alvis; Gerstein, Mark; Paten, Benedict; Pham, Son; Keane, Thomas M; Odom, Duncan T; Flicek, Paul

    2018-04-01

    Understanding the mechanisms driving lineage-specific evolution in both primates and rodents has been hindered by the lack of sister clades with a similar phylogenetic structure having high-quality genome assemblies. Here, we have created chromosome-level assemblies of the Mus caroli and Mus pahari genomes. Together with the Mus musculus and Rattus norvegicus genomes, this set of rodent genomes is similar in divergence times to the Hominidae (human-chimpanzee-gorilla-orangutan). By comparing the evolutionary dynamics between the Muridae and Hominidae, we identified punctate events of chromosome reshuffling that shaped the ancestral karyotype of Mus musculus and Mus caroli between 3 and 6 million yr ago, but that are absent in the Hominidae. Hominidae show between four- and sevenfold lower rates of nucleotide change and feature turnover in both neutral and functional sequences, suggesting an underlying coherence to the Muridae acceleration. Our system of matched, high-quality genome assemblies revealed how specific classes of repeats can play lineage-specific roles in related species. Recent LINE activity has remodeled protein-coding loci to a greater extent across the Muridae than the Hominidae, with functional consequences at the species level such as reproductive isolation. Furthermore, we charted a Muridae-specific retrotransposon expansion at unprecedented resolution, revealing how a single nucleotide mutation transformed a specific SINE element into an active CTCF binding site carrier specifically in Mus caroli , which resulted in thousands of novel, species-specific CTCF binding sites. Our results show that the comparison of matched phylogenetic sets of genomes will be an increasingly powerful strategy for understanding mammalian biology. © 2018 Thybert et al.; Published by Cold Spring Harbor Laboratory Press.

  17. Repeat associated mechanisms of genome evolution and function revealed by the Mus caroli and Mus pahari genomes

    Science.gov (United States)

    Thybert, David; Roller, Maša; Navarro, Fábio C.P.; Fiddes, Ian; Streeter, Ian; Feig, Christine; Martin-Galvez, David; Kolmogorov, Mikhail; Janoušek, Václav; Akanni, Wasiu; Aken, Bronwen; Aldridge, Sarah; Chakrapani, Varshith; Chow, William; Clarke, Laura; Cummins, Carla; Doran, Anthony; Dunn, Matthew; Goodstadt, Leo; Howe, Kerstin; Howell, Matthew; Josselin, Ambre-Aurore; Karn, Robert C.; Laukaitis, Christina M.; Jingtao, Lilue; Martin, Fergal; Muffato, Matthieu; Nachtweide, Stefanie; Quail, Michael A.; Sisu, Cristina; Stanke, Mario; Stefflova, Klara; Van Oosterhout, Cock; Veyrunes, Frederic; Ward, Ben; Yang, Fengtang; Yazdanifar, Golbahar; Zadissa, Amonida; Adams, David J.; Brazma, Alvis; Gerstein, Mark; Paten, Benedict; Pham, Son; Keane, Thomas M.; Odom, Duncan T.; Flicek, Paul

    2018-01-01

    Understanding the mechanisms driving lineage-specific evolution in both primates and rodents has been hindered by the lack of sister clades with a similar phylogenetic structure having high-quality genome assemblies. Here, we have created chromosome-level assemblies of the Mus caroli and Mus pahari genomes. Together with the Mus musculus and Rattus norvegicus genomes, this set of rodent genomes is similar in divergence times to the Hominidae (human-chimpanzee-gorilla-orangutan). By comparing the evolutionary dynamics between the Muridae and Hominidae, we identified punctate events of chromosome reshuffling that shaped the ancestral karyotype of Mus musculus and Mus caroli between 3 and 6 million yr ago, but that are absent in the Hominidae. Hominidae show between four- and sevenfold lower rates of nucleotide change and feature turnover in both neutral and functional sequences, suggesting an underlying coherence to the Muridae acceleration. Our system of matched, high-quality genome assemblies revealed how specific classes of repeats can play lineage-specific roles in related species. Recent LINE activity has remodeled protein-coding loci to a greater extent across the Muridae than the Hominidae, with functional consequences at the species level such as reproductive isolation. Furthermore, we charted a Muridae-specific retrotransposon expansion at unprecedented resolution, revealing how a single nucleotide mutation transformed a specific SINE element into an active CTCF binding site carrier specifically in Mus caroli, which resulted in thousands of novel, species-specific CTCF binding sites. Our results show that the comparison of matched phylogenetic sets of genomes will be an increasingly powerful strategy for understanding mammalian biology. PMID:29563166

  18. Serine/threonine-protein phosphatase 1 α levels are paralleling olfactory memory formation in the CD1 mouse.

    Science.gov (United States)

    Winding, Christiana; Sun, Yanwei; Höger, Harald; Bubna-Littitz, Hermann; Pollak, Arnold; Schmidt, Peter; Lubec, Gert

    2011-06-01

    Although olfactory discrimination has already been studied in several mouse strains, data on protein levels linked to olfactory memory are limited. Wild mouse strains Mus musculus musculus, Mus musculus domesticus and CD1 laboratory outbred mice were tested in a conditioned odor preference task and trained to discriminate between two odors, Rose and Lemon, by pairing one odor with a sugar reward. Six hours following the final test, mice were sacrificed and olfactory bulbs (OB) were taken for gel-based proteomics analyses and immunoblotting. OB proteins were extracted, separated by 2-DE and quantified using specific software (Proteomweaver). Odor-trained mice showed a preference for the previously rewarded odor suggesting that conditioned odor preference occurred. In CD1 mice levels, one out of 482 protein spots was significantly increased in odor-trained mice as compared with the control group; it was in-gel digested by trypsin and chymotrypsin and analyzed by tandem mass spectrometry (nano-ESI-LC-MS/MS). The spot was unambiguously identified as serine/threonine-protein phosphatase PP1-α catalytic subunit (PP-1A) and differential levels observed in gel-based proteomic studies were verified by immunoblotting. PP-1A is a key signalling element in synaptic plasticity and memory processes and is herein shown to be paralleling olfactory discrimination representing olfactory memory. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. The role of cohesin genes in the meiosis of male house mouse

    OpenAIRE

    Šebestová, Lenka

    2015-01-01

    Cohesin genes play an important role in cell division. They ensure proper chromosome segregation during mitosis and meiosis. This study is focused on the role of cohesin genes during meiosis in male house mouse (Mus musculus). At first, this study introduces key processes of mammalian meiosis. Next, the structure of cohesin complex is described; it consists of a heterodimer SMC proteins - SMC3 and SMC1α or SMC1β, which are enclosed to the ring by cleavable subunit RAD21, RAD21L or REC8. Fourt...

  20. Clinical Procedures Training for Veterinary Technicians and Investigators using Common Laboratory Animal Species, including: Mice (Mus musculus), Rats (Rattus norvegicus), Hamsters (Mesocricetus auratus), Guinea Pigs (Gavia porcellus), Rabbits (Otyctolagus cuniculus), Ferrets (Mustela putorius furo), Pigs (Sus scrofa), Sheep (Ovis aries), and Goats (Capra hircus)

    Science.gov (United States)

    2016-08-30

    60th Medical Group (AMC), Travis AFB, CA INSTITUTIONAL ANIMAL CARE AND USE COMMITTEE (IACUC) FINAL REPORT SUMMARY (Please !ml all information. Use...Technicians and Investigators using Common Laboratory Animal Species, including: Mice (Mus muscu/us), Rats (Rattus norvegicus), Hamsters (Mesocricetus auratus...DATE: 14 November 2016 FUNDING SOURCE: SG O&M funds LAST TRIENNIAL REVISION DATE: 15 October 2015 1. RECORD OF ANIMAL USAGE: Animal Species: Total

  1. Food preferences of wild house-mice (Mus musclus L).

    Science.gov (United States)

    Rowe, F P; Bradfield, A; Redfern, R

    1974-12-01

    The relative acceptance of various plain foods by wild house-mice (Mus musculus L.) was compared in laboratory choice tests. The palatability of glycerine and six oils, each included at 5% in pinhead oatmeal, was compared in a similar manner.The most favoured food was found to be whole canary seed (Phalaris canariensis). Pinhead oatmeal and wheat were also comparatively well accepted. Glycerine, corn oil, arachis oil and mineral oil were more palatable than either olive, linseed or cod-liver oils.The results of the choice tests are considered in relation to the use of poison baits for the control of free-living mice.

  2. Life history and bioeconomy of the house mouse.

    Science.gov (United States)

    Berry, R J; Bronson, F H

    1992-11-01

    1. More is known about the western European house mouse, Mus (musculus) domesticus than any other non-human mammal. If laboratory and field information is combined, an extremely valuable understanding of the species' bioeconomy could be obtained. 2. The seven stages of mouse life-history are surveyed (up to birth, nest life, sex life, social structure, population statics and stability, senescence, and death), and the interactions between the changing phenotype and the environment are described. 3. These interactions can be used to build up a model of the opportunities and compromises which result in the fitness of individual mice. It is not yet possible to quantify such a model, but this should in principle be achievable.

  3. Recombinational hotspot specific to female meiosis in the mouse major histocompatibility complex.

    Science.gov (United States)

    Shiroishi, T; Hanzawa, N; Sagai, T; Ishiura, M; Gojobori, T; Steinmetz, M; Moriwaki, K

    1990-01-01

    The wm7 haplotype of the major histocompatibility complex (MHC), derived from the Japanese wild mouse Mus musculus molossinus, enhances recombination specific to female meiosis in the K/A beta interval of the MHC. We have mapped crossover points of fifteen independent recombinants from genetic crosses of the wm7 and laboratory haplotypes. Most of them were confined to a short segment of approximately 1 kilobase (kb) of DNA between the A beta 3 and A beta 2 genes, indicating the presence of a female-specific recombinational hotspot. Its location overlaps with a sex-independent hotspot previously identified in the Mus musculus castaneus CAS3 haplotype. We have cloned and sequenced DNA fragments surrounding the hotspot from the wm7 haplotype and the corresponding regions from the hotspot-negative B10.A and C57BL/10 strains. There is no significant difference between the sequences of these three strains, or between these and the published sequences of the CAS3 and C57BL/6 strains. However, a comparison of this A beta 3/A beta 2 hotspot with a previously characterized hotspot in the E beta gene revealed that they have a very similar molecular organization. Each hotspot consists of two elements, the consensus sequence of the mouse middle repetitive MT family and the tetrameric repeated sequences, which are separated by 1 kb of DNA.

  4. The Sycp1 loci of the mouse genome: successive retropositions of a meiotic gene during the recent evolution of the genus.

    Science.gov (United States)

    Sage, J; Yuan, L; Martin, L; Mattei, M G; Guénet, J L; Liu, J G; Hoög, C; Rassoulzadegan, M; Cuzin, F

    1997-08-15

    The murine Sycp1 gene is expressed at the early stages of meiosis. We show that it is composed of a number of small exons and localized on mouse chromosome 3. In the laboratory strains, two retrogenes were also identified. The first one (Sycp1-ps1), on chromosome 7, has accumulated point mutations and deletions and is not transcribed. A second retrogene (Sycp1-ps2), on chromosome 8, is inserted within the continuity of a moderately repeated element, in an intron of another gene (Cad11). The two retroposition events can be dated to distinct periods in the evolution of the Muridae. Sycp1-ps2 has kept features indicative of a relatively recent origin, namely a nearly intact coding region, a poly(A) tail, and 14-bp terminal repeats. Its recent origin was confirmed by the fact that it is found in all the laboratory strains of mice, but neither in a recent isolate from Mus musculus domesticus wild stocks nor in the closely related subspecies M. musculus musculus, M. m. molossinus, M. m. castaneus, and M. m. bactrianus. Appearance of the more ancient Sycp1-ps1 retrogene is concomitant with the radiation of the genus. It is present in various Mus species (M. spretus, M. spicilegus, M. macedonicus, and M. cookii), but neither in the rat nor in the more closely related Pyromis genus. Transposition of retrotranscripts during meiosis and their hereditary establishment thus appear to occur relatively frequently. They may, therefore, play a significant role in the evolutionary process.

  5. Genetic conflict outweighs heterogametic incompatibility in the mouse hybrid zone?

    Czech Academy of Sciences Publication Activity Database

    Macholán, Miloš; Baird, S. J. E.; Munclinger, P.; Dufková, Petra; Bímová, Barbora; Piálek, Jaroslav

    2008-01-01

    Roč. 8, - (2008), s. 271-284 ISSN 1471-2148 R&D Projects: GA ČR GA206/06/0707; GA ČR GA206/06/0955; GA AV ČR IAA600930506; GA ČR GA206/08/0640 Grant - others:GA ČR(CZ) GP206/03/D148 Institutional research plan: CEZ:AV0Z50450515; CEZ:AV0Z60930519 Keywords : Mus musculus musculus * Mus musculus domesticus Subject RIV: EG - Zoology Impact factor: 4.050, year: 2008

  6. Mouse lipocalins (MUP, OBP, LCN) are co-expressed in tissues involved in chemical communication

    Czech Academy of Sciences Publication Activity Database

    Stopková, R.; Vinkler, D.; Kuntová, B.; Šedo, O.; Albrecht, T.; Suchan, J.; Dvořáková-Hortová, Kateřina; Zdráhal, Z.; Stopka, P.

    2016-01-01

    Roč. 47, č. 4 (2016), s. 1-11 ISSN 2296-701X Institutional support: RVO:86652036 Keywords : lipocalin * odorant * chemical communication * Mus musculus * olfaction Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology

  7. Vitamin K epoxide reductase complex subunit 1 (Vkorc1 haplotype diversity in mouse priority strains

    Directory of Open Access Journals (Sweden)

    Kohn Michael H

    2008-12-01

    Full Text Available Abstract Background Polymorphisms in the vitamin K-epoxide reductase complex subunit 1 gene, Vkorc1, could affect blood coagulation and other vitamin K-dependent proteins, such as osteocalcin (bone Gla protein, BGP. Here we sequenced the Vkorc1 gene in 40 mouse priority strains. We analyzed Vkorc1 haplotypes with respect to prothrombin time (PT and bone mineral density and composition (BMD and BMC; phenotypes expected to be vitamin K-dependent and represented by data in the Mouse Phenome Database (MPD. Findings In the commonly used laboratory strains of Mus musculus domesticus we identified only four haplotypes differing in the intron or 5' region sequence of the Vkorc1. Six haplotypes differing by coding and non-coding polymorphisms were identified in the other subspecies of Mus. We detected no significant association of Vkorc1 haplotypes with PT, BMD and BMC within each subspecies of Mus. Vkorc1 haplotype sequences divergence between subspecies was associated with PT, BMD and BMC. Conclusion Phenotypic variation in PT, BMD and BMC within subspecies of Mus, while substantial, appears to be dominated by genetic variation in genes other than the Vkorc1. This was particularly evident for M. m. domesticus, where a single haplotype was observed in conjunction with virtually the entire range of PT, BMD and BMC values of all 5 subspecies of Mus included in this study. Differences in these phenotypes between subspecies also should not be attributed to Vkorc1 variants, but should be viewed as a result of genome wide genetic divergence.

  8. NCBI nr-aa BLAST: CBRC-OLAT-26-0164 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-26-0164 ref|NP_031715.1| chondroadherin [Mus musculus] sp|O55226|CHAD_MOUSE Chondroad...herin precursor (Cartilage leucine-rich protein) gb|AAC39963.1| chondroadherin [Mus musculus] gb|AAH12672.1| Chondroad...herin [Mus musculus] emb|CAI25589.1| chondroadherin [Mus musculus] dbj|BAE34451.1| unn...amed protein product [Mus musculus] gb|EDL15934.1| chondroadherin [Mus musculus] NP_031715.1 5e-85 57% ...

  9. Characterization of two forms of mouse salivary androgen-binding protein (ABP): implications for evolutionary relationships and ligand-binding function.

    Science.gov (United States)

    Karn, Robert C; Laukaitis, Christina M

    2003-06-17

    Mouse salivary androgen-binding protein (ABP) is a member of the secretoglobin family produced in the submaxillary glands of house mice (Mus musculus). We report the cDNA sequences and amino acid sequences of the beta and gamma subunits of ABP from a mouse cDNA library, identifying the two subunits by their pIs and molecular weights. An anomalously high molecular weight of the alpha subunit is likely due to glycosylation at a single site. A phylogenetic comparison of the three subunits of ABP with the chains of other mammalian secretoglobins shows that ABP is most closely related to mouse lachrymal protein and to the major cat allergen Fel dI. An evaluation of the most conserved residues in ABP and the other secretoglobins, in light of structural data reported by others [Callebaut, I., Poupon, A., Bally, R., Demaret, J.-P., Housset, D., Delettre, J., Hossenlopp, P., and Mornon, J.-P. (2000) Ann. N.Y. Acad. Sci. 923, 90-112; Pattabiraman, N., Matthews, J., Ward, K., Mantile-Selvaggi, G., Miele, L., and Mukherjee, A. (2000) Ann. N.Y. Acad. Sci. 923, 113-127], allows us to draw conclusions about the critical residues important in ligand binding by the two different ABP dimers and to assess the importance of ligand binding in the function of the molecule. In addition to the cDNAs, which represent those of the musculus subspecies of Mus musculus, we also report the coding regions of the beta and gamma subunit cDNAs from two other mouse inbred strains which represent the other two subspecies: M. musculus domesticus and M. musculus castaneus. The high nonsynonymous/synonymous substitution rate ratios (K(a)/K(s)) for both the beta and gamma subunits suggest that these two proteins are evolving under strong directional selection, as has been reported for the alpha subunit [Hwang, J., Hofstetter, J., Bonhomme, F., and Karn, R. (1997) J. Hered. 88, 93-97; Karn, R., and Clements, M. (1999) Biochem. Genet. 37, 187-199].

  10. Estudio de interacciones metal-biomolecula en organismos modelos Mus musculus/Mus spretus. Diagnosis de problemas ambientales

    OpenAIRE

    Jara Biedma, Rocío

    2014-01-01

    La presencia creciente de una gran variedad de contaminantes químicos en el medio ambiente supone un riesgo para la salud de los organismos presentes en ellos y los correspondientes ecosistemas. La monitorización medioambiental convencional de los ecosistemas se lleva a cabo mediante análisis químico de elementos traza tóxicos (por ejemplo, Cd, As, Pb, Hg, etc), contaminantes orgánicos (plaguicidas, PCBs, PAHs), contaminantes emergentes (disruptores endocrinos, productos farmacéuticos, produc...

  11. Sperm morphology in two house mouse subspecies: Do wild-derived strains and wild mice tell the same story?

    Czech Academy of Sciences Publication Activity Database

    Albrechtová, Jana; Albrecht, Tomáš; Ďureje, Ľudovít; Pallazola, V. A.; Piálek, Jaroslav

    2014-01-01

    Roč. 9, č. 12 (2014), e115669 E-ISSN 1932-6203 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 Keywords : Mus musculus musculus * hybrid zone * multiple paternity * Passerine birds * Swimming velocity * Central Europe * Competition * Speciation * Common * Size Subject RIV: EG - Zoology Impact factor: 3.234, year: 2014

  12. Transgene mus som sygdomsmodeller

    DEFF Research Database (Denmark)

    Schuster, Mikkel Bruhn; Porse, Bo Torben

    2003-01-01

    Transgenic animal models have proven to be useful tools in understanding both basic biology and the events associated with disease. Recent technical advances in the area of genomic manipulation in combination with the availability of the human and murine genomic sequences now allow the precise...... tailoring of the mouse genome. In this review we describe a few systems in which transgenic animal models have been employed for the purpose of studying the etiology of human diseases. Udgivelsesdato: 2003-Feb-17...

  13. PENGARUH EKSTRAK DAUN KEMANGI (Ocimum sanctum L. TERHADAP MOTILITAS DAN KONSENTRASI SPERMATOZOA MENCIT JANTAN (Mus musculus

    Directory of Open Access Journals (Sweden)

    Safwan

    2016-10-01

    Full Text Available We have conducted a research on the effect of the extract of leaves basil (Ocimum sanctum L on male mice to investigate the consentration and motility spermatozoa mice. Twoty male mice which has age about 2 months with wight 20 – 25 g were divided into four groups. The extract was provided orally daily until the 20 th day. At 21th day were sacrificed and determine of consentration and motility. The result of the research showed that the extract of Ocimum sanctum L leaves that being given during 20 days with the dosage of 50 mg/g body weight, 100 mg/g bw, and 250 mg/g bw could signifi increase the consentration and motility spermatozoa mice.

  14. Radioautographic DNA-synthesis study on mice mus musculus gingival epithelium

    International Nuclear Information System (INIS)

    Silveira Tarelho, Z.V. da; Hetem, S.

    1984-01-01

    The DNA-synthetizing cells frequency in the gingival epithelium basal layer of the first lower molar region in young and adult mice of both sexes, using 3H-thymidine and radioautography were studied. The labeled cells frequency and proportion were determined and the data were statiscally analysed. The labeled cells frenquency is higher in female than in male animals, but difference is statiscally significant for adult animals only; this result suggests a hormonal influence, possibly of estrogen on the epithelial tissue. (Author) [pt

  15. Skin mites in mice (Mus musculus): high prevalence of Myobia sp. (Acari, Arachnida) in Robertsonian mice.

    Science.gov (United States)

    Sastre, Natalia; Calvete, Oriol; Martínez-Vargas, Jessica; Medarde, Nuria; Casellas, Joaquim; Altet, Laura; Sánchez, Armand; Francino, Olga; Ventura, Jacint

    2018-05-04

    Myobia sp. and Demodex sp. are two skin mites that infest mice, particularly immunodeficient or transgenic lab mice. In the present study, wild house mice from five localities from the Barcelona Roberstonian system were analysed in order to detect skin mites and compare their prevalence between standard (2n = 40) and Robertsonian mice (2n > 40). We found and identified skin mites through real-time qPCR by comparing sequences from the mitochondrial 16S rRNA and the nuclear 18S rRNA genes since no sequences are available so far using the mitochondrial gene. Fourteen positive samples were identified as Myobia musculi except for a deletion of 296 bp out to 465 bp sequenced, and one sample was identified as Demodex canis. Sampling one body site, the mite prevalence in standard and Robertsonian mice was 0 and 26%, respectively. The malfunction of the immune system elicits an overgrowth of skin mites and consequently leads to diseases such as canine demodicosis in dogs or rosacea in humans. In immunosuppressed mice, the probability of developing demodicosis is higher than in healthy mice. Since six murine toll-like receptors (TLRs) are located in four chromosomes affected by Robertsonian fusions, we cannot dismiss that differences in mite prevalence could be the consequence of the interruption of TLR function. Although ecological and/or morphological factors cannot be disregarded to explain differences in mite prevalence, the detection of translocation breakpoints in TLR genes or the analysis of TLR gene expression are needed to elucidate how Robertsonian fusions affect the immune system in mice.

  16. MORFOLOGI FETUS MENCIT (MUS MUSCULUS L. SETELAH PEMBERIAN EKSTRAK DAUN SAMBILOTO (ANDROGRAPHIS PANICULATA NEES

    Directory of Open Access Journals (Sweden)

    IRIANI SETYAWATI

    2014-08-01

    Full Text Available This experiment was performed to examine the effects of Andrographis paniculata Nees leaves extract on foetus morphology if given during organogenesis period. Thirty pregnant mice were randomly divided into 5 groups for teratogenic effects. Extract was given orally by gavage with 0 (as control; 0,004 (equal to one time dose to human; 7,5; 15; and 22,5 g/g body weight/ day. Treatment was given from day 6 to day 13 of gestation (organogenesis period. Foetus were removed on day 18 of gestation by caesarean section. Quantitative data were analyzed with Anova and Duncan's Multiple Range Test. The results showed that teratogenic effects increased in dose-related manner by causing foetus death and resorption, hemorrhage and clubfoot.

  17. PENGARUH PEMBERIAN AIR REBUSAN DAUN UBI JALAR (Ipomea batatas TERHADAP PENINGKATAN JUMLAH TROMBOSIT MENCIT (Mus musculus

    Directory of Open Access Journals (Sweden)

    Rahma Widyastuti

    2016-11-01

    abstract The leaves of sweet potato contains a very high nutritional value, so it can be used as a vegetable and as a herbal remedy. Sweet potato leaves are often found in various regions in Indonesia. This vegetable contains polyphenols that act as antioxidants that fight disease into the body. . In the leaves of sweet potato 100g contains 117 mg of calcium, 1.8 mg iron, 3.5 mg carotene, 7.2 mg vitamin C, 1.6 mg vitamin E and 0.5 mg of vitamin K, B vitamins, beta-carotene, as well as protein. Formulation of the problem of this study was to determine whether there are effects of sweet potato leaves boiled water to increase platelet counts in mice. The purpose of this study was to determine the number of platelets which water is boiled sweet potato leaves and boiled water without being sweet potato leaves in mice. This research was conducted at the Laboratory of Experimental Medicine Faculty Wijaya Kusuma Surabaya and the sample examined in the Hematology Laboratory at the Center for Health Laboratory Surabaya. The number of samples from this study there were 32 mice, 16 mice as a control group and 16 mice as the treatment group. From the results of the levels of the number of platelets in the blood samples of mice known to the average levels of platelet counts after being given water boiled sweet potato leaves as much as 210.5 / mm3 of blood and platelet count levels of mice that were not given water boiled sweet potato leaves as much as 129.7 / mm3 of blood. Statistical analyzes to test differences in the levels of T showed a platelet count between which water is boiled sweet potato leaves and boiled water without being sweet potato leaves, with a value significantly less than 0.05 (5%.   Key word : leaves of sweet potato, the levels of the number of platelets in the blood samples

  18. STUDI HISTOPATOLOGI HATI MENCIT (Mus musculus L. YANG DIINDUKSI PEMANIS BUATAN

    Directory of Open Access Journals (Sweden)

    Y Utomo

    2013-07-01

    Full Text Available Penggunaan pemanis buatan yang semula hanya ditujukan pada produk-produk khusus bagi penderita diabetes, saat ini penggunaannya semakin meluas pada berbagai produk pangan. Oleh karena itu perlu adanya penelitian tentang pengaruh pemberian pemanis buatan terhadap kerusakan organ tubuh khususnya organ hati. Tujuan penelitian ini adalah untuk mengetahui gambaran histopatologi hati pada mencit yang diinduksi pemanis buatan. Penelitian ini merupakan penelitian eksperimental laboratoris dengan rancangan post test randomized control group design. Sebanyak 20 ekor mencit  jantan  galur Balb/c dibagi secara acak menjadi empat kelompok, masing-masing kelompok terdiri dari lima ekor. Kelompok 1 sebagai kelompok kontrol diberi akuades sebagai placebo. Kelompok 2,3, dan 4 berturut-turut diberi  pemanis buatan dengan dosis 5 mg/KgBB, 10 mg/KgBB, dan 15 mg/KgBB. Pemanis buatan diberikan secara oral selama 30 hari. Pada hari ke-31 semua mencit dimatikan untuk diambil organ hatinya. Organ hati selanjutnya dibuat preparat mikroanatomi dan diwarnai dengan HE. Perubahan struktur jaringan hati diamati dan dilakukan penskoran dari 0 sampai 4 berdasarkan derajat perubahannya. Data skor perubahan dianalisis secara deskriptif. Hasil penelitian menunjukkan bahwa kelompok 1 dan 2 derajat kerusakannya hampir sama yaitu skor 1-2, sedangkan kelompok 4 derajat kerusakannya mencapai skor 2-3. Disimpulkan bahwa semakin tinggi dosis pemanis buatan yang diberikan semakin tinggi derajat kerusakan organ hatinya. The use of artificial sweetener was originally aimed at the specific products for diabetics, but today the use of artificial sweetener is widespread in various food to products. Therefore, it is needed a research on the effects of artificial sweeteners to organs damage especially the liver. The purpose of this study was to determine the histopathological picture of the liver of mice induced by artificial sweeteners. This study was a laboratory experimental design with randomized posttest control group design. Twenty male mice strain Balb/c were randomly divided into four groups, each group consisted of five mice. Group 1 as the control group was given distilled water as placebo. Group 2,3, and 4 was given artificial sweeteners with rising doses. Artificial sweetener was given orally for 30 days. On day 31th all mice’s liver were taken to be examined. Liver then was formed as mikroanatomi smear and stained with HE. Change in the structure of the liver tissue was observed and scored from 0 to 4 based on the degree of change. Score changes data were analyzed descriptively. The results showed that group 1 and 2 has almost same degrees of damage with score of 1-2, while group 4 reached a score of 2-3 of damage degree. It can be concluded that the higher dose of artificial sweeteners given the higher degree of damage to the organs.

  19. AKTIVITAS ANALGETIK EKSTRAK ETANOL DAUN MELINJO (Gnetum gnemon L. PADA MENCIT PUTIH (Mus musculus L. JANTAN

    Directory of Open Access Journals (Sweden)

    Safwan

    2016-03-01

    Full Text Available Leaf melinjo (Gnetum gnemon L. contain flavonoids that has the potential to reduce pain by blocking the action of the enzyme cyclooxygenase. This research was aims to determine the effect of ethanol extract of leaf melinjo of the analgesic effect in mice. Twenty-five mice were divided into 5 groups: negative control (CMC Na 0,5%, positive control group (mefenamic acid 1.3 mg / kg and groups melinjo leaf extract (dose of 6.48 mg / kg, 25.92 mg / kg and 51.84 mg / BB on white male mice. Analgesic test were examined by giving pain stimulation to treated animals, such a 55°C heat stimulation. The observation, then at 30, 60, 90 and 120 minutes after administered.The results showed melinjo leaf ethanol extract with a dose of 51.84 mg / kg have analgesic effects is no different significantly with mefenamic acid dose of 1.3 mg / kg body weight (P> 0.05.

  20. Pengaruh Tepung Teripang Pasir (Holothuria Scabra Terhadap Perilaku Seksual dan Kadar Testosteron Darah Mencit (Mus musculus

    Directory of Open Access Journals (Sweden)

    Sarifah Nurjanah

    2009-09-01

    Full Text Available Sea cucumber is generally believed as a natural material that can be used as a tonic food to increase man vitality. The aim of this study was to investigate the effect of sandfish powder on sexual behavior and blood testosterone level of male mice. Method applied in the study was laboratory experimental method. Mature male mice were treated with administration of sandfish powder with three dosage rate of steroid content (10, 30 and 50 ìg/100 g body weight during 12 days, whereas for control treatment were without hormone administration and with the metil testosterone administration. Parameters that were investigated were kissing vagina and mounting for sexual behavior and the blood testosterone level of male mice. It was found that administration of sandfish powder significantly give effect on the number of kissing vagina and mounting compared to control. Administration of 10 ìg/100 g body weight on male mice showed the highest sexual behavior with 25 kissing vagina for and 6 mounting for 30 minutes. Moreover, administration of sandfish powder increased the testosterone level in the male mice blood. This may due to the steroid contained in sandfish powder and nutrition value that increase mice libido. The study proved that the sandfish powder has a potential as a nature aphrodisiac.

  1. Pengaruh Minyak Kelapa Murni Terhadap Peningkatan Stamina Pada Mencit (Mus Musculus)

    OpenAIRE

    Pertiwi, Dwi

    2015-01-01

    Virgin coconut oil is an oil which composed of fatty acid and dominated by medium chain triglyceride (MCT) different from palm oil which dominated by long chain triglyceride (LCT). Virgin coconut oil is rapidly digested and quickly absorbed then go into liver so that it can increase metabolism and stamina. The purpose of this research is to know stamina enhancement effect from virgin coconut oil which compared palm oil with various dose and be given in acute. In this research is use AZMI® ...

  2. Efek ekstrak testis terhadap jumlah implantasi dan jumlah anak pada mencit (Mus musculus

    Directory of Open Access Journals (Sweden)

    Sri Puji Astuti Wahyuningsih

    2012-02-01

    Full Text Available Extract of testis contains the testis specific proteins. The testis proteins may raise immune responses. The immune responses arethe antibodies against testis specific anti-protein. The reaction between the antibodies and the sperms can inhibit fertilization. Thisprocess has contraception effects. This research used 24 female and 20 male mice strain Balb/c. The experiment used the completerandom design with 4 concentration treatments (0, 500, 1000, and 2000 μg extracts of testis and 3 replications. Mice were injected 3times with time interval 21 days. After 15 days from the rising of vaginal plug, 3 mice were dissected and counted the implantation. Theothers mice were waited until delivered of the children. The datas were analyzed by ANOVA and LSD (α = 5%. The results showed thatextract of testis did not influence the amount of implantation at the uterus endometrial, but it decreased the amount of children. Theeffective concentration of extract testis is 2000 μg. So, this study showed that the intraperitoneum injection of the extract of testis hadcontraception effects.

  3. Fraksi Etanol 96% Biji Koro Benguk (Mucuna Pruriens L.) Sebagai Peningkat Kualitas Spermatozoa Mencit (Mus Musculus)

    OpenAIRE

    Winarni, Sri; Judiwati, Rina; Prajogo, Bambang; Hayati, Alfiah

    2011-01-01

    Background: The examination of sperm quality is the main priority for infertility diagnosis. Based on previous study with mice, active ingredient of Mucuna pruriens L. or koro benguk (Papilionaceae), the L-dopa, may affect the quality of spermatozoa.Objective: Research was to study the effect of 96% ethanol fraction Mucuna pruriens seed on spermatozoaquality of mice exposed to 2-Methoxy ethanol. L-dopa in 96% ethanol fraction of M. pruriens seed was 14.7%.Methode: This was an experimental stu...

  4. Female nursing partner choice in a population of wild house mice (Mus musculus domesticus).

    Science.gov (United States)

    Harrison, Nicola; Lindholm, Anna K; Dobay, Akos; Halloran, Olivia; Manser, Andri; König, Barbara

    2018-01-01

    Communal nursing in house mice is an example of cooperation where females pool litters in the same nest and indiscriminately nurse own and other offspring despite potential exploitation. The direct fitness benefits associated with communal nursing shown in laboratory studies suggest it to be a selected component of female house mice reproductive behaviour. However, past studies on communal nursing in free-living populations have debated whether it is a consequence of sharing the same nest or an active choice. Here using data from a long-term study of free-living, wild house mice we investigated individual nursing decisions and determined what factors influenced a female's decision to nurse communally. Females chose to nurse solitarily more often than expected by chance, but the likelihood of nursing solitarily decreased when females had more partners available. While finding no influence of pairwise relatedness on partner choice, we observed that females shared their social environment with genetically similar individuals, suggesting a female's home area consisted of related females, possibly facilitating the evolution of cooperation. Within such a home area females were more likely to nest communally when the general relatedness of her available options was relatively high. Females formed communal nests with females that were familiar through previous associations and had young pups of usually less than 5 days old. Our findings suggest that communal nursing was not a by-product of sharing the same nesting sites, but females choose communal nursing partners from a group of genetically similar females, and ultimately the decision may then depend on the pool of options available. Social partner choice proved to be an integrated part of cooperation among females, and might allow females to reduce the conflict over number of offspring in a communal nest and milk investment towards own and other offspring. We suggest that social partner choice may be a general mechanism to stabilize costly cooperation.

  5. A quantitative study of the second meiotic metaphase in male mice (Mus musculus).

    Science.gov (United States)

    Beatty, R A; Lim, M C; Coulter, V J

    1975-01-01

    Over 11,000 second meiotic metaphase spreads stained for the pericentromeric region have been studied quantitatively in male mice of 14 strains. The sex-chromosome constitution of a cell could be judged objectively if X and Y chromosomes and ploidy were all scored. A bias arose if only Y chromosomes and ploidy were scored but could be corrected statistically. There was no sign of other forms of bias. The original contiguity of X and Y second metaphases in vivo was very occasionally evident in the preparations. Most of the subhaploid aneuploid counts were assumed to be artifactual. The incidence of truly aneuploid second metaphases in 13 strains was estimated as 0.38+/-0.12%. The estimated average rate per chromosome was 0.019+/-0.006%, with a comparable order of magnitude for the sex chromosomes alone. Simultaneous aneuploidy of two or more chromosomes of the haploid set was estimated to be very rare. Of the spreads from 13 strains, 9.6% were polyploid (2N, 3N, 4N) and showed most of the possible combinations of sex chromosomes. Nearly all the polyploid spreads were considered to arise by artifactual cell fusion at the time of second metaphase during the preparative technique, especially of the X and Y daughter-cell products of the first meiotic division. Other modes of origin (true polyploidy, accidental superposition of cells during preparation) were unlikely. The data could be accommodated by a statistical model with only four parameters. It allowed for artifactual fusion mainly between daughter cells but also between non-daughter cells, bias in one scoring method, and bias in the numbers of cells with given ploidy successfully mounted. Current techniques of chromosome preparation were thought to be wholly unsuitable for the recognition of true polyploidy. The artifactual origin of polyploid spreads was borne out by an absence of polyploid spermatozoa in 14 strains. There appeared to be a virtually constant transmission rate of paternal X and Y chromosomes from early meiosis to late blastocyst. The estimated rate of 49.05+/-0.67% with a Y chromosome also estimated the primary sex ratio. There was evidence of polymorphism in autosomal pericentromeric staining in 3 strains. No measure of the numbers of autosomes or sex chromosomes varied significantly between duplicate preparations or between duplicate males of a strain.

  6. Effect of parsley (Petroselinum crispum, Apiaceae) juice against cadmium neurotoxicity in albino mice (Mus musculus).

    Science.gov (United States)

    Maodaa, Saleh N; Allam, Ahmed A; Ajarem, Jamaan; Abdel-Maksoud, Mostafa A; Al-Basher, Gadah I; Wang, Zun Yao

    2016-02-04

    Parsley was employed as an experimental probe to prevent the behavioral, biochemical and morphological changes in the brain tissue of the albino mice following chronic cadmium (Cd) administration. Non-anesthetized adult male mice were given parsley juice (Petroselinum crispum, Apiaceae) daily by gastric intubation at doses of 10 and 20 g/kg/day. The animals were divided into six groups: Group A, mice were exposed to saline; Groups B and C, were given low and high doses of parsley juice, respectively; Group D, mice were exposed to Cd; Groups E and F, were exposed to Cd and concomitantly given low and high doses of parsley, respectively. Cd intoxication can cause behavioral abnormalities, biochemical and histopathological disturbances in treated mice. Parsley juice has significantly improved the Cd-associated behavioral changes, reduced the elevation of lipid peroxidation and normalized the Cd effect on reduced glutathione and peroxidase activities in the brain of treated mice. Histological data have supported these foundations whereas Cd treatment has induced neuronal degeneration, chromatolysis and pyknosis in the cerebrum, cerebellum and medulla oblongata. The low dose (5 g/kg/day) of parsley exhibited beneficial effects in reducing the deleterious changes associated with Cd treatment on the behavior, neurotransmitters level, oxidative stress and brain neurons of the Cd-treated mice.

  7. Lack of genotoxic potential of pesticides, spinosad, imidacloprid and neem oil in mice (Mus musculus).

    Science.gov (United States)

    Saxena, Ankita; Kesari, V P

    2016-03-01

    Pesticides, spinosad, imidacloprid and neem oil are widely used both in residential and agricultural environments because of its broad spectrum insecticidal activity and effectiveness. The present study was undertaken to estimate genotoxicity of formulations of some pesticides in mice. Three pesticides of diverse group studied were spinosad (45% w/v), imidacloprid (17.8%, w/v) and neem oil. Animals were exposed 37, 4.5 and 50 mg kg⁻¹ b.wt. for spinosad, imidacloprid and neem oil, respectively, through oral gavage for 5 consecutive days. A vehicle control group and one positive control (cyclophosphamide; 20 mg kg⁻¹ b. wt.) were also selected. The results showed that cyclophosphamide produced 1.12% micronuclei in mice, as against 0.18 in vehicle control, 0.30 in spinosad, 0.28 in imidacloprid and 0.22% in neem oil, respectively. The gross percentage of chromosomal aberration in mice were 28.5% in cyclophosphamide against 6.5% in vehicle control, 8.0% in spinosad, 9.5% in imidacloprid and 7.0% in neem oil, respectively. The overall findings of the present study revealed that all the three pesticide formulations, imidacloprid, spinosad and neem oil at tested dose did not show any genotoxic effect in mice.

  8. Histopathological effects of Chromium (III Sulfate on Liver and Kidney of Swiss Albino Mice (Mus musculus

    Directory of Open Access Journals (Sweden)

    Iffat Fatima

    2016-08-01

    Full Text Available Chromium (III sulfate has various industrial applications and is widely used in leather industry due to its high tanning properties. Cr (III is required for efficient metabolism of fats and carbohydrates in traces. Various studies have reported that its constant exposure may lead to severe health problems in both animals and humans. In this study, histopathological effect of dietary Cr (III was evaluated on liver and kidneys of rodents. For this purpose, adult Swiss albino mice (n=25 were divided into different treatment and control groups (n=5/group after sufficient acclimatization. After 3 weeks of treatment, animals were sacrificed and observations regarding histopathology of liver and kidneys were made in all treatment groups and compared to control. Microscopy and photography was performed after processing the tissues according to standard protocol of sectioning and staining. Liver cross sections of treated animals showed signs of fibrosis in portal area, and congestion of sinusoid and central vein. Whereas, more pronounced effects of Cr (III toxicity were observed in kidneys. These include mononuclear cell infiltration, necrosis and contraction of glomerulus within Bowman’s capsule. However, No pathological changes were observed in control group. These results support the hypothesis that enhanced level of Cr (III contamination of food can induce both hepatotoxicity and nephrotoxicity. These basic findings prove that currently increasing levels of trivalent chromium in environment are hazardous to living organisms. Therefore, to avoid health risks to both animals and humans, conversion of toxic chromium waste to less toxic compounds is required. Moreover, exposure level through any route should also be minimized.

  9. PENGARUH PEMBERIAN “KOMBUCHA” TEH ROSELLA TERHADAP PROFIL DARAH MENCIT (Mus musculus L

    Directory of Open Access Journals (Sweden)

    Mukhani Dwi Hidayanti

    2015-02-01

    dan hemoglobin, serta penurunan jumlah leukosit mencit akibat perlakuan “Kombucha” teh rosella pada ketiga dosis dibanding kontrol. Kata kunci: “Kombucha”, rosella, teh fermentasi, profil darah, mencit

  10. Phagocytic Index of Peritoneal Macrophages after Propolis Suplementation in Mice (Mus musculus

    Directory of Open Access Journals (Sweden)

    Siti Eva Mustafiah

    2011-12-01

    Design and Method: This research is an experiment with post test study design randomized control group design. This study used mice that were divided into four groups randomly. The first group / Group-I were for negative control (standard feed and aquadest; The second group/Group-II were fed standard-feed, aquadest, and propolis at a dose of 1.25 mg/kgBM; the third group/group-III were fed standard-feed, water, and propolis at a dose of 2.5 mg/KgBM; The fourth group/Group-IV were fed standard feed, water, and propolis at a dose of 5 mg/KgBM. Treatment where conducted for 3 days. Result: The average macrophage phagocytic index, were at the highest level of it (7.82 1.63 while the lowest one were the first group 3.43 0.13. The Kruskall Wallis result stated that there is index difference among various groups with p 0.002 (p < 0.05. Conclusion: Propolis effected on mice peritoneal macrophage phagocytosis index (Sains Medika, 3(2:121-128.

  11. Effect of administering black cumin (Nigella sativa) toward postpartum mice (MusMusculus L.)

    Science.gov (United States)

    Imelda, F.; Darti, N. A.

    2018-03-01

    The period of childbirth is a period for the health provider monitoring that less monitoring can cause the mother to suffer a variety of problemsandcomplications during childbirth such as post-partum infections. This type of research was an experimental group P0: control group, treatment groups by administering Nigella sativa P1:2.6mg/day, P2:3.9mg/day, P3:5.2mg/day, and P4:6.5mg/day, which each group 5 samples. The average amount of leukocytes after given Nigella sativa 2.6mg/day for seven days (P1) which was 7:10±0:57 (x103cells/mm3), and at least in female mice after given Nigella sativa 6.5mg/day for sevendays (P4) which was 6.62±0.52 (x103cells/mm3). The average amount lymphocytes after given Nigella sativa 2.6mg/day for seven days (P1) which was 63.40±4.77 (x103cells/mm3), and least in female mice after given Nigella sativa 3.9 mg/day for seven days (P3) which was 47.00±14:58 (x103cells/mm3). Amount of monocytes after given Nigella sativa 5.2mg/day for seven days (P3) which was 5.40±0.55 (x103cells/mm3), and least in female mice after given Nigella sativa 2.6mg/day for seven days (P1) which was 4.80±1.30 (x103cells/mm3).

  12. Radioautographic study of DNA synthesis on gingival epithelium of mice Mus musculus

    International Nuclear Information System (INIS)

    Silveira Tarelho, Z.V. da; Hetem, S.

    1985-01-01

    The frequency of DNA-sinthetizing cells in the basal layer of the gingival epithelium of the first lower molar region of young and adult mice of both sexes was studied using 3 H-thymidine and radioautography. (M.A.C.) [pt

  13. Evaluation of Acute toxicity of Lambda Cyhalothrin in Mus musculus L.

    Science.gov (United States)

    Tomar, Monika; Kumar, Ajay; Kataria, Sudhir Kumar

    2015-08-01

    Lambda Cyhalothrin (LCT) is a type II synthetic pyrethroid widely used in agriculture, home pest control and protection of food stuff. Here, we evaluated its toxicity on biochemical parameters (Total protein, Acetyl cholinesterase, RNA and DNA) and liver histological alteration in mice after 24 h of oral administration @ 25, 50 and 75% of LD50 i.e.; 26.49 mg/kg/body wt. Distilled water (DW) and Cyclophosphamide (CP @ 40 mg/kg/body wt.) were used as negative and positive control; respectively. LCT treated mice showed significant decrease in total protein (P < 0.01), acetyl cholinesterase (P < 0.001) and DNA (P < 0.001) in a dose dependent manner. On the contrary, RNA content showed significant increase (P < 0.01) at 50% of LD50 of LCT. Histological observations of the mice liver showed vascular congestion and hepatocyte degeneration with 6.63 mg/kg/body wt. of LCT; and accumulation of RBCs with sinusoid degeneration and wide necrotic area with pyknosis with 13.25 and 19.88 mg/kg/body wt., respectively. The results demonstrated LCT induced biochemical changes and hepatotoxicity in female mice.

  14. Genetics of alkaline phosphatase of the small intestine of the house mouser (Mus musculus).

    Science.gov (United States)

    Wilcox, F H

    1983-08-01

    Four inbred strains of mice exhibited either slow (PL/J), intermediate (DBA/2J, LP/J), or fast (SWR/J) rates of migration of duodenal alkaline phosphatase on cellulose acetate electrophoresis. Hybrids of these strains also had intermediate rates of migration regardless of the combination of strains used as parents. Strain differences were present in all regions of the small but not the large intestine. Crosses of the PL/J strain to hybrids between this strain and the other three strains gave a 1:1 segregation of the slow and intermediate patterns. The symbol Akp-3 is proposed for the locus responsible for the slower migration of the enzyme in this strain. Data from the LP/J X PL/J hybrid crossed with the PL/J strain showed linkage with two loci on chromosome 1 as follows: centromere--Idh-1--13.8 cM--Akp-3--8.9 +/- 2.6 cM--Pep-3. The available data do not reveal the genetic basis for the faster migration rate of the enzyme from the SWR/J strain, but a different response to neuraminidase and apparent nonlinkage to the Pep-3 locus suggest that a locus other than Akp-3 is responsible.

  15. Tartrazine induced changes in physiological and biochemical parameters in Swiss albino mice, Mus musculus

    OpenAIRE

    Arefin, Sayema; Hossain, Mohammad Salim; Akter Neshe, Shamme; Rashid, Md. Mamun Or; Amin, Mohammad Tohidul; Hussain, Md. Saddam

    2017-01-01

    Now-a-days synthetic food dyes are being used most commonly as food colorant in confectionaries, drugs and cosmetics. Present study was designed to evaluate the toxic effect of tartrazine, a widely used azo dye, on Swiss Albino mice. Experimental animals were treated with tested dye at a dose level 200mg/kg & 400mg/kg body weight along with normal diet. Various physiological and biochemical parameters were assessed to study the toxic effect of tartrazine. Our study rev...

  16. Macroscopic description of the coronary arteries in Swiss albino mice (Mus musculus

    Directory of Open Access Journals (Sweden)

    A. Yoldas

    2010-05-01

    Full Text Available A total of 25 (13 male, 12 female adult, healthy Swiss albino mice were used to investigate the origin, course and anastomoses of coronary arteries. Coloured latex was injected into the aortic arch to enable these arteries to be clearly discerned. A. coronaria sinistra was larger than A. coronaria dextra. It was divided into a Ramus interventricularis paraconalis and a Ramus circumflexus sinister. However, in 2 specimens, the septal ramus, was observed to stem directly from the left coronary artery, and only 1 ventricular branch arose from the left circumflex. The collateral branches of the paraconal interventricular ramus had a larger diameter and more extensive distribution was observed in these specimens. The A. coronaria dextra was divided into a Ramus septalis and Ramus circumflexus dexter. The Ramus interventricularis subsinuosis was not detected in this study. The ventricular branches of the left coronary artery run intramyocardially whereas the branches of the right coronary artery course subendocardially.

  17. UJI TOKSISITAS AKUT EKSTRAK DAUN PSIDIUM GUAVA LINN (DAUN JAMBU BIJI TERHADAP MENCIT (MUS MUSCULUS

    Directory of Open Access Journals (Sweden)

    Amiyatun Naini

    2015-09-01

    Full Text Available The Psidium guava Linn leaf extract as mouthrinse has been suggested to be used against toothache, and also has suggested effect against diarrhea and vomiting, as well as anti spasmodic and rheumatic symptoms, anti inflammation, anti piretic, analgetic, and anti bacterial activity. However, to consider potential side effects, this work aimed to test the acute toxicity of guava leaf extract. For this purpose guava leaf extract was given orally to to groups of ten mice each at a doses of 1.25g, 2.5, 5, 10 and 21 g/kg body weight in a suspension with CMC Na 0,5%. Ten mice were used as control with a dose of 1 ml CMC Na 0,5%. The results suggest no acute toxicity to mice, since even the biggest dose given (show no measurable value of LD 50. It could be concluded that guava leaf extract shows no acute toxicity to mice at tested concentrations.

  18. Isolation of three novel rat and mouse papillomaviruses and their genomic characterization.

    Directory of Open Access Journals (Sweden)

    Eric Schulz

    Full Text Available Despite a growing knowledge about the biological diversity of papillomaviruses (PV, only little is known about non-human PV in general and about PV mice models in particular. We cloned and sequenced the complete genomes of two novel PV types from the Norway rat (Rattus norvegicus; RnPV2 and the wood mouse (Apodemus sylvaticus; AsPV1 as well as a novel variant of the recently described MmuPV1 (originally designated as MusPV from a house mouse (Mus musculus; MmuPV1 variant. In addition, we conducted phylogenetic analyses using a systematically representative set of 79 PV types, including the novel sequences. As inferred from concatenated amino acid sequences of six proteins, MmuPV1 variant and AsPV1 nested within the Beta+Xi-PV super taxon as members of the Pi-PV. RnPV2 is a member of the Iota-PV that has a distant phylogenetic position from Pi-PV. The phylogenetic results support a complex scenario of PV diversification driven by different evolutionary forces including co-divergence with hosts and adaptive radiations to new environments. PV types particularly isolated from mice and rats are the basis for new animal models, which are valuable to study PV induced tumors and new treatment options.

  19. Cryptosporidium tyzzeri and Cryptosporidium muris originated from wild West-European house mice (Mus musculus domesticus) and East-European house mice (Mus musculus musculus) are non-infectious for pigs

    Czech Academy of Sciences Publication Activity Database

    Kváč, Martin; Kestřánová, M.; Květoňová, Dana; Kotková, M.; Ortega, Y.; McEvoy, J.; Sak, Bohumil

    2012-01-01

    Roč. 131, č. 1 (2012), s. 107-110 ISSN 0014-4894 R&D Projects: GA MŠk(CZ) LH11061 Grant - others:GA ČR(CZ) GA206/08/0640 Program:GA Institutional support: RVO:60077344 Keywords : Pigs * Cryptosporidium tyzzeri * Cryptosporidium muris * Experimental infection * PCR * Histology Subject RIV: GJ - Animal Vermins ; Diseases, Veterinary Medicine Impact factor: 2.154, year: 2012 http://www.sciencedirect.com/science/article/pii/S0014489412001105

  20. Characterization of a male reproductive transcriptome for Peromyscus eremicus (Cactus mouse

    Directory of Open Access Journals (Sweden)

    Lauren L. Kordonowy

    2016-10-01

    Full Text Available Rodents of the genus Peromyscus have become increasingly utilized models for investigations into adaptive biology. This genus is particularly powerful for research linking genetics with adaptive physiology or behaviors, and recent research has capitalized on the unique opportunities afforded by the ecological diversity of these rodents. Well characterized genomic and transcriptomic data is intrinsic to explorations of the genetic architecture responsible for ecological adaptations. Therefore, this study characterizes the transcriptome of three male reproductive tissues (testes, epididymis and vas deferens of Peromyscus eremicus (Cactus mouse, a desert specialist. The transcriptome assembly process was optimized in order to produce a high quality and substantially complete annotated transcriptome. This composite transcriptome was generated to characterize the expressed transcripts in the male reproductive tract of P. eremicus, which will serve as a crucial resource for future research investigating our hypothesis that the male Cactus mouse possesses an adaptive reproductive phenotype to mitigate water-loss from ejaculate. This study reports genes under positive selection in the male Cactus mouse reproductive transcriptome relative to transcriptomes from Peromyscus maniculatus (deer mouse and Mus musculus. Thus, this study expands upon existing genetic research in this species, and we provide a high quality transcriptome to enable further explorations of our proposed hypothesis for male Cactus mouse reproductive adaptations to minimize seminal fluid loss.

  1. NCBI nr-aa BLAST: CBRC-CINT-01-0186 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0186 ref|NP_083045.3| synovial apoptosis inhibitor 1, synoviolin [Mus ...musculus] sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin precursor (Synovial apoptosis inhibit...or 1) gb|AAH42199.1| Synovial apoptosis inhibitor 1, synoviolin [Mus musculus] gb|AAH57917.1| Synovial apoptosis inhibitor 1, synovio...lin [Mus musculus] gb|AAH80722.1| Synovial apoptosis inhibitor 1, synoviolin... [Mus musculus] gb|EDL33195.1| synovial apoptosis inhibitor 1, synoviolin, isoform CRA_b [Mus musculus] NP_083045.3 1e-167 51% ...

  2. NCBI nr-aa BLAST: CBRC-CJAC-01-1133 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1133 ref|NP_068677.2| hairless protein [Mus musculus] sp|Q61645|HAIR_MOUSE Protein hair...less gb|AAH49182.1| Hairless [Mus musculus] gb|EDL35888.1| hairless, isoform CRA_a [Mus musculus] gb|EDL35889.1| hai...rless, isoform CRA_a [Mus musculus] gb|EDL35890.1| hairless, isoform CRA_a [Mus musculus] NP_068677.2 5.1 44% ...

  3. Prdm9 incompatibility controls oligospermia and delayed fertility but no selfish transmission in mouse intersubspecific hybrids.

    Science.gov (United States)

    Flachs, Petr; Bhattacharyya, Tanmoy; Mihola, Ondřej; Piálek, Jaroslav; Forejt, Jiří; Trachtulec, Zdenek

    2014-01-01

    PR-domain 9 (Prdm9) is the first hybrid sterility gene identified in mammals. The incompatibility between Prdm9 from Mus musculus domesticus (Mmd; the B6 strain) and the Hstx2 region of chromosome (Chr) X from M. m. musculus (Mmm; the PWD strain) participates in the complete meiotic arrest of mouse intersubspecific (PWD×B6)F1 hybrid males. Other studies suggest that also semisterile intersubspecific hybrids are relevant for mouse speciation, but the genes responsible remain unknown. To investigate the causes of this semisterility, we analyzed the role of Prdm9 and Chr X in hybrids resulting from the crosses of PWK, another Mmm-derived inbred strain. We demonstrate that Prdm9 and Chr X control the partial meiotic arrest and reduced sperm count in (PWK×B6)F1 males. Asynapsis of heterosubspecific chromosomes and semisterility were partially suppressed by removal of the B6 allele of Prdm9. Polymorphisms between PWK and PWD on Chr X but not in the Prdm9 region were responsible for the modification of the outcome of Prdm9-Chr X F1 hybrid incompatibility. Furthermore, (PWK×B6)F1 hybrid males displayed delayed fertility dependent on the Prdm9 incompatibility. While the Drosophila hybrid sterility gene Overdrive causes both delayed fertility and increased transmission of its own chromosome to the offspring, the segregation of Chr X and the Prdm9 region from the mouse (PWK×B6)F1 males was normal. Our results indicate extended functional consequences of Prdm9-Chr X intersubspecific incompatibility on the fertility of hybrids and should influence the design of fertility analyses in hybrid zones and of laboratory crosses between Mmm and Mmd strains.

  4. Prdm9 incompatibility controls oligospermia and delayed fertility but no selfish transmission in mouse intersubspecific hybrids.

    Directory of Open Access Journals (Sweden)

    Petr Flachs

    Full Text Available PR-domain 9 (Prdm9 is the first hybrid sterility gene identified in mammals. The incompatibility between Prdm9 from Mus musculus domesticus (Mmd; the B6 strain and the Hstx2 region of chromosome (Chr X from M. m. musculus (Mmm; the PWD strain participates in the complete meiotic arrest of mouse intersubspecific (PWD×B6F1 hybrid males. Other studies suggest that also semisterile intersubspecific hybrids are relevant for mouse speciation, but the genes responsible remain unknown. To investigate the causes of this semisterility, we analyzed the role of Prdm9 and Chr X in hybrids resulting from the crosses of PWK, another Mmm-derived inbred strain. We demonstrate that Prdm9 and Chr X control the partial meiotic arrest and reduced sperm count in (PWK×B6F1 males. Asynapsis of heterosubspecific chromosomes and semisterility were partially suppressed by removal of the B6 allele of Prdm9. Polymorphisms between PWK and PWD on Chr X but not in the Prdm9 region were responsible for the modification of the outcome of Prdm9-Chr X F1 hybrid incompatibility. Furthermore, (PWK×B6F1 hybrid males displayed delayed fertility dependent on the Prdm9 incompatibility. While the Drosophila hybrid sterility gene Overdrive causes both delayed fertility and increased transmission of its own chromosome to the offspring, the segregation of Chr X and the Prdm9 region from the mouse (PWK×B6F1 males was normal. Our results indicate extended functional consequences of Prdm9-Chr X intersubspecific incompatibility on the fertility of hybrids and should influence the design of fertility analyses in hybrid zones and of laboratory crosses between Mmm and Mmd strains.

  5. Imaging of Chromosome Dynamics in Mouse Testis Tissue by Immuno-FISH.

    Science.gov (United States)

    Scherthan, Harry

    2017-01-01

    The mouse (Mus musculus) represents the central mammalian genetic model system for biomedical and developmental research. Mutant mouse models have provided important insights into chromosome dynamics during the complex meiotic differentiation program that compensates for the genome doubling at fertilization. Homologous chromosomes (homologues) undergo dynamic pairing and recombine during first meiotic prophase before they become partitioned into four haploid sets by two consecutive meiotic divisions that lack an intervening S-phase. Fluorescence in situ hybridization (FISH) has been instrumental in the visualization and imaging of the dynamic reshaping of chromosome territories and mobility during prophase I, in which meiotic telomeres were found to act as pacemakers for the chromosome pairing dance. FISH combined with immunofluorescence (IF) co-staining of nuclear proteins has been instrumental for the visualization and imaging of mammalian meiotic chromosome behavior. This chapter describes FISH and IF methods for the analysis of chromosome dynamics in nuclei of paraffin-embedded mouse testes. The techniques have proven useful for fresh and archived paraffin testis material of several mammalian species.

  6. The Robertsonian phenomenon in the house mouse: mutation, meiosis and speciation.

    Science.gov (United States)

    Garagna, Silvia; Page, Jesus; Fernandez-Donoso, Raul; Zuccotti, Maurizio; Searle, Jeremy B

    2014-12-01

    Many different chromosomal races with reduced chromosome number due to the presence of Robertsonian fusion metacentrics have been described in western Europe and northern Africa, within the distribution area of the western house mouse Mus musculus domesticus. This subspecies of house mouse has become the ideal model for studies to elucidate the processes of chromosome mutation and fixation that lead to the formation of chromosomal races and for studies on the impact of chromosome heterozygosities on reproductive isolation and speciation. In this review, we briefly describe the history of the discovery of the first and subsequent metacentric races in house mice; then, we focus on the molecular composition of the centromeric regions involved in chromosome fusion to examine the molecular characteristics that may explain the great variability of the karyotype that house mice show. The influence that metacentrics exert on the nuclear architecture of the male meiocytes and the consequences on meiotic progression are described to illustrate the impact that chromosomal heterozygosities exert on fertility of house mice-of relevance to reproductive isolation and speciation. The evolutionary significance of the Robertsonian phenomenon in the house mouse is discussed in the final section of this review.

  7. Predictive validity of a non-induced mouse model of compulsive-like behavior

    NARCIS (Netherlands)

    Greene-Schloesser, D. M.; Van der Zee, E. A.; Sheppard, D. K.; Castillo, M. R.; Gregg, K. A.; Burrow, T.; Foltz, H.; Slater, M.; Bult-Ito, A.

    2011-01-01

    A key to advancing the understanding of obsessive-compulsive disorder (OCD)-like symptoms is the development of spontaneous animal models. Over 55 generations of bidirectional selection for nest-building behavior in house mice, Mus musculus, resulted in a 40-fold difference in the amount of cotton

  8. 76 FR 20706 - South Farallon Islands Nonnative Mouse Eradication Project; Farallon National Wildlife Refuge...

    Science.gov (United States)

    2011-04-13

    ... Noonday Rock. In 1969 the Refuge was expanded to include the South Farallon Islands and is still managed... eradicate nonnative mice from the South Farallon Islands, part of the Farallon National Wildlife Refuge off... eradicate nonnative house mice (Mus musculus) from the South Farallon Islands. The purpose of this project...

  9. Genome-wide architecture of reproductive isolation in a naturally occurring hybrid zone between Mus musculus musculus and M. m. domesticus

    Czech Academy of Sciences Publication Activity Database

    Janoušek, V.; Wang, L.; Luzynski, K.; Dufková, Petra; Mrkvicová Vyskočilová, Martina; Nachman, M. W.; Munclinger, P.; Macholán, Miloš; Piálek, Jaroslav; Tucker, P. K.

    2012-01-01

    Roč. 21, č. 12 (2012), s. 3032-3047 ISSN 0962-1083 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : genomics * proteomics * hybridization * mammals * speciation Subject RIV: EG - Zoology Impact factor: 6.275, year: 2012

  10. Hybrid Sterility Locus on Chromosome X Controls Meiotic Recombination Rate in Mouse.

    Directory of Open Access Journals (Sweden)

    Maria Balcova

    2016-04-01

    Full Text Available Meiotic recombination safeguards proper segregation of homologous chromosomes into gametes, affects genetic variation within species, and contributes to meiotic chromosome recognition, pairing and synapsis. The Prdm9 gene has a dual role, it controls meiotic recombination by determining the genomic position of crossover hotspots and, in infertile hybrids of house mouse subspecies Mus m. musculus (Mmm and Mus m. domesticus (Mmd, it further functions as the major hybrid sterility gene. In the latter role Prdm9 interacts with the hybrid sterility X 2 (Hstx2 genomic locus on Chromosome X (Chr X by a still unknown mechanism. Here we investigated the meiotic recombination rate at the genome-wide level and its possible relation to hybrid sterility. Using immunofluorescence microscopy we quantified the foci of MLH1 DNA mismatch repair protein, the cytological counterparts of reciprocal crossovers, in a panel of inter-subspecific chromosome substitution strains. Two autosomes, Chr 7 and Chr 11, significantly modified the meiotic recombination rate, yet the strongest modifier, designated meiotic recombination 1, Meir1, emerged in the 4.7 Mb Hstx2 genomic locus on Chr X. The male-limited transgressive effect of Meir1 on recombination rate parallels the male-limited transgressive role of Hstx2 in hybrid male sterility. Thus, both genetic factors, the Prdm9 gene and the Hstx2/Meir1 genomic locus, indicate a link between meiotic recombination and hybrid sterility. A strong female-specific modifier of meiotic recombination rate with the effect opposite to Meir1 was localized on Chr X, distally to Meir1. Mapping Meir1 to a narrow candidate interval on Chr X is an important first step towards positional cloning of the respective gene(s responsible for variation in the global recombination rate between closely related mouse subspecies.

  11. Hybrid Sterility Locus on Chromosome X Controls Meiotic Recombination Rate in Mouse.

    Science.gov (United States)

    Balcova, Maria; Faltusova, Barbora; Gergelits, Vaclav; Bhattacharyya, Tanmoy; Mihola, Ondrej; Trachtulec, Zdenek; Knopf, Corinna; Fotopulosova, Vladana; Chvatalova, Irena; Gregorova, Sona; Forejt, Jiri

    2016-04-01

    Meiotic recombination safeguards proper segregation of homologous chromosomes into gametes, affects genetic variation within species, and contributes to meiotic chromosome recognition, pairing and synapsis. The Prdm9 gene has a dual role, it controls meiotic recombination by determining the genomic position of crossover hotspots and, in infertile hybrids of house mouse subspecies Mus m. musculus (Mmm) and Mus m. domesticus (Mmd), it further functions as the major hybrid sterility gene. In the latter role Prdm9 interacts with the hybrid sterility X 2 (Hstx2) genomic locus on Chromosome X (Chr X) by a still unknown mechanism. Here we investigated the meiotic recombination rate at the genome-wide level and its possible relation to hybrid sterility. Using immunofluorescence microscopy we quantified the foci of MLH1 DNA mismatch repair protein, the cytological counterparts of reciprocal crossovers, in a panel of inter-subspecific chromosome substitution strains. Two autosomes, Chr 7 and Chr 11, significantly modified the meiotic recombination rate, yet the strongest modifier, designated meiotic recombination 1, Meir1, emerged in the 4.7 Mb Hstx2 genomic locus on Chr X. The male-limited transgressive effect of Meir1 on recombination rate parallels the male-limited transgressive role of Hstx2 in hybrid male sterility. Thus, both genetic factors, the Prdm9 gene and the Hstx2/Meir1 genomic locus, indicate a link between meiotic recombination and hybrid sterility. A strong female-specific modifier of meiotic recombination rate with the effect opposite to Meir1 was localized on Chr X, distally to Meir1. Mapping Meir1 to a narrow candidate interval on Chr X is an important first step towards positional cloning of the respective gene(s) responsible for variation in the global recombination rate between closely related mouse subspecies.

  12. Metabolic profiles in serum of mouse after chronic exposure to drinking water.

    Science.gov (United States)

    Zhang, Yan; Wu, Bing; Zhang, Xuxiang; Li, Aimin; Cheng, Shupei

    2011-08-01

    The toxicity of Nanjing drinking water on mouse (Mus musculus) was detected by (1)H nuclear magnetic resonance (NMR)-based metabonomic method. Three groups of mice were fed with drinking water (produced by Nanjing BHK Water Plant), 3.8 μg/L benzo(a)pyrene as contrast, and clean water as control, respectively, for 90 days. It was observed that the levels of lactate, alanine, and creatinine in the mice fed with drinking water were increased and that of valine was decreased. The mice of drinking water group were successfully separated from control. The total concentrations of polycyclic aromatic hydrocarbons (PAHs), phthalates (PAEs), and other organic pollutants in the drinking water were 0.23 μg/L, 4.57 μg/L, and 0.34 μg/L, respectively. In this study, Nanjing drinking water was found to induce distinct perturbations of metabolic profiles on mouse including disorders of glucose-alanine cycle, branched-chain amino acid and energy metabolism, and dysfunction of kidney. This study suggests that metabonomic method is feasible and sensitive to evaluate potential toxic effects of drinking water.

  13. Gastrointestinal microbiota of wild and inbred individuals of two house mouse subspecies assessed using high-throughput parallel pyrosequencing

    Czech Academy of Sciences Publication Activity Database

    Kreisinger, Jakub; Čížková, Dagmar; Vohánka, J.; Piálek, Jaroslav

    2014-01-01

    Roč. 23, č. 20 (2014), s. 5048-5060 ISSN 0962-1083 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 Keywords : domestication * hybrid zone * metagenomics * microbiome * Mus musculus * symbiosis Subject RIV: EG - Zoology Impact factor: 6.494, year: 2014

  14. Hyperelastic Material Properties of Mouse Skin under Compression.

    Directory of Open Access Journals (Sweden)

    Yuxiang Wang

    Full Text Available The skin is a dynamic organ whose complex material properties are capable of withstanding continuous mechanical stress while accommodating insults and organism growth. Moreover, synchronized hair cycles, comprising waves of hair growth, regression and rest, are accompanied by dramatic fluctuations in skin thickness in mice. Whether such structural changes alter skin mechanics is unknown. Mouse models are extensively used to study skin biology and pathophysiology, including aging, UV-induced skin damage and somatosensory signaling. As the skin serves a pivotal role in the transfer function from sensory stimuli to neuronal signaling, we sought to define the mechanical properties of mouse skin over a range of normal physiological states. Skin thickness, stiffness and modulus were quantitatively surveyed in adult, female mice (Mus musculus. These measures were analyzed under uniaxial compression, which is relevant for touch reception and compression injuries, rather than tension, which is typically used to analyze skin mechanics. Compression tests were performed with 105 full-thickness, freshly isolated specimens from the hairy skin of the hind limb. Physiological variables included body weight, hair-cycle stage, maturity level, skin site and individual animal differences. Skin thickness and stiffness were dominated by hair-cycle stage at young (6-10 weeks and intermediate (13-19 weeks adult ages but by body weight in mature mice (26-34 weeks. Interestingly, stiffness varied inversely with thickness so that hyperelastic modulus was consistent across hair-cycle stages and body weights. By contrast, the mechanics of hairy skin differs markedly with anatomical location. In particular, skin containing fascial structures such as nerves and blood vessels showed significantly greater modulus than adjacent sites. Collectively, this systematic survey indicates that, although its structure changes dramatically throughout adult life, mouse skin at a given

  15. Intraluminar testicular colonization and differentiation of the inner cell mass in mice (Mus Musculus Colonización intraluminar testicular y diferenciación de la masa celular interna en ratones (Mus musculus

    Directory of Open Access Journals (Sweden)

    Láyonal Acosta

    2012-02-01

    Full Text Available Primordial germ cells (PGC`s are transplanted to testicle of other individual of the same species, they colonize the lumen of the seminiferous tubules, seeking a niche to differentiate into sperm. Our objective was to evaluate the intraluminal colonization of a suspension of cells in the inner cell mass (IMC`s of blastocysts obtained from mice, using a novel technique. It was transplanted a suspension of ICM by mean of inmunosurgery into the rete testis of recipient animals which were previously treated with cyclophosphamide to reduce their own spermatogenesis. We confirmed the presence of intraluminal minitubules in 2 of 100 seminiferous tubules, demonstrating that transplantation of a suspension of cells from the inner cell mass can colonize the seminiferous tubules and also maintain a synchronously xenogenic spermatogenesis with the receiver.Cuando las células germinales primordiales (CGPs son trasplantadas al testículo de otro individuo de la misma especie; colonizan el lumen de los túbulos seminíferos, buscando su nicho para diferenciarse en espermatozoides. Nuestro objetivo fue evaluar la colonización intraluminal de una suspensión de células de la masa celular interna (MCI obtenidas de blastocistos de ratones. Una suspensión de MCI obtenidos mediante una inmunocirugía en la red testicular de animales tratados previamente con ciclofosfamida para disminuir su propia espermatogénesis fueron trasladados a animales receptores. Se comprobó la presencia de minitúbulos intraluminales en 2 de 100 túbulos seminíferos, lo que demuestra que el trasplante de una suspensión de células de la masa celular interna pueden colonizar los túbulos seminíferos y además mantener una espermatogénesis xenogénica de manera sincrónica con el receptor.

  16. AcEST: DK950322 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 19 OS=Mus mus... 34 0.62 >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms...YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms...ith multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 87.0 bits (214), Expect = 8

  17. Estrogenic Effect of 70% Ethanol Turmeric (Curcuma domestica Val. Extract on Ovariectomized Female Mice (Mus musculus L.

    Directory of Open Access Journals (Sweden)

    A.N. Dewi

    2007-11-01

    Full Text Available The influence of extract turmeric (Curcuma domestica Val. on endometrium thickness, vaginal epithelium, mammary gland, and protein of estrogen receptor of ovariectomized mice was examined. Twenty five ovariectomized mice which were divided into five groups, were treated by ethynilestradiol (8,4 x 10-3 g, aquades (10 ml, and turmeric extract at doses 230 mg/kg b.w.; 310 mg/kg b.w.; and 390 mg/kg b.w. for eight days. At the end of experiments the mice were killed, then the uterus, vagina, and mammae were removed and the wet weight of uterus was recorded. Uterus, vagina, and mammae were examined histologically. Estrogen receptor protein from uterus were analized by using SDS-PAGE. One way anava test showed that turmeric extract at doses 310 mg/kg b.w. and 390 mg/kg b.w give estrogenic effect on vaginal ephitelium, endometrium thickness, and diametre of mammary glands. SDS-PAGE analysis showed there were differences in protein concentration between control and treatment groups which were seen in the thickness of the bands. Estrogen receptor band could be detected in sampel of treatment groups at molecular weight 45 kDa.

  18. Effects of social stress and intrauterine position on sexual phenotype in wild-type house mice (Mus musculus)

    Science.gov (United States)

    William J. Zielinski; John G. Vandenbergh; Monica M. Montano

    1991-01-01

    Wild-type house mice were used to test the effect of intrauterine position on anogenital distance (AGD) and to verify whether crowding stress would masculinize female pups, developing at all intrauterine positions, as has been demonstrated in CF-1 mice stressed by restraint, heat, and...

  19. Toxicological evaluation in silico and in vivo of secondary metabolites of Cissampelos sympodialis in Mus musculus mice following inhalation.

    Science.gov (United States)

    Alves, Mateus Feitosa; Ferreira, Larissa Adilis Maria Paiva; Gadelha, Francisco Allysson Assis Ferreira; Ferreira, Laércia Karla Diega Paiva; Felix, Mayara Barbalho; Scotti, Marcus Tullius; Scotti, Luciana; de Oliveira, Kardilândia Mendes; Dos Santos, Sócrates Golzio; Diniz, Margareth de Fátima Formiga Melo

    2017-12-04

    The ethanolic extract of the leaves of Cissampelos sympodialis showed great pharmacological potential, with inflammatory and immunomodulatory activities, however, it showed some toxicological effects. Therefore, this study aims to verify the toxicological potential of alkaloids of the genus Cissampelos through in silico methodologies, to develop a method in LC-MS/MS verifying the presence of alkaloids in the infusion and to evaluate the toxicity of the infusion of the leaves of C. sympodialis when inhaled by Swiss mice. Results in silico showed that alkaloid 93 presented high toxicological potential along with the products of its metabolism. LC-MS/MS results showed that the infusion of the leaves of this plant contained the alkaloids warifteine and methylwarifteine. Finally, the in vivo toxicological analysis of the C. sympodialis infusion showed results, both in biochemistry, organ weights and histological analysis, that the infusion of C. sympodialis leaves presents a low toxicity.

  20. Terapi Hiperkolesterol pada Mencit (Mus musculus strain Balb/C Betina Umur 2 Bulan Menggunakan Sari Bawang Putih

    Directory of Open Access Journals (Sweden)

    Muhammad Sungging Pradana

    2017-08-01

    Full Text Available Cholesterol is a waxy substance which is mainly made in the body. Cholesterol can provide benefits. However, having too much cholesterol in the blood can increase risk of cardiovascular disease. Prevention and treatment of cardiovascular disease can be done by taking synthetic drugs such as statin. Due to side effects of synthetic drugs, it is necessary to substitute synthetic drugs with herbal plant and some natural component in these plants. The important ones is garlic. Garlic contain organosulphur compounds such as diallyldisulphide (DADS, dipropyldisulphide (DPDS, diallytrisulphide (DATS and dipropyltrisulphide (DPTS which have anti artherogenic effects. Garlic also have active agent allicin, can reduce the levels of cholesterol. This research was conducted at the Experimental Animal Enclosure Installation, Center for Veterinary Farma Surabaya with 3 experimental groups. Animals used in this research were female mice 2 months old were feeding with high cholesterol feed such as fried offal of chicken twice a day as much 0,5 cc/ day every 3 days. On the 3rd day, the levels of cholesterol in each group was examined. On the 4th day, mice in group 3 were given 1cc of garlic juice. 1 hour later mice was examined blood cholesterol using Strip Test Easy Touch GCU. The results through T-paired test on SPSS stated that (p < 0,05, it means there is influence between the 3 treatment of mice. This results it can be concluded that the provision of garlic juice can reduced blood cholesterol levels in mice after fed with high cholesterol.

  1. EFEK ANTIDIABETES EKSTRAK AIR KULIT BUAH PISANG AMBON (Musa paradisiaca L. TERHADAP MENCIT (Mus musculus MODEL HIPERGLIKEMIA

    Directory of Open Access Journals (Sweden)

    Sri Indrawati

    2015-10-01

    Full Text Available Pisang Ambon (Musa paradisiaca L. is one type of bananas usually consumed by Indonesian people. Besides its flesh which has high nutrition, its peels also has antioxidant activity. Antioxidants has the ability to reduce oxidative damage in people’s body with diabetes mellitus. Therefore, this study aimed to determine the antioxidant activity of the aqueous  extract of Pisang Ambon peels and to determine it’s effective dose as an antidiabetic agent in hyperglycemic mice. This study used male mice which all have been intravenously induced with alloxan at a dose of 50 mg/kgBW. They were then divided into five groups. The first two groups got Na CMC 0.5% (negative control and glibenclamide 0.65 mg/kgBW (positive control, while the other three got  the aqueous  extract of Pisang Ambon peels successively at doses of 400, 800, and 1200 mg/kgBW. The data were statistically analyzed using ANOVA (Analysis of Variance at 95% confidence interval with parameter of blood glucose levels difference between before and after treatment. The results showed that the aqueous extract of Pisang Ambon peels had antidiabetic activity at an effective dose of 400 mg/kgBW in hyperglycemic mice which was comparable to glibenclamide

  2. Efecto de Maytenus macrocarpa“Chuchuhuasi” en el sistema reproductor masculino del ratón (Mus musculus)

    OpenAIRE

    Acosta, Láyonal G.; Vásquez, Jonathan; Núñez, Víctor; Pino, José; Shiga, Betty

    2014-01-01

    Maytenus macrocarpa(chuchuhuasi) is native tree of the Peruvian Amazon used as traditional medicine for the treatment of many diseases, but its effect on the male reproductive system has not yet been elucidated. The aim of this study is evaluate the effect of aqueous extract of M. macrocarpa in daily doses for 7 days on reproductive parameters of male mice. We used C57BL mature male mice divided into 2 groups (n= 10), Control Group (C): 0.9% NaCl and Treatment group (T): Aqueous extract ...

  3. Increased survivorship of testosterone-treated female house mice (Mus musculus) in high-density field conditions

    Science.gov (United States)

    W.J. Zielinski; J.G. Vandenbergh

    1991-01-01

    Differences in hormone levels influence sexual differences in aggression. survival, home-range size and dispcrsal in rodents. The role oftestosterone in establishing some of these differences in wild house mice was examined. Females treated with either 0·5 mg of testosterone enanthate (TE-treated) or oil (control), and an...

  4. X-rays effect on the proximal tubes of mice kidney (Mus musculus). Ultra-structural study

    International Nuclear Information System (INIS)

    Pacheco, I.P.

    1973-01-01

    The kidney alterations in mice it was submitted to total irradiation was studied, trying to determine which lesions were produced and in which sequence its occur. Knowing that irradiation, since in low doses, decrease the organism survival, since anticipating the normal aging, and how it occur and, in event of it occur if such alterations are qualitative and/or quantitatively related with that occur in aging. (L.M.J.)

  5. In vivo toxicity of the culturable marine cyanobacterium Geitlerinema pseudacutissimum CNP 1019 extract on male Swiss albino mice (Mus musculus).

    Science.gov (United States)

    Maruthanayagam, Veerabadhran; Nagarajan, Manivel; Sundararaman, Muthuraman

    2014-01-01

    In this study, we investigated the in vivo toxicity of Geitlerinema pseudacutissimum CNP 1019 organic extract in a murine host. A single intraperitoneal injection of 1 g extract kg⁻¹ body weight (BW) did not exhibit mortality, whereas 3 g extract kg⁻¹ BW (approximate lethal dose) resulted in mortality within 5 days. To perform subchronic exposure toxicity analyses (i.e., daily exposure for a total of 14 days), a maximum concentration of ≤1 g extract kg⁻¹ BW was used. Subchronic toxicity studies in the treated mice, showed fluctuations of feed intake, loss of body weight, increase in specific activity of serum lactate dehydrogenase, alanine aminotransferase and decrease in whole serum protein concentration. LDH isoenzyme expression was found, and levels of the various isoforms were decreased as a result of the treatment. Histopathology studies in liver, kidney, and spleen isolated from the treated mice showed the presence of necrotic debris, hemorrhage, and micronuclei revealing the toxicity of the extract. The dose-dependent alterations in biochemical parameters in conjunction with the histological lesions noted in the animals treated with the prepared extract illustrate the likely potential toxicity to mammals from any encounters with the studied cyanobacterium.

  6. PREDIKSI LAMA KEMATIAN BERDASARKAN KEBERADAAN SERANGGA GENUS LUCILIA (CALLIPHORIDAE PADA BANGKAI MENCIT (Mus musculus DI LOKASI HUTAN MANGROVE

    Directory of Open Access Journals (Sweden)

    Ayu Saka Laksmita

    2014-03-01

    Full Text Available Normal 0 false false false EN-US X-NONE X-NONE This study aimed to investigate the presence of insects on mice carcasses in mangrove forest, the chronology of the insect presence and growth phase of the insects on estimating the time of death of the animal for the beneficial of forensic study. Collected insects were identified at The Laboratory of Animal Taxonomy and The Laboratory of Ecology, Department of Biology, Udayana University. The samples were divided into two based on the study areas: dry and watered areas. Five mice carcasses in three different spot were laid on each dry area. The data collected were analyzed descriptively. The differences of insect growths from egg to pupae and also the ex-pupae found on carcasses could be used to estimated the time of death of an animal.

  7. EFEKTIVITAS MIKRONUTRIEN ZINC DARI EKSTRAK LABU KUNING (Cucurbita Moschata D TERHADAP PERILAKU KAWIN MENCIT (MUS MUSCULUS JANTAN

    Directory of Open Access Journals (Sweden)

    Linda Prasetyaning

    2018-02-01

    Full Text Available Male reproductive ability ability has a linear correlation with libido and testosterone. Both are associated with various things main food consumption such as protein, vitamins and minerals. Aphrodisiac  is an ingredient or drug that arouses sexual arousal or libido. Pumpkin is an example of food from plants with the highest content of zinc. This study was to determine whether there is a difference between the content of zinc on the peel, flesh and pumpkin seeds against sexual activity of mice. The experimental animals used were 24 male, group I mice as control group, Group II was grouped with pumpkin peel extract, Group III was grouped with extract of pumpkin flesh, Group IV was grouped with extract of pumpkin seeds. The dose used is 2gr / kg BB and volume of 0.2 ml is given for 35 days. Sexual Activity is observed every day  by the position of male mice riding females. Based on Anova One Way test results showed there are differences in sexual activity  mice males in each group (ρ 0.000. The difference of the result of the number of mounts indicated that the giving of yellow pumpkin extract had an effect on the increase of mating behavior of male mice. The group treated with the extract of pumpkin flesh showed the highest number of mice mounts (mean = 24,1667.Further research is needed to get a clearer picture of the composition of the pumpkin nutrients that indirectly affect fertility in men.

  8. Effects of a 5-HT3 agonist and antagonist on inter-male aggression in Mus musculus

    Directory of Open Access Journals (Sweden)

    Michael Kerchner

    2006-01-01

    Full Text Available Research has revealed an inverse relationship between serotonin (5-HT levels in the brain and aggressive behavior. However, effects on aggression at the level of the receptor have yet to be elucidated for many 5-HT receptor subtypes. This study examined the effects of the 5-HT3 receptor agonist m-chlorophenylbiguanide (mCPBG and antagonist ondansetron on inter-male aggression in mice. Using a resident-intruder paradigm designed to assess both offensive and defensive aggression, male C57BL/6J mice received 1 mg/kg i.p. injections of either mCPBG, ondansetron, or an inactive vehicle and were subsequently exposed to male AKR/J mice for a period of 10 minutes. Attack latency and the proportion of time engaged in a range of defensive behaviors were recorded. Subject C57BL/6J mice were then immediately run in an open field test for an additional 10 minutes to examine any anxiolytic or sedative effects of the drugs. Results show no significant differences between drug groups in either offensive or defensive behavior. No significant differences were observed between drug groups and open field activity; however, significant differences were seen between the offensive and defensive condition in the open field. In conclusion, this study fails to reveal any significant effects of the 5-HT3 agents on inter-male aggression, which may reflect a functional difference between the 5-HT3 receptor and the remaining G-protein coupled 5-HT receptor. However, this conclusion is limited by the large variance in behavior combined with small sample sizes, or the possibility of a drug dose insufficient for behavioral effects.

  9. Expression of stress hormones AVP and CRH in the hypothalamus of Mus musculus following water and food deprivation.

    Science.gov (United States)

    Yadawa, Arun Kumar; Chaturvedi, Chandra Mohini

    2016-12-01

    Neurohypophyseal hormone, arginine vasopressin (AVP), in addition to acting as antidiuretic hormone is also considered to be stress hormone like hypothalamic corticotropin-releasing hormone (CRH). Present study was designed to investigate the relative response of these stress hormones during water and food deprivation. In this study, male laboratory mice of Swiss strain were divided in 5 groups, control - provided water and food ad libitum, two experimental groups water deprived for 2 and 4days respectively (WD2 and WD4) and another two groups food deprived for 2 and 4days respectively (FD2 and FD4). Results indicate an increased expression of AVP mRNA as well as peptide in the hypothalamus of WD2 mice and the expression was further upregulated after 4days of water deprivation but the expression of CRH remained unchanged compare to their respective controls. On the other hand no change was observed in the expression of hypothalamic AVP mRNA while AVP peptide increased significantly in FD2 and FD4 mice compare to control. Further, the expression of CRH mRNA although increased in hypothalamus of both FD2 and FD4 mice, the immunofluorescent staining shows decreased expression of CRH in PVN of food deprived mice. Based on these findings it is concluded that since during osmotic stress only AVP expression is upregulated but during metabolic stress i.e. food deprivation transcription and translation of both the stress hormones are differentially regulated. Further, it is suggested that role of AVP and CRH may be stress specific. Copyright © 2016 Elsevier Inc. All rights reserved.

  10. Gambaran Histopatologik Payudara Mencit (Mus Musculus) Yang Diinduksi Benzo(α)pyrene Dan Diberikan Ekstrak Kunyit (Curcuma Longa L.)

    OpenAIRE

    Nansi, Eka M; Durry, Meilany F; Kairupan, Carla

    2015-01-01

    : Breast cancer (Carcinoma mammae) is one of the most common cancers affecting women. The etiology of breast cancer is still unknown, however, there are several important risk factors linked to the occurence of breast cancer, as follows: genetic, hormonal, and environmental. Polycyclic aromatic hydrocarbons (PHA) such as benzo(a)pyrene is a carcinogenic agent that can be found in the surrounding environment. It has been proven that benzo(a)pyrene can induce tumors in experimental animal model...

  11. AKTIVITAS ANTIOKSIDAN EKSTRAK TUMBUHAN PAKU EKOR KUDA (Equisetum debile L. TERHADAP PEROKSIDASI LIPID PLASMA DARAH MENCIT (Mus musculus

    Directory of Open Access Journals (Sweden)

    Riana Dyah Suryaningrum

    2017-04-01

    Full Text Available The purpose of this research was to study the antioxidant activity from ethanol extract of horstail (Equisetum debile L. in the free radical scavenging in mice blood plasma. The antioxidant activity test was conducted with the DPPH method and measuring the MDA concentration in mice blood. The antioxidant activity test with the DPPH results showed that the ethanol extract of horstail (Equisetum debile L. had the antioxidant activity of IC50 which was 1.604 mg/mL or 1,604 ppm. The statistical analysis result of the MDA blood plasma in mice with various doses (125 mg/kgBM, 250 mg/kgBM, 375 mg/kgBM and 500 mg/kgBM showed that the 500 mg/kgBM dose extract was able to reduce the MDA concentration in mice blood which given the most amount of exercise.

  12. UJI EFEK ANALGETIKA EKSTRAK BUAH KAKTUS (Opuntia elatior Mill. PADA MENCIT (Mus musculus YANG DIINDUKSI ASAM ASETAT

    Directory of Open Access Journals (Sweden)

    Gissa Amellia

    2015-10-01

    Full Text Available Pain is a mechanism of body defense. One way to allay or decreasing the pain is using medicines that have analgetic effect. The aim of this study is determine the analgetic effect of cactus fruits (Opuntia elatior Mill. extract and the most effective dose to giving analgetic effect. This study used writhing method by the injection acetic acid 1% as induced. Group I as a negative control used natrium carboxy methylcellulose 1%, group II as a positive control used aspirin suspension which dosage was 1,3 mg/20g BB, group III as a extract of cactus fruits give to dose 50 mg/kg BB, group IV dose 100 mg/kg BB, and group V dose 150 mg/kg BB. The result shows that cactus fruits extract to giving analgetic effect judging from the reduction strength writhing reflex to protection percentage at dose 50 mg/kg BB (11,26%, 100 mg/kg BB (42,10%, 150 mg/kg BB(60,14% and the positif control (75,34%, at the positif control shows that higher protection percentage. Effectiveness percentage analgetic extract of cactus fruits at dose of 50 mg/kg BB (14,4%, 100 mg/kg BB (55,36%, 150 mg/kg BB (79,95% and positif control (100%. The data which is got from the calculation later is analyzed by Kruskal Wallis. The result showed that at dose of 150 mg/kg BB is p: 0,016 (p<0,05 when compared with the positive control. So that is different significantly between dose 150 mg/kg BB and the positive control. The extract showed a optimal analgetic effect characterized by a significant reduction in the number of writhes or abdominal stretches in mice with dose 150 mg/kg BB body weight used when compared to the cactus fruits extract dose 50 and 100 mg/kg BB

  13. UJI POTENSI UMBI KIMPUL (Xanthosoma sagittifolium (L. Schott. SEBAGAI BAHAN PANGAN FUNGSIONAL ANTIULSER PADA MENCIT (Mus musculus L.

    Directory of Open Access Journals (Sweden)

    Triyani Yuliastuti

    2016-03-01

    Full Text Available Cocoyam (Xanthosoma sagittifolium (L. Schott. tuber is usually consumed as carbohydrates source. Because of highly mineral and fiber contents, it is potential to develop as a functional food source. The mineral contents are potassium, phosphor, magnesium, iron, copper and sodium. Some minerals are well known able to neutralize pH of the gastric fluid. It is necessary to study cocoyam activity on the ulcer gastric. The aims of this study were to determine anti-ulcerogenic activity of cocoyam tuber by observing macroscopic stomach mucous structure on mice and measuring the gastric fluid pH. Twenty male mice aged 2-3 months were used in this study. They were classified in to 4 different treatment groups. Group I was control mice without gastric ulcer, group II, III, and IV were mice with gastric ulcer by using aspirin treatment. Group II,III, and IV were treated with different treatments then for 7 days. Group II was treated by aquadest (negative control group, group III by sucralfat (positive control group, and group IV by cocoyam tuber. In the last treatment day, mice were fasted for 24 hours and then sacrified to pick stomach up. Gastric fluid was collected and the pH was measured then. Stomach mucous structure was observed macroscopically. Data in the gastric fluid pH was analyzed by using one-way ANOVA (Analysis of Variance and continued  HSD (Honest Significant Difference-Tukey test in 5% significance degree. Degree of stomach mucous structure damage was analyzed descriptively and then it was scored based on number and diameter size of ulcers. Data on the ulcer score were analyzed by using Kruskal-Wallis test. The results showed that there was a significant difference (p<0.05 at the stomach fluid pH. Normal group was not significantly different to the sucralfat and cocoyam tuber group, nevertheless normal group was different significantly to the ulcer group. Based on the degree of stomach mucous structure damage, there was not significantly different (p>0,05 between cocoyam tuber group and aquadest group. Nevertheless, mice in the cocoyam tuber group had lower ulcer score than mice in the aquadest group. Therefore cocoyam tuber is safe consumed by the gastric ulcer mice. Cocoyam tuber is potential to develop as a functional food on gastric ulcer patient.

  14. Designing peptide inhibitor of insulin receptor to induce diabetes mellitus type 2 in animal model Mus musculus.

    Science.gov (United States)

    Permatasari, Galuh W; Utomo, Didik H; Widodo

    2016-10-01

    A designing peptide as agent for inducing diabetes mellitus type 2 (T2DM) in an animal model is challenging. The computational approach provides a sophisticated tool to design a functional peptide that may block the insulin receptor activity. The peptide that able to inhibit the binding between insulin and insulin receptor is a warrant for inducing T2DM. Therefore, we designed a potential peptide inhibitor of insulin receptor as an agent to generate T2DM animal model by bioinformatics approach. The peptide has been developed based on the structure of insulin receptor binding site of insulin and then modified it to obtain the best properties of half life, hydrophobicity, antigenicity, and stability binding into insulin receptor. The results showed that the modified peptide has characteristics 100h half-life, high-affinity -95.1±20, and high stability 28.17 in complex with the insulin receptor. Moreover, the modified peptide has molecular weight 4420.8g/Mol and has no antigenic regions. Based on the molecular dynamic simulation, the complex of modified peptide-insulin receptor is more stable than the commercial insulin receptor blocker. This study suggested that the modified peptide has the promising performance to block the insulin receptor activity that potentially induce diabetes mellitus type 2 in mice. Copyright © 2016 Elsevier Ltd. All rights reserved.

  15. Dosis letal 50 de lorazepam en ratón (Mus musculus Albino, cepa suizo-icr

    Directory of Open Access Journals (Sweden)

    Francisco Alejandro Múnera G.

    2000-10-01

    Full Text Available Objective: The lethal dose 50 (LD50 of  lorazepam in albino mice (Musmusculus, swiss ICR strain, was determined as a first step in the study of the conjoint toxicity of admixtures of scopolamine and benzodiazepines ("new burundanga". Method: Sixty adult male mice were randomly assigned to five experimental groups and to a control one. The dose of lorazepam administered intraperitoneally to each group was: group 1,10 mg kg_1; group 11,20 mg kgI; group 111,40mg kgL; group IV,80mgkg'; group V,160mg kg-l.The control group received only the vehicle solution. Mortality was recorded during 15 days after injection. Necropsies were performed to all the mice dead during the assay and to the survivors. Data were processed using probit analysis and survival analysis. Results: Estimated LD50 were 90.71 mg kg- 1, with 95% confidence range of 65,02to 150,13mg kg- 1.Deaths occurred within the first six days after injection of doses higher than 80 mg kg:', mostly during the first 48 hours. Conclusions: The estimated LD50 of  lorazepam in this experiment almost doubles the reported one, this finding suggests a higher resistance of the mice strain used in this experiment The critic period for lorazepam poisoning spans the first 48 hours.

  16. Dose Optimization of Calcusol™ and Calcium Oxalate Monohydrate (COM on Primary Renal Epithelial Cells Cultures of Mice ( Mus musculus

    Directory of Open Access Journals (Sweden)

    Ahmad Soni

    2014-05-01

    Full Text Available Kidney stones are one of the urologic diseases that have plagued mankind for centuries. The main constituents of stones in the kidney are calcium oxalate monohydrate (COM crystals. Nowadays, there are varieties of drugs and treatments that can be made to minimize the grievances due to kidney stone disease. The treatment can be done either by using chemicals or traditional medicine. Calcusol™ is one of the popular herbal products that have been used by Indonesian people in curing the kidney stone disease. The main constituent that was contained in Calcusol™ is an extract of the tempuyung leaves (Sonchus arvensis L., which is expected could cure the kidney stone disease. This study used primary cultured renal epithelial cells of mice to determine the optimal dose of Calcusol™ and the optimal dose of COM. The primary Kidney epithelial cell were treated with Calcusol™ and COM at various doses. The analysis of the cell death either by necrosis or apoptosis pathways was analyzed by flow cytometric analysis. The results that were obtained is the percentage of cell death that is then analyzed by using a complete randomized design (CRD One Way Anova. Based on the results that were obtained, it is known that the optimal dose of Calcusol™ in vitro were ranging from 75 ppm to 100 ppm, whereas the optimal dose of COM suggested for 500 ppm.

  17. Pengaruh Pemberian Fraksi Protein Ekstrak Kuda Laut (Hippocampus Kuda Bleeker, 1852) Terhadap Peningkatan Kadar Hemoglobin Mencit (Mus Musculus L)

    OpenAIRE

    Adam, Kindi; Fitria, Laksmindra; Sarto, Mulyati

    2014-01-01

    Seahorse (Hippocampus kuda) is known to have a high concentration of iron, taurin and progesteron as testosteron precursor. Seahorse extract can increase the production of testosterone hormone of mice. On the erythrocytes development, kidney is stimulated to release erythropoietin hormone in case of hypoxia and also related with testosterone production. Erythropoietin control erythrocytes development and increase hemoglobin synthesis. The objective of experiment was to study the effect of sea...

  18. Pengaruh Pemberian Fraksi Protein Ekstrak Kuda Laut (Hippocampus kuda Bleeker, 1852) terhadap Peningkatan Kadar Hemoglobin Mencit (Mus musculus L)

    OpenAIRE

    Kindi Adam; Laksmindra Fitria; Mulyati Sarto

    2015-01-01

    Seahorse (Hippocampus kuda) is known to have a high concentration of iron, taurin and progesteron as testosteron precursor. Seahorse extract can increase the production of testosterone hormone of mice. On the erythrocytes development, kidney is stimulated to release erythropoietin hormone in case of hypoxia and also related with testosterone production. Erythropoietin control erythrocytes development and increase hemoglobin synthesis. The objective of experiment was to study the effect of sea...

  19. Several classical mouse inbred strains, including DBA/2, NOD/Lt, FVB/N, and SJL/J, carry a putative loss-of-function allele of Gpr84.

    Science.gov (United States)

    Perez, Carlos J; Dumas, Aline; Vallières, Luc; Guénet, Jean-Louis; Benavides, Fernando

    2013-01-01

    G protein-coupled receptor 84 (GPR84) is a 7-transmembrane protein expressed on myeloid cells that can bind to medium-chain free fatty acids in vitro. Here, we report the discovery of a 2-bp frameshift deletion in the second exon of the Gpr84 gene in several classical mouse inbred strains. This deletion generates a premature stop codon predicted to result in a truncated protein lacking the transmembrane domains 4-7. We sequenced Gpr84 exon 2 from 58 strains representing different groups in the mouse family tree and found that 14 strains are homozygous for the deletion. Some of these strains are DBA/1J, DBA/2J, FVB/NJ, LG/J, MRL/MpJ, NOD/LtJ, and SJL/J. However, the deletion was not found in any of the wild-derived inbred strains analyzed. Haplotype analysis suggested that the deletion originates from a unique mutation event that occurred more than 100 years ago, preceding the development of the first inbred strain (DBA), from a Mus musculus domesticus source. As GPR84 ostensibly plays a role in the biology of myeloid cells, it could be relevant 1) to consider the existence of this Gpr84 nonsense mutation in several mouse strains when choosing a mouse model to study immune processes and 2) to consider reevaluating data obtained using such strains.

  20. Les sens du musée

    Directory of Open Access Journals (Sweden)

    Laurent Grison

    1999-09-01

    Full Text Available Cet article, fondé sur l'exemple de la National Gallery de Londres, porte sur l'intégration dans le cadre urbain, l'aménagement et les dynamiques spatiales du lieu muséal. Sur le même thème, nous relatons un exercice réalisé avec des lycéens.

  1. Generation of competent bone marrow-derived antigen presenting cells from the deer mouse (Peromyscus maniculatus

    Directory of Open Access Journals (Sweden)

    Farrell Regina M

    2004-09-01

    Full Text Available Abstract Background Human infections with Sin Nombre virus (SNV and related New World hantaviruses often lead to hantavirus cardiopulmonary syndrome (HCPS, a sometimes fatal illness. Lungs of patients who die from HCPS exhibit cytokine-producing mononuclear infiltrates and pronounced pulmonary inflammation. Deer mice (Peromyscus maniculatus are the principal natural hosts of SNV, in which the virus establishes life-long persistence without conspicuous pathology. Little is known about the mechanisms SNV employs to evade the immune response of deer mice, and experimental examination of this question has been difficult because of a lack of methodologies for examining such responses during infection. One such deficiency is our inability to characterize T cell responses because susceptible syngeneic deer mice are not available. Results To solve this problem, we have developed an in vitro method of expanding and generating competent antigen presenting cells (APC from deer mouse bone marrow using commercially-available house mouse (Mus musculus granulocyte-macrophage colony stimulating factor. These cells are capable of processing and presenting soluble protein to antigen-specific autologous helper T cells in vitro. Inclusion of antigen-specific deer mouse antibody augments T cell stimulation, presumably through Fc receptor-mediated endocytosis. Conclusions The use of these APC has allowed us to dramatically expand deer mouse helper T cells in culture and should permit extensive characterization of T cell epitopes. Considering the evolutionary divergence between deer mice and house mice, it is probable that this method will be useful to other investigators using unconventional models of rodent-borne diseases.

  2. ORF Alignment: NC_003103 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available s] ref|NP_766317.1| caspase recruitment domain 4 ... [Mus musculus] gb|AAH42670.1| Caspase recruitment... domain ... 4 [Mus musculus] sp|Q8BHB0|CARD4_MOUSE Caspase ... recruitment domain protein 4 d

  3. X chromosome control of meiotic chromosome synapsis in mouse inter-subspecific hybrids.

    Directory of Open Access Journals (Sweden)

    Tanmoy Bhattacharyya

    2014-02-01

    Full Text Available Hybrid sterility (HS belongs to reproductive isolation barriers that safeguard the integrity of species in statu nascendi. Although hybrid sterility occurs almost universally among animal and plant species, most of our current knowledge comes from the classical genetic studies on Drosophila interspecific crosses or introgressions. With the house mouse subspecies Mus m. musculus and Mus m. domesticus as a model, new research tools have become available for studies of the molecular mechanisms and genetic networks underlying HS. Here we used QTL analysis and intersubspecific chromosome substitution strains to identify a 4.7 Mb critical region on Chromosome X (Chr X harboring the Hstx2 HS locus, which causes asymmetrical spermatogenic arrest in reciprocal intersubspecific F1 hybrids. Subsequently, we mapped autosomal loci on Chrs 3, 9 and 13 that can abolish this asymmetry. Combination of immunofluorescent visualization of the proteins of synaptonemal complexes with whole-chromosome DNA FISH on pachytene spreads revealed that heterosubspecific, unlike consubspecific, homologous chromosomes are predisposed to asynapsis in F1 hybrid male and female meiosis. The asynapsis is under the trans- control of Hstx2 and Hst1/Prdm9 hybrid sterility genes in pachynemas of male but not female hybrids. The finding concurred with the fertility of intersubpecific F1 hybrid females homozygous for the Hstx2(Mmm allele and resolved the apparent conflict with the dominance theory of Haldane's rule. We propose that meiotic asynapsis in intersubspecific hybrids is a consequence of cis-acting mismatch between homologous chromosomes modulated by the trans-acting Hstx2 and Prdm9 hybrid male sterility genes.

  4. X chromosome control of meiotic chromosome synapsis in mouse inter-subspecific hybrids.

    Science.gov (United States)

    Bhattacharyya, Tanmoy; Reifova, Radka; Gregorova, Sona; Simecek, Petr; Gergelits, Vaclav; Mistrik, Martin; Martincova, Iva; Pialek, Jaroslav; Forejt, Jiri

    2014-02-01

    Hybrid sterility (HS) belongs to reproductive isolation barriers that safeguard the integrity of species in statu nascendi. Although hybrid sterility occurs almost universally among animal and plant species, most of our current knowledge comes from the classical genetic studies on Drosophila interspecific crosses or introgressions. With the house mouse subspecies Mus m. musculus and Mus m. domesticus as a model, new research tools have become available for studies of the molecular mechanisms and genetic networks underlying HS. Here we used QTL analysis and intersubspecific chromosome substitution strains to identify a 4.7 Mb critical region on Chromosome X (Chr X) harboring the Hstx2 HS locus, which causes asymmetrical spermatogenic arrest in reciprocal intersubspecific F1 hybrids. Subsequently, we mapped autosomal loci on Chrs 3, 9 and 13 that can abolish this asymmetry. Combination of immunofluorescent visualization of the proteins of synaptonemal complexes with whole-chromosome DNA FISH on pachytene spreads revealed that heterosubspecific, unlike consubspecific, homologous chromosomes are predisposed to asynapsis in F1 hybrid male and female meiosis. The asynapsis is under the trans- control of Hstx2 and Hst1/Prdm9 hybrid sterility genes in pachynemas of male but not female hybrids. The finding concurred with the fertility of intersubpecific F1 hybrid females homozygous for the Hstx2(Mmm) allele and resolved the apparent conflict with the dominance theory of Haldane's rule. We propose that meiotic asynapsis in intersubspecific hybrids is a consequence of cis-acting mismatch between homologous chromosomes modulated by the trans-acting Hstx2 and Prdm9 hybrid male sterility genes.

  5. X Chromosome Control of Meiotic Chromosome Synapsis in Mouse Inter-Subspecific Hybrids

    Science.gov (United States)

    Bhattacharyya, Tanmoy; Reifova, Radka; Gregorova, Sona; Simecek, Petr; Gergelits, Vaclav; Mistrik, Martin; Martincova, Iva; Pialek, Jaroslav; Forejt, Jiri

    2014-01-01

    Hybrid sterility (HS) belongs to reproductive isolation barriers that safeguard the integrity of species in statu nascendi. Although hybrid sterility occurs almost universally among animal and plant species, most of our current knowledge comes from the classical genetic studies on Drosophila interspecific crosses or introgressions. With the house mouse subspecies Mus m. musculus and Mus m. domesticus as a model, new research tools have become available for studies of the molecular mechanisms and genetic networks underlying HS. Here we used QTL analysis and intersubspecific chromosome substitution strains to identify a 4.7 Mb critical region on Chromosome X (Chr X) harboring the Hstx2 HS locus, which causes asymmetrical spermatogenic arrest in reciprocal intersubspecific F1 hybrids. Subsequently, we mapped autosomal loci on Chrs 3, 9 and 13 that can abolish this asymmetry. Combination of immunofluorescent visualization of the proteins of synaptonemal complexes with whole-chromosome DNA FISH on pachytene spreads revealed that heterosubspecific, unlike consubspecific, homologous chromosomes are predisposed to asynapsis in F1 hybrid male and female meiosis. The asynapsis is under the trans- control of Hstx2 and Hst1/Prdm9 hybrid sterility genes in pachynemas of male but not female hybrids. The finding concurred with the fertility of intersubpecific F1 hybrid females homozygous for the Hstx2Mmm allele and resolved the apparent conflict with the dominance theory of Haldane's rule. We propose that meiotic asynapsis in intersubspecific hybrids is a consequence of cis-acting mismatch between homologous chromosomes modulated by the trans-acting Hstx2 and Prdm9 hybrid male sterility genes. PMID:24516397

  6. Behavioral and other phenotypes in a cytoplasmic Dynein light intermediate chain 1 mutant mouse.

    Science.gov (United States)

    Banks, Gareth T; Haas, Matilda A; Line, Samantha; Shepherd, Hazel L; Alqatari, Mona; Stewart, Sammy; Rishal, Ida; Philpott, Amelia; Kalmar, Bernadett; Kuta, Anna; Groves, Michael; Parkinson, Nicholas; Acevedo-Arozena, Abraham; Brandner, Sebastian; Bannerman, David; Greensmith, Linda; Hafezparast, Majid; Koltzenburg, Martin; Deacon, Robert; Fainzilber, Mike; Fisher, Elizabeth M C

    2011-04-06

    The cytoplasmic dynein complex is fundamentally important to all eukaryotic cells for transporting a variety of essential cargoes along microtubules within the cell. This complex also plays more specialized roles in neurons. The complex consists of 11 types of protein that interact with each other and with external adaptors, regulators and cargoes. Despite the importance of the cytoplasmic dynein complex, we know comparatively little of the roles of each component protein, and in mammals few mutants exist that allow us to explore the effects of defects in dynein-controlled processes in the context of the whole organism. Here we have taken a genotype-driven approach in mouse (Mus musculus) to analyze the role of one subunit, the dynein light intermediate chain 1 (Dync1li1). We find that, surprisingly, an N235Y point mutation in this protein results in altered neuronal development, as shown from in vivo studies in the developing cortex, and analyses of electrophysiological function. Moreover, mutant mice display increased anxiety, thus linking dynein functions to a behavioral phenotype in mammals for the first time. These results demonstrate the important role that dynein-controlled processes play in the correct development and function of the mammalian nervous system.

  7. Phylogenetic relationship and time of divergence of Mus terricolor ...

    Indian Academy of Sciences (India)

    2016-06-06

    Jun 6, 2016 ... ... Developmental Biology, National Heart Lung and Blood Institute, National Institutes of Health, .... matic short arms in homozygous conditions (Sen and Sharma ..... differences in selection pressure between M. musculus and.

  8. Two Predicted Transmembrane Domains Exclude Very Long Chain Fatty acyl-CoAs from the Active Site of Mouse Wax Synthase.

    Directory of Open Access Journals (Sweden)

    Steffen Kawelke

    Full Text Available Wax esters are used as coatings or storage lipids in all kingdoms of life. They are synthesized from a fatty alcohol and an acyl-CoA by wax synthases. In order to get insights into the structure-function relationships of a wax synthase from Mus musculus, a domain swap experiment between the mouse acyl-CoA:wax alcohol acyltransferase (AWAT2 and the homologous mouse acyl-CoA:diacylglycerol O-acyltransferase 2 (DGAT2 was performed. This showed that the substrate specificity of AWAT2 is partially determined by two predicted transmembrane domains near the amino terminus of AWAT2. Upon exchange of the two domains for the respective part of DGAT2, the resulting chimeric enzyme was capable of incorporating up to 20% of very long acyl chains in the wax esters upon expression in S. cerevisiae strain H1246. The amount of very long acyl chains in wax esters synthesized by wild type AWAT2 was negligible. The effect was narrowed down to a single amino acid position within one of the predicted membrane domains, the AWAT2 N36R variant. Taken together, we provide first evidence that two predicted transmembrane domains in AWAT2 are involved in determining its acyl chain length specificity.

  9. Trends and tactics of mouse predation on Tristan Albatross Diomedea dabbenena chicks at Gough Island, South Atlantic Ocean

    Directory of Open Access Journals (Sweden)

    Delia Davies

    2015-06-01

    Full Text Available The critically endangered Tristan Albatross Diomedea dabbenena breeds almost exclusively on Gough Island, in the central South Atlantic, where breeding success is much lower than other great albatrosses (Diomedea spp. worldwide. Most breeding failures occur during the chick-rearing stage, when other great albatrosses suffer few failures. This unusual pattern of breeding failure is assumed to be largely due to predation by introduced house mice Mus musculus, but there have been few direct observations of mouse attacks. We closely monitored the fates of 20 chicks in the Gonydale study colony (123 chicks in 2014 using motion-activated cameras to determine the causes of chick mortality. Only 5 of 20 chicks survived to fledge, and of the 15 failures, 14 (93% were due to mouse predation. One mouse-wounded chick was killed by a Southern Giant Petrel Macronectes giganteus; the rest died outright from their wounds within 3.9 ± 1.2 days of the first attack. Despite this high impact, most chicks were attacked by only 1-2 mice at once (maximum 9. The remaining 103 chicks in the study colony were checked less frequently, but the timing of failures was broadly similar to the 20 closely monitored nests, and the presence of mouse wounds on other chicks strongly suggests that mice were responsible for most chick deaths. Breeding success in the Gonydale study colony averages 28% from 2001 to 2014; far lower than the normal range of breeding success of Diomedea species occurring on islands free from introduced predators. Island-wide breeding success fell below 10% for the first time in 2014, making it even more urgent to eradicate mice from Gough Island.

  10. MUS81 promotes common fragile site expression

    DEFF Research Database (Denmark)

    Ying, Songmin; Minocherhomji, Sheroy; Chan, Kok Lung

    2013-01-01

    Fragile sites are chromosomal loci with a propensity to form gaps or breaks during early mitosis, and their instability is implicated as being causative in certain neurological disorders and cancers. Recent work has demonstrated that the so-called common fragile sites (CFSs) often impair the fait......Fragile sites are chromosomal loci with a propensity to form gaps or breaks during early mitosis, and their instability is implicated as being causative in certain neurological disorders and cancers. Recent work has demonstrated that the so-called common fragile sites (CFSs) often impair...... the faithful disjunction of sister chromatids in mitosis. However, the mechanisms by which CFSs express their fragility, and the cellular factors required to suppress CFS instability, remain largely undefined. Here, we report that the DNA structure-specific nuclease MUS81-EME1 localizes to CFS loci in early...

  11. A Deconvolution Protocol for ChIP-Seq Reveals Analogous Enhancer Structures on the Mouse and Human Ribosomal RNA Genes

    Directory of Open Access Journals (Sweden)

    Jean-Clement Mars

    2018-01-01

    Full Text Available The combination of Chromatin Immunoprecipitation and Massively Parallel Sequencing, or ChIP-Seq, has greatly advanced our genome-wide understanding of chromatin and enhancer structures. However, its resolution at any given genetic locus is limited by several factors. In applying ChIP-Seq to the study of the ribosomal RNA genes, we found that a major limitation to resolution was imposed by the underlying variability in sequence coverage that very often dominates the protein–DNA interaction profiles. Here, we describe a simple numerical deconvolution approach that, in large part, corrects for this variability, and significantly improves both the resolution and quantitation of protein–DNA interaction maps deduced from ChIP-Seq data. This approach has allowed us to determine the in vivo organization of the RNA polymerase I preinitiation complexes that form at the promoters and enhancers of the mouse (Mus musculus and human (Homo sapiens ribosomal RNA genes, and to reveal a phased binding of the HMG-box factor UBF across the rDNA. The data identify and map a “Spacer Promoter” and associated stalled polymerase in the intergenic spacer of the human ribosomal RNA genes, and reveal a very similar enhancer structure to that found in rodents and lower vertebrates.

  12. Onset and progress of meiotic prophase in the oocytes in the B6.YTIR sex-reversed mouse ovary.

    Science.gov (United States)

    Park, E-H; Taketo, T

    2003-12-01

    When the Y chromosome of a Mus musculus domesticus male mouse (caught in Tirano, Italy) is placed on a C57BL/6J genetic background, approximately half of the XY (B6.YTIR) progeny develop into normal-appearing but infertile females. We have previously reported that the primary cause of infertility can be attributed to their oocytes. To identify the primary defect in the XY oocyte, we examined the onset and progress of meiotic prophase in the B6.YTIR fetal ovary. Using bromo-deoxyuridine incorporation and culture, we determined that the germ cells began to enter meiosis at the developmental ages and in numbers comparable to those in the control XX ovary. Furthermore, the meiotic prophase appeared to progress normally until the late zygotene stage. However, the oocytes that entered meiosis early in the XY ovary failed to complete the meiotic prophase. On the other hand, a considerable number of oocytes entered meiosis at late developmental stages and completed the meiotic prophase in the XY ovary. We propose that the timing of entry into meiosis and the XY chromosomal composition influence the survival of oocytes during meiotic prophase in the fetal ovary.

  13. Detection of quantitative trait loci causing abnormal spermatogenesis and reduced testis weight in the small testis (Smt) mutant mouse.

    Science.gov (United States)

    Bolor, Hasbaira; Wakasugi, Noboru; Zhao, Wei Dong; Ishikawa, Akira

    2006-04-01

    The small testis (Smt) mutant mouse is characterized by a small testis of one third to one half the size of a normal testis, and its spermatogenesis is mostly arrested at early stages of meiosis, although a small number of spermatocytes at the late prophase of meiosis and a few spermatids can sometimes be seen. We performed quantitative trait locus (QTL) analysis of these spermatogenic traits and testis weight using 221 F2 males obtained from a cross between Smt and MOM (Mus musculus molossinus) mice. At the genome-wide 5% level, we detected two QTLs affecting meiosis on chromosomes 4 and 13, and two QTLs for paired testis weight as a percentage of body weight on chromosomes 4 and X. In addition, we found several QTLs for degenerated germ cells and multinuclear giant cells on chromosomes 4, 7 and 13. Interestingly, for cell degeneration, the QTL on chromosome 13 interacted epistatically with the QTL on chromosome 4. These results reveal polygenic participation in the abnormal spermatogenesis and small testis size in the Smt mutant.

  14. Transcriptomic and Proteomic Profiling Revealed High Proportions of Odorant Binding and Antimicrobial Defense Proteins in Olfactory Tissues of the House Mouse

    Directory of Open Access Journals (Sweden)

    Barbora Kuntová

    2018-02-01

    Full Text Available Mammalian olfaction depends on chemosensory neurons of the main olfactory epithelia (MOE, and/or of the accessory olfactory epithelia in the vomeronasal organ (VNO. Thus, we have generated the VNO and MOE transcriptomes and the nasal cavity proteome of the house mouse, Mus musculus musculus. Both transcriptomes had low levels of sexual dimorphisms, while the soluble proteome of the nasal cavity revealed high levels of sexual dimorphism similar to that previously reported in tears and saliva. Due to low levels of sexual dimorphism in the olfactory receptors in MOE and VNO, the sex-specific sensing seems less likely to be dependent on receptor repertoires. However, olfaction may also depend on a continuous removal of background compounds from the sites of detection. Odorant binding proteins (OBPs are thought to be involved in this process and in our study Obp transcripts were most expressed along other lipocalins (e.g., Lcn13, Lcn14 and antimicrobial proteins. At the level of proteome, OBPs were highly abundant with only few being sexually dimorphic. We have, however, detected the major urinary proteins MUP4 and MUP5 in males and females and the male-biased central/group-B MUPs that were thought to be abundant mainly in the urine. The exocrine gland-secreted peptides ESP1 and ESP22 were male-biased but not male-specific in the nose. For the first time, we demonstrate that the expression of nasal lipocalins correlates with antimicrobial proteins thus suggesting that their individual variation may be linked to evolvable mechanisms that regulate natural microbiota and pathogens that regularly enter the body along the ‘eyes-nose-oral cavity’ axis.

  15. NCBI nr-aa BLAST: CBRC-PCAP-01-1368 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1368 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

  16. NCBI nr-aa BLAST: CBRC-PHAM-01-1594 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PHAM-01-1594 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

  17. NCBI nr-aa BLAST: CBRC-MLUC-01-1112 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MLUC-01-1112 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

  18. NCBI nr-aa BLAST: CBRC-OPRI-01-0982 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OPRI-01-0982 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

  19. NCBI nr-aa BLAST: CBRC-VPAC-01-1554 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-VPAC-01-1554 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

  20. NCBI nr-aa BLAST: CBRC-MMUR-01-1494 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUR-01-1494 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

  1. NCBI nr-aa BLAST: CBRC-TTRU-01-0117 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TTRU-01-0117 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

  2. NCBI nr-aa BLAST: CBRC-GGOR-01-1297 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-1297 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE RecName: Full=Cannabinoid receptor 1; Short=CB1; Short=CB-R; AltName: Full=Brain-type cann...abinoid receptor gb|AAD34624.1|AF153345_1 CB1 cannabinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannab...inoid receptor [Mus musculus] gb|AAA91176.1| neuronal cannabinoid receptor [Mus m...usculus] emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal cannabinoid recepto

  3. NCBI nr-aa BLAST: CBRC-SARA-01-1746 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-SARA-01-1746 ref|NP_705806.1| non-imprinted in Prader-Willi/Angelman syndrome ...1 [Mus musculus] sp|Q8BHK1|NIPA1_MOUSE Non-imprinted in Prader-Willi/Angelman syndrome region protein 1 homo...protein product [Mus musculus] gb|AAH55828.1| Non imprinted in Prader-Willi/Angel...man syndrome 1 homolog (human) [Mus musculus] gb|EDL21870.1| non imprinted in Prader-Willi/Angelman syndrome 1 homolog (human) [Mus musculus] NP_705806.1 1e-113 81% ... ...log gb|AAM34534.1| non-imprinted in Prader-Willi/Angelman syndrome 1 [Mus musculus] dbj|BAC32809.1| unnamed

  4. NCBI nr-aa BLAST: CBRC-STRI-01-2632 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2632 ref|NP_076136.2| non-imprinted in Prader-Willi/Angelman syndrome ...2 [Mus musculus] sp|Q9JJC8|NIPA2_MOUSE RecName: Full=Magnesium transporter NIPA2; AltName: Full=Non-imprinte...tein product [Mus musculus] tpg|DAA01178.1| TPA_exp: non-imprinted in Prader-Willi/Angelman syndrome 2 [Mus ...musculus] dbj|BAE32806.1| unnamed protein product [Mus musculus] gb|EDL21872.1| non imprint...ed in Prader-Willi/Angelman syndrome 2 homolog (human), isoform CRA_a [Mus musculus] gb|EDL21874.1| non imprint

  5. NCBI nr-aa BLAST: CBRC-MMUS-06-0135 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-06-0135 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-139 80% ...

  6. NCBI nr-aa BLAST: CBRC-STRI-01-2305 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2305 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 8e-64 55% ...

  7. NCBI nr-aa BLAST: CBRC-MMUS-06-0136 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-06-0136 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-175 100% ...

  8. NCBI nr-aa BLAST: CBRC-OCUN-01-0645 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0645 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 3e-46 53% ...

  9. NCBI nr-aa BLAST: CBRC-MMUS-06-0141 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-06-0141 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9EP51|VN1B1_MOUSE Vomeronas...al type-1 receptor B1 (Vomeronasal type-1 receptor A5) (Vomeronasal receptor 2) (Ph...eromone receptor VN2) gb|AAG42083.1|AF291489_1 vomeronasal receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 ...[Mus musculus] gb|AAI07184.1| Vomeronasal 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 1e-135 78% ...

  10. NCBI nr-aa BLAST: CBRC-STRI-01-1937 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1937 ref|NP_444455.1| vomeronasal 1 receptor, B1 [Mus musculus] sp|Q9E...P51|VN1B1_MOUSE RecName: Full=Vomeronasal type-1 receptor B1; AltName: Full=Vomeronasal type-1 receptor A5; AltName: Full=Vomeronasa...l receptor 2; AltName: Full=Pheromone receptor VN2 gb|AAG42083.1|AF291489_1 vomeronasa...l receptor V1RB1 [Mus musculus] gb|AAG43248.1| VN2 [Mus musculus] gb|AAI07184.1| Vomeronasa...l 1 receptor, B1 [Mus musculus] gb|EDK99276.1| vomeronasal 1 receptor, B1 [Mus musculus] NP_444455.1 2e-25 41% ...

  11. Age-associated metabolic and morphologic changes in mitochondria of individual mouse and hamster oocytes.

    Directory of Open Access Journals (Sweden)

    Fatma Simsek-Duran

    Full Text Available BACKGROUND: In human oocytes, as in other mammalian ova, there is a significant variation in the pregnancy potential, with approximately 20% of oocyte-sperm meetings resulting in pregnancies. This frequency of successful fertilization decreases as the oocytes age. This low proportion of fruitful couplings appears to be influenced by changes in mitochondrial structure and function. In this study, we have examined mitochondrial biogenesis in both hamster (Mesocricetus auratus and mouse (Mus musculus ova as models for understanding the effects of aging on mitochondrial structure and energy production within the mammalian oocyte. METHODOLOGY/PRINCIPAL FINDINGS: Individual metaphase II oocytes from a total of 25 young and old mice and hamsters were collected from ovarian follicles after hormone stimulation and prepared for biochemical or structural analysis. Adenosine triphosphate levels and mitochondrial DNA number were determined within individual oocytes from young and old animals. In aged hamsters, oocyte adenosine triphosphate levels and mitochondrial DNA molecules were reduced 35.4% and 51.8%, respectively. Reductions of 38.4% and 44% in adenosine triphosphate and mitochondrial genomes, respectively, were also seen in aged mouse oocytes. Transmission electron microscopic (TEM analysis showed that aged rodent oocytes had significant alterations in mitochondrial and cytoplasmic lamellae structure. CONCLUSIONS/SIGNIFICANCE: In both mice and hamsters, decreased adenosine triphosphate in aged oocytes is correlated with a similar decrease in mtDNA molecules and number of mitochondria. Mitochondria in mice and hamsters undergo significant morphological change with aging including mitochondrial vacuolization, cristae alterations, and changes in cytoplasmic lamellae.

  12. Presencia de los géneros invasores Mus y Rattus en áreas naturales de Chile: un riesgo ambiental y epidemiológico Presence of the invasive genera Mus and Rattus in natural areas in Chile: an environmental and epidemiological risk

    Directory of Open Access Journals (Sweden)

    GABRIEL LOBOS

    2005-03-01

    Full Text Available Realizamos un estudio que incluyó muestreos y prospecciones en un gradiente latitudinal en Chile continental para determinar la presencia y ausencia de roedores murinos introducidos, particularmente Mus musculus, Rattus rattus y R. norvegicus en áreas naturales o silvestres a lo largo de Chile. Además se analizó el riesgo epidemiológico que representan estas especies en el marco de un estudio sobre el virus Hanta. Los resultados mostraron que M. musculus rara vez es recolectado en áreas naturales. Sin embargo, las dos especies de Rattus han invadido ampliamente la región mediterránea chilena. Las regiones desérticas, los ambientes de alturas y las regiones australes, serían biótopos restringidos para estos invasores. Desde una perspectiva epidemiológica, la presencia del virus Hanta (variedades Andes y Seoul en Rattus es un elemento que demuestra que las especies invasoras además de generar impactos ecológicos, pueden ocasionar problemas económicos y de salud pública. La fragilidad de los ecosistemas mediterráneos determina que la presencia de especies exóticas constituya un elemento de alto riesgo para la conservación del patrimonio natural del país. Probablemente, la conservación de áreas naturales constituye la mejor herramienta para enfrentar a estas especies exóticasWe conducted a latitudinal study in natural areas of continental Chile to evaluate the occurrence of the introduced murine rodents Mus musculus, Rattus rattus and R. norvegicus. Furthermore, we evaluated the epidemiological risk of these species as part of an ongoing study on Hantavirus. The results allowed us to conclude that M. musculus occurs rarely in natural environments. However, the two species of Rattus have widely invaded the mediterranean region of Chile. Desert, altitudinal and high latitude regions seem to be restricted areas for these invasive rodents. From an epidemiological perspective, the occurrence of Hantavirus in Rattus (Andes and Seoul

  13. Contrasting patterns of polymorphism and selection in bacterial-sensing toll-like receptor 4 in two house mouse subspecies

    Czech Academy of Sciences Publication Activity Database

    Fornůsková, Alena; Bryja, Josef; Vinkler, M.; Macholán, Miloš; Piálek, Jaroslav

    2014-01-01

    Roč. 4, č. 14 (2014), s. 2931-2944 ISSN 2045-7758 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:68081766 ; RVO:67985904 Keywords : adaptive evolution * arms race * directional selection * host–pathogen interaction * MAMPs * Mus musculus * parasite-mediated selection * pattern-recognition receptors Subject RIV: EG - Zoology Impact factor: 2.320, year: 2014

  14. Experiment list: SRX655691 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fibroblast || ge...notype/variation=MED23 knockout || chip antibody=H2Bub http://dbarchive.bioscienc

  15. Experiment list: SRX191071 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available Mus musculus; ChIP-Seq source_name=Kdm2b knockdown mouse ES cells || chip antibody=Flag || antibody manufact... || cell type=embryonbic stem cells || genotype=Kdm2b knockdown http://dbarchive.

  16. Elevated expression of H19 and Igf2 in the female mouse eye.

    Directory of Open Access Journals (Sweden)

    Björn Reinius

    Full Text Available The catalogue of genes expressed at different levels in the two sexes is growing, and the mechanisms underlying sex differences in regulation of the mammalian transcriptomes are being explored. Here we report that the expression of the imprinted non-protein-coding maternally expressed gene H19 was female-biased specifically in the female mouse eye (1.9-fold, p = 3.0E-6 while not being sex-biased in other somatic tissues. The female-to-male expression fold-change of H19 fell in the range expected from an effect of biallelic versus monoallelic expression. Recently, the possibility of sex-specific parent-of-origin allelic expression has been debated. This led us to hypothesize that H19 might express biallelically in the female mouse eye, thus escape its silencing imprint on the paternal allele specifically in this tissue. We therefore performed a sex-specific imprinting assay of H19 in female and male eye derived from a cross between Mus musculus and Mus spretus. However, this analysis demonstrated that H19 was exclusively expressed from the maternal gene copy, disproving the escape hypothesis. Instead, this supports that the female-biased expression of H19 is the result of upregulation of the single maternal. Furthermore, if H19 would have been expressed from both gene copies in the female eye, an associated downregulation of Insulin-like growth factor 2 (Igf2 was expected, since H19 and Igf2 compete for a common enhancer element located in the H19/Igf2 imprinted domain. On the contrary we found that also Igf2 was significantly upregulated in its expression in the female eye (1.2-fold, p = 6.1E-3, in further agreement with the conclusion that H19 is monoallelically elevated in females. The female-biased expression of H19 and Igf2 specifically in the eye may contribute to our understanding of sex differences in normal as well as abnormal eye physiology and processes.

  17. Effects of Mutagen-Sensitive Mus Mutations on Spontaneous Mitotic Recombination in Aspergillus

    OpenAIRE

    Zhao, P.; Kafer, E.

    1992-01-01

    Methyl methane-sulfonate (MMS)-sensitive, radiation-induced mutants of Aspergillus were shown to define nine new DNA repair genes, musK to musS. To test mus mutations for effects on mitotic recombination, intergenic crossing over was assayed between color markers and their centromeres, and intragenic recombination between two distinguishable adE alleles. Of eight mutants analyzed, four showed significant deviations from mus(+) controls in both tests. Two mutations, musK and musL, reduced reco...

  18. Are ribosomal DNA clusters rearrangement hotspots? A case study in the genus Mus (Rodentia, Muridae

    Directory of Open Access Journals (Sweden)

    Douzery Emmanuel JP

    2011-05-01

    Full Text Available Abstract Background Recent advances in comparative genomics have considerably improved our knowledge of the evolution of mammalian karyotype architecture. One of the breakthroughs was the preferential localization of evolutionary breakpoints in regions enriched in repetitive sequences (segmental duplications, telomeres and centromeres. In this context, we investigated the contribution of ribosomal genes to genome reshuffling since they are generally located in pericentromeric or subtelomeric regions, and form repeat clusters on different chromosomes. The target model was the genus Mus which exhibits a high rate of karyotypic change, a large fraction of which involves centromeres. Results The chromosomal distribution of rDNA clusters was determined by in situ hybridization of mouse probes in 19 species. Using a molecular-based reference tree, the phylogenetic distribution of clusters within the genus was reconstructed, and the temporal association between rDNA clusters, breakpoints and centromeres was tested by maximum likelihood analyses. Our results highlighted the following features of rDNA cluster dynamics in the genus Mus: i rDNA clusters showed extensive diversity in number between species and an almost exclusive pericentromeric location, ii a strong association between rDNA sites and centromeres was retrieved which may be related to their shared constraint of concerted evolution, iii 24% of the observed breakpoints mapped near an rDNA cluster, and iv a substantial rate of rDNA cluster change (insertion, deletion also occurred in the absence of chromosomal rearrangements. Conclusions This study on the dynamics of rDNA clusters within the genus Mus has revealed a strong evolutionary relationship between rDNA clusters and centromeres. Both of these genomic structures coincide with breakpoints in the genus Mus, suggesting that the accumulation of a large number of repeats in the centromeric region may contribute to the high level of chromosome

  19. The loss of imprinted DNA methylation in mouse blastocysts is inflicted to a similar extent by in vitro follicle culture and ovulation induction.

    Science.gov (United States)

    Saenz-de-Juano, M D; Billooye, K; Smitz, J; Anckaert, E

    2016-06-01

    Does in vitro follicle culture (IFC) have an effect on maintenance of imprinted DNA methylation in preimplantation mouse embryos? We report similar alterations in the methylation pattern of H19 imprinted maternally expressed transcript (H19), small nuclear ribonucleoprotein polypeptide N (Snrpn) and mesoderm specific transcript (Mest) imprinted genes in mouse blastocysts obtained after ovulation induction and IFC. Furthermore, we observed no differences in the gene expression of maternal effect proteins related with imprinting maintenance between superovulated in vivo grown or IFC oocytes. Assisted reproductive technology is associated with adverse post-natal outcomes such as increased risk of premature birth, altered birthweight, congenital anomalies and genomic imprinting syndromes in human and in animal models. Previous studies have shown that ovulation induction allowed normal imprinting establishment in mouse oocytes, but interfered with imprinting maintenance during preimplantation . Normal imprinting establishment was also observed in mouse oocytes derived from a standardized IFC from the early pre-antral follicle stage. The methylation profiles of differentially methylated regions (DMRs) of three key imprinted genes (H19, Snrpn and Mest) were compared at hatched blastocyst stage between embryos obtained from IFC or superovulated oocytes, each subjected to IVF and preimplantation in vitro culture (IVC); in non-manipulated in vivo produced late blastocyst (control) and in in vivo produced 2-cell embryos that were in vitro cultured until the hatched blastocyst stage (to assess the effect of IVC). Two different mice strains (Mus musculus C57BL/6J X CBA/Ca and Mus musculus B6 (CAST7)) were used to discriminate between maternal and paternal alleles of imprinted genes. Additionally, a limiting-dilution bisulfite-sequencing technique was carried out on individual embryos in order to avoid amplification bias. To assess whether IFC and ovulation induction

  20. NCBI nr-aa BLAST: CBRC-RNOR-04-0256 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-04-0256 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

  1. NCBI nr-aa BLAST: CBRC-STRI-01-1973 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1973 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9E...Q46|VN1B7_MOUSE RecName: Full=Vomeronasal type-1 receptor B7; AltName: Full=Vomeronasal type-1 receptor A11 ...gb|AAG42087.1|AF291493_1 vomeronasal receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A1...1 [Mus musculus] gb|AAI41627.1| Vomeronasal 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasa

  2. NCBI nr-aa BLAST: CBRC-RNOR-04-0238 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-04-0238 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

  3. NCBI nr-aa BLAST: CBRC-MMUS-06-0122 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-06-0122 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

  4. NCBI nr-aa BLAST: CBRC-STRI-01-1277 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-1277 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

  5. NCBI nr-aa BLAST: CBRC-STRI-01-2495 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2495 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

  6. NCBI nr-aa BLAST: CBRC-STRI-01-2240 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2240 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

  7. NCBI nr-aa BLAST: CBRC-OCUN-01-1141 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1141 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

  8. NCBI nr-aa BLAST: CBRC-MMUS-06-0135 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-06-0135 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

  9. NCBI nr-aa BLAST: CBRC-STRI-01-2627 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2627 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9E...Q52|VN1A3_MOUSE RecName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A6 g...b|AAG42076.1|AF291482_1 vomeronasal receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 ...[Mus musculus] gb|AAI41612.1| Vomeronasal 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasa

  10. NCBI nr-aa BLAST: CBRC-RNOR-04-0259 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-04-0259 ref|NP_444458.1| vomeronasal 1 receptor, B7 [Mus musculus] sp|Q9EQ46|VN1B7_MOUSE Vomeronas...al type-1 receptor B7 (Vomeronasal type-1 receptor A11) gb|AAG42087.1|AF291493_1 vomeronasa...l receptor V1RB7 [Mus musculus] dbj|BAB79217.1| vomeronasal receptor 1 A11 [Mus musculus] gb|AAI41627.1| Vomeronasa...l 1 receptor, B7 [synthetic construct] gb|AAI40251.1| Vomeronasal

  11. Effects of mutagen-sensitive mus mutations on spontaneous mitotic recombination in Aspergillus.

    Science.gov (United States)

    Zhao, P; Kafer, E

    1992-04-01

    Methyl methane-sulfonate (MMS)-sensitive, radiation-induced mutants of Aspergillus were shown to define nine new DNA repair genes, musK to musS. To test mus mutations for effects on mitotic recombination, intergenic crossing over was assayed between color markers and their centromeres, and intragenic recombination between two distinguishable adE alleles. Of eight mutants analyzed, four showed significant deviations from mus+ controls in both tests. Two mutations, musK and musL, reduced recombination, while musN and musQ caused increases. In contrast, musO diploids produced significantly higher levels only for intragenic recombination. Effects were relatively small, but averages between hypo- and hyperrec mus differed 15-20-fold. In musL diploids, most of the rare color segregants resulted from mitotic malsegregation rather than intergenic crossing over. This indicates that the musL gene product is required for recombination and that DNA lesions lead to chromosome loss when it is deficient. In addition, analysis of the genotypes of intragenic (ad+) recombinants showed that the musL mutation specifically reduced single allele conversion but increased complex conversion types (especially recombinants homozygous for ad+). Similar analysis revealed differences between the effects of two hyperrec mutations; musN apparently caused high levels solely of mitotic crossing over, while musQ increased various conversion types but not reciprocal crossovers. These results suggest that mitotic gene conversion and crossing over, while generally associated, are affected differentially in some of the mus strains of Aspergillus nidulans.

  12. Mutations at the mei-41, mus(1)101, mus(1)103, mus(2)205 and mus(3)310 loci of Drosophila exhibit differential UDS responses with different DNA-damaging agents

    International Nuclear Information System (INIS)

    Dusenbery, R.L.

    1987-01-01

    5 mutagen-sensitive mutants of Drosophila melanogaster, reported to perform normal or only slightly reduced excision repair of UV damage, were examined by an unscheduled DNA synthesis (UDS) assay. 2 mutants, classified as completely or partially proficient for both excision and postreplication repair of UV damage, mus(1)103 and mus(2)205, were found to give positive UDS responses only for UV damage. These mutants exhibit no measurable UDS activity following DNA damage by several different alkylating agents and X-rays. 3 mutants, classified as having no defect in excision repair, but measurable defects in postreplication repair of UV damage, exhibit 3 different response patterns. The mutant mei-41 exhibits a highly positive UDS response following damage by all agents, consistent with its prior classification as excision-repair-proficient, but postreplication-repair-deficient for UV damage. The mutant mus(1)101, however, exhibits a strong positive UDS response following only UV damage and appears to be blocked in the excision repair of damage produced by both alkylating agents and X-irradiation. Finally, mus(3)310 exhibits no UDS response to alkylation, X-ray or UV damage. This is not consistent with its previous classification. Results obtained w0272the qualitative in vitro UDS assay are entirely consistent with the results from two separate in vivo measures of excision repair deficiency followign DNA damage, larval hypersensitivity to killing and hypermutability in the sex-linked recessive lethal test. (Auth.)

  13. Acute MUS81 depletion leads to replication fork slowing and a constitutive DNA damage response

    DEFF Research Database (Denmark)

    Xing, Meichun; Wang, Xiaohui; Palmai-Pallag, Timea

    2015-01-01

    have investigated the role of MUS81 in human cells by acutely depleting the protein using shRNAs. We found that MUS81 depletion from human fibroblasts leads to accumulation of ssDNA and a constitutive DNA damage response that ultimately activates cellular senescence. Moreover, we show that MUS81...

  14. Rad54 and Mus81 cooperation promotes DNA damage repair and restrains chromosome missegregation

    DEFF Research Database (Denmark)

    Ghamrasni, S El; Cardoso, R; Li, L

    2016-01-01

    . The inefficient repair of DNA double-strand breaks (DSBs) in Rad54(-/-)Mus81(-/-) cells was accompanied by elevated levels of chromosome missegregation and cell death. Perhaps as a consequence, tumor incidence in Rad54(-/-)Mus81(-/-) mice remained comparable to that in Mus81(-/-) mice. Our study highlights...

  15. Acute Radiation Syndrome Severity Score System in Mouse Total-Body Irradiation Model.

    Science.gov (United States)

    Ossetrova, Natalia I; Ney, Patrick H; Condliffe, Donald P; Krasnopolsky, Katya; Hieber, Kevin P

    2016-08-01

    Radiation accidents or terrorist attacks can result in serious consequences for the civilian population and for military personnel responding to such emergencies. The early medical management situation requires quantitative indications for early initiation of cytokine therapy in individuals exposed to life-threatening radiation doses and effective triage tools for first responders in mass-casualty radiological incidents. Previously established animal (Mus musculus, Macaca mulatta) total-body irradiation (γ-exposure) models have evaluated a panel of radiation-responsive proteins that, together with peripheral blood cell counts, create a multiparametic dose-predictive algorithm with a threshold for detection of ~1 Gy from 1 to 7 d after exposure as well as demonstrate the acute radiation syndrome severity score systems created similar to the Medical Treatment Protocols for Radiation Accident Victims developed by Fliedner and colleagues. The authors present a further demonstration of the acute radiation sickness severity score system in a mouse (CD2F1, males) TBI model (1-14 Gy, Co γ-rays at 0.6 Gy min) based on multiple biodosimetric endpoints. This includes the acute radiation sickness severity Observational Grading System, survival rate, weight changes, temperature, peripheral blood cell counts and radiation-responsive protein expression profile: Flt-3 ligand, interleukin 6, granulocyte-colony stimulating factor, thrombopoietin, erythropoietin, and serum amyloid A. Results show that use of the multiple-parameter severity score system facilitates identification of animals requiring enhanced monitoring after irradiation and that proteomics are a complementary approach to conventional biodosimetry for early assessment of radiation exposure, enhancing accuracy and discrimination index for acute radiation sickness response categories and early prediction of outcome.

  16. Phenotypic and epistatic grouping of hypo- and hyper-rec mus mutants in Aspergillus.

    Science.gov (United States)

    Kafer, E; Chae, S K

    1994-03-01

    The mutants musK to musS of Aspergillus nidulans are sensitive to methyl-methanesulfonate (MMS) and several of them are meiotic-defective and alter mitotic recombination frequencies. All were found to be cross-sensitive to 4-nitro-quinoline-N-oxide (4-NQO) but unexpectedly none of them was hypersensitive to gamma-rays and few to UV light. Double mus; uvs mutants were constructed to test for interactions with uvs mutations of the four epistatic groups of Aspergillus, "UvsF", "UvsC", "UvsI", and "UvsB". All meiotic-defective mus mutations caused some lethal interactions, usually with uvsF. None of them showed epistasis with UvsF or UvsB group mutants and one, musO, may represent a new group. Three mus mutations that affect recombination were assigned to the UvsC group, namely musN and K, and also musL which is recombination-defective and closely resembles uvsC. While uvsC mutants are mutators and lack UV-mutagenesis, most mus mutants had no effects on mutation. Only musR, which appeared epistatic with uvsI, showed reduced UV-reversion frequencies similar to uvsI. The recombination-proficient mus mutants appeared to be epistatic with more than one group, but in several cases sensitivities were slight and overlaps insufficient to obtain corroborating results with MMS and 4-NQO.

  17. Phosphorylation by CK2 regulates MUS81/EME1 in mitosis and after replication stress.

    Science.gov (United States)

    Palma, Anita; Pugliese, Giusj Monia; Murfuni, Ivana; Marabitti, Veronica; Malacaria, Eva; Rinalducci, Sara; Minoprio, Anna; Sanchez, Massimo; Mazzei, Filomena; Zolla, Lello; Franchitto, Annapaola; Pichierri, Pietro

    2018-06-01

    The MUS81 complex is crucial for preserving genome stability through the resolution of branched DNA intermediates in mitosis. However, untimely activation of the MUS81 complex in S-phase is dangerous. Little is known about the regulation of the human MUS81 complex and how deregulated activation affects chromosome integrity. Here, we show that the CK2 kinase phosphorylates MUS81 at Serine 87 in late-G2/mitosis, and upon mild replication stress. Phosphorylated MUS81 interacts with SLX4, and this association promotes the function of the MUS81 complex. In line with a role in mitosis, phosphorylation at Serine 87 is suppressed in S-phase and is mainly detected in the MUS81 molecules associated with EME1. Loss of CK2-dependent MUS81 phosphorylation contributes modestly to chromosome integrity, however, expression of the phosphomimic form induces DSBs accumulation in S-phase, because of unscheduled targeting of HJ-like DNA intermediates, and generates a wide chromosome instability phenotype. Collectively, our findings describe a novel regulatory mechanism controlling the MUS81 complex function in human cells. Furthermore, they indicate that, genome stability depends mainly on the ability of cells to counteract targeting of branched intermediates by the MUS81/EME1 complex in S-phase, rather than on a correct MUS81 function in mitosis.

  18. NCBI nr-aa BLAST: CBRC-PTRO-04-0004 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-04-0004 sp|Q8VBS7|VN1A6_MOUSE Vomeronasal type-1 receptor A6 (Vomeronasal... type-1 receptor A3) (Vomeronasal type-1 receptor A1) (Vomeronasal type-1 receptor A10) dbj|BAB79209.1| vomeronasa...l receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasal receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasa

  19. AcEST: DK950692 [AcEST

    Lifescience Database Archive (English)

    Full Text Available |Q8VC52|RBPS2_MOUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length ...ultiple splicing OS=Mus musculus GN=Rbpms PE=2 SV=1 Length = 197 Score = 77.0 bits (188), Expect = 8e-14 Ide...S_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Length = 196 Score =

  20. AcEST: DK958175 [AcEST

    Lifescience Database Archive (English)

    Full Text Available USE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 36...>sp|Q9YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Lengt... EEVRTLFVSGLPIDIKPRELYLLFRPFKGYE 47 >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms

  1. AcEST: DK955384 [AcEST

    Lifescience Database Archive (English)

    Full Text Available >sp|Q9WVB0|RBPMS_MOUSE RNA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms...OUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Score = 5...XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms PE=2 SV=1 Length = 196 Score = 5

  2. AcEST: DK953370 [AcEST

    Lifescience Database Archive (English)

    Full Text Available PS2_MOUSE RNA-binding protein with multiple splicing 2 OS=Mus musculus GN=Rbpms2 PE=1 SV=1 Length = 206 Scor...NA-binding protein with multiple splicing OS=Mus musculus GN=Rbpms PE=2 SV=1 Leng...FDPEIPQTLRLEFAKANTK 104 >sp|Q9YGP5|RBPMS_XENLA RNA-binding protein with multiple splicing OS=Xenopus laevis GN=rbpms

  3. Fighting in the home cage: Agonistic encounters and effects on neurobiological markers within the social decision-making network of house mice (Mus musculus).

    Science.gov (United States)

    Greenberg, Gian D; Howerton, Chris L; Trainor, Brian C

    2014-04-30

    Inbred strains of mice, such as C57Bl/6, have become preferred animal models for neurobehavioral studies. A main goal in creating inbred lines is to reduce the effects of individual genetic variation on observed phenotypes. Most studies use only males, and there is increasing evidence that agonistic interactions within the home cage may produce systematic variability in behavior and brain function. Previous studies have demonstrated that the outcomes of aggressive interactions have powerful effects on the brain and behavior, but less is known about whether aggressive interactions within the home cage have similar effects. We assessed group-housed laboratory mice C57Bl/6 for competitive ability and then tested the extent high competitive ability (CA) or low CA was related to gene and protein expression within related pathways. We focused on a broad social behavior network, including the nucleus accumbens (NAc) and bed nucleus of the stria terminalis (BNST). High CA mice had significantly more corticotropin releasing hormone receptor 2 (CRHR2) and estrogen receptor alpha (ESR1) mRNA in the BNST. Our data suggest a simple test of CA could yield valuable information that could be used to reduce error variance and increase power in neurobiological studies using mice. Copyright © 2014 Elsevier Ireland Ltd. All rights reserved.

  4. 1800 MHz mobile phone irradiation induced oxidative and nitrosative stress leads to p53 dependent Bax mediated testicular apoptosis in mice, Mus musculus.

    Science.gov (United States)

    Shahin, Saba; Singh, Surya P; Chaturvedi, Chandra M

    2018-09-01

    Present study was carried out to investigate the effect of long-term mobile phone radiation exposure in different operative modes (Dialing, Receiving, and Stand-by) on immature male mice. Three-week old male mice were exposed to mobile phone (1800 MHz) radiation for 3 hr/day for 120 days in different operative modes. To check the changes/alteration in testicular histoarchitecture and serum testosterone level, HE staining and ELISA was performed respectively. Further, we have checked the redox status (ROS, NO, MDA level, and antioxidant enzymes: SOD, CAT, and GPx) by biochemical estimation, alteration in the expression of pro-apoptotic proteins (p53 and Bax), active executioner caspase-3, full length/uncleaved PARP-1 (DNA repair enzyme), anti-apoptotic proteins (Bcl-2 and Bcl-x L ) in testes by immunofluorescence and cytosolic cytochrome-c by Western blot. Decreased seminiferous tubule diameter, sperm count, and viability along with increased germ cells apoptosis and decreased serum testosterone level, was observed in the testes of all the mobile phone exposed mice compared with control. We also observed that, mobile phone radiation exposure in all the three different operative modes alters the testicular redox status via increasing ROS, NO, and MDA level, and decreasing antioxidant enzymes levels leading to enhanced apoptosis of testicular cells by increasing the expression of pro-apoptotic and apoptotic proteins along with decreasing the expression of anti-apoptotic protein. On the basis of results, it is conclude that long-term mobile phone radiation exposure induced oxidative stress leads to apoptosis of testicular cells and thus impairs testicular function. © 2018 Wiley Periodicals, Inc.

  5. THE EFFECT OF CIPLUKAN (Physalis angulata L. FRUIT EXTRACT ON SGPT AND SGOT LEVELS AGAINST WHITE MALE MICE (Mus musculus HYPERGLYCEMIA INDUCED BY ALLOXAN AS BIOLOGY LEARNING RESOURCES

    Directory of Open Access Journals (Sweden)

    Nur Lailatul Fitri

    2016-07-01

    Full Text Available Ciplukan (Physalis angulata L. used by the community as an antidiabetic drug. Antidiabetic effects caused ciplukan fruit of this plant contain chemicals flavonoids with the percentage of fruit extract 300 mg / ml was 84%. Flavonoids are antioxidant compounds one that works a treat or neutralize free radicals that are expected with the administration of these antioxidants can be inhibited damage to body cells and can prevent damage to the body and the onset of degenerative diseases. This type of research is True Experimental Research. The research design using The Posttest-Only Control Group Design. The research design used completely randomized design (CRD. This research data is data SGPT and SGOT levels. Analysis of data using one-way analysis of variance at significance level of 0.05 and Duncan 5%. The results showed that different doses of fruit extract ciplukan effect on SGPT and SGOT levels of mice. Duncan test showed that the treatment dose ciplukan fruit extract is the most effective dose of 2 ml / kg. The research results can be used by teachers as information of an alternative to utilize medical plants of hyperglicemia and antiocsidant on Biology subject for X Grade of Senior High School, especially on the concept Maintenance and Utilizing of Biological Diversity in Core Competence 4

  6. Tapak liman (Elephantopus scaber L) extract-induced CD4+ and CD8+ differentiation from hematopoietic stem cells and progenitor cell proliferation in mice (Mus musculus L)

    Science.gov (United States)

    Djati, Muhammad Sasmito; Habibu, Hindun; Jatiatmaja, Nabilah A.; Rifa'i, Muhaimin

    2017-11-01

    Tapak Liman (Elephantopus scaber L) is a traditional medicinal plant containing several active compounds that potentially affecting hematopoietic stem cells, such as epifrieelinol, lupeol, stigmasterol, triacontane-1-ol, dotriacontane-1-ol, lupeol acetate, deoxyelephan-topin, isodeoxyelephantopin, polyphenol luteolin-7, as well as various flavonoids and glucosides. The aim of this study was to elucidate the effect of leaf extract of Tapak Liman on hematopoietic stem cells in mice BALB/c, by observation of the relative number of cells expressing CD4/CD8, CD4/CD62L, and TER119/B220 in the spleen, and TER119/B220, TER119/VLA-4 and TER119/CD34 in bone marrow, after being administered leaf extract for 2 weeks. This experiment used 12 female mice, which were divided into three treatment groups, P1= 0.5 g.g bw-1.day-1, P2= 1.0 g.g bw-1.day-1 and P3=2.0 g.g bw-1.day-1 Tapak Liman leaf extract as well as a control. The relative numbers of cells expressing surface molecules were analyzed by flowcytometry and quantitative data were tested using one-way ANOVA. The results showed that the leaf extract of Tapak Liman has no significant effect on erythrocyte proliferation; on the other hand, it had a significant effect on both proliferation and differentiation of B lymphocytes (B220+) in bone marrow (p=0.044) and increased the expression of CD4+, CD8+ molecule in B cells (p=0.026) and erythroid cells in spleen and bone marrow, based on the estimation of cells that expressed TER119+VLA-4+, identified as important in the development pathway of erythrocytes. An increased cell percentage of TER11+VLA-4+ occurred for treatment P2, 12% higher than the control. The increased expression of TER119+VLA-4+ was assumed to be due to the iron content in Tapak Liman, which functioned to stimulate the progenitor hematopoietic cells to proliferate and differentiate into a precursor of erythroid cells (TER119+VLA-4+). There was an increasing number of cells expressing the surface molecules TER119+ and VLA-4+. This indicated that the Tapak Liman leaf extract with a dose of 1.0 g.g bw-1.day-1 could stimulate the proliferation of hematopoietic stem cells into the lymphoid and erythroid pathway, in spleen and bone marrow.

  7. Efecto embriotóxico y teratogénico de Ruta chalepensis L. «ruda», en ratón (Mus musculus

    Directory of Open Access Journals (Sweden)

    José Gonzales

    2013-05-01

    Full Text Available Ruta graveolens L. y R. chalepensis L. son plantas usadas en medicina folclórica como antiespasmódicos, antihelmínticos, antimicrobianos, emenagogos y abortivos. En el presente trabajo se evaluó el efecto del extracto acuoso liofilizado (EAL de las hojas de R. chalepensis en embriones postimplantacionales de ratón. Ratonas albinas preñadas recibieron intraperitonalmente (ip 10 mg de ruda liofilizada/kg de peso corporal (grupo tratado, n=12 durante el periodo post-implantacional (día 9 – día 17 post-cópula, y un grupo control(C, n=18, que recibió sólo agua destilada durante el mismo período. El EAL de ruda no afectó negativamente el peso de la madre pero sí del útero durante el tratamiento (p<0,05. En el grupo tratado la frecuencia de reabsorciones fetales fue mayor (p<0,05 y el peso fetal fue significativamente menor en comparación con el control (p<0,01. Además en el grupo tratado se evidenció la presencia de malformaciones esqueléticas. En conclusión, encontramos que el EAL de R. chalepensis muestra efectos embriotóxicos en ratones expuestos durante el período postimplantacional.

  8. Nullification of aspirin induced gastrotoxicity and hepatotoxicity by prior administration of wheat germ oil in Mus musculus: histopathological, ultrastructural and molecular studies.

    Science.gov (United States)

    Mohamed, H R H; Hamad, S R

    2017-08-30

    Aspirin (acetyl salicylic acid) is used worldwide to treat various inflammatory conditions and prevent cardiovascular disease, along with reducing the risk of cancer. However, administration of aspirin causes toxic effects, especially in the stomach and liver. Thus, our study examined the protective effect of wheat germ oil on aspirin-induced toxicity in the stomach and liver tissues of Swiss albino mice. Administration of wheat germ oil before aspirin has restored normal hepatic and gastric tissue architecture and DNA integrity has become better than that of a negative health control group compared with the aspirin only treated group. The elevated gastric nitric oxide content in the aspirin only treated group was significantly decreased by wheat germ oil prior administration as a result of reduced the expression of inducible nitric synthase and increased the expression of endothelial nitric oxide synthase compared to their expression in the aspirin administered group. Wheat germ oil pre-administration significantly reduced the level of malondialdehyde, increased the level of glutathione and catalase and superoxide dismutase activities compared with those in aspirin only treated group. We conclude that wheat germ oil has a potential protective effect against aspirin induced gastro- and hepato-toxicity because of its free radical scavenging ability.

  9. Perbedaan Efek Pemberian Topikal Gel Lidah Buaya (Aloe vera L. Dengan Solusio Povidone Iodine Terhadap Penyembuhan Luka Sayat Pada Kulit Mencit (Mus musculus

    Directory of Open Access Journals (Sweden)

    Nur Atik

    2009-06-01

    Full Text Available Normal wound healing is a complex and dynamic process. Wound healing process can accelerate, with chemical treatment or natural. The chemical treatment often used in healing process is povidone iodine. For natural treatment, topical application of Aloe vera gel may accelerate the full-thickness wound healing process. The purpose of this research was to evaluate the differences between topical application of povidone iodine and Aloe vera gel for skin wound healing in mice. This study used 18 mice that were divided into three groups. First group was the wounded (control group, the second group was wounded – Aloe vera group, the third group was wounded - povidone iodine group. Full-thickness skin wound were created on the dorsal area of mice in each group. The control group were not given anything, while the second group were given Aloe vera gel twice a day, and the third group were given povidone iodine solution twice a day. At the fifth day, all mice were sacrificed for histologic evaluation and VEGF A expression. Data was obtained by microscopic observation of the wounded skin, based on quantitative parameter: epithelial thickness, total fibroblast, total blood vessels, and VEGF A expression. Then the data was statistically analyzed by using independent samples T test, ANOVA, and Chi square. The result demonstrated that the sum of epithelial thickness, fibroblast, blood vessels, and VEGF A expression in the Aloe vera group is higher than in povidone iodine group. Statistic evaluation showed that there were significant differences between the two groups (p < 0.05, with 95% confidence interval. Based on this result, it can be concluded that the topical administration of Aloe vera gel twice a day is better than povidone iodine with parameter epithelial thickness, total fibroblass, total blood vessels and VEGF A expression.

  10. Protective Effect of Parsley Juice (Petroselinum crispum, Apiaceae against Cadmium Deleterious Changes in the Developed Albino Mice Newborns (Mus musculus Brain

    Directory of Open Access Journals (Sweden)

    Ahmed A. Allam

    2016-01-01

    Full Text Available Parsley was used as a probe of the current experiment to prevent the behavioral, morphological and biochemical changes in the newborn brain following the administration of cadmium (Cd to the pregnant mice. The nonanesthetized pregnant mice were given daily parsley juice (Petroselinum crispum at doses of 20 mg/kg and 10 mg/kg. Pregnant mothers were given Cd at a dose of 30 mg/kg divided into 3 equal times. The newborns have been divided into 6 groups: Group A, mothers did not take treatment; Groups B and C, mothers were treated with low and high dose of parsley, respectively; Group D, mothers were treated only with Cd (perinatal intoxication; Groups E and F, mothers were treated with Cd doses and protected by low and high doses of parsley, respectively. Light microscopy showed that Cd-induced neuronal degeneration by chromatolysis and pyknosis in the brain regions. The low dose of parsley 10 g/kg/day exhibited significant effects in neutralizing and reducing the deleterious changes due to Cd exposure during pregnancy on the behavioral activities, neurotransmitters, oxidative stress, and brain neurons morphology of the mice newborns.

  11. Protective Effect of Parsley Juice (Petroselinum crispum, Apiaceae) against Cadmium Deleterious Changes in the Developed Albino Mice Newborns (Mus musculus) Brain.

    Science.gov (United States)

    Allam, Ahmed A; Maodaa, Salah N; Abo-Eleneen, Rasha; Ajarem, Jamaan

    2016-01-01

    Parsley was used as a probe of the current experiment to prevent the behavioral, morphological and biochemical changes in the newborn brain following the administration of cadmium (Cd) to the pregnant mice. The nonanesthetized pregnant mice were given daily parsley juice (Petroselinum crispum) at doses of 20 mg/kg and 10 mg/kg. Pregnant mothers were given Cd at a dose of 30 mg/kg divided into 3 equal times. The newborns have been divided into 6 groups: Group A, mothers did not take treatment; Groups B and C, mothers were treated with low and high dose of parsley, respectively; Group D, mothers were treated only with Cd (perinatal intoxication); Groups E and F, mothers were treated with Cd doses and protected by low and high doses of parsley, respectively. Light microscopy showed that Cd-induced neuronal degeneration by chromatolysis and pyknosis in the brain regions. The low dose of parsley 10 g/kg/day exhibited significant effects in neutralizing and reducing the deleterious changes due to Cd exposure during pregnancy on the behavioral activities, neurotransmitters, oxidative stress, and brain neurons morphology of the mice newborns.

  12. Effect of Diet High in Coconut Oil on Cardiovascular Disease Risk in ApoE Knockout and Wild Type Mice (Mus musculus)

    Science.gov (United States)

    2016-04-07

    Objective: We evaluated the risk of cardiovascular disease in both control and proatherosclerotic mice consuming diets high in coconut oil. Methods...evaluated by a pathologist blinded to treatment. Results: There were no differences in the average weight gain or amount of diet consumed regardless of...genotype or diet consumed . Similarly, there were no differences in total cholesterol, HDL, and triglyceride in any of the groups. Statistically

  13. Protective propensity of bacoside A and bromelain on renal cholinesterases, γ-Aminobutyric acid and serotonin level of Mus musculus intoxicated with dichlorvos.

    Science.gov (United States)

    Agarwal, Sonam; Chaudhary, Bharti; Bist, Renu

    2017-01-05

    Current study established a protective action of bacoside A and bromelain against the toxic effects of dichlorvos in kidneys of mice. Experimental design included five groups. The first group was control. Mice of groups II, III and IV were administered doses of dichlorvos, bromelain and bacoside A respectively. In group V, mice were treated with both the antioxidants (bacoside A and bromelain) and dichlorvos. After 21 days of exposure of different doses, levels of acetylcholinesterase (AChE), butyrylcholinesterase (BChE), γ-aminobutyric acid (GABA) and serotonin were measured in renal tissues. Dichlorvos significantly reduced the kidney AChE (p GABA level (p level (p GABA level. Meanwhile, a significant decline in serotonin level (p < 0.001) was revealed, compared to dichlorvos exposed mice. Bacoside A and bromelain occupy a tremendous antioxidant action in the mice kidneys and a combination of the same ameliorates the renal toxicity induced by dichlorvos. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  14. PENGARUH PEMBERIAN EKSTRAK BUAH PISANG (Musa acuminate L DAN BUAH ALPUKAT (Persea americana Mill TERHADAP BERAT HATI MENCIT (Mus musculus BETINA

    Directory of Open Access Journals (Sweden)

    Heny Utami Ningsih

    2018-02-01

    Full Text Available Male reproductive ability ability has a linear correlation with libido and testosterone. Both are associated with various things main food consumption such as protein, vitamins and minerals. Aphrodisiac  is an ingredient or drug that arouses sexual arousal or libido. Pumpkin is an example of food from plants with the highest content of zinc. This study was to determine whether there is a difference between the content of zinc on the peel, flesh and pumpkin seeds against sexual activity of mice. The experimental animals used were 24 male, group I mice as control group, Group II was grouped with pumpkin peel extract, Group III was grouped with extract of pumpkin flesh, Group IV was grouped with extract of pumpkin seeds. The dose used is 2gr / kg BB and volume of 0.2 ml is given for 35 days. Sexual Activity is observed every day  by the position of male mice riding females. Based on Anova One Way test results showed there are differences in sexual activity  mice males in each group (ρ 0.000. The difference of the result of the number of mounts indicated that the giving of yellow pumpkin extract had an effect on the increase of mating behavior of male mice. The group treated with the extract of pumpkin flesh showed the highest number of mice mounts (mean = 24,1667.Further research is needed to get a clearer picture of the composition of the pumpkin nutrients that indirectly affect fertility in men.

  15. Effects of Topical Anesthetics on Behavior, Plasma Corticosterone, and Blood Glucose Levels after Tail Biopsy of C57BL/6NHSD Mice (Mus musculus).

    Science.gov (United States)

    Dudley, Emily S; Johnson, Robert A; French, DeAnne C; Boivin, Gregory P

    2016-01-01

    Tail biopsy is a common procedure that is performed to obtain genetic material for determining genotype of transgenic mice. The use of anesthetics or analgesics is recommended, although identifying safe and effective drugs for this purpose has been challenging. We evaluated the effects of topical 2.5% lidocaine-2.5% prilocaine cream applied to the distal tail tip at 5 or 60 min before biopsy, immersion of the tail tip for 10 seconds in ice-cold 70% ethanol just prior to biopsy, and immersion of the tail tip in 0.5% bupivacaine for 30 s after biopsy. Mice were 7, 11, or 15 d old at the time of tail biopsy. Acute behavioral responses, plasma corticosterone, and blood glucose were measured after biopsy, and body weight and performance in elevated plus maze and open-field tests after weaning. Ice-cold ethanol prior to biopsy prevented acute behavioral responses to biopsy, and both ice-cold ethanol and bupivacaine prevented elevations in corticosterone and blood glucose after biopsy. Tail biopsy with or without anesthesia did not affect body weight or performance on elevated plus maze or open-field tests. We recommend the use of ice-cold ethanol for topical anesthesia prior to tail biopsy in mice 7 to 15 d old.

  16. The effect of pomelo citrus (Citrus maxima var. Nambangan), vitamin C and lycopene towards the number reduction of mice (Mus musculus) apoptotic hepatocyte caused of ochratoxin A

    Science.gov (United States)

    Badriyah, Hastuti, Utami Sri

    2017-06-01

    Foods can contaminated by some mycotoxin produced by molds. Ochratoxin A is a sort of mycotoxin that cause structural damage on hepatocytes. Pomelo citrus (Citrus maxima var. Nambangan) contain vitamin C and lycopene that have antioxidant character. This research is done to: 1)examine the effect of pomelo citrus juice, vitamin C, and lycopene treatment towards the number reduction of mice apoptotic hepatocytes caused by ochratoxin A exposure, 2)examine the effect of vitamin C mixed with lycopene treatment towards the number reduction of mice apoptotic hepatocytes caused by ochratoxin A exposure. The experimental group used male mice strain BALB-C in the age of three month and bodyweight 20-30 grams devided in 4 experiment group and control group. The experiment group I were administered pomelo citrus juice 0,5 ml/30 grams BW/day orally during 2 weeks and then administered with ochratoxin in the dose of 1 mg/kg BW during 1 week. The experiment group II were administered with vitamin C in the dose of 5,85 µg/30g BW with the same methods. The experiment group III were administered with lycopene in the dose of 0,1025 µg/30 g BW with the same methods. The experiment group IV were administered with vitamin C mixed with lycopene with the same methods. The control group were administered with ochratoxin A in the dose of 1 mg/kg BW per oral during 1 week. The apoptotic hepatocyte number were count by microscopic observation of hepatocyte slides from experiment group as well as control group with cytochemical staining. The research result shows that: 1) the pomelo citrus juice, vitamin C as well as lycopene administration could reduce the mice apoptotic hepatocyte number caused by ochratoxin A exposure, compared with the mice apoptotic hepatocyte number caused by ochratoxin A exposure only; 2) the vitamin C mixed with lycopene could reduce the mice apoptotic hepatocyte number caused by ochratoxin A exposure compared with the mice apoptotic hepatocyte number caused by ochratoxin exposure only.

  17. Swiss albino farelerde-Mus musculus, tartrazin’in neden olduğu fizyolojik ve biyokimyasal parametrelerindeki değişiklikler

    OpenAIRE

    Arefin, Sayema; Hossain, Mohammad Salim; Neshe, Shamme Akter; Rashid, Md. Mamun Or; Tohidul Amin, Mohammad; Hussain, Md. Saddam

    2017-01-01

    Günümüzde sentetik gıda boyaları, şekerlemelerde, ilaçlarda vekozmetiklerde renklendirici olarak sıklıkla kullanılmaktadır.Çalışmamızda, geniş kullanım alanı olan bir azo boyar maddetartrazin’inSwiss albino farelerdeki toksik etkilerinin tespitedilmesi hedeflendi. Normal diyetle beslenen laboratuvarhayvanlarına tartrazin 200mg/kg ve 400mg/kg dozlardauygulandı. Tartrazin’in toksik etkisini incelemek için çeşitlifizyolojik ve biyokimyasal parametreler değerlendirildi.Çalışmamızda tartrazin’in 4...

  18. The Effect of Red Fruit's (Pandanus conoideus Extract to Eritrocytes, Hemoglobin, PCV and TPP Concentrations of Mice (Mus musculus Infected by Toxoplasma gondii

    Directory of Open Access Journals (Sweden)

    Anis Dwi Utami

    2014-11-01

    Full Text Available Toxoplasmosis is a zoonotic parasites caused by Toxoplasma gondii. The red fruit’s extract contains tocopherol and betacarotene as antioxidant and it can repair the bodies immune system. This research was aimed to study the effect of red fruit’s extract to erithrocytes, hemoglobine, the values of PCV and TPP concentration of mice infected with T. gondii, so that the red fruit extract can be used as alternative herbal medicine for eliminating Toxoplasmosis. 15 of Balb/C mice, male, three months, 30 gr of body weight were used as experimental animals. The mice were then devided into three groups. Group I was a control, group II  was tachyzoite infected and group III was tachyzoite infected and given red fruit’s extract. Group III given red fruit’s extract on first day with 0,53 g/kg BW/mice/day. Mice in group II and III were infected by injection Toxoplasma gondii tachyziote 1x103 a mice intraperitoneally. The blood sample was taken from five mice in each group at 7th and 12th day pass through cantus medialis. The blood was examinated in Clinical Pathology Laboratory, Faculty of Veterinary Medicine, Gadjah Mada University. Data were analyzed by using Factorial 2 x 3. The result showed no significant difference (P>0,05 in hemoglobin, and PCV’s value between groups I, II and III before and after infection of T. gondii’s tachyzoite. The TPP’s value between groups I, II and III before and after infection of T. gondii’s tachyzoite was significantly difference (P<0,05.

  19. Regional thermal specialisation in a mammal: temperature affects power output of core muscle more than that of peripheral muscle in adult mice (Mus musculus).

    Science.gov (United States)

    James, Rob S; Tallis, Jason; Angilletta, Michael J

    2015-01-01

    In endotherms, such as mammals and birds, internal organs can specialise to function within a narrow thermal range. Consequently, these organs should become more sensitive to changes in body temperature. Yet, organs at the periphery of the body still experience considerable fluctuations in temperature, which could select for lower thermal sensitivity. We hypothesised that the performance of soleus muscle taken from the leg would depend less on temperature than would the performance of diaphragm muscle taken from the body core. Soleus and diaphragm muscles were isolated from mice and subjected to isometric and work-loop studies to analyse mechanical performance at temperatures between 15 and 40 °C. Across this thermal range, soleus muscle took longer to generate isometric force and longer to relax, and tended to produce greater normalised maximal force (stress) than did diaphragm muscle. The time required to produce half of maximal force during isometric tetanus and the time required to relax half of maximal force were both more sensitive to temperature in soleus than they were in diaphragm. However, thermal sensitivities of maximal force during isometric tetani were similar for both muscles. Consistent with our hypothesis, power output (the product of speed and force) was greater in magnitude and more thermally sensitive in diaphragm than it was in soleus. Our findings, when combined with previous observations of muscles from regionally endothermic fish, suggest that endothermy influences the thermal sensitivities of power output in core and peripheral muscles.

  20. Infrared and optical observations of Nova Mus 1983

    International Nuclear Information System (INIS)

    Whitelock, P.A.; Carter, B.S.; Feast, M.W.; Glass, I.S.; Laney, D.; Menzies, J.W.

    1984-01-01

    Extensive optical (UBVRI) and infrared (JHKL) photometry of Nova Mus 1983 obtained over a period of 300 days is tabulated. Infrared and optical spectra are described. Although by classical definition this was a fast nova its later development was slower than for typical objects of this class. Surprisingly the development of infrared thermal dust emission did not occur. Throughout the period covered, the infrared emission was characteristic of a bound-free plus free-free plasma continuum with emission lines. (author)

  1. Detection of expression quantitative trait Loci in complex mouse crosses: impact and alleviation of data quality and complex population substructure.

    Science.gov (United States)

    Iancu, Ovidiu D; Darakjian, Priscila; Kawane, Sunita; Bottomly, Daniel; Hitzemann, Robert; McWeeney, Shannon

    2012-01-01

    Complex Mus musculus crosses, e.g., heterogeneous stock (HS), provide increased resolution for quantitative trait loci detection. However, increased genetic complexity challenges detection methods, with discordant results due to low data quality or complex genetic architecture. We quantified the impact of theses factors across three mouse crosses and two different detection methods, identifying procedures that greatly improve detection quality. Importantly, HS populations have complex genetic architectures not fully captured by the whole genome kinship matrix, calling for incorporating chromosome specific relatedness information. We analyze three increasingly complex crosses, using gene expression levels as quantitative traits. The three crosses were an F(2) intercross, a HS formed by crossing four inbred strains (HS4), and a HS (HS-CC) derived from the eight lines found in the collaborative cross. Brain (striatum) gene expression and genotype data were obtained using the Illumina platform. We found large disparities between methods, with concordance varying as genetic complexity increased; this problem was more acute for probes with distant regulatory elements (trans). A suite of data filtering steps resulted in substantial increases in reproducibility. Genetic relatedness between samples generated overabundance of detected eQTLs; an adjustment procedure that includes the kinship matrix attenuates this problem. However, we find that relatedness between individuals is not evenly distributed across the genome; information from distinct chromosomes results in relatedness structure different from the whole genome kinship matrix. Shared polymorphisms from distinct chromosomes collectively affect expression levels, confounding eQTL detection. We suggest that considering chromosome specific relatedness can result in improved eQTL detection.

  2. Testing parasite "intimacy": the whipworm Trichuris muris in the European house mouse hybrid zone

    Czech Academy of Sciences Publication Activity Database

    Wasimuddin, Wasimuddin; Bryja, Josef; Ribas, A.; Baird, Stuart J. E.; Piálek, Jaroslav; Goüy de Bellocq, Joëlle

    2016-01-01

    Roč. 6, č. 9 (2016), s. 2688-2701 ISSN 2045-7758 R&D Projects: GA ČR GA206/08/0640; GA MŠk EE2.3.35.0026; GA MŠk EE2.3.20.0303; GA ČR(CZ) GA16-20049S Institutional support: RVO:68081766 Keywords : Hybrid zones * Mus musculus * parasite life history traits * phylogeography * population structure Subject RIV: EG - Zoology OBOR OECD: Ecology Impact factor: 2.440, year: 2016

  3. MUS81 is associated with cell proliferation and cisplatin sensitivity in serous ovarian cancer

    Energy Technology Data Exchange (ETDEWEB)

    Xie, Suhong; Zheng, Hui [Department of Clinical Laboratory, Fudan University Shanghai Cancer Center, Shanghai (China); Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Wen, Xuemei [Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Sun, Jiajun; Wang, Yanchun; Gao, Xiang; Guo, Lin [Department of Clinical Laboratory, Fudan University Shanghai Cancer Center, Shanghai (China); Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China); Lu, Renquan, E-mail: lurenquan@126.com [Department of Clinical Laboratory, Fudan University Shanghai Cancer Center, Shanghai (China); Department of Oncology, Shanghai Medical College, Fudan University, Shanghai (China)

    2016-08-05

    The dysfunction of DNA damage repair (DDR) pathway contributes to tumorigenesis and drug-resistance in cancer. MUS81 is a member of the conserved xeroderma pigmentosum group F (XPF) family protein of endonucleases, which is important to the DDR pathway. However, the role of MUS81 in the development of ovarian cancer remains uncertain. To explore the expression of MUS81 and its association to serous ovarian cancer (SOC), 43 biopsies of SOC patients were detected by qRT-PCR, and 29 specimens were further performed by immunohistochemistry analysis. Here, we observed that MUS81 was over-expressed in SOC tissues at both transcript and protein levels, and the expression level of MUS81 protein in ovarian cancer cell lines was also higher than that in human normal ovarian surface epithelial cell line (HOSEpiC). We also found that down-regulation of MUS81 expression in ovarian cancer cells inhibited cell proliferation and colony formation ability, and influenced cell cycle progression. Moreover, inhibition of MUS81 expression induced cellular senescence and enhanced the antitumor effect of cisplatin. Down-regulation of MUS81 expression could suppress the growth and development of SOC. These results indicate that MUS81 might play important roles in the progression of SOC and influence the antitumor effect of cisplatin. - Highlights: • MUS81 was overexpression in serous ovarian cancer (SOC). • Meanwhile down-regulation of inhibited cell proliferation and influenced cell cycle progression. • Inhibition of MUS81 induced cell cellular senescence and enhanced the antitumor effect of cisplatin. • Down-regulation of MUS81 expression could suppress the growth and development of SOC.

  4. MUS81 is associated with cell proliferation and cisplatin sensitivity in serous ovarian cancer

    International Nuclear Information System (INIS)

    Xie, Suhong; Zheng, Hui; Wen, Xuemei; Sun, Jiajun; Wang, Yanchun; Gao, Xiang; Guo, Lin; Lu, Renquan

    2016-01-01

    The dysfunction of DNA damage repair (DDR) pathway contributes to tumorigenesis and drug-resistance in cancer. MUS81 is a member of the conserved xeroderma pigmentosum group F (XPF) family protein of endonucleases, which is important to the DDR pathway. However, the role of MUS81 in the development of ovarian cancer remains uncertain. To explore the expression of MUS81 and its association to serous ovarian cancer (SOC), 43 biopsies of SOC patients were detected by qRT-PCR, and 29 specimens were further performed by immunohistochemistry analysis. Here, we observed that MUS81 was over-expressed in SOC tissues at both transcript and protein levels, and the expression level of MUS81 protein in ovarian cancer cell lines was also higher than that in human normal ovarian surface epithelial cell line (HOSEpiC). We also found that down-regulation of MUS81 expression in ovarian cancer cells inhibited cell proliferation and colony formation ability, and influenced cell cycle progression. Moreover, inhibition of MUS81 expression induced cellular senescence and enhanced the antitumor effect of cisplatin. Down-regulation of MUS81 expression could suppress the growth and development of SOC. These results indicate that MUS81 might play important roles in the progression of SOC and influence the antitumor effect of cisplatin. - Highlights: • MUS81 was overexpression in serous ovarian cancer (SOC). • Meanwhile down-regulation of inhibited cell proliferation and influenced cell cycle progression. • Inhibition of MUS81 induced cell cellular senescence and enhanced the antitumor effect of cisplatin. • Down-regulation of MUS81 expression could suppress the growth and development of SOC.

  5. NCBI nr-aa BLAST: CBRC-MMUS-04-0013 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-04-0013 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  6. NCBI nr-aa BLAST: CBRC-PTRO-07-0067 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-07-0067 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  7. NCBI nr-aa BLAST: CBRC-RMAC-04-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-04-0050 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  8. NCBI nr-aa BLAST: CBRC-CFAM-12-0016 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-12-0016 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  9. NCBI nr-aa BLAST: CBRC-ACAR-01-0845 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-ACAR-01-0845 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  10. NCBI nr-aa BLAST: CBRC-FRUB-02-0074 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FRUB-02-0074 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  11. NCBI nr-aa BLAST: CBRC-TBEL-01-1883 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-1883 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  12. NCBI nr-aa BLAST: CBRC-LAFR-01-1734 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-LAFR-01-1734 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  13. NCBI nr-aa BLAST: CBRC-TNIG-10-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-10-0006 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  14. NCBI nr-aa BLAST: CBRC-OCUN-01-1522 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1522 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  15. NCBI nr-aa BLAST: CBRC-FCAT-01-1020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-FCAT-01-1020 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  16. NCBI nr-aa BLAST: CBRC-GACU-18-0022 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-18-0022 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  17. NCBI nr-aa BLAST: CBRC-CJAC-01-1332 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1332 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  18. NCBI nr-aa BLAST: CBRC-TNIG-14-0023 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TNIG-14-0023 ref|NP_031752.1| cannabinoid receptor 1 (brain) [Mus musculus] sp...|P47746|CNR1_MOUSE Cannabinoid receptor 1 (CB1) (CB-R) (Brain-type cannabinoid receptor) gb|AAD34624.1|AF153345_1 CB1 cann...abinoid receptor [Mus musculus] gb|AAA64413.1| CB1 cannabinoid receptor gb|AAA91176.1| neuronal cann...abinoid receptor emb|CAB42647.1| cannabinoid CB1 receptor [Mus musculus] gb|AAS91800.1| striatal can...nabinoid receptor type 1 protein [Mus musculus] gb|AAS91801.1| striatal cannabinoid

  19. NCBI nr-aa BLAST: CBRC-MMUS-06-0131 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-06-0131 ref|NP_444459.1| vomeronasal 1 receptor, B8 [Mus musculus] sp|Q9EQ45|VN1B8_MOUSE Vomeronas...al type-1 receptor B8 (Vomeronasal type-1 receptor A13) gb|AAG42088.1|AF291494_1 vomeronasa...l receptor V1RB8 [Mus musculus] dbj|BAB79220.1| vomeronasal receptor 1 A13 [Mus musculus] gb|AAI40252.1| Vomeronasa...l 1 receptor, B8 [synthetic construct] gb|EDK99274.1| vomeronasal ...1 receptor, B8 [Mus musculus] gb|AAI46525.1| Vomeronasal 1 receptor, B8 [synthetic construct] NP_444459.1 1e-175 100% ...

  20. Identification and field evaluation of attractants for the cranberry weevil, Anthonomus musculus Say.

    Science.gov (United States)

    Szendrei, Zsofia; Averill, Anne; Alborn, Hans; Rodriguez-Saona, Cesar

    2011-04-01

    Studies were conducted to develop an attractant for the cranberry weevil, Anthonomus musculus, a pest of blueberry and cranberry flower buds and flowers in the northeastern United States. In previous studies, we showed that cinnamyl alcohol, the most abundant blueberry floral volatile, and the green leaf volatiles (Z)-3-hexenyl acetate and hexyl acetate, emitted from both flowers and flower buds, elicit strong antennal responses from A. musculus. Here, we found that cinnamyl alcohol did not increase capture of A. musculus adults on yellow sticky traps compared with unbaited controls; however, weevils were highly attracted to traps baited with the Anthonomus eugenii Cano aggregation pheromone, indicating that these congeners share common pheromone components. To identify the A. musculus aggregation pheromone, headspace volatiles were collected from adults feeding on blueberry or cranberry flower buds and analyzed by gas chromatography-mass spectrometry. Three male-specific compounds were identified: (Z)-2-(3,3-dimethyl-cyclohexylidene) ethanol (Z grandlure II); (Z)-(3,3-dimethylcyclohexylidene) acetaldehyde (grandlure III); and (E)-(3,3- dimethylcyclohexylidene) acetaldehyde (grandlure IV). A fourth component, (E)-3,7-dimethyl-2,6-octadien-1-ol (geraniol), was emitted in similar quantities by males and females. The emission rates of these volatiles were about 2.8, 1.8, 1.3, and 0.9 ng/adult/d, respectively. Field experiments in highbush blueberry (New Jersey) and cranberry (Massachusetts) examined the attraction of A. musculus to traps baited with the male-produced compounds and geraniol presented alone and combined with (Z)-3-hexenyl acetate and hexyl acetate, and to traps baited with the pheromones of A. eugenii and A. grandis. In both states and crops, traps baited with the A. musculus male-produced compounds attracted the highest number of adults. Addition of the green leaf volatiles did not affect A. musculus attraction to its pheromone but skewed the sex ratio

  1. One normal void and residual following MUS surgery is all that is necessary in most patients.

    Science.gov (United States)

    Ballard, Paul; Shawer, Sami; Anderson, Colette; Khunda, Aethele

    2018-04-01

    There is considerable variation worldwide on how the assessment of voiding function is performed following midurethral sling (MUS) surgery. There is potentially a financial cost, and reduction in efficiency when patient discharge is delayed. Using our current practice of two normal void and residual (V&R) readings before discharge, the aim of this retrospective study was to evaluate the likelihood of an abnormal second V&R test if the first V&R test was normal in order to determine if a policy of discharge after only one satisfactory V&R test is reasonable. Data from 400 patients who had had MUS surgery with or without other procedures were collected. Our unit protocol included two consecutive voids of greater than 200 ml with residuals less than 150 ml before discharge. The patients were divided into the following groups: MUS only, MUS plus anterior colporrhaphy (AR) plus any other procedures (MUS/AR), and MUS with any non-AR procedures (MUS+). Complete datasets were available for 335 patients. Once inadequate tests (low volume voids <200 ml) had been excluded (28% overall), the likelihood of an abnormal second V&R test if the first test was normal was 7.1% overall, but 3.6% for MUS, 11.5% for MUS/AR and 8.6% for MUS+. The findings in the MUS-only group indicate that it is probably safe to discharge patients after one satisfactory V&R test, as long as safety measures such as 'open access' are available so that patients have unhindered readmission if problems arise.

  2. Both nuclear and cytoplasmic components are defective in oocytes of the B6.Y(TIR) sex-reversed female mouse.

    Science.gov (United States)

    Amleh, A; Smith, L; Chen, H; Taketo, T

    2000-03-15

    In the mammalian gonadal primordium, activation of the Sry gene on the Y chromosome initiates a cascade of genetic events leading to testicular organization whereas its absence results in ovarian differentiation. An exception occurs when the Y chromosome of Mus musculus domesticus from Tirano, Italy (Y(TIR)), is placed on the C57BL/6J (B6) genetic background. The B6.Y(TIR) progeny develop only ovaries or ovotestes despite Sry transcription in fetal life. Consequently, the XY offspring with bilateral ovaries develop into apparently normal females, but their eggs fail to develop after fertilization. Our previous studies have shown that the primary cause of infertility can be attributed to oocytes rather than their surrounding somatic cells in the XY ovary. This study attempted to identify the defects in oocytes from the B6.Y(TIR) female mouse. We examined the developmental potential of embryos from XY and XX females after exchanging their nuclear components by microsurgery following in vitro maturation and fertilization. The results suggest that both nuclear and cytoplasmic components are defective in oocytes from XY females. In the XY fetal ovary, most germ cells entered meiosis and their autosomes appeared to synapse normally while the X and Y chromosomes remained unpaired during meiotic prophase. This lack of X-Y pairing probably caused aneuploidy in some secondary oocytes following in vitro maturation. However, normal numbers of chromosomes in the rest of the secondary oocytes indicate that aneuploidy alone can not explain the nuclear defect in oocytes. Copyright 2000 Academic Press.

  3. Recombinant major urinary proteins of the mouse in specific IgE and IgG testing

    NARCIS (Netherlands)

    Krop, Esmeralda J. M.; Matsui, Elizabeth C.; Sharrow, Scott D.; Stone, Martin J.; Gerber, Peter; van der Zee, Jaring S.; Chapman, Martin D.; Aalberse, Rob C.

    2007-01-01

    BACKGROUND: Recombinant allergens are preferred over natural allergen extracts in measuring antibodies. We tested the use of recombinant variants of the major mouse allergen Mus m 1 in detection of mouse-specific antibodies in sera of laboratory animal workers and children. METHODS: Six recombinant

  4. ORF Alignment: NT_033777 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NT_033777 gi|28571958 >1bor0 1 53 282 342 4e-04 ... ref|NP_083045.3| synoviolin 1 [Mu...s musculus] gb|AAH42199.1| Synoviolin 1 [Mus ... musculus] gb|AAH80722.1| Synoviolin 1 [Mus musculus]... ... gb|AAH57917.1| Synoviolin 1 [Mus musculus] ... Length = 61 ... Query: 280 EELRQSDNICIICREDMV

  5. EFFECT OF IMPERMEANT CRYOPROTECTANTS ON THE IN VITRO VIABILITY OF FROZEN SPERMATOZOA OF SWISS-ALBINA AND BALB/C MICE (Mus musculus EFEITO DE CRIOPROTETORES IMPERMEÁVEIS SOBRE A VIABILIDADE IN VITRO DE ESPERMATOZOIDES CONGELADOS DE CAMUNDONGOS (Mus musculus DAS LINHAGENS SWISS-ALBINA e BALB/c

    Directory of Open Access Journals (Sweden)

    Antonio Sergio Varela Junior

    2009-12-01

    Full Text Available

    The objective of this study was to evaluate the effect of three disaccharides (sucrose, threalose and lactose used as nonpenetrating cryoprotectants in extender for mice semen. The parameters evaluated were sperm motility (MOT and cleavage rate (CLV after in vitro fertilization in the SWISS-ALBINA and BALB/c lines. The treatments were S1=sucrose; S2=threalose; S3=lactose, for SWISS-ALBINA; and B1=lactose; B2=threalose for BALB/c.  MOT was evaluated after: thawing (THA, centrifugation and re-suspension in P-1 medium (CEN and after 10 minutes of incubation (10M. The MOT for the SWISS-ALBINA line was higher for S2 (P<0.001 in the 3 evaluated steps (47% at DES; 66.5% at CEN and 67.2% at 10M than for S1 (32.5% at DES; 51.5% at CEN and 47.7% at 10M and S3 (30% at DES, 46.5% at CEN and 32.7% at 10M. For the BALB/c line, MOT was superior for B2 than for B1 (P<0.001. Thus, the tested disaccharides, especially threalose, can be recommended for freezing of mice sperm.

    KEY WORDS: Cryopreservation, disaccharides, mice, semen. 

    O trabalho objetivou avaliar os efeitos dos dissacarídeos sacarose, trealose e lactose, como crioprotetores impermeáveis à membrana plasmática em diluentes para criopreservação de sêmen de camundongos. Para avaliação do sêmen utilizaram-se os seguintes parâmetros: motilidade progressiva (MOT das células espermáticas, e a taxa de clivagem embrionária (TXCL obtida por meio de fertilização in vitro, nas linhagens SWISS-ALBINA e BALB/c. Os tratamentos avaliados foram: S1=sacarose; S2=trealose; S3=lactose, para SWISS-ALBINA e B1=lactose; B2=trealose para BALB/c. Avaliou-se a MOT durante as seguintes etapas: descongelação (DES, centrifugação e ressuspensão no meio P-1 (CEN e após dez minutos de incubação (10M. A MOT no S2 para a linhagem SWISS-ALBINA nas três etapas (47% no DES; 66,5% na CEN e 67,2% no 10M foi superior (P<0,001 a S1 (32,5% no DES; 51,5% no CEN e 47,7% na 10M e S3 (30% no DES, 46,5% na CEN e 32,7% no 10M. Na linhagem BALB/c, a MOT no B2 foi superior ao B1 (P<0,001. Em conclusão, pode-se recomendar a utilização dos dissacarídeos testados, com destaque para a trealose, na congelação rápida de sêmen de camundongos. 

    PALAVRAS-CHAVES: Camundongo, criopreservação, dissacarídeos, sêmen.

  6. Interval training by normobaric hypoxia accelerates the reinnervation of musculus extensor digitorum longus in mice

    DEFF Research Database (Denmark)

    Vardya, Irina; (Vard'ya); Mospanova, Svetlana V.

    2000-01-01

    Dokl Biol Sci. 2000 Mar-Apr;371:112-4. Interval training by normobaric hypoxia accelerates the reinnervation of musculus extensor digitorum longus in mice. Vard'ya IV , Mospanova SV , Portnov VV , Balezina OP , Koshelev VB . Department of Human and Animal Physiology, Faculty of Biology, Moscow St...... State University, Russia. PMID: 10833635 [PubMed - indexed for MEDLINE] Udgivelsesdato: 2000...

  7. AcEST: BP921475 [AcEST

    Lifescience Database Archive (English)

    Full Text Available BlastX Result : Swiss-Prot sp_hit_id O35902 Definition sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus Al...gnificant alignments: (bits) Value sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus GN=Dsg3 PE=2 SV=1 31 2....2 sp|Q29IL2|POMT2_DROPS Protein O-mannosyl-transferase 2 OS=Drosop... 30 4.8 >sp|O35902|DSG3_MOUSE Desmog

  8. [Effect of heterozygosity for insertions of homogeneously stained regions in chromosome 1 of the house mouse on synapsis in meiotic prophase].

    Science.gov (United States)

    Borodin, P M; Ladygina, T Iu; Gorlov, I P

    1989-02-01

    Electron microscope analysis of surface-spread synaptonemal complexes (SC) in oocytes and spermatocytes from double cis heterozygotes for Is(HSR; 1C5)1Icg and Is(HSR; 1E3)2Icg was carried out. Aberrant chromosomes were isolated from the feral population of Mus musculus musculus of Novosibirsk. They contain homogeneously stained regions of total length of about 30% of Chr 1 mitotic metaphase. Heteromorphic bivalents of Chr1 with different lengths of the lateral elements of SC and the loop in the intermedial position were revealed in 4.4% spermatocytes and 20% oocytes of heterozygous animals. The loop size depends on the stage of meiosis: it is maximal at late zygotene and decreases up to disappearance during pachytene.

  9. Genetic diversity and striatal gene networks: focus on the heterogeneous stock-collaborative cross (HS-CC mouse

    Directory of Open Access Journals (Sweden)

    Belknap John

    2010-10-01

    Full Text Available Abstract Background The current study focused on the extent genetic diversity within a species (Mus musculus affects gene co-expression network structure. To examine this issue, we have created a new mouse resource, a heterogeneous stock (HS formed from the same eight inbred strains that have been used to create the collaborative cross (CC. The eight inbred strains capture > 90% of the genetic diversity available within the species. For contrast with the HS-CC, a C57BL/6J (B6 × DBA/2J (D2 F2 intercross and the HS4, derived from crossing the B6, D2, BALB/cJ and LP/J strains, were used. Brain (striatum gene expression data were obtained using the Illumina Mouse WG 6.1 array, and the data sets were interrogated using a weighted gene co-expression network analysis (WGCNA. Results Genes reliably detected as expressed were similar in all three data sets as was the variability of expression. As measured by the WGCNA, the modular structure of the transcriptome networks was also preserved both on the basis of module assignment and from the perspective of the topological overlap maps. Details of the HS-CC gene modules are provided; essentially identical results were obtained for the HS4 and F2 modules. Gene ontology annotation of the modules revealed a significant overrepresentation in some modules for neuronal processes, e.g., central nervous system development. Integration with known protein-protein interactions data indicated significant enrichment among co-expressed genes. We also noted significant overlap with markers of central nervous system cell types (neurons, oligodendrocytes and astrocytes. Using the Allen Brain Atlas, we found evidence of spatial co-localization within the striatum for several modules. Finally, for some modules it was possible to detect an enrichment of transcription binding sites. The binding site for Wt1, which is associated with neurodegeneration, was the most significantly overrepresented. Conclusions Despite the marked

  10. Allergen and Epitope Targets of Mouse-Specific T Cell Responses in Allergy and Asthma

    Directory of Open Access Journals (Sweden)

    Véronique Schulten

    2018-02-01

    Full Text Available Mouse allergy has become increasingly common, mainly affecting laboratory workers and inner-city households. To date, only one major allergen, namely Mus m 1, has been described. We sought to identify T cell targets in mouse allergic patients. PBMC from allergic donors were expanded with either murine urine or epithelial extract and subsequently screened for cytokine production (IL-5 and IFNγ in response to overlapping peptides spanning the entire Mus m 1 sequence, peptides from various Mus m 1 isoforms [major urinary proteins (MUPs], peptides from mouse orthologs of known allergens from other mammalian species and peptides from proteins identified by immunoproteomic analysis of IgE/IgG immunoblots of mouse urine and epithelial extracts. This approach let to the identification of 106 non-redundant T cell epitopes derived from 35 antigens. Three major T cell-activating regions were defined in Mus m 1 alone. Moreover, our data show that immunodominant epitopes were largely shared between Mus m 1 and other MUPs even from different species, suggesting that sequence conservation in different allergens is a determinant for immunodominance. We further identified several novel mouse T cell antigens based on their homology to known mammalian allergens. Analysis of cohort-specific T cell responses revealed that rhinitis and asthmatic patients recognized different epitope repertoires. Epitopes defined herein can be formulated into an epitope “megapool” used to diagnose mouse allergy and study mouse-specific T cell responses directly ex vivo. This analysis of T cell epitopes provides a good basis for future studies to increase our understanding of the immunopathology associated with MO-allergy and asthma.

  11. The electrostatic role of the Zn-Cys2His2 complex in binding of operator DNA with transcription factors: mouse EGR-1 from the Cys2His2 family.

    Science.gov (United States)

    Chirgadze, Y N; Boshkova, E A; Polozov, R V; Sivozhelezov, V S; Dzyabchenko, A V; Kuzminsky, M B; Stepanenko, V A; Ivanov, V V

    2018-01-07

    The mouse factor Zif268, known also as early growth response protein EGR-1, is a classical representative for the Cys2His2 transcription factor family. It is required for binding the RNA polymerase with operator dsDNA to initialize the transcription process. We have shown that only in this family of total six Zn-finger protein families the Zn complex plays a significant role in the protein-DNA binding. Electrostatic feature of this complex in the binding of factor Zif268 from Mus musculus with operator DNA has been considered. The factor consists of three similar Zn-finger units which bind with triplets of coding DNA. Essential contacts of the factor with the DNA phosphates are formed by three conservative His residues, one in each finger. We describe here the results of calculations of the electrostatic potentials for the Zn-Cys2His2 complex, Zn-finger unit 1, and the whole transcription factor. The potential of Zif268 has a positive area on the factor surface, and it corresponds exactly to the binding sites of each of Zn-finger units. The main part of these areas is determined by conservative His residues, which form contacts with the DNA phosphate groups. Our result shows that the electrostatic positive potential of this histidine residue is enhanced due to the Zn complex. The other contacts of the Zn-finger with DNA are related to nucleotide bases, and they are responsible for the sequence-specific binding with DNA. This result may be extended to all other members of the Cys2His2 transcription factor family.

  12. Model of chromosome associations in Mus domesticus spermatocytes

    Directory of Open Access Journals (Sweden)

    Soledad Berríos

    2010-01-01

    Full Text Available Understanding the spatial organization of the chromosomes in meiotic nuclei is crucial to our knowledge of the genome's functional regulation, stability and evolution. This study examined the nuclear architecture of Mus domesticus 2n=40 pachytene spermatocytes, analyzing the associations among autosomal bivalents via their Centromere Telomere Complexes (CTC. The study developed a nuclear model in which each CTC was represented as a 3D computer object. The probability of a given combination of associations among CTC was estimated by simulating a random distribution of 19 indistinguishable CTC over n indistinguishable "cells" on the nuclear envelope. The estimated association frequencies resulting from this numerical approach were similar to those obtained by quantifying actual associations in pachytene spermatocyte spreads. The nuclear localization and associations of CTC through the meiotic prophase in well-preserved nuclei were also analyzed. We concluded that throughout the meiotic prophase: 1 the CTC of autosomal bivalents are not randomly distributed in the nuclear space; 2 the CTC associate amongst themselves, probably at random, over a small surface of the nuclear envelope, at the beginning of the meiotic prophase; 3 the initial aggregation of centromere regions occurring in lepto-zygotene likely resolves into several smaller aggregates according to patterns of preferential partitioning; 4 these smaller aggregates spread over the inner face of the nuclear envelope, remaining stable until advanced stages of the meiotic prophase or even until the first meiotic division.

  13. INTEGRAL/JEM-X detection of fading emission from GT Mus

    DEFF Research Database (Denmark)

    Fiocchi, M.; Chenevez, J.; Sguera, V.

    2015-01-01

    On November 15th 2015 the MAXI/GSC detected a big flare from the RS CVn star GT Mus with a flux of ~100 mCrab in the 2-20 keV energy band. (ATel #8285). During recent INTEGRAL observations of the Musca region performed between 17 Nov 16:08 and 18 Nov 00:05 (UTC) the source GT Mus was within the f...

  14. AcEST: BP913064 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _MOUSE Experimental autoimmune prostatitis antige... 31 5.2 sp|Q9NVV0|TM38B_HUMAN...|Q6QR59|EAPA2_MOUSE Experimental autoimmune prostatitis antigen 2 OS=Mus musculus GN=Eapa2 PE=2 SV=1 Length

  15. AcEST: DK951433 [AcEST

    Lifescience Database Archive (English)

    Full Text Available 6e-22 sp|Q9LM18|FB303_ARATH F-box protein At1g22220 OS=Arabidopsis tha... 100 1e-20 sp|O35902|DSG3_MOUSE Desmog...VGDCMYGEAVVALLKCKKNALEMNSF 314 >sp|O35902|DSG3_MOUSE Desmoglein-3 OS=Mus musculus GN=Dsg3 PE=2 SV=1 Length =

  16. UniProt search blastx result: AK288448 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK288448 J090034N14 P48545|IRK5_MOUSE G protein-activated inward rectifier potassiu...m channel 4 (GIRK4) (Potassium channel, inwardly rectifying subfamily J member 5) (Inward rectifier K(+) cha...nnel Kir3.4) (Heart KATP channel) (KATP-1) (Cardiac inward rectifier) (CIR) - Mus musculus (Mouse) 0 ...

  17. AcEST: DK944957 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ant alignments: (bits) Value sp|Q82Y15|ORN_NITEU Oligoribonuclease OS=Nitrosomonas europaea G... 31 1.7 sp|Q9JLC8|SACS_MOUSE Sacsi...LVVTDAQLNTLAEAPVLVVHQPDDI 54 >sp|Q9JLC8|SACS_MOUSE Sacsin OS=Mus musculus GN=Sacs PE=1 SV=2 Length = 4582 Sc

  18. Hexavalents in spermatocytes of Robertsonian heterozygotes between Mus m. domesticus 2n=26 from the Vulcano and Lipari Islands (Aeolian Archipelago, Italy).

    Science.gov (United States)

    Berríos, Soledad; Fernández-Donoso, Raúl; Page, Jesús; Ayarza, Eliana; Capanna, Ernesto; Solano, Emanuela; Castiglia, Riccardo

    2018-02-20

    The size and shape of the chromosomes, as well as the chromosomal domains that compose them, are determinants in the distribution and interaction between the bivalents within the nucleus of spermatocytes in prophase I of meiosis. Thus the nuclear architecture characteristic of the karyotype of a species can be modified by chromosomal changes such as Rb chromosomes. In this study we analysed the meiotic prophase nuclear organization of the heterozygous spermatocytes from Mus musculus domesticus 2n=26, and the synaptic configuration of the hexavalent formed by the dependent Rb chromosomes Rbs 6.16, 16.10, 10.15, 15.17 and the telocentric chromosomes 6 and 17. Spreads of 88 pachytene spermatocytes from two males were studied and in all of them five metacentric bivalents, four telocentric bivalents, one hexavalent and the XY bivalent were observed. About 48% of the hexavalents formed a chain or a ring of synapsed chromosomes, the latter closed by synapsis between the short arms of telocentric chromosomes 6 and 17.  About 52% of hexavalents formed an open chain of 10 synapsed chromosomal arms belonging to 6 chromosomes.  In about half of the unsynapsed hexavalents one of the telocentric chromosome short arms appears associated with the X chromosome single axis, which was otherwise normally paired with the Y chromosome.  The cluster of pericentromeric heterochromatin mostly determines the hexavalent's nuclear configuration, dragging the centromeric regions and all the chromosomes towards the nuclear envelope similar to an association of five telocentric bivalents. These reiterated encounters between these chromosomes restrict the interactions with other chromosomal domains and might favour eventual rearrangements within the metacentric, telocentric or hexavalent chromosome subsets. The unsynapsed short arms of telocentric chromosomes frequently bound to the single axis of the X chromosome could further complicate the already complex segregation of hexavalent

  19. Hexavalents in spermatocytes of Robertsonian heterozygotes between Mus m. domesticus 2n 26 from the Vulcano and Lipari Islands (Aeolian Archipelago, Italy)

    Science.gov (United States)

    Berríos, Soledad; Fernández-Donoso, Raúl; Page, Jesús; Ayarza, Eliana; Capanna, Ernesto; Solano, Emanuela; Castiglia, Riccardo

    2018-01-01

    The size and shape of the chromosomes, as well as the chromosomal domains that compose them, are determinants in the distribution and interaction between the bivalents within the nucleus of spermatocytes in prophase I of meiosis. Thus the nuclear architecture characteristic of the karyotype of a species can be modified by chromosomal changes such as Robertsonian (RB) chromosomes. In this study we analysed the meiotic prophase nuclear organization of the heterozygous spermatocytes from Mus musculus domesticus 2n=26, and the synaptic configuration of the hexavalent formed by the dependent Rb chromosomes Rbs 6.16, 16.10, 10.15, 15.17 and the telocentric chromosomes 6 and 17. Spreads of 88 pachytene spermatocytes from two males were studied and in all of them five metacentric bivalents, four telocentric bivalents, one hexavalent and the XY bivalent were observed. About 48% of the hexavalents formed a chain or a ring of synapsed chromosomes, the latter closed by synapsis between the short arms of telocentric chromosomes 6 and 17. About 52% of hexavalents formed an open chain of 10 synapsed chromosomal arms belonging to 6 chromosomes. In about half of the unsynapsed hexavalents one of the telocentric chromosome short arms appears associated with the X chromosome single axis, which was otherwise normally paired with the Y chromosome. The cluster of pericentromeric heterochromatin mostly determines the hexavalent’s nuclear configuration, dragging the centromeric regions and all the chromosomes towards the nuclear envelope similar to an association of five telocentric bivalents. These reiterated encounters between these chromosomes restrict the interactions with other chromosomal domains and might favour eventual rearrangements within the metacentric, telocentric or hexavalent chromosome subsets. The unsynapsed short arms of telocentric chromosomes frequently bound to the single axis of the X chromosome could further complicate the already complex segregation of

  20. Hexavalents in spermatocytes of Robertsonian heterozygotes between Mus m. domesticus 2n=26 from the Vulcano and Lipari Islands (Aeolian Archipelago, Italy

    Directory of Open Access Journals (Sweden)

    Soledad Berríos

    2018-02-01

    Full Text Available The size and shape of the chromosomes, as well as the chromosomal domains that compose them, are determinants in the distribution and interaction between the bivalents within the nucleus of spermatocytes in prophase I of meiosis. Thus the nuclear architecture characteristic of the karyotype of a species can be modified by chromosomal changes such as Rb chromosomes. In this study we analysed the meiotic prophase nuclear organization of the heterozygous spermatocytes from Mus musculus domesticus 2n=26, and the synaptic configuration of the hexavalent formed by the dependent Rb chromosomes Rbs 6.16, 16.10, 10.15, 15.17 and the telocentric chromosomes 6 and 17. Spreads of 88 pachytene spermatocytes from two males were studied and in all of them five metacentric bivalents, four telocentric bivalents, one hexavalent and the XY bivalent were observed. About 48% of the hexavalents formed a chain or a ring of synapsed chromosomes, the latter closed by synapsis between the short arms of telocentric chromosomes 6 and 17.  About 52% of hexavalents formed an open chain of 10 synapsed chromosomal arms belonging to 6 chromosomes.  In about half of the unsynapsed hexavalents one of the telocentric chromosome short arms appears associated with the X chromosome single axis, which was otherwise normally paired with the Y chromosome.  The cluster of pericentromeric heterochromatin mostly determines the hexavalent’s nuclear configuration, dragging the centromeric regions and all the chromosomes towards the nuclear envelope similar to an association of five telocentric bivalents. These reiterated encounters between these chromosomes restrict the interactions with other chromosomal domains and might favour eventual rearrangements within the metacentric, telocentric or hexavalent chromosome subsets. The unsynapsed short arms of telocentric chromosomes frequently bound to the single axis of the X chromosome could further complicate the already complex segregation

  1. AcEST: DK962031 [AcEST

    Lifescience Database Archive (English)

    Full Text Available VSFLTGLGCPNCIECFTSQGLQ 392 >tr|B1AX90|B1AX90_MOUSE Transformation related protein 73 OS=Mus musculus GN=Trp7...tr|B1AX90|B1AX90_MOUSE Transformation related protein 73 OS=Mus ... 37 1.5 tr|B7Q4E7|B7Q4E7_IXOSC Putative u...rized protein OS=Mus m... 37 1.5 tr|Q9CU77|Q9CU77_MOUSE Putative uncharacterized protein (Fragmen... 37 1.5

  2. iTRAQ analysis of hepatic proteins in free-living Mus spretus mice to assess the contamination status of areas surrounding Doñana National Park (SW Spain)

    Energy Technology Data Exchange (ETDEWEB)

    Abril, Nieves; Chicano-Gálvez, Eduardo; Michán, Carmen; Pueyo, Carmen; López-Barea, Juan, E-mail: bb1lobaj@uco.es

    2015-08-01

    This work aims to develop and integrate new -omics tools that would be applicable to different ecosystem types for a technological updating of environmental evaluations. We used a 2nd-generation (iTRAQ-8plex) proteomic approach to identify/quantify proteins differentially expressed in the liver of free-living Mus spretus mice from Doñana National Park or its proximities. Mass spectrometry was performed in an LTQ Orbitrap system for iTRAQ reporter ion quantitation and protein identification using a Mus musculus database as reference. A prior IEF step improved the separation of the complex peptide mixture. Over 2000 identified proteins were altered, of which 118 changed by ≥ 2.5-fold in mice from at least two problem sites. Part of the results obtained with the iTRAQ analysis was confirmed by Western blot. Over 75% of the 118 proteins were upregulated in animals captured at polluted sites and only 16 proteins were downregulated. Upregulated proteins were involved in stress response; cell proliferation and apoptosis; signal transduction; metastasis or tumour suppression; xenobiotic export or vesicular trafficking; and metabolism. The downregulated proteins, all potentially harmful, were classified as oncoproteins and proteins favouring genome instability. The iTRAQ results presented here demonstrated that the survival of hepatic cells is compromised in animals living at polluted sites, which showed deep alterations in metabolism and the signalling pathways. The identified proteins may be useful as biomarkers of environmental pollution and provide insight about the metabolic pathways and/or physiological processes affected by pollutants in DNP and its surrounding areas. - Highlights: • iTRAQ quantitation was used for the first time to monitor a wildlife reserve • Over 2,000 proteins with altered expression were identified in problem Doñana sites • Of them, 118 changed over 2.5-fold in, at least, two problem sites • Upregulation of protective proteins

  3. Joint molecule resolution requires the redundant activities of MUS-81 and XPF-1 during Caenorhabditis elegans meiosis.

    Directory of Open Access Journals (Sweden)

    Nigel J O'Neil

    Full Text Available The generation and resolution of joint molecule recombination intermediates is required to ensure bipolar chromosome segregation during meiosis. During wild type meiosis in Caenorhabditis elegans, SPO-11-generated double stranded breaks are resolved to generate a single crossover per bivalent and the remaining recombination intermediates are resolved as noncrossovers. We discovered that early recombination intermediates are limited by the C. elegans BLM ortholog, HIM-6, and in the absence of HIM-6 by the structure specific endonuclease MUS-81. In the absence of both MUS-81 and HIM-6, recombination intermediates persist, leading to chromosome breakage at diakinesis and inviable embryos. MUS-81 has an additional role in resolving late recombination intermediates in C. elegans. mus-81 mutants exhibited reduced crossover recombination frequencies suggesting that MUS-81 is required to generate a subset of meiotic crossovers. Similarly, the Mus81-related endonuclease XPF-1 is also required for a subset of meiotic crossovers. Although C. elegans gen-1 mutants have no detectable meiotic defect either alone or in combination with him-6, mus-81 or xpf-1 mutations, mus-81;xpf-1 double mutants are synthetic lethal. While mus-81;xpf-1 double mutants are proficient for the processing of early recombination intermediates, they exhibit defects in the post-pachytene chromosome reorganization and the asymmetric disassembly of the synaptonemal complex, presumably triggered by crossovers or crossover precursors. Consistent with a defect in resolving late recombination intermediates, mus-81; xpf-1 diakinetic bivalents are aberrant with fine DNA bridges visible between two distinct DAPI staining bodies. We were able to suppress the aberrant bivalent phenotype by microinjection of activated human GEN1 protein, which can cleave Holliday junctions, suggesting that the DNA bridges in mus-81; xpf-1 diakinetic oocytes are unresolved Holliday junctions. We propose that the

  4. Fine mapping and candidate gene search of quantitative trait loci for growth and obesity using mouse intersubspecific subcongenic intercrosses and exome sequencing.

    Directory of Open Access Journals (Sweden)

    Akira Ishikawa

    Full Text Available Although growth and body composition traits are quantitative traits of medical and agricultural importance, the genetic and molecular basis of those traits remains elusive. Our previous genome-wide quantitative trait locus (QTL analyses in an intersubspecific backcross population between C57BL/6JJcl (B6 and wild Mus musculus castaneus mice revealed a major growth QTL (named Pbwg1 on a proximal region of mouse chromosome 2. Using the B6.Cg-Pbwg1 intersubspecific congenic strain created, we revealed 12 closely linked QTLs for body weight and body composition traits on an approximately 44.1-Mb wild-derived congenic region. In this study, we narrowed down genomic regions harboring three (Pbwg1.12, Pbwg1.3 and Pbwg1.5 of the 12 linked QTLs and searched for possible candidate genes for the QTLs. By phenotypic analyses of F2 intercross populations between B6 and each of four B6.Cg-Pbwg1 subcongenic strains with overlapping and non-overlapping introgressed regions, we physically defined Pbwg1.12 affecting body weight to a 3.8-Mb interval (61.5-65.3 Mb on chromosome 2. We fine-mapped Pbwg1.3 for body length to an 8.0-Mb interval (57.3-65.3 and Pbwg1.5 for abdominal white fat weight to a 2.1-Mb interval (59.4-61.5. The wild-derived allele at Pbwg1.12 and Pbwg1.3 uniquely increased body weight and length despite the fact that the wild mouse has a smaller body size than that of B6, whereas it decreased fat weight at Pbwg1.5. Exome sequencing and candidate gene prioritization suggested that Gcg and Grb14 are putative candidate genes for Pbwg1.12 and that Ly75 and Itgb6 are putative candidate genes for Pbwg1.5. These genes had nonsynonymous SNPs, but the SNPs were predicted to be not harmful to protein functions. These results provide information helpful to identify wild-derived quantitative trait genes causing enhanced growth and resistance to obesity.

  5. Epitope of titin A-band-specific monoclonal antibody Tit1 5 H1.1 is highly conserved in several Fn3 domains of the titin molecule. Centriole staining in human, mouse and zebrafish cells

    Directory of Open Access Journals (Sweden)

    Mikelsaar Aavo-Valdur

    2012-09-01

    Full Text Available Abstract Background Previously we have reported on the development of a new mouse anti-titin monoclonal antibody, named MAb Titl 5 H1.1, using the synthetic peptide N-AVNKYGIGEPLESDSVVAK-C which corresponds to an amino acid sequence in the A-region of the titin molecule as immunogen. In the human skeletal muscles, MAb Titl 5 H1.1 reacts specifically with titin in the A-band of the sarcomere and in different non-muscle cell types with nucleus and cytoplasm, including centrioles. In this report we have studied the evolutionary aspects of the binding of MAb Tit1 5 H1.1 with its target antigen (titin. Results We have specified the epitope area of MAb Tit1 5 H1.1 by subpeptide mapping to the hexapeptide N-AVNKYG-C. According to protein databases this amino acid sequence is located in the COOH-terminus of several different Fn3 domains of the A-region of titin molecule in many organisms, such as human being, mouse, rabbit, zebrafish (Danio rerio, and even in sea squirt (Ciona intestinalis. Our immunohisto- and cytochemical studies with MAb Tit1 5 H1.1 in human, mouse and zebrafish tissues and cell cultures showed a striated staining pattern in muscle cells and also staining of centrioles, cytoplasm and nuclei in non-muscle cells. Conclusions The data confirm that titin can play, in addition to the known roles in striated muscle cells also an important role in non-muscle cells as a centriole associated protein. This phenomenon is highly conserved in the evolution and is related to Fn3 domains of the titin molecule. Using titin A-band-specific monoclonal antibody MAb Tit1 5 H1.1 it was possible to locate titin in the sarcomeres of skeletal muscle cells and in the centrioles, cytoplasm and nuclei of non-muscle cells in phylogenetically so distant organisms as Homo sapiens, Mus musculus and zebrafish (Danio rerio.

  6. X-RAY DETECTION OF THE CLUSTER CONTAINING THE CEPHEID S MUS

    Energy Technology Data Exchange (ETDEWEB)

    Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan [Smithsonian Astrophysical Observatory, MS 4, 60 Garden Street, Cambridge, MA 02138 (United States); Guinan, Edward; Engle, Scott [Department of Astronomy and Astrophysics, Villanova University, 800 Lancaster Avenue, Villanova, PA 19085 (United States); Bond, Howard E. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Schaefer, Gail H., E-mail: nevans@cfa.harvard.edu [The CHARA Array of Georgia State University, Mount Wilson, CA 91023 (United States)

    2014-04-20

    The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J – K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator.

  7. POSSuMUS: a position sensitive scintillating muon SiPM detector

    CERN Document Server

    Ruschke, Alexander

    The development of a modular designed large scale scintillation detector with a two-dimensional position sensitivity is presented in this thesis. This novel POsition Sensitive Scintillating MUon SiPM Detector is named POSSuMUS. The POSSuMUS detector is capable to determine the particle’s position in two space dimensions with a fast trigger capability. Each module is constructed from two trapezoidal shaped plastic scintillators to form one rectangular shaped detector module. Both trapezoids are optically insulated against each other. In both trapezoids the scintillation light is collected by plastic fibers and guided towards silicon photomultipliers (SiPMs). SiPMs are light sensors which are capable to detect even smallest amounts of light. By combining several detector modules, position sensitive areas from 100 cm2 to few m2 are achievable with few readout channels. Therefore, POSSuMUS provides a cost effective detector concept. The position sensitivity along the trapezoidal geometry of one detector module ...

  8. X-Ray Detection of the Cluster Containing the Cepheid S Mus

    Science.gov (United States)

    Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Guinan, Edward; Engle, Scott; Bond, Howard E.; Schaefer, Gail H.; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan

    2014-04-01

    The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J - K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator.

  9. X-RAY DETECTION OF THE CLUSTER CONTAINING THE CEPHEID S MUS

    International Nuclear Information System (INIS)

    Evans, Nancy Remage; Pillitteri, Ignazio; Wolk, Scott; Karovska, Margarita; DePasquale, Joseph; Tingle, Evan; Guinan, Edward; Engle, Scott; Bond, Howard E.; Schaefer, Gail H.

    2014-01-01

    The galactic Cepheid S Muscae has recently been added to the important list of Cepheids linked to open clusters, in this case the sparse young cluster ASCC 69. Low-mass members of a young cluster are expected to have rapid rotation and X-ray activity, making X-ray emission an excellent way to discriminate them from old field stars. We have made an XMM-Newton observation centered on S Mus and identified a population of X-ray sources whose near-IR Two Micron All Sky Survey counterparts lie at locations in the J, (J – K) color-magnitude diagram consistent with cluster membership at the distance of S Mus. Their median energy and X-ray luminosity are consistent with young cluster members as distinct from field stars. These strengthen the association of S Mus with the young cluster, making it a potential Leavitt law (period-luminosity relation) calibrator

  10. Dbf4-dependent kinase and the Rtt107 scaffold promote Mus81-Mms4 resolvase activation during mitosis.

    Science.gov (United States)

    Princz, Lissa N; Wild, Philipp; Bittmann, Julia; Aguado, F Javier; Blanco, Miguel G; Matos, Joao; Pfander, Boris

    2017-03-01

    DNA repair by homologous recombination is under stringent cell cycle control. This includes the last step of the reaction, disentanglement of DNA joint molecules (JMs). Previous work has established that JM resolving nucleases are activated specifically at the onset of mitosis. In case of budding yeast Mus81-Mms4, this cell cycle stage-specific activation is known to depend on phosphorylation by CDK and Cdc5 kinases. Here, we show that a third cell cycle kinase, Cdc7-Dbf4 (DDK), targets Mus81-Mms4 in conjunction with Cdc5-both kinases bind to as well as phosphorylate Mus81-Mms4 in an interdependent manner. Moreover, DDK-mediated phosphorylation of Mms4 is strictly required for Mus81 activation in mitosis, establishing DDK as a novel regulator of homologous recombination. The scaffold protein Rtt107, which binds the Mus81-Mms4 complex, interacts with Cdc7 and thereby targets DDK and Cdc5 to the complex enabling full Mus81 activation. Therefore, Mus81 activation in mitosis involves at least three cell cycle kinases, CDK, Cdc5 and DDK Furthermore, tethering of the kinases in a stable complex with Mus81 is critical for efficient JM resolution. © 2017 The Authors. Published under the terms of the CC BY NC ND 4.0 license.

  11. Accumulation of silver from drinking water into cerebellum and musculus soleus in mice

    International Nuclear Information System (INIS)

    Pelkonen, Kai H.O.; Heinonen-Tanski, Helvi; Haenninen, Osmo O.P.

    2003-01-01

    In spite of the general toxicity, ecotoxicity and sparsely known metabolism of silver, WHO allows silver ions (Ag) up to 0.1 mg/l in drinking water disinfection. In order to determine the accumulation and distribution of silver in a mammalian body, mice were given for 1 and 2 weeks drinking water containing a 3-fold lower concentration, namely 0.03 mg/l silver ions as silver nitrate labelled with 110m Ag. The silver concentrations in different tissues were analysed by gamma radioactivity. The saturation of tissues with silver seems to occur quickly, as there were no statistical differences between silver contents of mice tissues in spite of the study design that mice were administered silver for 1 or 2 weeks. The highest concentrations were found in musculus soleus (m. soleus), cerebellum, spleen, duodenum, and myocardial muscle in the rank order. Concentrations of silver in musculus gastrocnemius (m. gastrocnemius) were found to correlate negatively with cerebrum and positively with blood and kidneys. The accumulation of silver into organs and tissues important in motor functions may be of relevance especially in emergency and catastrophe situations in which accurate motor functions may be critical. A re-evaluation of the present recommendations on the use of silver salts for disinfection of drinking water might be necessary

  12. Theoretical implications of quantitative properties of interval timing and probability estimation in mouse and rat.

    Science.gov (United States)

    Kheifets, Aaron; Freestone, David; Gallistel, C R

    2017-07-01

    In three experiments with mice ( Mus musculus ) and rats (Rattus norvigicus), we used a switch paradigm to measure quantitative properties of the interval-timing mechanism. We found that: 1) Rodents adjusted the precision of their timed switches in response to changes in the interval between the short and long feed latencies (the temporal goalposts). 2) The variability in the timing of the switch response was reduced or unchanged in the face of large trial-to-trial random variability in the short and long feed latencies. 3) The adjustment in the distribution of switch latencies in response to changes in the relative frequency of short and long trials was sensitive to the asymmetry in the Kullback-Leibler divergence. The three results suggest that durations are represented with adjustable precision, that they are timed by multiple timers, and that there is a trial-by-trial (episodic) record of feed latencies in memory. © 2017 Society for the Experimental Analysis of Behavior.

  13. Meiotic drive on aberrant chromosome 1 in the mouse is determined by a linked distorter.

    Science.gov (United States)

    Agulnik, S I; Sabantsev, I D; Orlova, G V; Ruvinsky, A O

    1993-04-01

    An aberrant chromosome 1 carrying an inverted fragment with two amplified DNA regions was isolated from wild populations of Mus musculus. Meiotic drive favouring the aberrant chromosome was demonstrated for heterozygous females. Its cause was preferential passage of aberrant chromosome 1 to the oocyte. Genetic analysis allowed us to identify a two-component system conditioning deviation from equal segregation of the homologues. The system consists of a postulated distorter and responder. The distorter is located on chromosome 1 distally to the responder, between the ln and Pep-3 genes, and it acts on the responder when in trans position. Polymorphism of the distorters was manifested as variation in their effect on meiotic drive level in the laboratory strain and mice from wild populations.

  14. Nova Mus 2018 (PNV J11261220-6531086) Is Forming Dust

    Science.gov (United States)

    Walter, Frederick M.

    2018-02-01

    Nova Mus 2018 (PNV J11261220-6531086) was discovered by R Kaufman on 2018 Jan 14.486, and reported by P. Schmeer in vsnet-alert 21772. The first detection was 2018 Jan 3.24 (ASAS-SN, reported in the TOCP).

  15. Musée ideale : unistused täiuslikust muuseumist / Mariann Raisma

    Index Scriptorium Estoniae

    Raisma, Mariann, 1974-

    2008-01-01

    18.-19. sajandi unistusi täiuslikust muuseumist kolmel tasandil: vormi ehk arhitektuuri, muuseumikogu terviklikkuse ning pärandi kättesaadavuse kaudu. Pikemalt Napoleon Bonaparte'ile pühendatud Musée Napoleoni kogudest, kontseptsioonist ja koopiamuuseumidest Lääne-Euroopas ning Tartus

  16. Detection of Highly-Absorbed X-rays from Nova Mus 2018 with Swift

    Science.gov (United States)

    Nelson, Thomas; Kuin, Paul; Mukai, Koji; Page, Kim; Chomiuk, Laura; Kawash, Adam; Sokoloski, J. L.; Linford, Justin; Rupen, Michael P.; Mioduszewski, Amy

    2018-03-01

    We report the detection of X-rays from Nova Mus 2018 with the Swift XRT instrument. We have been carrying out weekly monitoring of the nova with Swift since its discovery on 2018 Jan 15 (see ATel #11220), and observations up to 2018 Feb 24 yielded X-ray non-detections.

  17. X-ray and UV observations of Nova Mus 2018 with Swift

    Science.gov (United States)

    Nelson, Thomas; Mukai, Koji; Chomiuk, Laura; Li, Kwan-Kok; Kawash, Adam; Sokoloski, J. L.; Rupen, Michael; Linford, Justin; Mioduszewski, Amy

    2018-01-01

    We observed Nova Mus 2018 (PNV J11261220-6531086) with the Neil Gehrels Swift Observatory on 2018 January 21, 18 days after the initial rapid rise to V=8.8 on 2018 January 3.24 (see link below for more details).

  18. Meiosis and speciation: a study in a speciating Mus terricolor complex

    Indian Academy of Sciences (India)

    Unknown

    2000-12-27

    Dec 27, 2000 ... (see reviews by White 1978; King 1981) or would lead to reduced viability of ... Indian pygmy field mice Mus terricolor, vis-à-vis the fixa- tion of autosomal ... plexes (SCs) were prepared and stained with silver nitrate. (Fletcher ...

  19. NCBI nr-aa BLAST: CBRC-PABE-21-0006 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-21-0006 sp|P97714|ADA1D_MOUSE Alpha-1D adrenergic receptor (Alpha 1D-adre...noceptor) (Alpha 1D-adrenoreceptor) (Alpha-1A adrenergic receptor) gb|AAB47042.1| alpha 1d-adrenergic recept...or [Mus sp.] dbj|BAA90312.1| alpha 1D adrenergic receptor [Mus musculus] P97714 0.0 78% ...

  20. NCBI nr-aa BLAST: CBRC-CPOR-01-1147 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1147 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

  1. NCBI nr-aa BLAST: CBRC-CPOR-01-0933 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-0933 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

  2. NCBI nr-aa BLAST: CBRC-MMUS-06-0130 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-06-0130 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

  3. NCBI nr-aa BLAST: CBRC-PABE-04-0003 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-04-0003 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

  4. NCBI nr-aa BLAST: CBRC-OCUN-01-1001 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-1001 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

  5. NCBI nr-aa BLAST: CBRC-MMUS-06-0137 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-06-0137 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

  6. NCBI nr-aa BLAST: CBRC-RNOR-04-0241 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-04-0241 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

  7. NCBI nr-aa BLAST: CBRC-CPOR-01-1167 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-1167 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

  8. NCBI nr-aa BLAST: CBRC-MMUS-06-0138 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-06-0138 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

  9. NCBI nr-aa BLAST: CBRC-STRI-01-2626 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2626 sp|Q8VBS7|VN1A6_MOUSE RecName: Full=Vomeronasal type-1 receptor A...6; AltName: Full=Vomeronasal type-1 receptor A3; AltName: Full=Vomeronasal type-1 receptor A1; AltName: Full=Vomeronasa...l type-1 receptor A10 dbj|BAB79209.1| vomeronasal receptor 1 A1 [Mus musculus] dbj|BAB79210.1| vomeronasa...l receptor 1 A3 [Mus musculus] gb|AAK98772.1| vomeronasal receptor V1RA10

  10. NCBI nr-aa BLAST: CBRC-MMUS-06-0124 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-06-0124 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8VIC7|VN1A2_MOUSE Vomeronas...al type-1 receptor A2 (Pheromone receptor 2) (Vomeronasal type-1 receptor A9) (mV1R...2) dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasal 1 receptor, A2 [synth...etic construct] gb|AAI40265.1| Vomeronasal 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasa

  11. NCBI nr-aa BLAST: CBRC-RNOR-08-0336 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-08-0336 ref|NP_666341.1| dynein cytoplasmic 1 light intermediate chain 1 ...[Mus musculus] sp|Q8R1Q8|DC1L1_MOUSE Cytoplasmic dynein 1 light intermediate chain 1 (Dynein light intermedia...te chain 1, cytosolic) (Dynein light chain A) (DLC-A) gb|AAH23347.1| Dynein cytoplasmic 1 light intermediat...b|EDL09299.1| dynein cytoplasmic 1 light intermediate chain 1 [Mus musculus] NP_666341.1 1e-137 63% ...

  12. NCBI nr-aa BLAST: CBRC-STRI-01-2691 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2691 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 1e-74 49% ...

  13. NCBI nr-aa BLAST: CBRC-OCUN-01-0928 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0928 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 1e-81 52% ...

  14. NCBI nr-aa BLAST: CBRC-OCUN-01-0428 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OCUN-01-0428 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 2e-82 51% ...

  15. NCBI nr-aa BLAST: CBRC-STRI-01-2568 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2568 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 5e-49 53% ...

  16. NCBI nr-aa BLAST: CBRC-STRI-01-2291 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2291 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 1e-79 50% ...

  17. NCBI nr-aa BLAST: CBRC-CPOR-01-0933 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CPOR-01-0933 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 7e-78 52% ...

  18. NCBI nr-aa BLAST: CBRC-MMUS-06-0143 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-06-0143 ref|NP_444448.1| vomeronasal 1 receptor, A3 [Mus musculus] sp|Q9EQ52|VN1A3_MOUSE Vomeronas...al type-1 receptor A3 (Vomeronasal type-1 receptor A6) gb|AAG42076.1|AF291482_1 vomeronasa...l receptor V1RA3 [Mus musculus] dbj|BAB79212.1| vomeronasal receptor 1 A6 [Mus musculus] gb|AAI41612.1| Vomeronasa...l 1 receptor, A3 [synthetic construct] gb|AAI40226.1| Vomeronasal 1 receptor, A3 [synthetic construct] NP_444448.1 4e-85 55% ...

  19. NCBI nr-aa BLAST: CBRC-STRI-01-0474 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-0474 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-81 53% ...

  20. NCBI nr-aa BLAST: CBRC-STRI-01-0722 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-0722 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-65 49% ...

  1. NCBI nr-aa BLAST: CBRC-STRI-01-2741 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2741 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 7e-83 53% ...

  2. NCBI nr-aa BLAST: CBRC-STRI-01-2574 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2574 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 2e-85 52% ...

  3. NCBI nr-aa BLAST: CBRC-STRI-01-0161 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-0161 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 3e-84 52% ...

  4. NCBI nr-aa BLAST: CBRC-STRI-01-2502 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-STRI-01-2502 ref|NP_035814.2| vomeronasal 1 receptor, A2 [Mus musculus] sp|Q8V...IC7|VN1A2_MOUSE RecName: Full=Vomeronasal type-1 receptor A2; Short=mV1R2; AltName: Full=Pheromone receptor ...2; AltName: Full=Vomeronasal type-1 receptor A9 dbj|BAB79214.1| vomeronasal receptor 1 A9 [Mus musculus] gb|AAI41637.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|AAI40265.1| Vomeronasa...l 1 receptor, A2 [synthetic construct] gb|EDK99273.1| vomeronasal 1 receptor, A2 [Mus musculus] NP_035814.2 5e-70 49% ...

  5. Comparison of trap types, placement, and colors for monitoring Anthonomus musculus (Coleoptera: Curculionidae) adults in highbush blueberries

    Science.gov (United States)

    Cranberry weevil, Anthonomus musculus Say (Coleoptera: Curculionidae), is a key pest of highbush blueberries in the northeast USA. To date, however, no trapping system has been developed to successfully monitor this pest. In 2012-2014, studies were conducted in commercial blueberry farms in New Jers...

  6. NCBI nr-aa BLAST: CBRC-XTRO-01-3247 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3247 sp|P97718|ADA1A_MOUSE Alpha-1A adrenergic receptor (Alpha 1A-adre...noceptor) (Alpha 1A-adrenoreceptor) (Alpha-1C adrenergic receptor) gb|AAC02658.1| alpha 1A-adrenergic receptor [Mus musculus] P97718 0.0 69% ...

  7. NCBI nr-aa BLAST: CBRC-MMUS-14-0085 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-14-0085 sp|P97718|ADA1A_MOUSE Alpha-1A adrenergic receptor (Alpha 1A-adre...noceptor) (Alpha 1A-adrenoreceptor) (Alpha-1C adrenergic receptor) gb|AAC02658.1| alpha 1A-adrenergic receptor [Mus musculus] P97718 0.0 99% ...

  8. Environmental Impact Statement. Disposal and Reuse of Wurtsmith Air Force Base, Michigan

    Science.gov (United States)

    1993-09-01

    Mephitis mephitis Meadow vole Microtus pennsy/vanicus House mouse Mus musculus Long-tailed weasel Mustela frenata Mink Mustela vison Little brown bat...fuels, such as coal and oil, are burned. SO2 is the main pollutant involved in the formation of acid rain. SO also can irritate the upper respiratory

  9. Experiment list: SRX897941 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 081,98.0,12.4,11292 GSM1624626: ChIP seq Chaf1a.166 Sox2 IP day3; Mus musculus; ChIP-Seq source_name=OKSM reprogramming... intermediates from Mouse Embryonic Fibroblasts || strain=Black6-129X1/SvJ || cell type=OKSM reprogramming

  10. Experiment list: SRX897943 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 153,97.9,13.9,15440 GSM1624628: ChIP seq Renilla Sox2 IP day3; Mus musculus; ChIP-Seq source_name=OKSM reprogramming... intermediates from Mouse Embryonic Fibroblasts || strain=Black6-129X1/SvJ || cell type=OKSM reprogramming

  11. A Survey of Toxoplasma gondii and Neospora caninum Infecting House Mice from a Hybrid Zone

    Czech Academy of Sciences Publication Activity Database

    Hůrková-Hofmannová, L.; Qablan, M. A.; Juránková, J.; Modrý, David; Piálek, Jaroslav

    2014-01-01

    Roč. 100, č. 1 (2014), s. 139-141 ISSN 0022-3395 R&D Projects: GA ČR GA206/08/0640 Institutional support: RVO:60077344 ; RVO:68081766 Keywords : mouse Mus musculus * feral rodents * wild rodents Subject RIV: EB - Genetics ; Molecular Biology; EB - Genetics ; Molecular Biology (UBO-W) Impact factor: 1.227, year: 2014

  12. On the determination of Toxoplasma gondii virulence in mice

    Science.gov (United States)

    Toxoplasma gondii is one of the most successful pathogens on earth, capable of infecting mammals and birds. Numerous papers and reports are published on isolation of T .gondii from various natural sources worldwide. The house mouse (Mus musculus) has been used as the laboratory animal model to deter...

  13. REVIEW - Thermal Physiology of Laboratory Mice: Defining Thermoneutrality

    Science.gov (United States)

    In terms of total number of publications, the laboratory mouse (Mus musculus) has emerged as the most popular test subject in biomedical research. Mice are used as models to study obesity, diabetes, eNS diseases and variety of other pathologies. Mice are classified as homeotherms...

  14. Experiment list: SRX471838 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available : ChIPseq GS WT Bmi1; Mus musculus; ChIP-Seq source_name=Cultured germline stem cells || genotype/variation=...Wild-type || strain=CD1 x C57BL/6 || cell type=Cultured germline stem cells || chip antibody=Mouse anti-Bmi1

  15. Population genetic structure in a Robertsonian race of house mice: evidence from microsatellite polymorphism

    NARCIS (Netherlands)

    Dallas, J.F.; Bonhomme, F.; Boursot, P.; Britton-Davidian, J.; Bauchau, V.

    1998-01-01

    Genetic evidence was assessed for inbreeding and population subdivision in a Robertsonian fusion (Rb) race of the western European form of house mouse, Mus musculus domesticus, in central Belgium. Inbreeding, and the factors responsible for subdivision (genetic drift and extinction-recolonization)

  16. Experiment list: SRX218536 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available strain=C57Bl/6 || age/gender=2-3 month old males || chip antibody=Santa Cruz Tech. rIgG (sc-2027) http://db....7,16.5,1194 GSM1067409: Rabbit IgG mouse liver ChIP-seq; Mus musculus; ChIP-Seq GEO Accession=GSM1067409 ||

  17. Fellow travellers

    DEFF Research Database (Denmark)

    Jones, E. P.; Skirnisson, K.; McGovern, T. H.

    2012-01-01

    Background: House mice (Mus musculus) are commensals of humans and therefore their phylogeography can reflect human colonization and settlement patterns. Previous studies have linked the distribution of house mouse mitochondrial (mt) DNA clades to areas formerly occupied by the Norwegian Vikings ...

  18. NCBI nr-aa BLAST: CBRC-CINT-01-0064 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CINT-01-0064 sp|Q9QY96|CASR_MOUSE Extracellular calcium-sensing receptor precu...rsor (CaSR) (Parathyroid Cell calcium-sensing receptor) gb|AAD28371.1|AF110178_1 calcium-sensing receptor [Mus musculus] Q9QY96 0.0 41% ...

  19. AcEST: BP917335 [AcEST

    Lifescience Database Archive (English)

    Full Text Available _MOUSE DNA-binding protein SMUBP-2 OS=Mus musculus GN=Ighmbp2 PE=1 SV=1 Length = 993 Score = 42.4 bits (98),...THGEYTSAAE 635 >tr|Q9EQN5|Q9EQN5_RAT Antifreeze-enhancer binding protein AEP OS=Rattus norvegicus GN=Ighmbp2

  20. Experiment list: SRX655689 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available 8698: pol2 KO ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embry...onic fibroblast || genotype/variation=MED23 knockout || chip antibody=Pol II http

  1. Experiment list: SRX655693 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ut KO ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fib...roblast || genotype/variation=MED23 knockout http://dbarchive.biosciencedbc.jp/ky

  2. Experiment list: SRX1121725 [Chip-atlas[Archive

    Lifescience Database Archive (English)

    Full Text Available ChIPSeq; Mus musculus; ChIP-Seq source_name=MEFs cells knockout MED23 || cell type=mouse embryonic fibroblas...t || genotype/variation=MED23 knockout || chip antibody=H3K4me3 http://dbarchive.

  3. NCBI nr-aa BLAST: CBRC-GACU-23-0054 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GACU-23-0054 sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 (Progesti...n and adipoQ receptor family member IX) gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 4e-55 36% ...

  4. NCBI nr-aa BLAST: CBRC-XTRO-01-3489 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-3489 sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 (Progesti...n and adipoQ receptor family member IX) gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 1e-151 78% ...

  5. NCBI nr-aa BLAST: CBRC-PMAR-01-0530 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PMAR-01-0530 sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 (Progesti...n and adipoQ receptor family member IX) gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 6e-69 42% ...

  6. NCBI nr-aa BLAST: CBRC-CFAM-23-0010 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CFAM-23-0010 sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 (Progesti...n and adipoQ receptor family member IX) gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 0.0 91% ...

  7. NCBI nr-aa BLAST: CBRC-OLAT-26-0036 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OLAT-26-0036 sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 (Progesti...n and adipoQ receptor family member IX) gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 1e-55 36% ...

  8. NCBI nr-aa BLAST: CBRC-BTAU-01-3057 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-BTAU-01-3057 sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 (Progesti...n and adipoQ receptor family member IX) gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 0.0 90% ...

  9. NCBI nr-aa BLAST: CBRC-DRER-07-0075 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DRER-07-0075 sp|Q6TCG2|PAQR9_MOUSE Progestin and adipoQ receptor family member 9 (Progesti...n and adipoQ receptor family member IX) gb|AAR08386.1| progestin and adipoQ receptor family member IX [Mus musculus] Q6TCG2 9e-57 36% ...

  10. RECQ5 Helicase Cooperates with MUS81 Endonuclease in Processing Stalled Replication Forks at Common Fragile Sites during Mitosis

    DEFF Research Database (Denmark)

    Di Marco, Stefano; Hasanova, Zdenka; Kanagaraj, Radhakrishnan

    2017-01-01

    The MUS81-EME1 endonuclease cleaves late replication intermediates at common fragile sites (CFSs) during early mitosis to trigger DNA-repair synthesis that ensures faithful chromosome segregation. Here, we show that these DNA transactions are promoted by RECQ5 DNA helicase in a manner dependent...... on its Ser727 phosphorylation by CDK1. Upon replication stress, RECQ5 associates with CFSs in early mitosis through its physical interaction with MUS81 and promotes MUS81-dependent mitotic DNA synthesis. RECQ5 depletion or mutational inactivation of its ATP-binding site, RAD51-interacting domain...

  11. Le MusVerre, Sars-Poteries, Hauts-de-France

    OpenAIRE

    Schmitt , Daniel

    2017-01-01

    Le MusVerre, inauguré en 2016, présente une collection patrimoniale et contemporaine d'art verrier. Le scénario de la visite propose un parcours en deux temps avec une séquence historique : de l’histoire des « bousillés » à la création du musée avec une galerie technique qui donne un aperçu des gestes de l’art verrier. Puis une séquence contemporaine développe un panorama des collections d’art verrier d’aujourd’hui, dans leur grande richesse et originalité.

  12. Stop Stalling: Mus81 Required for Efficient Replication | Center for Cancer Research

    Science.gov (United States)

    DNA replication is precisely controlled to ensure that daughter cells receive intact, accurate genetic information. Each segment of DNA must be copied only once, and the rate of replication coordinated genome-wide. Mild replication stress slows DNA synthesis and activates a pathway involving the Mus81 endonuclease, which generates a series of DNA breaks that are rapidly repaired, allowing the cell to avoid activating the S-phase checkpoint and its potentially damaging outcomes of apoptosis or error-prone repair. Mirit Aladjem, Ph.D., of CCR’s Developmental Therapeutics Branch, and her colleagues wondered whether Mus81 also plays a role in regulating the replication rate during growth in the absence of stress.

  13. Mechanistic basis of infertility of mouse intersubspecific hybrids

    Science.gov (United States)

    Bhattacharyya, Tanmoy; Gregorova, Sona; Mihola, Ondrej; Anger, Martin; Sebestova, Jaroslava; Denny, Paul; Simecek, Petr; Forejt, Jiri

    2013-01-01

    According to the Dobzhansky–Muller model, hybrid sterility is a consequence of the independent evolution of related taxa resulting in incompatible genomic interactions of their hybrids. The model implies that the incompatibilities evolve randomly, unless a particular gene or nongenic sequence diverges much faster than the rest of the genome. Here we propose that asynapsis of heterospecific chromosomes in meiotic prophase provides a recurrently evolving trigger for the meiotic arrest of interspecific F1 hybrids. We observed extensive asynapsis of chromosomes and disturbance of the sex body in >95% of pachynemas of Mus m. musculus × Mus m. domesticus sterile F1 males. Asynapsis was not preceded by a failure of double-strand break induction, and the rate of meiotic crossing over was not affected in synapsed chromosomes. DNA double-strand break repair was delayed or failed in unsynapsed autosomes, and misexpression of chromosome X and chromosome Y genes was detected in single pachynemas and by genome-wide expression profiling. Oocytes of F1 hybrid females showed the same kind of synaptic problems but with the incidence reduced to half. Most of the oocytes with pachytene asynapsis were eliminated before birth. We propose the heterospecific pairing of homologous chromosomes as a preexisting condition of asynapsis in interspecific hybrids. The asynapsis may represent a universal mechanistic basis of F1 hybrid sterility manifested by pachytene arrest. It is tempting to speculate that a fast-evolving subset of the noncoding genomic sequence important for chromosome pairing and synapsis may be the culprit. PMID:23329330

  14. Corrected placement of Mus-Rattus fossil calibration forces precision in the molecular tree of rodents

    OpenAIRE

    Kimura, Yuri; Hawkins, Melissa T. R.; McDonough, Molly M.; Jacobs, Louis L.; Flynn, Lawrence J.

    2015-01-01

    Time calibration derived from the fossil record is essential for molecular phylogenetic and evolutionary studies. Fossil mice and rats, discovered in the Siwalik Group of Pakistan, have served as one of the best-known fossil calibration points in molecular phylogenic studies. Although these fossils have been widely used as the 12 Ma date for the Mus/Rattus split or a more basal split, conclusive paleontological evidence for the nodal assignments has been absent. This study analyzes newly reco...

  15. Potential of MuS1 Transgenic Tobacco for Phytoremediation of the Urban Soils Contaminated with Cadmium

    Science.gov (United States)

    Kim, K. H.; Kim, Y. N.; Kim, S. H.

    2010-05-01

    Urban soils are prone to contamination by trace elements such as Cd, Cu, Pb and Zn. Phytoremediation is one of the attractive remediation methods for soils contaminated with trace elements due to its non-destructive and environmentally-friendly characteristic. Scientists have tried to find hyper-accumulator plants in nature or to develop transgenic plant through genetic engineering. This study was carried out to identify a potential of MuS1 transgenic tobacco for phytoremediation of the urban soils contaminated with Cd. MuS1 is known as a multiple stress related gene with several lines. The previous study using RT-PCR showed that the expression of MuS1 gene in tobacco plant induced tolerance to Cd stress. For this study, MuS1 transgenic tobacco and wild-type tobacco (control) were cultivated in a hydroponic system treated with Cd (0, 50, 100 and 200μM Cd) for 3 weeks. At harvest, both tobacco and nutrient solution were collected and were analyzed for Cd. Effect of Cd treatment on morphological change of the tobacco leaves was also observed by variable-pressure scanning electron microscopy (VP-SEM). The tolerance of MuS1 transgenic tobacco to Cd stress was better than that of wild-type tobacco at all Cd levels. Especially, wild-type tobacco showed chlorosis and withering with 200μM Cd treatment, whereas MuS1 transgenic tobacco gradually recovered from Cd damage. Wild-type tobacco accumulated more Cd (4.65mg per plant) than MuS1 transgenic tobacco (2.37mg per plant) with 200μM Cd treatment. Cd translocation rate from root to leaves was 81.8 % for wild-type tobacco compared to 37.1 % for MuS1 transgenic tobacco. Result of VP-SEM showed that the number of trichome in the leaves for wild-type tobacco increased in comparison with that for untreated samples after 3 weeks, while that for MuS1 transgenic tobacco was not changed by Cd treatment. Results showed that the mechanism of the recovery of the MuS1 tobacco plant was not by high level of Cd uptake and accumulation

  16. The MusIC method: a fast and quasi-optimal solution to the muscle forces estimation problem

    OpenAIRE

    Muller , Antoine; Pontonnier , Charles; Dumont , Georges

    2018-01-01

    International audience; The present paper aims at presenting a fast and quasi-optimal method of muscle forces estimation: the MusIC method. It consists in interpolating a first estimation in a database generated offline thanks to a classical optimization problem, and then correcting it to respect the motion dynamics. Three different cost functions – two polynomial criteria and a min/max criterion – were tested on a planar musculoskeletal model. The MusIC method provides a computation frequenc...

  17. Corrected placement of Mus-Rattus fossil calibration forces precision in the molecular tree of rodents.

    Science.gov (United States)

    Kimura, Yuri; Hawkins, Melissa T R; McDonough, Molly M; Jacobs, Louis L; Flynn, Lawrence J

    2015-09-28

    Time calibration derived from the fossil record is essential for molecular phylogenetic and evolutionary studies. Fossil mice and rats, discovered in the Siwalik Group of Pakistan, have served as one of the best-known fossil calibration points in molecular phylogenic studies. Although these fossils have been widely used as the 12 Ma date for the Mus/Rattus split or a more basal split, conclusive paleontological evidence for the nodal assignments has been absent. This study analyzes newly recognized characters that demonstrate lineage separation in the fossil record of Siwalik murines and examines the most reasonable nodal placement of the diverging lineages in a molecular phylogenetic tree by ancestral state reconstruction. Our specimen-based approach strongly indicates that Siwalik murines of the Karnimata clade are fossil members of the Arvicanthini-Otomyini-Millardini clade, which excludes Rattus and its relatives. Combining the new interpretation with the widely accepted hypothesis that the Progonomys clade includes Mus, the lineage separation event in the Siwalik fossil record represents the Mus/Arvicanthis split. Our test analysis on Bayesian age estimates shows that this new calibration point provides more accurate estimates of murine divergence than previous applications. Thus, we define this fossil calibration point and refine two other fossil-based points for molecular dating.

  18. Primera evidencia de infección por el virus de la coriomeningitis linfocítica (arenavirus en roedores Mus musculus capturados en la zona urbana del municipio de Sincelejo, Sucre, Colombia

    Directory of Open Access Journals (Sweden)

    Anais Castellar

    2017-04-01

    Conclusión. Los resultados indicaron que la infección por el virus de la coriomeningitis linfocítica en humanos podría ocurrir en el área urbana de Sincelejo, aunque hasta la fecha no se hayan reportado casos.

  19. Evaluation of the in vivo mutagenic potential of hydroalcoholic extracts of the northern highbush blueberry (Vaccinium corymbosum L. Ericales, Ericaceae on peripheral blood cells of Swiss mice (Mus musculus Rodentia, Muridae

    Directory of Open Access Journals (Sweden)

    Patrícia Scotini Freitas

    2008-01-01

    Full Text Available The northern highbush blueberry (Vaccinium corymbosum L. Ericales, Ericaceae is very rich in anthocyanins, natural pigments which have strong antioxidant properties and potential health benefits, resulting in the worldwide use the blueberry as a medicinal plant. We investigated the mutagenic potential of simple hydroalcoholic extracts of V. corymbosum acutely administrated by gavage to Swiss mice at doses of 1 g kg-1, 1.5 g kg-1 and 2 g kg-1. Peripheral blood cells were collected 4 h and 24 h post-gavage and assessed by the alkaline comet assay, with further blood samples being collected at 48 h and 72 h for assessment using the micronucleus (MN assay. Our results show that the V. corymbosum extracts did not induce any statistically significant increase in the average amount of DNA damage in peripheral blood leukocytes. However, we did record a significant increase in the frequency of micronucleated polychromatic erythrocytes at the three doses tested.

  20. Studies the alterations of biochemical and mineral contents in bone tissue of mus musculus due to aluminum toxicity and the protective action of desferrioxamine and deferiprone by FTIR, ICP-OES, SEM and XRD techniques.

    Science.gov (United States)

    Sivakumar, S; Khatiwada, Chandra Prasad; Sivasubramanian, J

    2014-05-21

    The present study has attempt to analyze the changes in the biochemical and mineral contents of aluminum intoxicated bone and determine the protective action of desferrioxamine (DFO) and deferiprone (DFP) by using Fourier transform infrared (FTIR) spectroscopy, X-ray diffraction (XRD), inductively coupled plasma optical emission spectroscopy (ICP-OES), and scanning electron microscopy (SEM) techniques for four groups of animals such as control (Group I), aluminum intoxicated (Group II), Al+DFP (Group III) and Al+DFO+DFP (Group IV) treated groups respectively. The FTIR spectra of the aluminum intoxicated bone showed significant alteration in the biochemical constituents. The bands ratio at I1400/I877 significantly decreased from control to aluminum, but enhanced it by Al+DFP to Al+DFO+DFP treated bone tissue for treatments of 16 weeks. This result suggests that DFO and DFP are the carbonate inhibitor, recovered from chronic growth of bone diseases and pathologies. The alteration of proteins profile indicated by Amide I and Amide II, where peak area values decreased from control to aluminum respectively, but enhanced by treated with DFP (p.o.) and DFO+DFP (i.p.) respectively. The XRD analysis showed a decrease in crystallinity due to aluminum toxicity. Further, the Ca, Mg, and P contents of the aluminum exposed bone were less than those of the control group, and enhanced by treatments with DFO and DFP. The concentrations of trace elements were found by ICP-OES. Therefore, present study suggests that due to aluminum toxicity severe loss of bone minerals, decrease in the biochemical constituents and changes in the surface morphology. Copyright © 2014 Elsevier B.V. All rights reserved.

  1. Histopatologia da esquistossomose mansoni em fígado de Mus musculus infectado por amostras humanas de fase aguda e crônica da periferia de Belo Horizonte, Minas Gerais

    Directory of Open Access Journals (Sweden)

    Amélia Dulce Vilela de Carvalho

    1986-06-01

    Full Text Available Exemplares de Biomphalaria glabrataforam infectados com miracídios obtidos de ovos de Schistosoma mansoni, encontrados em fezes de indivíduos de 7 a 18 anos, da região de Lagoa da Pampulha, Belo Horizonte, MG. Os pacientes de fase aguda se infectaram em uma primeira visita ao foco. Os da fase crônica eram moradores próximos aos focos. Para cada caso clínico, isolou-se a respectiva amostra do parasita. Foram infectados pela cauda 55 camundongos fêmeas com 70 ± 10 cercárias. Cortes histológicos de fígados, corados por HE, tricrômico de Gomori, impregnação metálica pela prata, e PAS foram observados à microscopia óptica. Não houve diferenças estatísticas em relação às médias das mensurações dos diâmetros dos granulomas referentes às amostras e datas de sacrifícios. Os granulomas apresentaram fase exsudativa do tipo Ha (reação de inflamação mista e IIIa (granuloma com células epitelióides. Com amostras de pacientes em fase aguda o padrão predominante foi a Ha na 7ª semana. Na 10.ª semana predominaram granulomas do tipo IIIa. Nas amostras de pacientes em fase crônica, verificou-se uma mescla de granulomas do tipo Ha e IIIa na 7ª semana. Na 10ª semana predominou o tipo IIIa. Alguns aspectos histopatológicos de fígados foram descritos e comparados com aqueles existentes na literatura.

  2. História da colonização do ratinho-caseiro, Mus musculus domesticus, em ilhas AtLânticas (Madeira, Açores e Cabo Verde): uma abordagem multilocus

    OpenAIRE

    Santos, Ana Sofia Carromeu dos

    2017-01-01

    Tese de mestrado, Biologia Evolutiva e do Desenvolvimento, Universidade de Lisboa, Faculdade de Ciências, 2017 As ilhas oceânicas são consideradas laboratórios naturais para o estudo da evolução. Os humanos são também agentes de colonização de várias espécies, nomeadamente, mamíferos terrestres, ao transportarem, ativa ou passivamente, estes animais para as ilhas. Uma das introduções mediadas pelo Homem mais icónicas envolve a disseminação mundial do ratinho-caseiro, principalmente da sub-...

  3. POSSuMUS. A position sensitive scintillating muon SiPM detector

    International Nuclear Information System (INIS)

    Ruschke, Alexander

    2014-01-01

    The development of a modular designed large scale scintillation detector with a two-dimensional position sensitivity is presented in this thesis. This novel POsition Sensitive Scintillating MUon SiPM Detector is named POSSuMUS. The POSSuMUS detector is capable to determine the particle's position in two space dimensions with a fast trigger capability. Each module is constructed from two trapezoidal shaped plastic scintillators to form one rectangular shaped detector module. Both trapezoids are optically insulated against each other. In both trapezoids the scintillation light is collected by plastic fibers and guided towards silicon photomultipliers (SiPMs). SiPMs are light sensors which are capable to detect even smallest amounts of light. By combining several detector modules, position sensitive areas from 100 cm 2 to few m 2 are achievable with few readout channels. Therefore, POSSuMUS provides a cost effective detector concept. The position sensitivity along the trapezoidal geometry of one detector module is achieved by the path length dependent amount of detected light for crossing particles. The ratio of the light yields in both trapezoids is calculated. This value corresponds to the position of the particle traversing the detector. A spatial resolution in the order of several mm is foreseen. The position sensitivity along the scintillator module is determined by the propagation time of light to the SiPMs located on opposite sides of the detector. A spatial resolution of few cm is expected for this direction. The POSSuMUS detector is applicable as large area trigger detector with a two dimensional position information of crossing particles. This is suitable in detector tests of large area precesion detectors or for measuring the small angle scattering of cosmic muons. At the beginning of this thesis, the determination of important SiPM characteristics like the breakdown voltage is presented. In the course of this work the detector principle is proven by

  4. Transcriptome-wide survey of mouse CNS-derived cells reveals monoallelic expression within novel gene families.

    Directory of Open Access Journals (Sweden)

    Sierra M Li

    Full Text Available Monoallelic expression is an integral component of regulation of a number of essential genes and gene families. To probe for allele-specific expression in cells of CNS origin, we used next-generation sequencing (RNA-seq to analyze four clonal neural stem cell (NSC lines derived from Mus musculus C57BL/6 (B6×Mus musculus molossinus (JF1 adult female mice. We established a JF1 cSNP library, then ascertained transcriptome-wide expression from B6 vs. JF1 alleles in the NSC lines. Validating the assay, we found that 262 of 268 X-linked genes evaluable in at least one cell line showed monoallelic expression (at least 85% expression of the predominant allele, p-value<0.05. For autosomal genes 170 of 7,198 genes (2.4% of the total showed monoallelic expression in at least 2 evaluable cell lines. The group included eight known imprinted genes with the expected pattern of allele-specific expression. Among the other autosomal genes with monoallelic expression were five members of the glutathione transferase gene superfamily, which processes xenobiotic compounds as well as carcinogens and cancer therapeutic agents. Monoallelic expression within this superfamily thus may play a functional role in the response to diverse and potentially lethal exogenous factors, as is the case for the immunoglobulin and olfactory receptor superfamilies. Other genes and gene families showing monoallelic expression include the annexin gene family and the Thy1 gene, both linked to inflammation and cancer, as well as genes linked to alcohol dependence (Gabrg1 and epilepsy (Kcnma1. The annotated set of genes will provide a resource for investigation of mechanisms underlying certain cases of these and other major disorders.

  5. Comparison of Trap Types, Placement, and Colors for Monitoring Anthonomus musculus (Coleoptera: Curculionidae) Adults in Highbush Blueberries

    Science.gov (United States)

    Silva, Diego; Salamanca, Jordano; Kyryczenko-Roth, Vera; Alborn, Hans T; Rodriguez-Saona, Cesar

    2018-01-01

    Abstract The cranberry weevil, Anthonomus musculus Say (Coleoptera: Curculionidae), is a key (univoltine) pest of highbush blueberries in the northeast United States. To date, however, no trapping system has been developed to successfully monitor this pest. In 2012–2014, studies were conducted in commercial highbush blueberry farms in New Jersey to 1) evaluate the efficacy of various commercially available traps, designed for other weevil species (e.g., pepper weevil, plum curculio, boll weevil, red palm weevil, and black vine weevil), in capturing A. musculus adults; 2) test whether the relative location of traps within the blueberry canopy affects adult captures and 3) determine the effects of different colored (yellow, white, green, red, blue, brown, and black) sticky traps on weevil captures. For a comparison with existing techniques, we also monitored the number of overwintered adult weevils on blueberry bushes using beat sheet sampling. Of all traps and colors tested, the most A. musculus adults were caught on yellow sticky traps and more adults were captured when these traps were placed at the bottom half of the blueberry canopy, i.e., 0.5–1.0 m above ground. Most weevils were caught on colored traps late in the season (i.e., during bloom), which corresponds mostly to the second (summer) adult generation. Thus, number of overwintered adults caught on traps did not correlate with those on bushes. Although our study identified traps that can be used to capture A. musculus adults, these traps alone (i.e., without semiochemicals) have so far limited applicability for monitoring overwintered adult weevils in highbush blueberries.

  6. Spontaneous laterality in mouse Crl:CD1.

    Science.gov (United States)

    Maciejewska, Maria; Zięba, Katarzyna; Szymańska, Justyna; Warońska, Magdalena

    2016-01-01

    Lateralization developed very early in evolution and it is a characteristic of a wide range of representatives from the animal kingdom. The aim of the present study was to examine the spontaneous laterality in mice (Mus musculus) with the T-maze test. We wanted to check if this kind of functional asymmetry occurs at a population level, and also if there are gender differences in this regard. The study involved 40 mice Crl:CD1. The research procedure was simple: mice had to choose one arm of the T-shaped apparatus to find the exit. The animals performed the 10 trails one after another. We took into account only the animals' fist reactions while preparing results. Most of the animals (68%) chose the right arm of the maze. The lateralization was stronger among females--75% of them had preferences for the right side. The majority of animals, which preferred the right side, were from the food deprivation group. However, the results did not unequivocally resolve whether mice evince the functional asymmetry at the population level, or whether there are gender differences in this area. Further research with a larger group and multiple observations for each animal are required to answer these questions.

  7. Quality characteristics of the Musculus longissimus dorsi from Pecora dell’Amiata reared in Tuscany

    Directory of Open Access Journals (Sweden)

    Roberto Tocci

    2017-07-01

    The trial was performed with ewes and lambs deriving from the local breed Pecora dell’Amiata. In this work, the Musculus longissimus dorsi (M. longissimus thoracis + lomborum physical-chemical and nutritional characteristics of 23 ewes and 20 lambs were compared. The ewes of the trial were over 7 years old while the lambs were on average 80 days old. Ewe meat has shown lower drip loss (4.14 vs 2.71% and lightness (L* 38.6 vs 45.3 values, and higher PH (6.15±0.07, shear force (8.4 vs 2.31 kg, fat content (5.9 vs 2.0%. The lamb meat lipids had higher polyunsaturated fatty acid content (PUFA: 14.58 vs 9.25% and higher PUFA/Saturated Fatty Acids (SFA ratio (0.31 vs 0.20. The PCA analysis identified two distinct groups regarding ewe and lamb meat respectively for the fatty acids composition and the health indices. Ewe meat showed dietetic and nutritional characteristics similar to that of lamb meat. These characteristics may allow in the future, to the ewe meat valorisation, now not appreciated by Tuscan and Italian market.

  8. Mouse adhalin

    DEFF Research Database (Denmark)

    Liu, L; Vachon, P H; Kuang, W

    1997-01-01

    . To analyze the biological roles of adhalin, we cloned the mouse adhalin cDNA, raised peptide-specific antibodies to its cytoplasmic domain, and examined its expression and localization in vivo and in vitro. The mouse adhalin sequence was 80% identical to that of human, rabbit, and hamster. Adhalin...... was specifically expressed in striated muscle cells and their immediate precursors, and absent in many other cell types. Adhalin expression in embryonic mouse muscle was coincident with primary myogenesis. Its expression was found to be up-regulated at mRNA and protein levels during myogenic differentiation...

  9. Srs2 and Mus81-Mms4 Prevent Accumulation of Toxic Inter-Homolog Recombination Intermediates.

    Directory of Open Access Journals (Sweden)

    Kenji Keyamura

    2016-07-01

    Full Text Available Homologous recombination is an evolutionally conserved mechanism that promotes genome stability through the faithful repair of double-strand breaks and single-strand gaps in DNA, and the recovery of stalled or collapsed replication forks. Saccharomyces cerevisiae ATP-dependent DNA helicase Srs2 (a member of the highly conserved UvrD family of helicases has multiple roles in regulating homologous recombination. A mutation (srs2K41A resulting in a helicase-dead mutant of Srs2 was found to be lethal in diploid, but not in haploid, cells. In diploid cells, Srs2K41A caused the accumulation of inter-homolog joint molecule intermediates, increased the levels of spontaneous Rad52 foci, and induced gross chromosomal rearrangements. Srs2K41A lethality and accumulation of joint molecules were suppressed by inactivating Rad51 or deleting the Rad51-interaction domain of Srs2, whereas phosphorylation and sumoylation of Srs2 and its interaction with sumoylated proliferating cell nuclear antigen (PCNA were not required for lethality. The structure-specific complex of crossover junction endonucleases Mus81 and Mms4 was also required for viability of diploid, but not haploid, SRS2 deletion mutants (srs2Δ, and diploid srs2Δ mus81Δ mutants accumulated joint molecule intermediates. Our data suggest that Srs2 and Mus81-Mms4 have critical roles in preventing the formation of (or in resolving toxic inter-homolog joint molecules, which could otherwise interfere with chromosome segregation and lead to genetic instability.

  10. Genome-wide mapping in a house mouse hybrid zone reveals hybrid sterility loci and Dobzhansky-Muller interactions.

    Science.gov (United States)

    Turner, Leslie M; Harr, Bettina

    2014-12-09

    Mapping hybrid defects in contact zones between incipient species can identify genomic regions contributing to reproductive isolation and reveal genetic mechanisms of speciation. The house mouse features a rare combination of sophisticated genetic tools and natural hybrid zones between subspecies. Male hybrids often show reduced fertility, a common reproductive barrier between incipient species. Laboratory crosses have identified sterility loci, but each encompasses hundreds of genes. We map genetic determinants of testis weight and testis gene expression using offspring of mice captured in a hybrid zone between M. musculus musculus and M. m. domesticus. Many generations of admixture enables high-resolution mapping of loci contributing to these sterility-related phenotypes. We identify complex interactions among sterility loci, suggesting multiple, non-independent genetic incompatibilities contribute to barriers to gene flow in the hybrid zone.

  11. Genetic variation and phylogeography of free-living mouse species (genus Mus) in the Balkans and the Middle East

    Czech Academy of Sciences Publication Activity Database

    Macholán, Miloš; Vyskočilová, Martina; Bonhomme, F.; Kryštufek, B.; Orth, A.; Vohralík, V.

    2007-01-01

    Roč. 16, č. 22 (2007), s. 4774-4788 ISSN 0962-1083 R&D Projects: GA AV ČR IAA6045307 Grant - others:GA ČR(CZ) GA206/05/2334 Institutional research plan: CEZ:AV0Z50450515; CEZ:AV0Z60930519 Keywords : glacial refugia * M. cypriacus * M. spicilegus Subject RIV: EG - Zoology Impact factor: 5.169, year: 2007 http://www.blackwell-synergy.com/doi/pdf/10.1111/j.1365-294X.2007.03526.x

  12. AcEST: DK962347 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ... 33 1.1 sp|Q7TSF1|DSG1B_MOUSE Desmoglein-1-beta OS=Mus musculus GN=Dsg1b... 31... 30 7.4 sp|Q61495|DSG1A_MOUSE Desmoglein-1-alpha OS=Mus musculus GN=Dsg1... 30 7.4 sp|Q9SIB4|WOX3_ARATH WUSC...hia co... 30 9.6 sp|Q01550|TANA_XENLA Tanabin OS=Xenopus laevis PE=2 SV=1 30 9.6 sp|Q7TSF0|DSG1C_MOUSE Desmog...VAEYVTH 428 IVG WDE LP D V E+ E+V+H Sbjct: 322 IVGGNWDEVLPVDVRVPEEIQEFVSH 347 >sp|Q7TSF1|DSG1B_MOUSE Desmogl

  13. Burrow characteristics of the co-existing sibling species Mus booduga and Mus terricolor and the genetic basis of adaptation to hypoxic/hypercapnic stress

    Directory of Open Access Journals (Sweden)

    Narayan Gopeshwar

    2009-04-01

    Full Text Available Abstract Background The co-existing, sibling species Mus booduga and Mus terricolor show a difference in site-preference for burrows. The former build them in flat portion of the fields while the latter make burrows in earthen mounds raised for holding water in cultivated fields. In northern India which experiences great variation in climatic condition between summer and winter, M. booduga burrows have an average depth of 41 cm, as against 30 cm in southern India with less climatic fluctuation. M. terricolor burrows are about 20 cm deep everywhere. The three chromosomal species M. terricolor I, II and III have identical burrows, including location of the nest which is situated at the highest position. In contrast, in M. booduga burrows, the nest is at the lowest position. Results The nest chamber of M. booduga is located at greater depth than the nest chamber of M. terricolor. Also, in the burrows of M. booduga the exchange of air takes place only from one side (top surface in contrast to the burrows of M. terricolor where air exchange is through three sides. Hence, M. booduga lives in relatively more hypoxic and hypercapnic conditions than M. terricolor. We observed the fixation of alternative alleles in M. booduga and M. terricolor at Superoxide dismutase-1 (Sod-1, Transferrin (Trf and Hemoglobin beta chain (Hbb loci. All the three are directly or indirectly dependent on oxygen concentration for function. In addition to these, there are differences in burrow patterns and site-preference for burrows suggesting difference in probable adaptive strategy in these co-existing sibling species. Conclusion The burrow structure and depth of nest of the chromosomal species M. terricolor I, II and III are same everywhere probably due to the recency of their evolutionary divergence. Moreover, there is lack of competition for the well-adapted 'microhabitats' since they are non-overlapping in distribution. However, the co-existing sibling species M. booduga

  14. Femoral cartilage thickness measurements in healthy individuals: learning, practicing and publishing with TURK-MUSCULUS.

    Science.gov (United States)

    Özçakar, Levent; Tunç, Hakan; Öken, Öznur; Ünlü, Zeliha; Durmuş, Bekir; Baysal, Özlem; Altay, Zuhal; Tok, Fatih; Akkaya, Nuray; Doğu, Beril; Çapkın, Erhan; Bardak, Ayşenur; Çarlı, Alparslan Bayram; Buğdaycı, Derya; Toktaş, Hasan; Dıraçoğlu, Demirhan; Gündüz, Berrin; Erhan, Belgin; Kocabaş, Hilal; Erden, Gül; Günendi, Zafer; Kesikburun, Serdar; Omaç, Özlem Köroğlu; Taşkaynatan, Mehmet Ali; Şenel, Kazım; Uğur, Mahir; Yalçınkaya, Ebru Yılmaz; Öneş, Kadriye; Atan, Çiğdem; Akgün, Kenan; Bilgici, Ayhan; Kuru, Ömer; Özgöçmen, Salih

    2014-01-01

    Measurement of the femoral cartilage thickness by using in-vivo musculoskeletal ultrasonography (MSUS) has been previously shown to be a valid and reliable method in previous studies; however, to our best notice, normative data has not been provided before in the healthy population.The aim of our study was to provide normative data regarding femoral cartilage thicknesses of healthy individuals with collaborative use of MSUS. This is across-sectional study run at Physical and Rehabilitation Medicine Departments of 18 Secondary and Tertiary Centers in Turkey. 1544 healthy volunteers (aged between 25-40 years) were recruited within the collaboration of TURK-MUSCULUS (Turkish Musculoskeletal Ultrasonography Study Group). Subjects who had a body mass index value of less than 30 and who did not have signs and symptoms of any degenerative/inflammatory arthritis or other rheumatic diseases, history of knee trauma and previous knee surgery were enrolled. Ultrasonographic measurements were performed axially from the suprapatellar window by using linear probes while subjects' knees were in maximum flexion. Three (mid-point) measurements were taken from both knees (lateral condyle, intercondylar area, medial condyle). A total of 2876 knees (of 817 M, 621 F subjects) were taken into analysis after exclusion of inappropriate images. Mean cartilage thicknesses were significantly lower in females than males (all p< 0.001). Thickness values negatively correlated with age; negatively (females) and positively (males) correlated with smoking. Men who regularly exercised had thicker cartilage than who did not exercise (all p < 0.05). Increased age (in both sexes) and absence of exercise (males) were found to be risk factors for decreased cartilage thicknesses. Further data pertaining to other countries would be interesting to uncover whether ethnic differences also affect cartilage thickness. Collaborative use of MSUS seems to be promising in this regard.

  15. Comparison the physicochemical quality indicators of Musculus Longissimus Dorsi from Mangalitsa Breed and their crossbreeds

    Directory of Open Access Journals (Sweden)

    Ondrej Debreceni

    2016-12-01

    Full Text Available In recent years, there has been a current trend in the market of pork to create products based on traditional, regional specialities, where is used technology such as drying, smoking and fermentation of products. These products require a specific quality of meat from pure-bred indigenous breeds or their crossbreeds with emphasis on dry matter content, intramuscular fat content in meat and fatty acid composition with higher share of unsaturated fatty acids and essential fatty acids. Due to this fact, indigenous breed such as the Mangalitsa has received attention from the aspect of high meat quality and meat products compared to pig meat breeds. The aim of study was to compare the meat quality of Musculus longissimus dorsi from Mangalitsa breed, the crossbreeds Mangalitsa x Duroc and the pig meat breed Slovak Large White. The experimental material comprised of 28 pcs of pigs, which were reared in the same intensive conditions and they were fed ad libitum by complete feed mixtures for fatteners. The fattening period lasted from 30 kg to 100 kg of body weight. In the presented study was found that the crossbreeds Mangalitsa x Duroc had lighter colour of meat and the Mangalitsa had darker colour than Slovak Large White (P < 0.01. From the point of texture of meat, it was found stiffer meat from Slovak Large White and more tender meat from crossbreeds Mangalitsa x Duroc compared to meat of Mangalitsa (P < 0.01. The crossbreeds Mangalitsa x Duroc had the highest intramuscular fat content and cholesterol content in meat (P < 0.01. The intramuscular fat content and cholesterol content was the lowest in Slovak Large White (P < 0.01. The results indicate that utilization of Mangalitsa breed for crossing with pig meat breeds can improve quality meat traits in their crossbreeds, which are requiring for production of special meat products.

  16. Of mice and (Viking?) men: phylogeography of British and Irish house mice

    OpenAIRE

    Searle, Jeremy B.; Jones, Catherine S.; Gündüz, İslam; Scascitelli, Moira; Jones, Eleanor P.; Herman, Jeremy S.; Rambau, R. Victor; Noble, Leslie R.; Berry, R.J.; Giménez, Mabel D.; Jóhannesdóttir, Fríða

    2008-01-01

    The west European subspecies of house mouse (Mus musculus domesticus) has gained much of its current widespread distribution through commensalism with humans. This means that the phylogeography of M. m. domesticus should reflect patterns of human movements. We studied restriction fragment length polymorphism (RFLP) and DNA sequence variations in mouse mitochondrial (mt) DNA throughout the British Isles (328 mice from 105 localities, including previously published data). There is a major mtDNA...

  17. The MusIC method: a fast and quasi-optimal solution to the muscle forces estimation problem.

    Science.gov (United States)

    Muller, A; Pontonnier, C; Dumont, G

    2018-02-01

    The present paper aims at presenting a fast and quasi-optimal method of muscle forces estimation: the MusIC method. It consists in interpolating a first estimation in a database generated offline thanks to a classical optimization problem, and then correcting it to respect the motion dynamics. Three different cost functions - two polynomial criteria and a min/max criterion - were tested on a planar musculoskeletal model. The MusIC method provides a computation frequency approximately 10 times higher compared to a classical optimization problem with a relative mean error of 4% on cost function evaluation.

  18. NCBI nr-aa BLAST: CBRC-MMUS-07-0085 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-MMUS-07-0085 ref|NP_665841.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAM...69674.1|AF394954_1 vomeronasal receptor 1 E2 [Mus musculus] dbj|BAB79222.1| vomeronasal receptor 1 E6 [Mus m...usculus] gb|AAM62399.1| vomeronasal receptor V1RE9 [Mus musculus] gb|AAI41483.1| Vomeronasal 1 receptor, E9 ...[synthetic construct] gb|EDL03620.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAI48767.1| Vomeronasa

  19. NCBI nr-aa BLAST: CBRC-RNOR-01-0219 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-01-0219 ref|NP_665841.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAM...69674.1|AF394954_1 vomeronasal receptor 1 E2 [Mus musculus] dbj|BAB79222.1| vomeronasal receptor 1 E6 [Mus m...usculus] gb|AAM62399.1| vomeronasal receptor V1RE9 [Mus musculus] gb|AAI41483.1| Vomeronasal 1 receptor, E9 ...[synthetic construct] gb|EDL03620.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAI48767.1| Vomeronasa

  20. NCBI nr-aa BLAST: CBRC-RNOR-01-0216 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RNOR-01-0216 ref|NP_665841.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAM...69674.1|AF394954_1 vomeronasal receptor 1 E2 [Mus musculus] dbj|BAB79222.1| vomeronasal receptor 1 E6 [Mus m...usculus] gb|AAM62399.1| vomeronasal receptor V1RE9 [Mus musculus] gb|AAI41483.1| Vomeronasal 1 receptor, E9 ...[synthetic construct] gb|EDL03620.1| vomeronasal 1 receptor, E9 [Mus musculus] gb|AAI48767.1| Vomeronasa

  1. Musculus soleus of rats at physical activity and L-carnitine and creatine phosphate effect

    Directory of Open Access Journals (Sweden)

    Irina A. Khutorskaya

    2017-09-01

    Full Text Available Introduction: The study of the effect of metabolic drugs on the histochemical characteristics of soleus muscle is relevant for solving the problem of providing the training process in Russia with non-doping drugs for safe correction of the consequences of intense physical activity in athletes. Materials and Methods: Dynamic physical activity in rats (n = 24 was simulated by swimming “to the limit” with weighting of 10 % of body weight (20 days, 1 time per day. The experimental animals were divided into four groups (6 animals each: № 1 – control, № 2 – swimming + isotonic NaCl solution, № 3 and № 4 – swimming + L-carnitine or creatine phosphate 100.0 mg/kg daily intraperitoneally. The object of the study was musculus soleus. Differentiation of muscle fibers was carried out by the intensity of histochemical activity of succinate dehydrogenase (SDG and alkaline stable adenosine triphosphate (ATP of myosin. The percentage of muscle fibers was evaluated and their diameter was defined by the direct morphometry. The obtained data were treated statistically by Student’s T-test. Results: Swimming of the animals “to the limit” do not affect the ratio of fibers with different phenotypes in the soleus muscle. This indicator is genetically determined and was not modified by L-carnitine and creatine phosphate. Dynamic physical activity promotes the development of hypertrophy of muscle fibers of various types. The investigated medicaments of the metabolic type either do not influence on the formation of exerciseinduced hypertrophy (predominantly creatine phosphate or reduce the intensity of the hypertrophic process (predominantly L-carnitine under dynamic physical activity. Discussion and Conclusions: The obtained data indicate L-carnitine and creatine phosphate do not have an anabolic effect. Taking into account the relevant data on ability of L-carnitine and creatine phosphate to effectively correct a negative effects of intensive

  2. Re-evaluation of the holotype of Mus ruber Jentink, 1880 (Rodentia: Muridae) from western New Guinea (Irian Jaya)

    NARCIS (Netherlands)

    Calaby, J.H.; Mary Taylor, J.

    1980-01-01

    INTRODUCTION The first rodent from the New Guinea region, now included in the genus Rattus, to be formally named, was Mus ruber Jentink, 1880. The name R. ruber is currently in widespread use (Lidicker, 1968, 1973; Lidicker & Ziegler, 1968; Misonne, 1969; Ziegler, 1971; Bulmer & Menzies, 1972, 1973;

  3. A geometric morphometric analysis of the shape of the first upper molar in mice of the genus Mus (Muridae, Rodentia)

    Czech Academy of Sciences Publication Activity Database

    Macholán, Miloš

    2006-01-01

    Roč. 270, č. 4 (2006), s. 672-681 ISSN 0952-8369 R&D Projects: GA AV ČR IAA6045307 Institutional research plan: CEZ:AV0Z50450515 Keywords : Mus * geometric morphometrics * thin-plate spline Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.413, year: 2006

  4. Pan-African phylogeny of Mus (subgenus Nannomys) reveals one of the most successful mammal radiations in Africa

    Czech Academy of Sciences Publication Activity Database

    Bryja, Josef; Mikula, Ondřej; Šumbera, R.; Meheretu, Y.; Aghová, Tatiana; Lavrenchenko, L. A.; Mazoch, Vladimír; Oguge, N.; Mbau, J. S.; Welegerima, K.; Amundala, N.; Colyn, M.; Leirs, H.; Verheyen, E.

    2014-01-01

    Roč. 14, č. 256 (2014), s. 256 ISSN 1471-2148 R&D Projects: GA ČR GAP506/10/0983 Institutional support: RVO:68081766 Keywords : Biogeography * Tropical Africa * Molecular phylogeny * Pygmy mice * Plio-Pleistocene climatic fluctuations * Divergence timing * Muridae (Murinae) * Mus minutoides * Phylogeography * DNA barcoding Subject RIV: EG - Zoology Impact factor: 3.368, year: 2014

  5. Transformative Poetry : A Case Study of W.H. Auden's Musée des Beaux Arts And General Conclusions

    NARCIS (Netherlands)

    Sarot, Marcel

    2016-01-01

    This article situates Auden’s poem Musée des Beaux Arts in the process of his conversion to Christianity. The author argues for the layered intertextuality of the poem, in which allusions to Bruegel’s Landscape with the Fall of Icarus, The Census at Jerusalem, and The Massacre of the Innocents can

  6. [Musical Inactivity - A Risk Factor? A Short Questionnaire to Assess Musical Activity (MusA)].

    Science.gov (United States)

    Fernholz, Isabel; Menzel, Juliane; Jabusch, Hans-Christian; Gembris, Heiner; Fischer, Felix; Kendel, Friederike; Kreutz, Gunter; Schmidt, Alexander; Willich, Stefan N; Weikert, Cornelia

    2018-02-27

    There is only a limited number of studies on associations between musical activity and health issues. It seems that musical activity has physiological and psychological benefits, as well as effects on the mental capacity, but this has been studied only in a few clinical and epidemiological studies. One reason might be that no appropriate survey instrument assessing musical activity is available. Here we provide an overview of survey instruments that assess musicality and musical activity. One focus is the presentation of a newly developed German questionnaire (MusA), which assesses musical activity (active music making and music reception) and was specifically developed for the "German National Cohort", a German health study. Through literature research, questionnaires were identified that assess musicality and / or musical activity. A new German questionnaire was developed from a panel of experts and tested in a small study (n=121, women and men age 18-70 years). In the literature research, 3 questionnaires were identified which focus on musicality and musical activity with different aspects (Gold-MSI, MUSE, MEQ). All 3 instruments may be characterized as large psychometric scales, which especially assess aspects of musicality in the English language. The Gold-MSI is additionally available in German. None of the existing questionnaires covers musical activities in detail. A new short German questionnaire consisting of 9 questions with a maximum filling time of 3-5 min has been developed. There are few questionnaires available for assessing musicality and musical activity with different aspects. The newly developed MusA in the German language focuses on the assessment of musical activity and is intended to be used in larger, population-based as well as clinical studies, to examine music activities and listening to music as independent factors in connection with prevention and therapy of chronic diseases. © Georg Thieme Verlag KG Stuttgart · New York.

  7. Glutamate Oxaloacetate Transaminase (Got) Genetics in the Mouse: Polymorphism of Got-1

    Science.gov (United States)

    Chapman, Verne M.; Ruddle, Frank H.

    1972-01-01

    We have examined a polymorphism for the soluble glutamate oxaloacetate (GOT-1) isozyme system which was found in the Asian mouse Mus castaneus. Variants of GOT-1 segregate as though they are controlled by codominant alleles for a single autosomal locus which we have designated Got-1. No close linkage of genes for soluble and mitochondrial forms of the enzyme, GOT-1 and GOT-2 respectively, was observed. Furthermore, no close linkage of Got-1 and the loci c, Gpi-1, Mod-2, Mod-1, Ld-1, Gpd-1, Pgm-1 or Gpo-1 was observed. Our results demonstrate the utility of sampling Mus from diverse populations to extend the repertoire of polymorphic loci and the genetic linkage map. PMID:17248564

  8. Reduced Activity of SRY and its Target Enhancer Sox9-TESCO in a Mouse Species with X*Y Sex Reversal.

    Science.gov (United States)

    Zhao, Liang; Quinn, Alexander; Ng, Ee Ting; Veyrunes, Frederic; Koopman, Peter

    2017-02-03

    In most eutherian mammals, sex determination is governed by the Y-linked gene Sry, but in African pygmy mice Mus minutoides, Sry action is overridden by a variant X chromosome (X*), yielding X*Y females. We hypothesized that X*Y sex reversal may be underpinned not only by neomorphic X chromosome functionality, but also by a compromised Sry pathway. Here, we show that neither M. minutoides SRY nor its target, the Sox9-TESCO enhancer, had appreciable transcriptional activity in in vitro assays, correlating with sequence degradation compared to Mus musculus counterparts. However, M. minutoides SRY activated its cognate TESCO to a moderate degree, and can clearly engage the male pathway in M. minutoides in the wild, indicating that SRY and TESCO may have co-evolved in M. minutoides to retain function above a threshold level. We suggest that weakening of the SRY/TESCO nexus may have facilitated the rise and spread of a variant X* chromosome carrying female-inducing modifier gene(s).

  9. Blue Whale (Balaenoptera musculus Behavior and Group Dynamics as Observed from an Aircraft off Southern California

    Directory of Open Access Journals (Sweden)

    Kate Lomac-MacNair

    2016-02-01

    Full Text Available Group behavior and interactions of endangered blue whales (Balaenoptera musculus have not been systematically studied. Such behavioral data are often overlooked when assessing anthropogenic effects. Yet behavioral data are necessary to compare “normal” behaviors with behavior affected by anthropogenic factors of concern relative to effective management and recovery of blue whales. For a baseline study, we hypothesized that the response variables sighting rate, group size, calf presence and group cohesion (i.e., spacing between individuals within a group differed according to the spatio-temporal explanatory variables behavioral state, time of day, season, water depth and distance from shore. To address our hypotheses, we flew systematic line transect surveys in southern California and collected focal group data. Two sets of data were separately analyzed using different sampling approaches: (1 point sample data associated with the first sighting of a blue whale(s, and (2 extended all-occurrence focal group behavioral sampling data (i.e., focal follows collected on a subsample of all sightings while the aircraft circled at a radial distance of approximately 0.5-1 km and an altitude of 1,500 m for extended periods of 5 – 60 minutes. Chi-square contingency table and G² analyses were used to assess statistical relationships between response and explanatory variables. We conducted 18 one-week-long aerial surveys spanning October 2008 through May 2013 (at least once during every month except December, totaling 87,555 km of observation effort. Seventy blue whale sightings (117 individuals were seen, ranging in size from 1 – 6 whales, and focal follow was performed on over half (55% of these sightings. Results supported our hypotheses that blue whale group characteristics were related to behavioral state and spatio-temporal variables. Sighting rates were significantly highest during summer followed by spring, fall, and winter. Group type differed

  10. Reflexões sobre a arte "primitiva": o caso do Musée Branly

    Directory of Open Access Journals (Sweden)

    Ilana Goldstein

    2008-06-01

    Full Text Available Na época das descobertas ultramarinas, os europeus acumulavam fragmentos das novas realidades que encontravam em suas viagens, nos chamados gabinetes de curiosidades. Os colecionadores se especializaram e, a partir do século XVIII, surgiram os primeiros museus científicos. No final do século XIX, as exposições universais expunham a "barbárie" dos povos colonizados. Já as vanguardas do século XX redescobriram a arte "primitiva" enquanto fonte de renovação. Este artigo recupera tais formas de apreensão da cultura material de sociedades tradicionais ao longo do tempo, para chegar à inauguração do Musée Branly, em 2006. A partir desse museu, podem-se repensar algumas questões fundamentais acerca da arte "primitiva", como a dicotomia entre tratar os artefatos como testemunhos etnográficos ou como criações estéticas; as relações de poder envolvidas na aquisição dos objetos; o problema da autenticidade, numa era em que se multiplicam os souvenirs étnicos "neotradicionais".In the epoch of overseas discoveries, Europeans accumulated fragments of the realities they found in cabinets of curiosities. The private collectors specialized in different branches of "natural history" and this led to the emergence of scientific museums in the 18th century. At the end of the 19th century, universal exhibitions displayed "primitive" artifacts side by side with Western technologies, suggesting the "barbarism" of colonized peoples. But, at the beginning of the 20th century, the avant-gardes rediscovered the art nègre, using it as a source of artistic renovation. This article begins by describing these various forms of dealing with the cultural expressions of others, in order to understand the meaning of the recently opened Musée Branly. The French museum, devoted to non-occidental societies, provides an opportunity to reconsider some fundamental issues. Should we exhibit these artifacts as ethnographic testimonies or works of art? Can we

  11. A note on the distribution and abundance of blue whales (Balaenoptera musculus in the Central and Northeast North Atlantic

    Directory of Open Access Journals (Sweden)

    Daniel G Pike

    2009-09-01

    Full Text Available The distribution and abundance of blue whales (Balaenoptera musculus was assessed from ship surveys conducted in the Central and Northeast Atlantic in 1987, 1989, 1995 and 2001. Blue whales were most commonly sighted off western Iceland, and to a lesser extent northeast of Iceland. They were very rare or absent in the Northeast Atlantic. Sightings were combined over all surveys to estimate the detection function using standard line transect methodology, with the addition of a covariate to account for differences between surveys. Total abundance was highest in 1995 (979, 95% CI 137-2,542 and lowest in 1987 (222, 95% CI 115-440. Uncertainty in species identity had little effect on estimates of abundance. There was a significant positive trend in abundance northeast of Iceland and in the total survey area.

  12. Hold your horSSEs: controlling structure-selective endonucleases MUS81 and Yen1/GEN1.

    Science.gov (United States)

    Blanco, Miguel G; Matos, Joao

    2015-01-01

    Repair of DNA lesions through homologous recombination promotes the establishment of stable chromosomal interactions. Multiple helicases, topoisomerases and structure-selective endonucleases (SSEs) act upon recombining joint molecules (JMs) to disengage chromosomal connections and safeguard chromosome segregation. Recent studies on two conserved SSEs - MUS81 and Yen1/GEN1- uncovered multiple layers of regulation that operate to carefully tailor JM-processing according to specific cellular needs. Temporal restriction of SSE function imposes a hierarchy in pathway usage that ensures efficient JM-processing while minimizing reciprocal exchanges between the recombining DNAs. Whereas a conserved strategy of fine-tuning SSE functions exists in different model systems, the precise molecular mechanisms to implement it appear to be significantly different. Here, we summarize the current knowledge on the cellular switches that are in place to control MUS81 and Yen1/GEN1 functions.

  13. Quelques espèces nouvelles d’hispides de Sumatra appartenant au Musée de Leyde

    NARCIS (Netherlands)

    Gestro, R.

    1897-01-01

    Sur le point d’entreprendre l’étude des Hispides recueillies à Sumatra par M. le Doct. E. Modigliani, j’ai demandé à M. Ritsema, le savant conservateur de la collection d’insectes du Musée de Leyde, la communication de quelques espèces dans le but de faciliter mon travail. Mon aimable collègue a

  14. The French Muséum national d'histoire naturelle vascular plant herbarium collection dataset

    Science.gov (United States)

    Le Bras, Gwenaël; Pignal, Marc; Jeanson, Marc L.; Muller, Serge; Aupic, Cécile; Carré, Benoît; Flament, Grégoire; Gaudeul, Myriam; Gonçalves, Claudia; Invernón, Vanessa R.; Jabbour, Florian; Lerat, Elodie; Lowry, Porter P.; Offroy, Bérangère; Pimparé, Eva Pérez; Poncy, Odile; Rouhan, Germinal; Haevermans, Thomas

    2017-02-01

    We provide a quantitative description of the French national herbarium vascular plants collection dataset. Held at the Muséum national d'histoire naturelle, Paris, it currently comprises records for 5,400,000 specimens, representing 90% of the estimated total of specimens. Ninety nine percent of the specimen entries are linked to one or more images and 16% have field-collecting information available. This major botanical collection represents the results of over three centuries of exploration and study. The sources of the collection are global, with a strong representation for France, including overseas territories, and former French colonies. The compilation of this dataset was made possible through numerous national and international projects, the most important of which was linked to the renovation of the herbarium building. The vascular plant collection is actively expanding today, hence the continuous growth exhibited by the dataset, which can be fully accessed through the GBIF portal or the MNHN database portal (available at: https://science.mnhn.fr/institution/mnhn/collection/p/item/search/form). This dataset is a major source of data for systematics, global plants macroecological studies or conservation assessments.

  15. The French Muséum national d’histoire naturelle vascular plant herbarium collection dataset

    Science.gov (United States)

    Le Bras, Gwenaël; Pignal, Marc; Jeanson, Marc L.; Muller, Serge; Aupic, Cécile; Carré, Benoît; Flament, Grégoire; Gaudeul, Myriam; Gonçalves, Claudia; Invernón, Vanessa R.; Jabbour, Florian; Lerat, Elodie; Lowry, Porter P.; Offroy, Bérangère; Pimparé, Eva Pérez; Poncy, Odile; Rouhan, Germinal; Haevermans, Thomas

    2017-01-01

    We provide a quantitative description of the French national herbarium vascular plants collection dataset. Held at the Muséum national d’histoire naturelle, Paris, it currently comprises records for 5,400,000 specimens, representing 90% of the estimated total of specimens. Ninety nine percent of the specimen entries are linked to one or more images and 16% have field-collecting information available. This major botanical collection represents the results of over three centuries of exploration and study. The sources of the collection are global, with a strong representation for France, including overseas territories, and former French colonies. The compilation of this dataset was made possible through numerous national and international projects, the most important of which was linked to the renovation of the herbarium building. The vascular plant collection is actively expanding today, hence the continuous growth exhibited by the dataset, which can be fully accessed through the GBIF portal or the MNHN database portal (available at: https://science.mnhn.fr/institution/mnhn/collection/p/item/search/form). This dataset is a major source of data for systematics, global plants macroecological studies or conservation assessments. PMID:28195585

  16. Nesting behavior of house mice (Mus domesticus) selected for increased wheel-running activity.

    Science.gov (United States)

    Carter, P A; Swallow, J G; Davis, S J; Garland, T

    2000-03-01

    Nest building was measured in "active" (housed with access to running wheels) and "sedentary" (without wheel access) mice (Mus domesticus) from four replicate lines selected for 10 generations for high voluntary wheel-running behavior, and from four randombred control lines. Based on previous studies of mice bidirectionally selected for thermoregulatory nest building, it was hypothesized that nest building would show a negative correlated response to selection on wheel-running. Such a response could constrain the evolution of high voluntary activity because nesting has also been shown to be positively genetically correlated with successful production of weaned pups. With wheel access, selected mice of both sexes built significantly smaller nests than did control mice. Without wheel access, selected females also built significantly smaller nests than did control females, but only when body mass was excluded from the statistical model, suggesting that body mass mediated this correlated response to selection. Total distance run and mean running speed on wheels was significantly higher in selected mice than in controls, but no differences in amount of time spent running were measured, indicating a complex cause of the response of nesting to selection for voluntary wheel running.

  17. NCBI nr-aa BLAST: CBRC-BTAU-01-2652 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available s musculus] gb|AAH17129.1| Solute carrier family 16 (monocarboxylic acid transporters), member 6 [Mus muscul...us] emb|CAM25213.1| solute carrier family 16 (monocarboxylic acid transporters), member 6 [Mus musculus] gb|...EDL34359.1| solute carrier family 16 (monocarboxylic acid transporters), member 6..., isoform CRA_a [Mus musculus] gb|EDL34361.1| solute carrier family 16 (monocarboxylic acid transporters), member 6, isoform CRA_a [Mus musculus] NP_598799.1 1e-110 76% ...

  18. AcEST: BP916012 [AcEST

    Lifescience Database Archive (English)

    Full Text Available ne... 29 6.4 sp|P07335|KCRB_RAT Creatine kinase B-type OS=Rattus norvegicus G... 29 6.4 sp|Q04447|KCRB_MOUSE Creatine... kinase B-type OS=Mus musculus GN=C... 29 6.4 sp|P05122|KCRB_CHICK Creatine kinase B-type OS=Gallu...N=ARSH... 29 6.4 sp|O13879|YE1F_SCHPO Uncharacterized transporter C1B3.15C OS=Sch... 29 8.3 sp|P24722|KCRT_ONCMY Creatine...6 LESGFDAQSRTKLSDLS 36 +ES +D +++ D+S Sbjct: 119 IESKYDVHTKSVTVDVS 135 >sp|P07335|KCRB_RAT Creatine...DGDLSGRYYALKSMTEAEQQQLIDDHFLFDKPV 198 >sp|Q04447|KCRB_MOUSE Creatine kinase B-type OS=Mus musculus GN=Ckb PE

  19. Comparative Analysis of Context-Dependent Mutagenesis Using Human and Mouse Models

    Directory of Open Access Journals (Sweden)

    Sofya A. Medvedeva

    2013-01-01

    Full Text Available Substitution rates strongly depend on their nucleotide context. One of the most studied examples is the excess of C > T mutations in the CG context in various groups of organisms, including vertebrates. Studies on the molecular mechanisms underlying this mutation regularity have provided insights into evolution, mutagenesis, and cancer development. Recently several other hypermutable motifs were identified in the human genome. There is an increased frequency of T > C mutations in the second position of the words ATTG and ATAG and an increased frequency of A > C mutations in the first position of the word ACAA. For a better understanding of evolution, it is of interest whether these mutation regularities are human specific or present in other vertebrates, as their presence might affect the validity of currently used substitution models and molecular clocks. A comprehensive analysis of mutagenesis in 4 bp mutation contexts requires a vast amount of mutation data. Such data may be derived from the comparisons of individual genomes or from single nucleotide polymorphism (SNP databases. Using this approach, we performed a systematical comparison of mutation regularities within 2–4 bp contexts in Mus musculus and Homo sapiens and uncovered that even closely related organisms may have notable differences in context-dependent mutation regularities.

  20. Cytomegalovirus (CMV) Infection Causes Degeneration of Cochlear Vasculature and Hearing Loss in a Mouse Model.

    Science.gov (United States)

    Carraro, Mattia; Almishaal, Ali; Hillas, Elaine; Firpo, Matthew; Park, Albert; Harrison, Robert V

    2017-04-01

    Cytomegalovirus (CMV) infection is one of the most common causes of congenital hearing loss in children. We have used a murine model of CMV infection to reveal functional and structural cochlear pathogenesis. The cerebral cortex of Balb/c mice (Mus musculus) was inoculated with 2000 pfu (plaque forming units) of murine CMV on postnatal day 3. At 6 weeks of age, cochlear function was monitored using auditory brainstem response (ABR) and distortion product otoacoustic emission (DPOAE) measures. Histological assessment of cochlear vasculature using a corrosion cast technique was made at 8 weeks. Vascular casts of mCMV-damaged cochleas, and those of untreated control animals, were examined using scanning electron microscopy. We find very large variations in the degree of vascular damage in animals given identical viral injections (2000 pfu). The primary lesion caused by CMV infection is to the stria vascularis and to the adjacent spiral limbus capillary network. Capillary beds of the spiral ligament are generally less affected. The initial vascular damage is found in the mid-apical turn and appears to progress to more basal cochlear regions. After viral migration to the inner ear, the stria vascularis is the primary affected structure. We suggest that initial auditory threshold losses may relate to the poor development or maintenance of the endocochlear potential caused by strial dysfunction. Our increased understanding of the pathogenesis of CMV-related hearing loss is important for defining methods for early detection and treatment.

  1. Learning and Olfaction: Understanding and Enhancing a Critical Information Channel

    Science.gov (United States)

    2013-05-13

    Mouse Strains (Mus-Musculus) and Major Histocompatibility Types by Humans ( Homo - Sapiens ). Journal of Comparative Psychology 100, 262-265 (1986). 13...min) 0 10 20 30 40 50 60 70 80 90 100 0 10 20 30 40 50 60 70 80 90 100 R el at iv e A bu nd an ce 48.09 33.64 10.39 42.64 44.3636.54 39.6925.26 30.62

  2. ProtoBee: Hierarchical classification and annotation of the honey bee proteome

    OpenAIRE

    Kaplan, Noam; Linial, Michal

    2006-01-01

    The recently sequenced genome of the honey bee (Apis mellifera) has produced 10,157 predicted protein sequences, calling for a computational effort to extract biological insights from them. We have applied an unsupervised hierarchical protein-clustering method, which was previously used in the ProtoNet system, to nearly 200,000 proteins consisting of the predicted honey bee proteins, the SWISS-PROT protein database, and the complete set of proteins of the mouse (Mus musculus) and the fruit fl...

  3. A pronounced evolutionary shift of the pseudoautosomal region boundary in house mice

    OpenAIRE

    White, Michael A.; Ikeda, Akihiro; Payseur, Bret A.

    2012-01-01

    The pseudoautosomal region (PAR) is essential for the accurate pairing and segregation of the X and Y chromosomes during meiosis. Despite its functional significance, the PAR shows substantial evolutionary divergence in structure and sequence between mammalian species. An instructive example of PAR evolution is the house mouse Mus musculus domesticus (represented by the C57BL/6J strain), which has the smallest PAR among those that have been mapped. In C57BL/6J, the PAR boundary is located jus...

  4. Unigene BLAST: CBRC-OANA-01-0960 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.46 51% ...

  5. Unigene BLAST: CBRC-OANA-01-1936 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.002 58% ...

  6. Unigene BLAST: CBRC-OANA-01-0549 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 3e-08 75% ...

  7. Unigene BLAST: CBRC-OANA-01-0647 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.002 58% ...

  8. Unigene BLAST: CBRC-OANA-01-0028 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.016 60% ...

  9. Unigene BLAST: CBRC-OANA-01-1804 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.095 92% ...

  10. Unigene BLAST: CBRC-OANA-01-0223 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.001 36% ...

  11. Unigene BLAST: CBRC-OANA-01-1479 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.21 86% ...

  12. Unigene BLAST: CBRC-OANA-01-0659 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2.3 66% ...

  13. Unigene BLAST: CBRC-OANA-01-1908 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.011 60% ...

  14. Unigene BLAST: CBRC-OANA-01-0589 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 4.1 73% ...

  15. Unigene BLAST: CBRC-OANA-01-1022 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.023 61% ...

  16. Unigene BLAST: CBRC-OANA-01-1841 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.001 50% ...

  17. Unigene BLAST: CBRC-OANA-01-1244 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2e-04 85% ...

  18. Unigene BLAST: CBRC-OANA-01-0600 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 8e-07 77% ...

  19. Unigene BLAST: CBRC-OANA-01-2064 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 0.023 75% ...

  20. Unigene BLAST: CBRC-OANA-01-1611 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available 4.0kb Ornithorhynchus anatinus cDNA similar to ref|NP_444392.1| mitochondrial ribosomal protein L34; DNA seg...ment, Chr 8, Brigham & Women's Genetics 1484 expressed [Mus musculus] sp|Q99N91|RM34_MOUSE 60S ribos> /gb=EH000574 /gi=118077003 /ug=Oan.4473 /len=654 2.4 35% ...