WorldWideScience

Sample records for monodisperse cds nanocrystals

  1. Synthesis of CdS Nanocrystals with Different Shapes via a Colloidal Method

    Energy Technology Data Exchange (ETDEWEB)

    Bai, Jie; Liu, Changsong; Niu, Jinzhong; Wang, Hongzhe; Xu, Shasha; Shen, Huaibin; Li, Lin Song [Henan Univ., Henan (China)

    2014-02-15

    Size- and shape-controlled monodisperse wurtzite structured CdS nanorods have been successfully synthesized using a facile solution-based colloidal method. Depending on the control of injection/growth temperatures and the variation of Cd-to-S molar ratios, the morphology of the CdS nanocrystals (NCs) can be adjusted into bullet-like, rod-like, and dot-like shapes. X-ray diffraction (XRD), transition electron microscopy (TEM), and absorption spectroscopy were used to characterize the structure, morphology, and optical properties of as-synthesized CdS NCs. It was found that uniform CdS nanorods could be successfully synthesized when the injection and growth temperatures were very high (> 360 .deg. C). The aspect ratios of different shaped (bullet-like or rod-like) CdS NCs could be controlled by simply adjusting the molar ratios between Cd and S.

  2. Synthesis of CdS Nanocrystals with Different Shapes via a Colloidal Method

    International Nuclear Information System (INIS)

    Bai, Jie; Liu, Changsong; Niu, Jinzhong; Wang, Hongzhe; Xu, Shasha; Shen, Huaibin; Li, Lin Song

    2014-01-01

    Size- and shape-controlled monodisperse wurtzite structured CdS nanorods have been successfully synthesized using a facile solution-based colloidal method. Depending on the control of injection/growth temperatures and the variation of Cd-to-S molar ratios, the morphology of the CdS nanocrystals (NCs) can be adjusted into bullet-like, rod-like, and dot-like shapes. X-ray diffraction (XRD), transition electron microscopy (TEM), and absorption spectroscopy were used to characterize the structure, morphology, and optical properties of as-synthesized CdS NCs. It was found that uniform CdS nanorods could be successfully synthesized when the injection and growth temperatures were very high (> 360 .deg. C). The aspect ratios of different shaped (bullet-like or rod-like) CdS NCs could be controlled by simply adjusting the molar ratios between Cd and S

  3. Rapid synthesis of triangular CdS nanocrystals without any trap emission

    International Nuclear Information System (INIS)

    Poulose, Aby Cheruvathoor; Veeranarayanan, Srivani; Yoshida, Yasuhiko; Maekawa, Toru; Sakthi Kumar, D.

    2012-01-01

    Nanocrystals (NCs) with anisotropic dimensions display polarized emission compared to nano dots. Triangular prisms are good candidates for polarized optical properties and monodisperse triangular NCs are ideal for developing building blocks for novel three-dimensional superlattices due to its anisotropic dimension. Among triangular nanocrystals, CdS nanocrystals are less discussed for the past one decade of research due to the difficulty in its processing method. Though well studied very few methods for developing CdS triangular nanocrystals have been reported, and most are having drawbacks either due to the time consuming process or the products are combination of triangular as well as many other shaped NC or with trap emissions due to defects which are comparable to band emissions limits its applications in full scale. Here, we are presenting a novel method to develop 7 nm CdS triangular NCs that can solve the above mentioned problems, which would augment the usage of CdS triangular crystals for many applications, based on its anisotropic properties.

  4. Shape and phase control of CdS nanocrystals using cationic surfactant in noninjection synthesis

    Directory of Open Access Journals (Sweden)

    Zou Yu

    2011-01-01

    Full Text Available Abstract Monodispersed CdS nanocrystals with controllable shape and phase have been successfully synthesized in this study by adding cationic surfactant in noninjection synthesis system. With the increase of the amount of cetyltrimethylammonium chloride (CTAC added, the shape of the CdS nanocrystals changed from spherical to multi-armed, and the phase changed from zinc-blende to wurtzite. It was found that halide ion Cl- plays a key role in the transformation, and other halide ions such as Br- can also induce similar transformation. We proposed that the strong binding between Cd2+ and halide ions reduced the reactivity of the precursors, decreased the nuclei formed in the nucleation stage, and led to the high concentration of precursor in the growth stage, resulting in the increase of size and phase transformation of CdS nanocrystals. In addition, it was found that the multi-armed CdS nanocrystals lost quantum confinement effect because of the increase of the size with the increase of the concentration of CTAC.

  5. Mechanistic Study of Monodisperse Iron Oxide Nanocrystals ...

    African Journals Online (AJOL)

    To gain better insight into the formation of iron oxide nanocrystals from the solution phase thermal decomposition of iron (III) oleate complex, different reaction conditions including time, heating ramp, as well as concentrations of iron oleate precursor and oleic acid ligand were systematically varied and the resulting ...

  6. An alternative route towards monodisperse CdS quantum dots for hybrid solar cells

    International Nuclear Information System (INIS)

    Cao, Fengfeng; Wang, Hao; Xia, Zhouhui; Dai, Xiao; Cong, Shan; Dong, Chao; Sun, Baoquan; Lou, Yanhui; Sun, Yinghui; Zhao, Jie; Zou, Guifu

    2015-01-01

    Monodisperse CdS quantum dots (QDs) are synthesized by thermal decomposition of organic complexes in the system of the cost-effective commercial 0 # diesel at 200 °C. The prepared CdS QDs have a good dispersion and high crystallization. When the CdS QDs are doped into the blends of poly(3-hexylthiophene) (P3HT) and 1-(3-methoxycarbonyl)-propyl-1-phenyl-(6, 6)C61 (PCBM) for hybrid solar cells (HSCs), the HSCs achieve about 25% increase of power conversion efficiency in comparison to the reference device without the CdS QDs. The improvement of the cell performance mainly attributes to the increased short-circuit current density arising from the absorption enhancement in the wavelength range of 350–550 nm by introducing the synthesized CdS QDs into the P3HT: PCBM active layer. - Highlights: • Monodisperse CdS quantum dots. • A cost-effective route to synthesize crystalline CdS quantum dots. • CdS quantum dots based hybrid solar cells with power conversion efficiency enhancement

  7. An alternative route towards monodisperse CdS quantum dots for hybrid solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Cao, Fengfeng; Wang, Hao [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China); Xia, Zhouhui [Institute of Functional Nano and Soft Materials, Soochow University, Suzhou 215123 (China); Dai, Xiao; Cong, Shan [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China); Dong, Chao [Department of Chemistry and Biology, University of New Mexico, ABQ 87120 (United States); Sun, Baoquan [Institute of Functional Nano and Soft Materials, Soochow University, Suzhou 215123 (China); Lou, Yanhui, E-mail: yhlou@suda.edu.cn [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China); Sun, Yinghui; Zhao, Jie [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China); Zou, Guifu, E-mail: zouguifu@suda.edu.cn [College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Soochow University, Suzhou 215006 (China)

    2015-01-15

    Monodisperse CdS quantum dots (QDs) are synthesized by thermal decomposition of organic complexes in the system of the cost-effective commercial 0{sup #} diesel at 200 °C. The prepared CdS QDs have a good dispersion and high crystallization. When the CdS QDs are doped into the blends of poly(3-hexylthiophene) (P3HT) and 1-(3-methoxycarbonyl)-propyl-1-phenyl-(6, 6)C61 (PCBM) for hybrid solar cells (HSCs), the HSCs achieve about 25% increase of power conversion efficiency in comparison to the reference device without the CdS QDs. The improvement of the cell performance mainly attributes to the increased short-circuit current density arising from the absorption enhancement in the wavelength range of 350–550 nm by introducing the synthesized CdS QDs into the P3HT: PCBM active layer. - Highlights: • Monodisperse CdS quantum dots. • A cost-effective route to synthesize crystalline CdS quantum dots. • CdS quantum dots based hybrid solar cells with power conversion efficiency enhancement.

  8. Luminescence in Mn-doped CdS nanocrystals

    Indian Academy of Sciences (India)

    Wintec

    and the Mn d levels occur at two different energies, allowed us to study the PL lifetime decay behaviour of both kinds of .... seen from the XRD analysis, the size of the nanocrystals .... levels couple to the CdS electronic states and the excited.

  9. Microwave Synthesized Monodisperse CdS Spheres of Different Size and Color for Solar Cell Applications

    Directory of Open Access Journals (Sweden)

    Carlos A. Rodríguez-Castañeda

    2015-01-01

    Full Text Available Monodisperse CdS spheres of size of 40 to 140 nm were obtained by microwave heating from basic solutions. It is observed that larger CdS spheres were formed at lower solution pH (8.4–8.8 and smaller ones at higher solution pH (10.8–11.3. The color of CdS products changed with solution pH and reaction temperature; those synthesized at lower pH and temperature were of green-yellow color, whereas those formed at higher pH and temperature were of orange-yellow color. A good photovoltage was observed in CdS:poly(3-hexylthiophene solar cells with spherical CdS particles. This is due to the good dispersion of CdS nanoparticles in P3HT solution that led to a large interface area between the organic and inorganic semiconductors. Higher photocurrent density was obtained in green-yellow CdS particles of lower defect density. The efficient microwave chemistry accelerated the hydrolysis of thiourea in pH lower than 9 and produced monodisperse spherical CdS nanoparticles suitable for solar cell applications.

  10. Aqueous dispersion of monodisperse magnetic iron oxide nanocrystals through phase transfer

    International Nuclear Information System (INIS)

    Yu, William W; Chang, Emmanuel; Sayes, Christie M; Drezek, Rebekah; Colvin, Vicki L

    2006-01-01

    A facile method was developed for completely transferring high quality monodisperse iron oxide nanocrystals from organic solvents to water. The as-prepared aqueous dispersions of iron oxide nanocrystals were extremely stable and could be functionalized for bioconjugation with biomolecules. These iron oxide nanocrystals showed negligible cytotoxicity to human breast cancer cells (SK-BR-3) and human dermal fibroblast cells. This method is general and versatile for many organic solvent-synthesized nanoparticles, including fluorescent semiconductor nanocrystals

  11. Facile Synthesis of Monodisperse Gold Nanocrystals Using Virola oleifera

    Science.gov (United States)

    Milaneze, Bárbara A.; Oliveira, Jairo P.; Augusto, Ingrid; Keijok, Wanderson J.; Côrrea, Andressa S.; Ferreira, Débora M.; Nunes, Otalíbio C.; Gonçalves, Rita de Cássia R.; Kitagawa, Rodrigo R.; Celante, Vinícius G.; da Silva, André Romero; Pereira, Ana Claudia H.; Endringer, Denise C.; Schuenck, Ricardo P.; Guimarães, Marco C. C.

    2016-10-01

    The development of new routes and strategies for nanotechnology applications that only employ green synthesis has inspired investigators to devise natural systems. Among these systems, the synthesis of gold nanoparticles using plant extracts has been actively developed as an alternative, efficient, cost-effective, and environmentally safe method for producing nanoparticles, and this approach is also suitable for large-scale synthesis. This study reports reproducible and completely natural gold nanocrystals that were synthesized using Virola oleifera extract. V. oleifera resin is rich in epicatechin, ferulic acid, gallic acid, and flavonoids (i.e., quercetin and eriodictyol). These gold nanoparticles play three roles. First, these nanoparticles exhibit remarkable stability based on their zeta potential. Second, these nanoparticles are functionalized with flavonoids, and third, an efficient, economical, and environmentally friendly mechanism can be employed to produce green nanoparticles with organic compounds on the surface. Our model is capable of reducing the resin of V. oleifera, which creates stability and opens a new avenue for biological applications. This method does not require painstaking conditions or hazardous agents and is a rapid, efficient, and green approach for the fabrication of monodisperse gold nanoparticles.

  12. Anodic Titania Nanotube Arrays Sensitized with Mn- or Co-Doped CdS Nanocrystals

    International Nuclear Information System (INIS)

    Smith, York R.; Gakhar, Ruchi; Merwin, Augustus; Mohanty, Swomitra K.; Chidambaram, Dev; Misra, Mano

    2014-01-01

    Highlights: • Mn or Co doped CdS where synthesized and deposited onto TiO 2 nanotubular arrays. • Synthesis and deposition were achieved simultaneously using SILAR method. • Various characterization techniques demonstrate lattice incorporation of dopant. • Photoelectrochemical performance was analyzed using AM 1.5 irradiation. • Dopants increases depletion width of CdS and increase photoelectrochemical responses. - Abstract: The use of doped luminescent nanocrystals or quantum dots have mainly been explored for imaging applications; however, recently they have gained interest in solar energy conversion applications due to long electron lifetimes, tunable band gaps and emission by compositional control. In this study, we have examined the application of Mn or Co doped CdS nanocrystals as a sensitizing layer over titania nanotubular arrays synthesized via electrochemical anodization in photoelectrochemical applications. The doped and undoped CdS nanocrystals were simultaneously synthesized and deposited onto the titania surface by adoption of a successive ion layer adsorption-reaction (SILAR) method. Various characterization methods indicate lattice incorporation of the dopant within CdS. The addition of dopants to CdS was found to improve the photoelectrochemical performance by increasing the depletion width of the CdS nanocrystals and reducing recombination losses of charge carriers

  13. Nonthermal plasma synthesis of size-controlled, monodisperse, freestanding germanium nanocrystals

    International Nuclear Information System (INIS)

    Gresback, Ryan; Holman, Zachary; Kortshagen, Uwe

    2007-01-01

    Germanium nanocrystals may be of interest for a variety of electronic and optoelectronic applications including photovoltaics, primarily due to the tunability of their band gap from the infrared into the visible range of the spectrum. This letter discusses the synthesis of monodisperse germanium nanocrystals via a nonthermal plasma approach which allows for precise control of the nanocrystal size. Germanium crystals are synthesized from germanium tetrachloride and hydrogen entrained in an argon background gas. The crystal size can be varied between 4 and 50 nm by changing the residence times of crystals in the plasma between ∼30 and 440 ms. Adjusting the plasma power enables one to synthesize fully amorphous or fully crystalline particles with otherwise similar properties

  14. Growth of monodisperse nanocrystals of cerium oxide during synthesis and annealing

    International Nuclear Information System (INIS)

    Ghosh, Swapankumar; Divya, Damodaran; Remani, Kottayilpadi C.; Sreeremya, Thadathil S.

    2010-01-01

    Monodisperse cerium oxide nanocrystals have been successfully synthesised using simple ammonia precipitation technique from cerium(III) nitrate solution at different temperatures in the range 35-80 o C. The activation energy for growth of CeO 2 nanocrystals during the precipitation is calculated as 11.54 kJ/mol using Arrhenius plot. Average crystal diameter was obtained from XRD analysis, HR-TEM and light scattering (PCS). The analysis of size data from HR-TEM images and PCS clearly indicated the formation of highly crystalline CeO 2 particles in narrow size range. CeO 2 nanocrystals precipitated at 35 o C were further annealed at temperatures in the range 300-700 o C. The activation energy for crystal growth during annealing is also calculated and is close to the reported values. An effort is made to predict the mechanism of crystal growth during the precipitation and annealing.

  15. Observation of Quantum Confinement in Monodisperse Methylammonium Lead Halide Perovskite Nanocrystals Embedded in Mesoporous Silica.

    Science.gov (United States)

    Malgras, Victor; Tominaka, Satoshi; Ryan, James W; Henzie, Joel; Takei, Toshiaki; Ohara, Koji; Yamauchi, Yusuke

    2016-10-13

    Hybrid organic-inorganic metal halide perovskites have fascinating electronic properties and have already been implemented in various devices. Although the behavior of bulk metal halide perovskites has been widely studied, the properties of perovskite nanocrystals are less well-understood because synthesizing them is still very challenging, in part because of stability. Here we demonstrate a simple and versatile method to grow monodisperse CH 3 NH 3 PbBr x I x-3 perovskite nanocrystals inside mesoporous silica templates. The size of the nanocrystal is governed by the pore size of the templates (3.3, 3.7, 4.2, 6.2, and 7.1 nm). In-depth structural analysis shows that the nanocrystals maintain the perovskite crystal structure, but it is slightly distorted. Quantum confinement was observed by tuning the size of the particles via the template. This approach provides an additional route to tune the optical bandgap of the nanocrystal. The level of quantum confinement was modeled taking into account the dimensions of the rod-shaped nanocrystals and their close packing inside the channels of the template. Photoluminescence measurements on CH 3 NH 3 PbBr clearly show a shift from green to blue as the pore size is decreased. Synthesizing perovskite nanostructures in templates improves their stability and enables tunable electronic properties via quantum confinement. These structures may be useful as reference materials for comparison with other perovskites, or as functional materials in all solid-state light-emitting diodes.

  16. Investigation of the photoluminescence properties of thermochemically synthesized CdS nanocrystals

    Directory of Open Access Journals (Sweden)

    M. Molaei

    2011-03-01

    Full Text Available In this work we have synthesized CdS nanocrystals with thermochemical method. CdSO4 and Na2S2O3 were used as the precursors and thioglycolic acid (TGA was used as capping agent molecule. The structure and optical property of the nanocrystals were characterized by means of XRD, TEM, UV-visible optical spectroscopy and photoluminescence (PL. X-ray diffraction (XRD and TEM analyses demonstrated hexagonal phase CdS nanocrystals with an average size around 2 nm. Synthesized nanocrystals exhibited band gap of about 3.2 eV and showed a broad band emission from 400-750 nm centered at 504 nm with a (0.27, 0.39 CIE coordinate. This emission can be attributed to recombination of an electron in conduction band with a hole trapped in Cd vacancies near to the valance band of CdS. The best attained photoluminescence quantum yield of the nanocrystals was about 12%, this amount is about 20 times higher than that for thioglycerol (TG capped CdS nanocrystals.

  17. Observation of melting in 30 angstrom diameter CdS nanocrystals

    International Nuclear Information System (INIS)

    Goldstein, A.N.; Colvin, V.L.; Alivisatos, A.P.

    1991-01-01

    In this paper temperature dependent electron diffraction studies on 30 Angstrom diameter CdS nanocrystals are described. The linear thermal expansion coefficient of the nanocrystals is 2.75 * 10 -5 Angstrom/K, and the melting point is 575 K. These data are in contrast to bulk CdS which has a melting point of 1750 K and a linear expansion coefficient of 5.5 * 10 -6 Angstrom/K. The observed depression in the melting point of these semiconductor clusters is similar to effects observed in metals and molecular crystals, indicating that the phenomenon of reduced melting point in small systems is a general one regardless of the type of material. The observation of melting point depression in these clusters also has far reaching implications for the preparation of highly crystalline clusters of CdS, as well as for the use of these nanocrystals as precursors to thin films

  18. Noninjection Synthesis of CdS and Alloyed CdSxSe1−xNanocrystals Without Nucleation Initiators

    Directory of Open Access Journals (Sweden)

    Zou Yu

    2010-01-01

    Full Text Available Abstract CdS and alloyed CdSxSe1−x nanocrystals were prepared by a simple noninjection method without nucleation initiators. Oleic acid (OA was used to stabilize the growth of the CdS nanocrystals. The size of the CdS nanocrystals can be tuned by changing the OA/Cd molar ratios. On the basis of the successful synthesis of CdS nanocrystals, alloyed CdSxSe1−x nanocrystals can also be prepared by simply replacing certain amount of S precursor with equal amount of Se precursor, verified by TEM, XRD, EDX as well as UV–Vis absorption analysis. The optical properties of the alloyed CdSxSe1−x nanocrystals can be tuned by adjusting the S/Se feed molar ratios. This synthetic approach developed is highly reproducible and can be readily scaled up for potential industrial production.

  19. Synthesis of CdS nanocrystals with different morphologies via an ultraviolet irradiation route

    International Nuclear Information System (INIS)

    Yao Suwei; Han Yuxin; Liu Weixing; Zhang Weiguo; Wang Hongzhi

    2007-01-01

    A simple ultraviolet photochemical reduction synthetic approach to preparing CdS nanocrystals with different morphologies is described. Sodium dodecyl sulfate (SDS) was used as soft template for the chemical synthesis of CdS nanocrystals in a mixture solution at room temperature. It was found that the magnetic force stirring and the volume proportions of C 2 H 5 OH and H 2 O had marked influences on the morphology of CdS nanocrystals (such as spherical, acicular-like, rod-like and worm-like shapes). The formation of CdS is via precipitation of Cd 2+ ions with the homogeneously released S 2- ions from decomposition of thioacetamide under ultraviolet irradiation source. X-ray diffraction (XRD), scanning electron microscopy (SEM) and the ultraviolet-visible (UV-vis) absorption spectra were employed to characterize the products. This novel method is expected to produce various semiconductor nanocrystals with potential applications in the fields of materials science and photovoltaic cells, etc

  20. Growth of monodisperse nanocrystals of cerium oxide during synthesis and annealing

    Energy Technology Data Exchange (ETDEWEB)

    Ghosh, Swapankumar, E-mail: swapankumar.ghosh2@mail.dcu.ie; Divya, Damodaran [National Institute for Interdisciplinary Science and Technology (NIIST), Council of Scientific and Industrial Research (CSIR) (India); Remani, Kottayilpadi C. [Sree Neelakanda Government Sanskrit College, Department of Chemistry (India); Sreeremya, Thadathil S. [National Institute for Interdisciplinary Science and Technology (NIIST), Council of Scientific and Industrial Research (CSIR) (India)

    2010-06-15

    Monodisperse cerium oxide nanocrystals have been successfully synthesised using simple ammonia precipitation technique from cerium(III) nitrate solution at different temperatures in the range 35-80 {sup o}C. The activation energy for growth of CeO{sub 2} nanocrystals during the precipitation is calculated as 11.54 kJ/mol using Arrhenius plot. Average crystal diameter was obtained from XRD analysis, HR-TEM and light scattering (PCS). The analysis of size data from HR-TEM images and PCS clearly indicated the formation of highly crystalline CeO{sub 2} particles in narrow size range. CeO{sub 2} nanocrystals precipitated at 35 {sup o}C were further annealed at temperatures in the range 300-700 {sup o}C. The activation energy for crystal growth during annealing is also calculated and is close to the reported values. An effort is made to predict the mechanism of crystal growth during the precipitation and annealing.

  1. Synthesis, characterization and magnetic properties of monodisperse Ni, Zn-ferrite nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Sanjeev, E-mail: sanjeevkumar.dubey2@gmail.com [University of Petroleum and Energy Studies, Dehradun, Uttarakhand (India); Kumar, Pankaj [University of Petroleum and Energy Studies, Dehradun, Uttarakhand (India); Singh, Vaishali [University School of Basic and Applied Science (India); Kumar Mandal, Uttam [University of Chemical Technology, GGS Indraprastha University, Sector 16, Dwarka, Delhi 110403 (India); Kumar Kotnala, Ravinder [National Physical laboratory, New Delhi 110012 (India)

    2015-04-01

    Synthesization of monodisperse Ni, Zn-ferrite (Ni{sub 1−x}Zn{sub x}Fe{sub 2}O{sub 4}, x=1, 0.8, 0.6, 0.5, 0.4, 0.2, 0.0) nanocrystals has been achieved by the inverse microemulsion method using CTAB as surfactant and kerosene as an oil phase. The detailed characterization of the synthesized nanocrystals and measurement of the magnetic properties has been done by techniques like X-ray diffraction (XRD), field emission transmission electron microscopy (FETEM), Fourier transform infrared spectroscopy (FITR) and Vibrating Sample Magnetometer (VSM) respectively. The relationship between the structure and composition of the nanocrystals with magnetic properties has been investigated. The nanocrystals size is found to be in the range 1–5 nm. The effect of Zn substitution on size and magnetic properties has been studied. It has been observed that magnetism changed from ferromagnetic at X= 0 to super paramagnetic to paramagnetic at X=1 as Zn concentration increased. The Curie temperature is found to decrease with an increase in Zn concentration. - Highlights: • Reverse microemulsion route is very facile route for synthesis of Ni{sub 1−x}Zn{sub x}Fe{sub 2}O{sub 4} ferrite. • Presence of Zn changes the structural and magnetic properties of the Zn substituted NiFe{sub 2}O{sub 4.} • The lattice constant increases with the increase in Zn substitution. • The curie temperature decreases with Zn concentration appreciably. • Magnetic behavior varies from ferromagnetic at x=0 to superparamagnetic to paramagnetic at x=1.

  2. Radiative Properties of Carriers in Cdse-Cds Core-Shell Heterostructured Nanocrystals of Various Geometries

    Science.gov (United States)

    Zhou, S.; Dong, L.; Popov, S.; Friberg, A. T.

    2013-07-01

    We report a model on core-shell heterostructured nanocrystals with CdSe as the core and CdS as the shell. The model is based on one-band Schrödinger equation. Three different geometries, nanodot, nanorod, and nanobone, are implemented. The carrier localization regimes with these structures are simulated, compared, and analyzed. Based on the electron and hole wave functions, the carrier overlap integral that has a great impact on stimulated emission is further investigated numerically by a novel approach. Furthermore, the relation between the nanocrystal size and electron-hole recombination energy is also examined.

  3. Patterned structures of in situ size controlled CdS nanocrystals in a polymer matrix under UV irradiation

    International Nuclear Information System (INIS)

    Fragouli, D; Pompa, P P; Caputo, G; Cingolani, R; Athanassiou, A; Resta, V; Laera, A M; Tapfer, L

    2009-01-01

    A method of in situ formation of patterns of size controlled CdS nanocrystals in a polymer matrix by pulsed UV irradiation is presented. The films consist of Cd thiolate precursors with different carbon chain lengths embedded in TOPAS polymer matrices. Under UV irradiation the precursors are photolyzed, driving to the formation of CdS nanocrystals in the quantum size regime, with size and concentration defined by the number of incident UV pulses, while the host polymer remains macroscopically/microscopically unaffected. The emission of the formed nanocomposite materials strongly depends on the dimensions of the CdS nanocrystals, thus, their growth at the different phases of the irradiation is monitored using spatially resolved photoluminescence by means of a confocal microscope. X-ray diffraction measurements verified the existence of the CdS nanocrystals, and defined their crystal structure for all the studied cases. The results are reinforced by transmission electron microscopy. It is proved that the selection of the precursor determines the efficiency of the procedure, and the quality of the formed nanocrystals. Moreover it is demonstrated that there is the possibility of laser induced formation of well-defined patterns of CdS nanocrystals, opening up new perspectives in the development of nanodevices.

  4. Patterned structures of in situ size controlled CdS nanocrystals in a polymer matrix under UV irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Fragouli, D; Pompa, P P; Caputo, G; Cingolani, R; Athanassiou, A [NNL-National Nanotechnology Laboratory, INFM, CNR, Via Arnesano, 73100 Lecce (Italy); Resta, V; Laera, A M; Tapfer, L [ENEA, Centro Ricerche Brindisi, SS7 Appia Km 706, I-72100 Brindisi (Italy)], E-mail: despina.fragouli@unile.it

    2009-04-15

    A method of in situ formation of patterns of size controlled CdS nanocrystals in a polymer matrix by pulsed UV irradiation is presented. The films consist of Cd thiolate precursors with different carbon chain lengths embedded in TOPAS polymer matrices. Under UV irradiation the precursors are photolyzed, driving to the formation of CdS nanocrystals in the quantum size regime, with size and concentration defined by the number of incident UV pulses, while the host polymer remains macroscopically/microscopically unaffected. The emission of the formed nanocomposite materials strongly depends on the dimensions of the CdS nanocrystals, thus, their growth at the different phases of the irradiation is monitored using spatially resolved photoluminescence by means of a confocal microscope. X-ray diffraction measurements verified the existence of the CdS nanocrystals, and defined their crystal structure for all the studied cases. The results are reinforced by transmission electron microscopy. It is proved that the selection of the precursor determines the efficiency of the procedure, and the quality of the formed nanocrystals. Moreover it is demonstrated that there is the possibility of laser induced formation of well-defined patterns of CdS nanocrystals, opening up new perspectives in the development of nanodevices.

  5. Synthesis of Monodisperse Nanocrystals via Microreaction: Open-to-Air Synthesis with Oleylamine as a Coligand

    Directory of Open Access Journals (Sweden)

    Yang Hongwei

    2009-01-01

    Full Text Available Abstract Microreaction provides a controllable tool to synthesize CdSe nanocrystals (NCs in an accelerated fashion. However, the surface traps created during the fast growth usually result in low photoluminescence (PL efficiency for the formed products. Herein, the reproducible synthesis of highly luminescent CdSe NCs directly in open air was reported, with a microreactor as the controllable reaction tool. Spectra investigation elucidated that applying OLA both in Se and Cd stock solutions could advantageously promote the diffusion between the two precursors, resulting in narrow full-width-at-half maximum (FWHM of PL (26 nm. Meanwhile, the addition of OLA in the source solution was demonstrated helpful to improve the reactivity of Cd monomer. In this case, the focus of size distribution was accomplished during the early reaction stage. Furthermore, if the volume percentage (vol.% of OLA in the precursors exceeded a threshold of 37.5%, the resulted CdSe NCs demonstrated long-term fixing of size distribution up to 300 s. The observed phenomena facilitated the preparation of a size series of monodisperse CdSe NCs merely by the variation of residence time. With the volume percentage of OLA as 37.5% in the source solution, a 78 nm tuning of PL spectra (from 507 to 585 was obtained through the variation of residence time from 2 s to 160 s, while maintaining narrow FMWH of PL (26–31 nm and high QY of PL (35–55%.

  6. Synthesis of CdS nanocrystals in polymeric films studied by in-situ GID and GISAXS

    KAUST Repository

    Di Luccio, Tiziana; Carbone, Dina; Masala, Silvia; Ramachandran, Karthik; Kornfield, Julie

    2015-01-01

    In this work, we describe the synthesis of CdS nanocrystals in thin polymeric films by in-situ Grazing Incidence Diffraction (GID) and Grazing Incidence Small Angle Scattering (GISAXS). The 2D GISAXS patterns indicate how the precursor structure is altered as the temperature is varied from 25°C to 300°C. At 150°C, the CdS nanocrystals start to arrange themselves in a hexagonal lattice with a lattice parameter of 27 A. The diffraction intensity from the hexagonal lattice reaches a maximum at 170"C and decreases steadily upon further heating above 220°C indicating loss of symmetry. Correspondingly, the GID scans at 170°C show strong crystalline peaks from cubic CdS nanocrystals that are about 2 nm size. The results indicate that a temperature of 170°C is sufficient to synthesize CdS nanocrystals without degradation of the polymer matrix (Topas) in thin films (about 30nm). © 2015 Materials Research Society.

  7. Synthesis of CdS nanocrystals in polymeric films studied by in-situ GID and GISAXS

    KAUST Repository

    Di Luccio, Tiziana

    2015-07-07

    In this work, we describe the synthesis of CdS nanocrystals in thin polymeric films by in-situ Grazing Incidence Diffraction (GID) and Grazing Incidence Small Angle Scattering (GISAXS). The 2D GISAXS patterns indicate how the precursor structure is altered as the temperature is varied from 25°C to 300°C. At 150°C, the CdS nanocrystals start to arrange themselves in a hexagonal lattice with a lattice parameter of 27 A. The diffraction intensity from the hexagonal lattice reaches a maximum at 170"C and decreases steadily upon further heating above 220°C indicating loss of symmetry. Correspondingly, the GID scans at 170°C show strong crystalline peaks from cubic CdS nanocrystals that are about 2 nm size. The results indicate that a temperature of 170°C is sufficient to synthesize CdS nanocrystals without degradation of the polymer matrix (Topas) in thin films (about 30nm). © 2015 Materials Research Society.

  8. Template-directed nucleation and growth of CdS nanocrystal: the role of helical and nonhelical nanofibers on their shape and size

    International Nuclear Information System (INIS)

    Bose, Partha Pratim; Banerjee, Arindam

    2010-01-01

    This study describes the use of chiral nature of synthetic self-assembled nanofibers for nucleation and growth of Cadmium sulfide (CdS) nanocrystals with different sizes and shapes in room temperature. The templates are built by immobilizing a peptide capping agent on the surface of synthetic self-assembled helical or nonhelical nanofibers and CdS nanocrystals were allowed to grow on them. It is observed that there are differences in shapes and sizes of the nanocrystals depending on the chiral nature of the nanofibers on which they were growing. Even the CdS nanocrystals grown on different chiral and achiral nanofibers differ markedly in their photoluminescence properties. Thus, here we introduce a new way of using chirality of nanofibers to nucleate and grow CdS nanocrystals of different shape, size, and optical property.

  9. In situ capping for size control of monochalcogenide (ZnS, CdS and SnS) nanocrystals produced by anaerobic metal-reducing bacteria

    International Nuclear Information System (INIS)

    Jang, Gyoung Gug; Datskos, Panos G; Jacobs, Christopher B; Ivanov, Ilia N; Joshi, Pooran C; Meyer, Harry M III; Armstrong, Beth L; Kidder, Michelle; Graham, David E; Moon, Ji-Won

    2015-01-01

    Metal monochalcogenide quantum dot nanocrystals of ZnS, CdS and SnS were prepared by anaerobic, metal-reducing bacteria using in situ capping by oleic acid or oleylamine. The capping agent preferentially adsorbs on the surface of the nanocrystal, suppressing the growth process in the early stages, thus leading to production of nanocrystals with a diameter of less than 5 nm. (paper)

  10. Polarization-resolved degenerate four-wave mixing of CdS nanocrystals in a nonresonant region

    International Nuclear Information System (INIS)

    Ma, S.M.; Seo, J.T.; Yang, Q.; Creemore, L.; Battle, R.; Tabibi, B.; Yu, W.

    2006-01-01

    The third-order susceptibilities of various concentrations of TOPO-passivated CdS nanocrystals (NCs) with the size near the Bohr radius were investigated using polarization-resolved degenerate four-wave mixing (DFWM) in a nonresonant excitation region with 532 nm wavelength and 8 ns pulse width. The second hyperpolarizabilities left angle γ h xxxx right angle and left angle γ h xyyx right angle of the CdS NCs were ∝1.25 x 10 -42 m 5 /V 2 and ∝3.66 x 10 -43 m 5 /V 2 , respectively. The ratio (left angle γ h xyyx right angle / left angle γ h xxxx right angle) of the hyperpolarizabilities was ∝0.29 that indicated a large contribution of electronic polarization process to the third-order nonlinearity of CdS NCs. (copyright 2006 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  11. Controllable synthesis and upconversion emission of ultrasmall near-monodisperse lanthanide-doped Sr2LaF7 nanocrystals

    International Nuclear Information System (INIS)

    Mao, Yifu; Ma, Mo; Gong, Lunjun; Xu, Changfu; Ren, Guozhong; Yang, Qibin

    2014-01-01

    Highlights: • Apropos NaOH content facilitates the growth of pure phase Sr 2 LaF 7 NCs. • Yb 3+ doping is favorable to the formation of Sr 2 LaF 7 NCs with uniform size. • Ultrasmall near-monodispersed Sr 2 LaF 7 NCs(sub-10 nm) were synthesized for the first time. • Intense multicolor upconversion can be obtained by properly lanthanide doping. - Abstract: Fluorite phase Sr 2 LaF 7 nanocrystals (NCs) were synthesized via solvothermal method using oleic acid as capping ligands. The effects of preparing conditions on the phase structure, crystal size, morphology, and upconversion (UC) emission properties of the products were studied. The results reveal that just apropos NaOH content facilitates the growth of near-monodispersed pure phase Sr 2 LaF 7 NCs, and Yb 3+ doping is favorable to the formation of pure Sr 2 LaF 7 phase with more uniform size distribution. The average crystalline size of the products can be controlled less than 10 nm. Following appropriate lanthanide ions doping, the NCs show intense blue, yellow, and white-color UC emission under the excitation of a 980 nm laser. The energy transfer UC mechanisms for the fluorescent intensity were also investigated

  12. Synthesis of CdS Nanocrystals by Employing the By-Products of the Anaerobic Respiratory Process of Desulfovibrio alaskensis 6SR Bacteria

    Directory of Open Access Journals (Sweden)

    L. G. Rangel-Chávez

    2015-01-01

    Full Text Available A novel methodology for the direct synthesis of CdS nanoparticles, using a biological agent that avoids the extracellular processing, and the results of the characterization of CdS nanocrystals are presented. The by-products of the anaerobic respiratory process of Desulfovibrio alaskensis 6SR along with aqueous solutions of Cd salts were successfully employed to produce CdS nanocrystals with mixed cubic and hexagonal phases. Nanocrystal size has a narrow size distribution with little dependence on the Cd concentration. Both the presence of the crystallographic cubic phase and the crystalline order decrease as Cd concentration increases. The band gap values obtained from optical transmission measurements are lower than those of the bulk crystal. Raman spectroscopy characterization agrees with electron transmission microscopy images and X-ray diffraction results indicating that the method promotes the formation of high structural quality nanocrystals when low concentrations of the Cd salt are used.

  13. Water-resistant, monodispersed and stably luminescent CsPbBr3/CsPb2Br5 core-shell-like structure lead halide perovskite nanocrystals

    Science.gov (United States)

    Qiao, Bo; Song, Pengjie; Cao, Jingyue; Zhao, Suling; Shen, Zhaohui; Gao, Di; Liang, Zhiqin; Xu, Zheng; Song, Dandan; Xu, Xurong

    2017-11-01

    Lead halide perovskite materials are thriving in optoelectronic applications due to their excellent properties, while their instability due to the fact that they are easily hydrolyzed is still a bottleneck for their potential application. In this work, water-resistant, monodispersed and stably luminescent cesium lead bromine perovskite nanocrystals coated with CsPb2Br5 were obtained using a modified non-stoichiometric solution-phase method. CsPb2Br5 2D layers were coated on the surface of CsPbBr3 nanocrystals and formed a core-shell-like structure in the synthetic processes. The stability of the luminescence of the CsPbBr3 nanocrystals in water and ethanol atmosphere was greatly enhanced by the photoluminescence-inactive CsPb2Br5 coating with a wide bandgap. The water-stable enhanced nanocrystals are suitable for long-term stable optoelectronic applications in the atmosphere.

  14. Characterization of Monodispersed Iron Oxide Nanocrystals by XAS and MCD measurement

    International Nuclear Information System (INIS)

    Kim, J.-Y.; Noh, H.-J.; Park, B.-G.; Kim, T.-Y.; Park, J.-H.; Hyeon, T.; Park, J.; Kang, E.

    2004-01-01

    Full text: Nanoparticles have attracted so much attention because of their potential technological applications and abundance of scientifically interesting issues. In particular, magnetic nanoparticles are considered to be applicable to various magnetic devices such as terabit memory, ferrofluids, magnetocaloric refrigeration systems, blood cells, etc. With the development of nano-technology, variation of physical properties as a function of particle size is one of the most important issues, but has been rarely explored because of difficulty of the size control in synthesizing nanoparticles. Recently, some of us successfully synthesized high crystalline and monodisperse maghemite nanoparticles without a size selection process and research in this field seems to be promoted by one step. In this report, we present a systematic characterization of the monodispersed nanocrystalline γ - Fe 2 O 3 with the diameter of 13, 8 and 4 nm by measuring the x-ray absorption spectroscopy (XAS) and the x-ray magnetic circular dichroism(XMCD) spectra on Fe L edge. The spectra of the 4 nm nanoparticles are very similar to those of maghemite (γ - Fe 2 O 3 ). However, the spectra become close to those of magnetite (Fe 3 O 4 ) as the particle size becomes 8 and 13 nm. Considering that the maghemite and magnetite have the same spinel structure with different Fe vacancies, these results can be explained that the surface of nanoparticles has more vacancies than the core part, indicating that surface disorder increases as the particle size decreases

  15. Photoluminescence studies on Cd(1-x)Zn(x)S:Mn2+ nanocrystals.

    Science.gov (United States)

    Sethi, Ruchi; Kumar, Lokendra; Pandey, A C

    2009-09-01

    Highly monodispersed, undoped and doped with Mn2+, binary and ternary (CdS, ZnS, Cd(1-x)Zn(x)S) compound semiconductor nanocrystals have been synthesized by co-precipitation method using citric acid as a stabilizer. As prepared sample are characterized by X-ray diffraction, Small angle X-ray scattering, Transmission electron microscope, Optical absorption and Photoluminescence spectroscopy, for their optical and structural properties. X-ray diffraction, Small angle X-ray scattering and Transmission electron microscope results confirm the preparation of monodispersed nanocrystals. Photoluminescence studies show a significant blue shift in the wavelength with an increasing concentration of Zn in alloy nanocrystals.

  16. Monodispersed porous flowerlike PtAu nanocrystals as effective electrocatalysts for ethanol oxidation

    Science.gov (United States)

    Li, Shumin; Xu, Hui; Xiong, Zhiping; Zhang, Ke; Wang, Caiqin; Yan, Bo; Guo, Jun; Du, Yukou

    2017-11-01

    Designing and tuning the bimetallic nanoparticles with desirable morphology and structure can embody them with greatly enhanced electrocatalytic activity and stability towards liquid fuel oxidation. We herein reported a facile one-pot method for the controlled synthesis of monodispersed binary PtAu nanoflowers with abundant exposed surface area. Owing to its fantastic structure, synergistic and electronic effect, such as-prepared PtAu nanoflowers exhibited outstandingly high electrocatalytic activity with the mass activity of 6482 mA mg-1 towards ethanol oxidation, which is 28.3 times higher than that of commercial Pt/C (227 mA mg-1). More interesting, the present PtAu nanoflower catalysts are more stable for the ethanol oxidation reaction in the alkaline with lower current density decay and retained a much higher current density after successive CVs of 500 cycles than that of commercial Pt/C. This work may open a new way for maximizing the catalytic performance of electrocatalysts towards ethanol oxidation by synthesizing shape-controlled alloy nanoparticles with more surface active sites to enhance the performances of direct fuel cells reaction, chemical conversion, and beyond.

  17. Biosynthesis of fluorescent CdS nanocrystals with semiconductor properties: Comparison of microbial and plant production systems.

    Science.gov (United States)

    Al-Shalabi, Zahwa; Doran, Pauline M

    2016-04-10

    This study investigated fission yeast (Schizosaccharomyces pombe) and hairy roots of tomato (Solanum lycopersicum) as in vitro production vehicles for biological synthesis of CdS quantum dots. Cd added during the mid-growth phase of the cultures was detoxified within the biomass into inorganic sulphide-containing complexes with the quantum confinement properties of semiconductor nanocrystals. Significant differences were found between the two host systems in terms of nanoparticle production kinetics, yield and quality. The much slower growth rate of hairy roots compared with yeast is a disadvantage for commercial scaled-up production. Nanoparticle extraction from the biomass was less effective for the roots: 19% of the Cd present in the hairy roots was recovered after extraction compared with 34% for the yeast. The overall yield of CdS quantum dots was also lower for the roots: relative to the amount of Cd taken up into the biomass, 8.5% was recovered in yeast gel filtration fractions exhibiting quantum dot properties whereas the result for hairy roots was only 0.99%. Yeast-produced CdS crystallites were somewhat smaller with diameters of approximately 2-6 nm compared with those of 4-10nm obtained from the roots. The average ratio of inorganic sulphide to Cd for the purified and size-fractionated particles was 0.44 for the yeast and 1.6 for the hairy roots. Despite the limitations associated with hairy roots in terms of culture kinetics and product yield, this system produced CdS nanoparticles with enhanced photostability and 3.7-13-fold higher fluorescence quantum efficiency compared with those generated by yeast. This work demonstrates that the choice of cellular host can have a significant effect on nanoparticle functional properties as well as on the bioprocessing aspects of biological quantum dot synthesis. Copyright © 2016 Elsevier B.V. All rights reserved.

  18. Photoemission studies of semiconductor nanocrystals

    International Nuclear Information System (INIS)

    Hamad, K.S.; Roth, R.; Alivisatos, A.P.

    1997-01-01

    Semiconductor nanocrystals have been the focus of much attention in the last ten years due predominantly to their size dependent optical properties. Namely, the band gap of nanocrystals exhibits a shift to higher energy with decreasing size due to quantum confinement effects. Research in this field has employed primarily optical techniques to study nanocrystals, and in this respect this system has been investigated extensively. In addition, one is able to synthesize monodisperse, crystalline particles of CdS, CdSe, Si, InP, InAs, as well as CdS/HgS/CdS and CdSe/CdS composites. However, optical spectroscopies have proven ambiguous in determining the degree to which electronic excitations are interior or surface admixtures or giving a complete picture of the density of states. Photoemission is a useful technique for understanding the electronic structure of nanocrystals and the effects of quantum confinement, chemical environments of the nanocrystals, and surface coverages. Of particular interest to the authors is the surface composition and structure of these particles, for they have found that much of the behavior of nanocrystals is governed by their surface. Previously, the authors had performed x-ray photoelectron spectroscopy (XPS) on CdSe nanocrystals. XPS has proven to be a powerful tool in that it allows one to determine the composition of the nanocrystal surface

  19. Raman Spectroscopy of SiO{sub 2}–Na{sub 2}O–Al{sub 2}O{sub 3}–B{sub 2}O{sub 3} glass doped with Nd{sup 3+} and CdS nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Serqueira, E.O.; Dantas, N.O. [Laboratório de Novos Materiais Isolantes e Semicondutores (LNMIS), Instituto de Física, Universidade Federal de Uberlândia, Uberlândia, MG 38400-902 (Brazil); Anjos, V. [Grupo de Espectroscopia de Materiais, Departamento de Física, ICE – UFJF, Campus Universitário, Juiz de Fora, MG 36036-330 (Brazil); Bell, M.J.V., E-mail: mjvbell@yahoo.com.br [Grupo de Espectroscopia de Materiais, Departamento de Física, ICE – UFJF, Campus Universitário, Juiz de Fora, MG 36036-330 (Brazil)

    2014-01-05

    Highlights: • The formation of CdS nanocrystals in the glassy host is shown by Raman measurements. • Nd{sub 2}O{sub 3} modifies the growth of CdS nanocrystals in the SNAB glass. • Nd{sup 3+} ions are not incorporated inside the semiconductor nanocrystals. -- Abstract: We report the Raman spectroscopic characterization of a SNAB glass system doped with neodymium and CdS nanocrystals and fabricated by the fusion process. Raman spectra revealed CdS nanocrystals in the glass host and bands associated with Si–O vibrational modes with five structural configurations, boroxol modes of B{sub 2}O{sub 3}, Al–O and Cd–S vibrational modes. Additionally, Nd{sub 2}O{sub 3} modifies the growth of CdS nanocrystals in the SNAB glass and Nd{sup 3+} ions are not incorporated inside the semiconductor nanocrystals.

  20. Use of CdS quantum dot-functionalized cellulose nanocrystal films for anti-counterfeiting applications

    Science.gov (United States)

    Chen, L.; Lai, C.; Marchewka, R.; Berry, R. M.; Tam, K. C.

    2016-07-01

    Structural colors and photoluminescence have been widely used for anti-counterfeiting and security applications. We report for the first time the use of CdS quantum dot (QD)-functionalized cellulose nanocrystals (CNCs) as building blocks to fabricate nanothin films via layer-by-layer (LBL) self-assembly for anti-counterfeiting applications. Both negatively- and positively-charged CNC/QD nanohybrids with a high colloidal stability and a narrow particle size distribution were prepared. The controllable LBL coating process was characterized by scanning electron microscopy and ellipsometry. The rigid structure of CNCs leads to nanoporous structured films on poly(ethylene terephthalate) (PET) substrates with high transmittance (above 70%) over the entire range of visible light and also resulted in increased hydrophilicity (contact angles of ~40 degrees). Nanothin films on PET substrates showed good flexibility and enhanced stability in both water and ethanol. The modified PET films with structural colors from thin-film interference and photoluminescence from QDs can be used in anti-counterfeiting applications.Structural colors and photoluminescence have been widely used for anti-counterfeiting and security applications. We report for the first time the use of CdS quantum dot (QD)-functionalized cellulose nanocrystals (CNCs) as building blocks to fabricate nanothin films via layer-by-layer (LBL) self-assembly for anti-counterfeiting applications. Both negatively- and positively-charged CNC/QD nanohybrids with a high colloidal stability and a narrow particle size distribution were prepared. The controllable LBL coating process was characterized by scanning electron microscopy and ellipsometry. The rigid structure of CNCs leads to nanoporous structured films on poly(ethylene terephthalate) (PET) substrates with high transmittance (above 70%) over the entire range of visible light and also resulted in increased hydrophilicity (contact angles of ~40 degrees). Nanothin films

  1. Synthesis of hybrid organic–inorganic nanocomposite materials based on CdS nanocrystals for energy conversion applications

    International Nuclear Information System (INIS)

    Laera, A. M.; Resta, V.; Ferrara, M. C.; Schioppa, M.; Piscopiello, E.; Tapfer, L.

    2011-01-01

    Efficient solar energy conversion is strongly related to the development of new materials with enhanced functional properties. In this context, a wide variety of inorganic, organic, or hybrid nanostructured materials have been investigated. In particular, in hybrid organic–inorganic nanocomposites are combined the convenient properties of organic polymers, such as easy manipulation and mechanical flexibility, and the unique size-dependent properties of nanocrystals (NCs). However, applications of hybrid nanocomposites in photovoltaic devices require a homogeneous and highly dense dispersion of NCs in polymer in order to guarantee not only an efficient charge separation, but also an efficient transport of the carriers to the electrodes without recombination. In previous works, we demonstrated that cadmium thiolate complexes are suitable precursors for the in situ synthesis of nanocrystalline CdS. Here, we show that the soluble [Cd(SBz) 2 ] 2 ·(1-methyl imidazole) complex can be efficiently annealed in a conjugated polymer obtaining a nanocomposite with a regular and compact network of NCs. The proposed synthetic strategies require annealing temperatures well below 200 °C and short time for the thermal treatment, i.e., less than 30 min. We also show that the same complex can be used to synthesize CdS NCs in mesoporous TiO 2 . The adsorption of cadmium thiolate molecule in TiO 2 matrix can be obtained by using chemical bath deposition technique and subsequent thermal annealing. The use of NCs, quantum dots, as sensitizers of TiO 2 matrices represents a very promising alternative to common dye-sensitized solar cells and an interesting solution for heterogeneous photocatalysis.

  2. Photon-induced formation of CdS nanocrystals in selected areas of polymer matrices

    International Nuclear Information System (INIS)

    Athanassiou, Athanassia; Cingolani, Roberto; Tsiranidou, Elsa; Fotakis, Costas; Laera, Anna Maria; Piscopiello, Emanuela; Tapfer, Leander

    2007-01-01

    We demonstrate light-induced formation of semiconductor quantum dots in TOPAS registered polymer matrix with very high control of their size and their spatial localization. Irradiation with UV laser pulses of polymer films embedding Cd thiolate precursors results in the formation of cadmium sulfide nanocrystals well confined in the irradiation area, through a macroscopically nondestructive procedure for the host matrix. With increasing number of laser pulses, we accomplish the formation of nanoparticles with gradually increasing dimensions, resulting in the dynamic change of the spectra emitted by the formed nanocomposite areas. The findings are supported by x-ray diffraction and transmission electron microscopy measurements

  3. Nanostructural and magnetic studies of virtually monodispersed NiFe2O4 nanocrystals synthesized by a liquid–solid-solution assisted hydrothermal route

    International Nuclear Information System (INIS)

    Li Xinghua; Tan Guoguo; Chen Wei; Zhou Baofan; Xue Desheng; Peng Yong; Li, Fashen; Mellors, Nigel J.

    2012-01-01

    This study presents a comprehensively and systematically structural, chemical and magnetic characterization of ∼9.5 nm virtually monodispersed nickel ferrite (NiFe 2 O 4 ) nanoparticles prepared using a modified liquid–solid-solution (LSS) assisted hydrothermal method. Lattice-resolution scanning transmission electron microscope (STEM) and converged beam electron diffraction pattern (CBED) techniques are adapted to characterize the detailed spatial morphology and crystal structure of individual NiFe 2 O 4 particles at nano scale for the first time. It is found that each NiFe 2 O 4 nanoparticle is single crystal with an fcc structure. The morphology investigation reveals that the prepared NiFe 2 O 4 nanoparticles of which the surfaces are decorated by oleic acid are dispersed individually in hexane. The chemical composition of nickel ferrite nanoparticles is measured to be 1:2 atomic ratio of Ni:Fe, indicating a pure NiFe 2 O 4 composition. Magnetic measurements reveal that the as-synthesized nanocrystals displayed superparamagnetic behavior at room temperature and were ferromagnetic at 10 K. The nanoscale characterization and magnetic investigation of monodispersed NiFe 2 O 4 nanoparticles should be significant for its potential applications in the field of biomedicine and magnetic fluid using them as magnetic materials.

  4. Monodisperse SnO2 nanocrystals functionalized multiwalled carbon nanotubes for large rate and long lifespan anode materials in lithium ion batteries

    International Nuclear Information System (INIS)

    Song, Huawei; Li, Na; Cui, Hao; Wang, Chengxin

    2014-01-01

    A facile way towards high rate and long lifespan anode materials based on SnO 2 and commercial multiwalled carbon nanotubes (MWCNTs) is readily achieved through a combination of activation and hydrothermal treatment. The former endows the MWCNTs with abundant hydrophilic radicals, while the latter guarantees intimate connection between SnO 2 and MWCNTs; eventually, monodisperse SnO 2 nanocrystals ca. 3 nm are firmly anchored on the MWCNTs without agglomeration. When used for lithium ion batteries (LIBs) anodes, the hybrid composite exhibits excellent cycling capability with high reversible capacity about 700 mAh g −1 (based on total weight of the composite) for 150 cycles at 0.1 A g −1 superior to both components involved. Besides large rates of 5 A g −1 with recoverable initial reversible capacity, it also last for more than 1000 cycles with little capacity decay, outperforming most SnO 2 based carbon nanotubes composites (SnO 2 /CNTs) so far. Insights into the electrochemical processes reveal the hybrid composite exhibits enhanced redox capacitance and interfacial capacitance in comparison with SnO 2 nanocrystals which indicate the perfect interfaces and robust structure of the hybrid composite

  5. Selective enhancement of surface-state emission and simultaneous quenching of interband transition in white-luminophor CdS nanocrystals using localized plasmon coupling

    Energy Technology Data Exchange (ETDEWEB)

    Ozel, Tuncay; Soganci, Ibrahim Murat; Nizamoglu, Sedat; Huyal, Ilkem Ozge; Mutlugun, Evren; Demir, Hilmi Volkan [Department of Physics, Department of Electrical and Electronics Engineering, Nanotechnology Research Center and Institute of Materials Science and Nanotechnology, Bilkent University, Ankara 06800 (Turkey); Sapra, Sameer; Gaponik, Nikolai; Eychmueller, Alexander [Physical Chemistry/Electrochemistry Group, Technische Universitaet Dresden, Bergstr. 66b, Dresden 01062 (Germany)], E-mail: volkan@bilkent.edu.tr

    2008-08-15

    We propose and demonstrate the controlled modification and selective enhancement of surface-state emission in white-luminophor CdS nanocrystals (NCs) by plasmon-coupling them with proximal metal nanostructures. By carefully designing nano-Ag films to match their localized plasmon resonance spectrally with the surface-state emission peak of CdS NCs, we experimentally show that the surface-state emission is substantially enhanced in the visible wavelength, while the interband (band-edge) transition at the shorter wavelength far away from the plasmon resonance is simultaneously significantly suppressed. With such plasmon tuning and consequent strong plasmon coupling specifically for the surface-state transitions, the surface-state emission is made stronger than the band-edge emission. This corresponds to an enhancement factor of 12.7-fold in the ratio of the surface-state peak emission to the band-edge peak emission of the plasmon-coupled film sample compared with that in solution. Such a plasmonic engineering of surface-state emission in trap-rich CdS white nanoluminophors holds great promise for future solid-state lighting.

  6. Selective enhancement of surface-state emission and simultaneous quenching of interband transition in white-luminophor CdS nanocrystals using localized plasmon coupling

    International Nuclear Information System (INIS)

    Ozel, Tuncay; Soganci, Ibrahim Murat; Nizamoglu, Sedat; Huyal, Ilkem Ozge; Mutlugun, Evren; Demir, Hilmi Volkan; Sapra, Sameer; Gaponik, Nikolai; Eychmueller, Alexander

    2008-01-01

    We propose and demonstrate the controlled modification and selective enhancement of surface-state emission in white-luminophor CdS nanocrystals (NCs) by plasmon-coupling them with proximal metal nanostructures. By carefully designing nano-Ag films to match their localized plasmon resonance spectrally with the surface-state emission peak of CdS NCs, we experimentally show that the surface-state emission is substantially enhanced in the visible wavelength, while the interband (band-edge) transition at the shorter wavelength far away from the plasmon resonance is simultaneously significantly suppressed. With such plasmon tuning and consequent strong plasmon coupling specifically for the surface-state transitions, the surface-state emission is made stronger than the band-edge emission. This corresponds to an enhancement factor of 12.7-fold in the ratio of the surface-state peak emission to the band-edge peak emission of the plasmon-coupled film sample compared with that in solution. Such a plasmonic engineering of surface-state emission in trap-rich CdS white nanoluminophors holds great promise for future solid-state lighting

  7. Investigation into CdS nanocrystal growth regularities in silicate glass and in the thin films SiO{sub 2} at the initial stages of solid solution phase decomposi8tion; Issledovanie zakonomernostej rosta nanokristalov CdS v silikatnom stekle i v tonkikh plenkakh SiO{sub 2} na nachal`nykh stadiyakh fazovogo raspada tverdogo rastvora

    Energy Technology Data Exchange (ETDEWEB)

    Gurevich, S A; Ekimov, A I; Kudryavtsev, I A [AN SSSR, Leningrad (Russian Federation). Fiziko-Tekhnicheskij Inst.

    1994-05-01

    Regularities of CdS semiconductor hanocrystal growth in amorphous media (silicate glasses and SiO{sub 2} thin films) are investigated. Dependences of crystal mean dimension on the annealing time show that in accordance with the theory of phase decomposition the crystal growth has the successive stages of nuclei formation and diffusion growth. By means of the nuclei mean radius dependences on the annealing temperature are determined the temperatures of CdS solubility in the matrix material. Effect of the annealing atmosphere composition on the growth and optical properties of CdS nanocrystals is shown.

  8. Mesoporous CdS via Network of Self-Assembled Nanocrystals: Synthesis, Characterization and Enhanced Photoconducting Property.

    Science.gov (United States)

    Patra, Astam K; Banerjee, Biplab; Bhaumik, Asim

    2018-01-01

    Semiconduction nanoparticles are intensively studied due to their huge potential in optoelctronic applications. Here we report an efficient chemical route for hydrothermal synthesis of aggregated mesoporous cadmium sulfide (CdS) nanoparticles using supramolecular-assembly of ionic and water soluble sodium salicylate as the capping agent. The nanostructure, mesophase, optical property and photoconductivity of these mesoporous CdS materials have been characterized by using small and wide angle powder X-ray diffraction (XRD), transmission electron microscopy (TEM), scanning electron microscopy (SEM), N2-sorption, Raman analysis, Fourier transformed infrared (FT-IR), UV-Visible DSR spectroscopy, and photoconductivity measurement. Wide angle XRD pattern and high resolution TEM image analysis suggested that the particle size of the materials is within 10 nm and the nanoparticles are in well-crystallized cubic phase. Mesoporous CdS nanoparticles showed drastically enhanced photoelectrochemical response under visible light irradiation on entrapping a photosensitizer (dye) molecule in the interparticle spaces. Efficient synthesis strategy and the enhanced photo response in the mesoporous CdS material could facilitate the designing of other porous semiconductor oxide/sulfide and their applications in photon-to-electron conversion processes.

  9. Synthesis of CdS flower-like hierarchical microspheres as electrode material for electrochemical performance

    International Nuclear Information System (INIS)

    Kaviyarasu, K.; Manikandan, E.; Maaza, M.

    2015-01-01

    We report in this paper, a facile hydrothermal route for the preparation of CdS nanocrystals at room temperature (RT). Composition, structure and morphology of the products were analyzed and characterized by X-ray diffraction (XRD) confirms that the hydrothermal treatment at 180 °C for periods ranging from 0 to 1440 min caused no significant modification of the long range order structure subjected to hydrothermal treatment. From the XRD analysis the diffraction peaks pertaining to 26.75°, 43.89° and 52.34° are attributed to the (111), (220) and (311) planes of cubic zinc blende structure. The Photoluminescence (PL) spectra are dominated by a strong narrow band edge emission tunable in the blue region of the visible spectra indicating the narrow size distribution of CdS nanocrystals. TEM observation shows that the CdS nanocrystals synthesized by hydrothermal synthesis are well dispersed and the average crystallite size was found to be ∼10 nm. The confocal microscopic studies reveal that each flower like spheres is due to Ostwald's ripening with numerous nanoparticles aggregating a surface. - Highlights: • The adjacent particle coalesces together forming spherical particles. • The average crystalline size of CdS nanoparticles was found to be ∼3 nm. • In the case of spherical crystallite, is given by L = 3/4 D. • The CdS nanocrystal exhibits a direct band gap of 2.4 eV. • The microspheres are dispersed with good monodispersity

  10. Convenient synthesis of magnetically recyclable Fe{sub 3}O{sub 4}@C@CdS photocatalysts by depositing CdS nanocrystals on carbonized ferrocene

    Energy Technology Data Exchange (ETDEWEB)

    Li, Dan [Institute of Physical Chemistry, Zhejiang Normal University, Jinhua, Zhejiang 321004 (China); Xie, Jianjian [Department of Materials Physics, Zhejiang Normal University, Jinhua, Zhejiang 321004 (China); Zhang, Yong; Qiao, Ru [Institute of Physical Chemistry, Zhejiang Normal University, Jinhua, Zhejiang 321004 (China); Li, Sheng [Department of Materials Physics, Zhejiang Normal University, Jinhua, Zhejiang 321004 (China); Li, Zhengquan, E-mail: zqli@zjnu.edu.cn [Institute of Physical Chemistry, Zhejiang Normal University, Jinhua, Zhejiang 321004 (China); Department of Materials Physics, Zhejiang Normal University, Jinhua, Zhejiang 321004 (China)

    2015-10-15

    Development of magnetic visible-light-driven photocatalysts is desirable to the practical application of photocatalyts for collection and recycling use. Here we present a facile approach to synthesize Fe{sub 3}O{sub 4}@C@CdS magnetic photocatalysts which can avoid multi-step preparation process. Through one-step solvothermal carbonization of ferrocene, the produced carbon-coated Fe{sub 3}O{sub 4} clusters can serve as both magnetic cores and deposition substrates for in situ generating crystalline CdS nanocrystals on them by rapid microwave irradiation. The prepared Fe{sub 3}O{sub 4}@C@CdS nanoparticles exhibit a uniform core–shell structure and display good photocatalytic activity and recyclability in the degradation of organic dyes. These magnetic photocatalysts may find potential application in wastewater treatment for the future environment remedy. - Highlights: • A rapid strategy is presented to obtain multifunctional core–shell nanostructures. • Magnetic visible-light-driven Fe{sub 3}O{sub 4}@C@CdS nanophotocatalysts are synthesized. • Carbonized ferrocene can provide both magnetic cores and good deposition substrate. • Photocatalytic and recyclable properties of Fe{sub 3}O{sub 4}@C@CdS nanoparticles are explored.

  11. Phase-Tunable Synthesis of Monodisperse YPO4:Ln3+ (Ln = Ce, Eu, Tb) Micro/Nanocrystals via Topotactic Transformation Route with Multicolor Luminescence Properties.

    Science.gov (United States)

    Shao, Baiqi; Feng, Yang; Zhao, Shuang; Yuan, Senwen; Huo, Jiansheng; Lü, Wei; You, Hongpeng

    2017-06-05

    A novel aqueous-based and phase-selected synthetic strategy toward YPO 4 :Ln 3+ (Ln = Ce, Eu, Tb) micro/nanocrystals was developed by selecting specific precursors whose structure topotactically matches with the target ones. It was found that layered yttrium hydroxide (LYH) induced the formation of hexagonal-phased h-YPO 4 ·0.8H 2 O with the crystalline relationship of [001]LYH//[0001]h-YPO 4 ·0.8H 2 O, while the amorphous Y(OH)CO 3 favored the formation of tetragonal-phased t-YPO 4 . We also systematically investigated the influence of Na 2 CO 3 /NaH 2 PO 4 feeding ratio on the evolutions of morphology and size of the h-YPO 4 ·0.8H 2 O sample, and we also obtained a novel mesoporous nanostructure for t-YPO 4 single crystalline with closed octahedron shape for the first time. Besides, the multicolor and phase-dependent luminescence properties of the as-obtained h-YPO 4 ·0.8H 2 O and t-YPO 4 micro/nanocrystals were also investigated in detail. Our work may provide some new guidance in synthesis of nanocrystals with target phase structure by rational selection of precursor with topotactic structural matching.

  12. Synthesis and study of optical and thermal properties of Mn doped CdS nanoparticles using polyvinylpyrrolidone

    International Nuclear Information System (INIS)

    Rajesh Kumar, M.; Murugadoss, G.

    2014-01-01

    High quality and monodispersed CdS:Mn (1–5%) nanoparticles were synthesized by chemical precipitation method using PVP as surfactant. The structure and morphology of the CdS:Mn were investigated by means of XRD, FT-IR, TEM, UV–visible, PL, EPR and TG-DTA. XRD study was confirmed the formation cubic structured CdS:Mn nanoparticles. The optical absorption of Mn doped CdS nanoparticles was found to be 420–432 nm, which is significantly decreased from the bulk CdS material. Photoluminescence spectroscopy of the CdS:Mn nanocrystals showed a strong emission peak at 535 nm near the band edge along with a week green emission around 575 nm. The PL property of annealed (255 °C–850 °C) samples was also investigated under different excitations. The presence of PVP on the CdS:Mn surface and incorporated the Mn ion into CdS lattice were identified by FT-IR and EPR spectroscopy, respectively. TEM result showed spherical with monodispersed particles with typical size of 3.8–4.3 nm, which is a favorable characteristic for many applications. The major weight loss and gain were found in the thermogravimetric analysis (TGA) which corresponds to the decomposition and oxidation of the samples. -- Highlights: • An optimum concentration of Mn was selected through optical study. • PL emission was improved by addition of capping agent. • The PL enhancement indicates good crystal quality and monodisperse of the synthesized CdS:Mn nanoparticles by chemical method

  13. Independent control of the shape and composition of ionic nanocrystals through sequential cation exchange reactions

    Energy Technology Data Exchange (ETDEWEB)

    Luther, Joseph Matthew; Zheng, Haimei; Sadtler, Bryce; Alivisatos, A. Paul

    2009-07-06

    Size- and shape-controlled nanocrystal growth is intensely researched for applications including electro-optic, catalytic, and medical devices. Chemical transformations such as cation exchange overcome the limitation of traditional colloidal synthesis, where the nanocrystal shape often reflects the inherent symmetry of the underlying lattice. Here we show that nanocrystals, with established synthetic protocols for high monodispersity, can be templates for independent composition control. Specifically, controlled interconversion between wurtzite CdS, chalcocite Cu2S, and rock salt PbS occurs while preserving the anisotropic dimensions unique to the as-synthesized materials. Sequential exchange reactions between the three sulfide compositions are driven by the disparate solubilites of the metal ion exchange pair in specific coordinating molecules. Starting with CdS, highly anisotropic PbS nanorods are created, which serve as an important material for studying strong 2-dimensional quantum confinement, as well as for optoelectronic applications. Furthermore, interesting nanoheterostructures of CdS|PbS are obtained by precise control over ion insertion and removal.

  14. Aging effect of quantum dots on solar cells sensitized with nano-crystals of CdS and PbS

    Directory of Open Access Journals (Sweden)

    V Borhanifar

    2015-01-01

    Full Text Available In this research, solar cells sensitized with CdS and PbS Nanocrystalline metal sulfides, chemically grown by SILAR, were fabricated and characterized. PV experiments including I-V test in the presence of light and dark,Vocdecay, and Electrochemical impedance spectroscopy were performed on the Cells made through this method in the presence of light and dark and in the time period of 2, 3, 6 and 10 days. From these experiments, the changes in indicators including fill factor, efficiency, open-circuit voltage, short-circuit current, lifetime of electrons in nanostructured anode electrode, recombination resistance and capacitance of the anode electrode-electrolyte interface were observed. Also, mechanisms for some existing evidences within photovoltaic experiments such as the increase and decrease of recombination resistance were proposed.

  15. Aqueous synthesis and characterization of bovine hemoglobin-conjugated cadmium sulfide nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Guangrui [Institute of Environmental and Municipal Engineering, North China University of Water Conservancy and Electric Power, Zhengzhou 450011 (China); Qin, Dezhi, E-mail: dezhiqin@163.com [College of Chemistry and Chemical Engineering, Pingdingshan University, Pingdingshan 467000 (China); Du, Xian; Zhang, Li; Zhao, Ganqing; Zhang, Qiuxia; Wu, Jiulin [College of Chemistry and Chemical Engineering, Pingdingshan University, Pingdingshan 467000 (China)

    2014-08-01

    Highlights: • CdS nanocrystals were synthesized by biomimetic method in bovine hemoglobin (BHb) solution. • The study of the interaction between Cd{sup 2+}/CdS and BHb. • The optical properties of BHb-conjugated CdS nanocrystals. • The synthesis process of BHb-conjugated CdS nanocrystals is facile, effective and environment friendly. • The change of secondary structure of BHb after binding to CdS nanocrystals. - Abstract: Cadmium sulfide (CdS) nanocrystals with average diameter about 5.5 nm were synthesized in aqueous solution of bovine hemoglobin (BHb) via simple biomimetic method. Powder X-ray diffraction (XRD), energy dispersive X-ray spectroscopy (EDS), transmission electron microscopy (TEM) and selected area electron diffraction (SAED) characterizations were used to determine the structure and morphology of CdS nanocrystals. It was revealed that amount of BHb, chelating of Cd{sup 2+} to BHb and reaction temperature were key factors in controlling shape and dispersion of CdS nanocrystals. The binding sites of BHb to CdS nanocrystals and the change of secondary structure of protein have been identified by Fourier transform infrared (FT-IR) and circular dichroism (CD) spectroscopy. It was found that conjugating of BHb with Cd{sup 2+} and CdS could protect nanocrystals from agglomerating. Moreover, the thermostability of BHb enhanced after conjugating with CdS nanocrystals. The interaction mechanism of BHb with Cd{sup 2+}/CdS was also proposed. The quantum-confined effect of CdS nanocrystals was confirmed by ultraviolet–visible (UV–vis) spectrum. The nanocrystals exhibited a well-defined photoluminescence (PL) emission feature at about 510 nm with narrow full width at half maximum (FWHM)

  16. The self-assembly of monodisperse nanospheres within microtubes

    International Nuclear Information System (INIS)

    Zheng Yuebing; Juluri, Bala Krishna; Huang, Tony Jun

    2007-01-01

    Self-assembled monodisperse nanospheres within microtubes have been fabricated and characterized. In comparison with colloidal crystals formed on planar substrates, colloidal nanocrystals self-assembled in microtubes demonstrate high spatial symmetry in their optical transmission and reflection properties. The dynamic self-assembly process inside microtubes is investigated by combining temporal- and spatial-spectrophotometric measurements. The understanding of this process is achieved through both experimentally recorded reflection spectra and finite difference time domain (FDTD)-based simulation results

  17. CERN Document Server (CDS): Introduction

    CERN Multimedia

    CERN. Geneva; Costa, Flavio

    2017-01-01

    A short online tutorial introducing the CERN Document Server (CDS). Basic functionality description, the notion of Revisions and the CDS test environment. Links: CDS Production environment CDS Test environment  

  18. Phase- and shape-controlled hydrothermal synthesis of CdS nanoparticles, and oriented attachment growth of its hierarchical architectures

    Science.gov (United States)

    Cao, Yali; Hu, Pengfei; Jia, Dianzeng

    2013-01-01

    Hydrothermal strategies were successfully used to control the phases and morphologies of CdS nanocrystals. In the absence of an external direction-controlling process, the hexagonal and cubic phase well-defined leaf- and flower-like CdS nanocrystals were controlled obtained via adjusting the reaction duration or the concentration of surfactant. Oriented attachment growth modes were suggested for the formation of CdS superstructures, which was clarified through the tracing of temporal evolution of CdS nanoparticles. The CdS superstructures were structured by primary building nanoparticles, and held excellent visible emission with a peak in the green regions. This strategy is very helpful for studying the phase and morphology controlled fabrication of sulfides nanocrystals.

  19. Simple and green synthesis of protein-conjugated CdS nanoparticles and spectroscopic study on the interaction between CdS and zein

    Energy Technology Data Exchange (ETDEWEB)

    Qin, Dezhi, E-mail: dezhiqin@163.com; Zhang, Li; Du, Xian; Wang, Yabo; Zhang, Qiuxia [Pingdingshan University, College of Chemistry and Environmental Engineering (China)

    2016-09-15

    The present study demonstrates the role of zein molecules in synthesizing CdS nanoassemblies through protein-directed, green synthetic approach. Zein molecules can as capping ligand and stabilizing agent to regulate the nucleation and growth of CdS nanocrystals, and the obtained products are organic–inorganic nanocomposites. The analysis of surface charge and conductivity indicates that strong electrostatic force restricts mobility of ions, which creates a local supersaturation surrounding the binding sites of zein and reduces the activated energy of nucleation. The interaction between Cd{sup 2+}/CdS and zein molecules was systematically investigated through spectroscopy techniques. Fourier transform infrared (FT-IR) spectra were used to envisage the binding of the functional groups of zein with the surface of CdS nanoparticles. Ultraviolet visible (UV–Vis) and photoluminescence (PL) spectra results show that Cd{sup 2+}/CdS might interact with the aromatic amino acids of protein molecules and change its chemical microenvironment. The quantum-confined effect of nanocrystals is confirmed by optical absorption spectrum due to the small size (3–5 nm) of CdS particles. The data of circular dichroism (CD) spectra indicate that the formation of CdS nanocrystals could lead to the conformational change of zein molecules. Moreover, the possible mechanism of CdS nanocrystals growth in zein solution was also discussed. The weak interactions such as Van der Waals, hydrophobic forces and hydrogen bonds in zein molecules should play a crucial factor in the self-assembly of small nanoparticles.

  20. Safe Haven CDS Premiums

    DEFF Research Database (Denmark)

    Klingler, Sven; Lando, David

    Credit Default Swaps can be used to lower capital requirements of dealer banks who enter into uncollateralized derivatives positions with sovereigns. We show in a model that the regulatory incentive to obtain capital relief makes CDS contracts valuable to dealer banks and empirically that...... support that CDS contracts are used for capital relief....

  1. Quantum confinement effects on superconducting properties of Lead nanocrystals

    Science.gov (United States)

    Aubin, Herve; Moreira, Helena; Mahler, Benoit; Dubertret, Benoit

    2008-03-01

    We developed a new chemical synthesis method for producing large quantities of monodispersed lead (Pb) nanocrystals. They are obtained from the alcohol reduction of a mixture of two lead carboxylates with alkyl chains of different lengths, dissolved in a high temperature solvent. The nanocrystals obtained are protected from oxydation and aggregation by long chain fatty acids and their diameter can be tuned to reach values as low as 10 nm. Our results suggest that monodispersed particules are obtained when nucleation and growth occur at distincts temperatures, possibly as a consequence of different reactivities of the two lead carboxylates used in the solution. Owing to the large quantities of monodispersed particles produced, thermodynamics studies as function of particles diameter become possible. In particular, we will present a study of the effect of quantum confinement on superconducting properties of these Pb particles through SQUID magnetometry measurements.

  2. CdS nanobubbles and Cd-DMS nanosheets: solvothermal synthesis and formation mechanism.

    Science.gov (United States)

    Feng, Miao; Zhan, Hongbing

    2013-02-01

    CdS nanobubbles and Cd-DMS nanosheets have been prepared by a solvothermal method from a solution of Cd2+ in dimethyl sulfoxide in the absence of elemental S. A formation mechanism for the nanobubble morphology arising during the CdS nanocrystal growth has been proposed, based on the results of transmission electron microscopy and photoluminescence spectrophotometry. The correlation of the morphology with reaction time was also suggested, and may be applicable to the solvothermal synthesis of other nanomaterials.

  3. Building Structural Complexity in Semiconductor Nanocrystals through Chemical Transformations

    Energy Technology Data Exchange (ETDEWEB)

    Sadtler, Bryce F [Univ. of California, Berkeley, CA (United States); Lawrence Berkeley National Lab. (LBNL), Berkeley, CA (United States)

    2009-05-01

    Methods are presented for synthesizing nanocrystal heterostructures comprised of two semiconductor materials epitaxially attached within individual nanostructures. The chemical transformation of cation exchange, where the cations within the lattice of an ionic nanocrystal are replaced with a different metal ion species, is used to alter the chemical composition at specific regions ofa nanocrystal. Partial cation exchange was performed in cadmium sulfide (CdS) nanorods of well-defined size and shape to examine the spatial organization of materials within the resulting nanocrystal heterostructures. The selectivity for cation exchange to take place at different facets of the nanocrystal plays an important role in determining the resulting morphology of the binary heterostructure. The exchange of copper (I) (Cu+) cations in CdS nanorods occurs preferentially at the ends of the nanorods. Theoretical modeling of epitaxial attachments between different facets of CdS and Cu2S indicate that the selectivity for cation exchange at the ends of the nanorods is a result of the low formation energy of the interfaces produced. During silver (I) (Ag+) cation exchange in CdS nanorods, non-selective nucleation of silver sulfide (Ag2S), followed by partial phase segregation leads to significant changes in the spatial arrangement of CdS and Ag2S regions at the exchange reaction proceeds through the nanocrystal. A well-ordered striped pattern of alternating CdS and Ag2S segments is found at intermediate fractions of exchange. The forces mediating this spontaneous process are a combination of Ostwald ripening to reduce the interfacial area along with a strain-induced repulsive interaction between Ag2S segments. To elucidate why Cu+ and Ag+ cation exchange with CdS nanorods produce different morphologies, models for epitaxial attachments between various facets of CdS with Cu2S or

  4. One-pot solvothermal route to self-assembly of cauliflower-shaped CdS microspheres

    Energy Technology Data Exchange (ETDEWEB)

    Ge Ming [Tianjin Key Laboratory of Environmental Remediation and Pollution Control, Nankai University, Tianjin 300071 (China); Cui Yao [Institute of New Energy Material Chemistry, and Key Laboratory of Advanced Energy Materials Chemistry (Ministry of Education), Nankai University, Tianjin 300071 (China); Liu Lu, E-mail: liul@nankai.edu.cn [Tianjin Key Laboratory of Environmental Remediation and Pollution Control, Nankai University, Tianjin 300071 (China); Zhou Zhen, E-mail: zhouzhen@nankai.edu.cn [Institute of New Energy Material Chemistry, and Key Laboratory of Advanced Energy Materials Chemistry (Ministry of Education), Nankai University, Tianjin 300071 (China)

    2011-05-15

    Nearly monodispersed cauliflower-shaped CdS microspheres were prepared through a simple one-step solvothermal route on a large scale by employing sodium dodecyl sulfate (SDS) as the surfactant. Images by field emission scanning electron microscope (FESEM) and transmission electron microscope (TEM) indicate that cauliflower-shaped CdS microspheres with diameters in the range from 1.3 to 4.5 {mu}m are assembled by nanoparticles with an average diameter of approximately 30 nm. The possible formation mechanism of the cauliflower-shaped CdS microspheres was also proposed. The photovoltaic activity of cauliflower-shaped CdS architectures has been investigated, indicating that the as-obtained CdS microspheres exhibited higher photovoltaic performance in comparison with CdS nanoparticles.

  5. Studies on II-VI and III-V semiconductor nanostructures. Introduction of the core/shell/shell structure and development of CdSe nanocrystals in an automatized procedure; Untersuchungen an II-VI und III-V Halbleiternanostrukturen. Einfuehrung der Core/shell/shell-Struktur und Darstellung von CdSe-Nanokristallen in einem automatisierten Verfahren

    Energy Technology Data Exchange (ETDEWEB)

    Mekis, I.

    2005-11-15

    The work in this dissertation is focused on the development and characterization of fluorescent II-VI and III-V-Nanomaterials. Highly luminescent and photostable Nanocrystals with narrow size distributions were prepared. It was shown that nearly monodisperse CdSe-Nanocrystals could be prepared from Cd(Ac){sub 2} and TOPSe in a mixture of TOPO/TOP/HDA/TDPA. Nearly monodisperse CdSe/CdS-Core/shell-Nanocrystals have been prepared in a one-pot-synthesis by injection of H{sub 2}S-Gas into a freshly prepared crude solution of CdSe. The passivation of the CdSe-core with an inorganic shell of CdS resulted in the drastic improvement of the photoluminescence-efficiency of the colloidal solution. Reproducible room-temperature quantum yields reached up to a value of 85%. Photostability investigations have proved the enhanced stability of CdSe/CdS-Nanocrystals compared to CdSe-Nanocrystals under illumination with UV-Light. A novel type of luminescent semiconductor nanocrystal structure has been developed, consisting of a CdSe core and two anorganic shells. Highly fluorescent and nearly monodisperse CdSe/CdS/ZnS- and CdSe/ZnSe/ZnS-Core/shell/shell-nanocrystals have been prepared via organometallic- and acetate-precursors. The Core/she ll/shell particles reached reproducible room-temperature quantum yields up to 85%. Photostability investigations among CdSe-core, CdSe/CdS-Core/shell- and CdSe/CdS/ZnS- Core/shell/-shell-nanocrystals under illumination with UV-light have proved the highest photostability of the Core/shell/shell-particles. The photostabilities of CdSe/ZnSe/ZnS-and CdSe/ZnS-nanocrystals were compared under illumination with intense laser-beam in air. Another part of this work focused on the development of an automated synthesis procedure of CdSe-nanocrystals by constructing and implementing a flow-reactor system. The size and structure of prepared nanocrystals depended considerably on the Cd:Se-precursorratio and the flow-rate. The preparation of CdSe using Cd(Ac)2

  6. Influence of hydrogen peroxide on the stability and optical properties of CdS quantum dots in gelatin

    Energy Technology Data Exchange (ETDEWEB)

    Klyuev, V.G.; Volykhin, D.V., E-mail: volykhin.d@ya.ru; Ivanova, A.A.

    2017-03-15

    Influence of hydrogen peroxide on the stability and optical characteristics of CdS quantum dots obtained by aqueous synthesis in gelatin is investigated. It is shown that the action of hydrogen peroxide on the CdS quantum dots reduces the average particle size, increases monodispersity of particle size distribution, and also increases the photoluminescence intensity. A model that explains the behavior of CdS quantum dots photoluminescence with a decrease of particle size as a result of treatment with hydrogen peroxide is presented.

  7. Clinical Decision Support (CDS) Inventory

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Clinical Decision Support (CDS) Inventory contains descriptions of past and present CDS projects across the Federal Government. It includes Federal projects,...

  8. Synthesis and photovoltaic application of coper (I) sulfide nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Wu, Yue; Wadia, Cyrus; Ma, Wanli; Sadtler, Bryce; Alivisatos, A.Paul

    2008-06-24

    We present the rational synthesis of colloidal copper(I) sulfide nanocrystals and demonstrate their application as an active light absorbing component in combination with CdS nanorods to make a solution-processed solar cell with 1.6percent power conversion efficiency on both conventional glass substrates and flexible plastic substrates with stability over a 4 month testing period.

  9. Aerosol fabrication methods for monodisperse nanoparticles

    Science.gov (United States)

    Jiang, Xingmao; Brinker, C Jeffrey

    2014-10-21

    Exemplary embodiments provide materials and methods for forming monodisperse particles. In one embodiment, the monodisperse particles can be formed by first spraying a nanoparticle-containing dispersion into aerosol droplets and then heating the aerosol droplets in the presence of a shell precursor to form core-shell particles. By removing either the shell layer or the nanoparticle core of the core-shell particles, monodisperse nanoparticles can be formed.

  10. Ultrasonic/surfactant assisted of CdS nano hollow sphere synthesis and characterization

    International Nuclear Information System (INIS)

    Rafati, Amir Abbas; Borujeni, Ahmad Reza Afraz; Najafi, Mojgan; Bagheri, Ahmad

    2011-01-01

    CdS hollow nanospheres with diameters ranging from 40 to 150 nm have been synthesized by a surfactant-assisted sonochemical route. The successful vesicle templating indicates that the outer leaflet of the bilayer is the receptive surface in the controlled growth of CdS nanoparticles which provide the unique reactor for the nucleation and mineralization growth of CdS nanoparticles. The CdS nanostructures obtained were characterized by X-ray diffraction, scanning electron microscopy, transmission electron microscopy, ultraviolet-visible spectroscopy and photoluminescence spectroscopy. Structural characterization of hollow CdS nanospheres indicates that these products packed with square subunits having sizes between 5 and 7 nm in diameter. The formation of the hollow nanostructure was explained by a vesicle template mechanism, in which sonication and surfactant play important roles. The band-edge emission and surface luminescence of the CdS nanoparticles were observed. -Research Highlights: → CdS hollow nanospheres with diameters of 40-150 nm were synthesized. → Nanoparticles were characterized by UV/Vis and photoluminescence. → Nanospheres are composed of smaller nanocrystals with the average size of 6.8 nm. → The band gap energy of the CdS nanoparticles is higher than its bulk value.

  11. Mechanistic aspects of biogenic synthesis of CdS nanoparticles using Bacillus licheniformis

    International Nuclear Information System (INIS)

    Tripathi, R M; Shrivastav, Archana; Bhadwal, Akhshay Singh; Singh, Priti; Singh, M P; Shrivastav, B R

    2014-01-01

    A novel eco-friendly effort has been made for the synthesis of cadmium sulfide (CdS) nanoparticles using bacterial biomass. Although some articles have been reported on CdS nanoparticles synthesis by bacteria, here we have synthesized CdS nanoparticles using non-pathogenic bacteria Bacillus licheniformis MTCC 9555. UV-Vis spectroscopy was carried out to confirm the formation of CdS nanoparticles; the peak occurring at 368 nm gives the indication of synthesis of CdS nanoparticles. The size and morphology of the synthesized CdS nanoparticles were analyzed by transmission electron microscopy (TEM) and the nanoparticles are found to have a narrow size of 5.1 ± 0.5 nm with spherical morphology. Further, the nanoparticles were examined by energy dispersive x-ray (EDX) spectroscopy to identify the presence of elements and confirmed the existence of Cd and S in single nanoparticles. X-ray diffraction (XRD) analysis exhibited 2θ values corresponding to CdS nanocrystals. Fourier transform infrared spectroscopy (FTIR) provides the evidence for the presence of proteins as possible biomolecules responsible for the stabilization of the synthesized CdS nanoparticles. (papers)

  12. Mechanistic aspects of biogenic synthesis of CdS nanoparticles using Bacillus licheniformis

    Science.gov (United States)

    Tripathi, R. M.; Singh Bhadwal, Akhshay; Singh, Priti; Shrivastav, Archana; Singh, M. P.; Shrivastav, B. R.

    2014-06-01

    A novel eco-friendly effort has been made for the synthesis of cadmium sulfide (CdS) nanoparticles using bacterial biomass. Although some articles have been reported on CdS nanoparticles synthesis by bacteria, here we have synthesized CdS nanoparticles using non-pathogenic bacteria Bacillus licheniformis MTCC 9555. UV-Vis spectroscopy was carried out to confirm the formation of CdS nanoparticles; the peak occurring at 368 nm gives the indication of synthesis of CdS nanoparticles. The size and morphology of the synthesized CdS nanoparticles were analyzed by transmission electron microscopy (TEM) and the nanoparticles are found to have a narrow size of 5.1 ± 0.5 nm with spherical morphology. Further, the nanoparticles were examined by energy dispersive x-ray (EDX) spectroscopy to identify the presence of elements and confirmed the existence of Cd and S in single nanoparticles. X-ray diffraction (XRD) analysis exhibited 2θ values corresponding to CdS nanocrystals. Fourier transform infrared spectroscopy (FTIR) provides the evidence for the presence of proteins as possible biomolecules responsible for the stabilization of the synthesized CdS nanoparticles.

  13. Coulomb gap triptych in a periodic array of metal nanocrystals.

    Science.gov (United States)

    Chen, Tianran; Skinner, Brian; Shklovskii, B I

    2012-09-21

    The Coulomb gap in the single-particle density of states (DOS) is a universal consequence of electron-electron interaction in disordered systems with localized electron states. Here we show that in arrays of monodisperse metallic nanocrystals, there is not one but three identical adjacent Coulomb gaps, which together form a structure that we call a "Coulomb gap triptych." We calculate the DOS and the conductivity in two- and three-dimensional arrays using a computer simulation. Unlike in the conventional Coulomb glass models, in nanocrystal arrays the DOS has a fixed width in the limit of large disorder. The Coulomb gap triptych can be studied via tunneling experiments.

  14. Monodisperse selenium-substituted hydroxyapatite: Controllable synthesis and biocompatibility

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Jianpeng [School of Civil Engineering, Xi' an University of Architecture and Technology, Shaanxi 710055 (China); Shaanxi Key Laboratory of Degradable Biomedical Materials, Shaanxi R& D Center of Biomaterials and Fermentation Engineering, School of Chemical and Engineering, Northwest University, Xi' an, 710069 (China); Zheng, Xiaoyan; Li, Hui; Fan, Daidi [Shaanxi Key Laboratory of Degradable Biomedical Materials, Shaanxi R& D Center of Biomaterials and Fermentation Engineering, School of Chemical and Engineering, Northwest University, Xi' an, 710069 (China); Song, Zhanping [School of Civil Engineering, Xi' an University of Architecture and Technology, Shaanxi 710055 (China); Ma, Haixia [Shaanxi Key Laboratory of Degradable Biomedical Materials, Shaanxi R& D Center of Biomaterials and Fermentation Engineering, School of Chemical and Engineering, Northwest University, Xi' an, 710069 (China); Hua, Xiufu, E-mail: hua_xiufu@163.com [Department of Scientific Research and Development, Tsinghua University, Beijing 100084 (China); Hui, Junfeng, E-mail: huijunfeng@126.com [Shaanxi Key Laboratory of Degradable Biomedical Materials, Shaanxi R& D Center of Biomaterials and Fermentation Engineering, School of Chemical and Engineering, Northwest University, Xi' an, 710069 (China)

    2017-04-01

    Hydroxyapatite (HA) is the major inorganic component of natural bone tissue. As an essential trace element, selenium involves in antioxidation and anticancer of human body. So far, ion-doped hydroxyapatites (HAs) are widely investigated owing to their great applications in field of biomaterial, biological labeling. In this paper, series of monodisperse HA doped with SeO{sub 3}{sup 2−} (SeHA) was successfully synthesized based on the liquid–solid–solution (LSS) strategy. The obtained samples were characterized by transmission electron microscopy (TEM), X-ray diffraction (XRD), Fourier-transform infrared spectroscopy (FTIR) and energy-dispersive spectrometer (EDS). The results indicated that the SeO{sub 3}{sup 2−} doping level of the Se/(P + Se) molar ratio of 0– 0.4 can be requisitely controlled, and the morphology of SeHA nanoparticles varied from nanorods to nanoneedles with increasing Se/(P + Se) molar ratio. Significantly, the as-synthesized SeHA nanocrystals exhibit a low cytotoxicity for osteoblastic cells, showing exciting potentials for application in artificial scaffold materials inhibiting of tumor growth in bone. - Highlights: • Series of SeO{sub 3}{sup 2−} doped HA nanorods or/and nanoneedles were successfully synthesized. • The morphology of the HA nanocrystals can be easily controlled by changing the Se/(P + Se) molar ratio. • The as-synthesized SeHA nanocrystals exhibit a low cytotoxicity for osteoblastic cells. • Showing exciting potentials for application in artificial scaffold materials inhibiting of tumor growth in bone.

  15. Monodisperse selenium-substituted hydroxyapatite: Controllable synthesis and biocompatibility

    International Nuclear Information System (INIS)

    Sun, Jianpeng; Zheng, Xiaoyan; Li, Hui; Fan, Daidi; Song, Zhanping; Ma, Haixia; Hua, Xiufu; Hui, Junfeng

    2017-01-01

    Hydroxyapatite (HA) is the major inorganic component of natural bone tissue. As an essential trace element, selenium involves in antioxidation and anticancer of human body. So far, ion-doped hydroxyapatites (HAs) are widely investigated owing to their great applications in field of biomaterial, biological labeling. In this paper, series of monodisperse HA doped with SeO 3 2− (SeHA) was successfully synthesized based on the liquid–solid–solution (LSS) strategy. The obtained samples were characterized by transmission electron microscopy (TEM), X-ray diffraction (XRD), Fourier-transform infrared spectroscopy (FTIR) and energy-dispersive spectrometer (EDS). The results indicated that the SeO 3 2− doping level of the Se/(P + Se) molar ratio of 0– 0.4 can be requisitely controlled, and the morphology of SeHA nanoparticles varied from nanorods to nanoneedles with increasing Se/(P + Se) molar ratio. Significantly, the as-synthesized SeHA nanocrystals exhibit a low cytotoxicity for osteoblastic cells, showing exciting potentials for application in artificial scaffold materials inhibiting of tumor growth in bone. - Highlights: • Series of SeO 3 2− doped HA nanorods or/and nanoneedles were successfully synthesized. • The morphology of the HA nanocrystals can be easily controlled by changing the Se/(P + Se) molar ratio. • The as-synthesized SeHA nanocrystals exhibit a low cytotoxicity for osteoblastic cells. • Showing exciting potentials for application in artificial scaffold materials inhibiting of tumor growth in bone

  16. Highly Selective Synthesis of Catalytically Active Monodisperse Rhodium Nanocubes

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Y.; Grass, M.E.; Kuhn, J.N.; Tao, F.; Habas, S.E.; Huang, W.; Yang, P.; Somorjai, G.A.

    2009-02-21

    Synthesis of monodisperse and shape-controlled colloidal inorganic nanocrystals (NCs) is of increasing scientific interest and technological significance. Recently, shape control of Pt, Pd, Ag, Au, and Rh NCs has been obtained by tuning growth kinetics in various solution-phase approaches, including modified polyol methods, seeded growth by polyol reduction, thermolysis of organometallics, and micelle techniques. Control of reduction kinetics of the noble metal precursors and regulation of the relative growth rates of low-index planes (i.e. {l_brace}100{r_brace} and {l_brace}111{r_brace}) via selective adsorption of selected chemical species are two keys for achieving shape modification of noble metal NCs. One application for noble metal NCs of well-defined shape is in understanding how NC faceting (determines which crystallographic planes are exposed) affects catalytic performance. Rh NCs are used in many catalytic reactions, including hydrogenation, hydroformylation, hydrocarbonylation, and combustion reactions. Shape manipulation of Rh NCs may be important in understanding how faceting on the nanoscale affects catalytic properties, but such control is challenging and there are fewer reports on the shape control of Rh NCs compared to other noble metals. Xia and coworkers obtained Rh multipods exhibiting interesting surface plasmonic properties by a polyol approach. The Somorjai and Tilley groups synthesized crystalline Rh multipods, cubes, horns and cuboctahedra, via polyol seeded growth. Son and colleagues prepared catalytically active monodisperse oleylamine-capped tetrahedral Rh NCs for the hydrogenation of arenes via an organometallic route. More recently, the Somorjai group synthesized sizetunable monodisperse Rh NCs using a one-step polyol technique. In this Communication, we report the highly selective synthesis of catalytically active, monodisperse Rh nanocubes of < 10 nm by a seedless polyol method. In this approach, Br{sup -} ions from trimethyl

  17. Single-Source Molecular Precursor for Synthesis of CdS Nanoparticles and Nanoflowers

    Science.gov (United States)

    Salavati-Niasari, Masoud; Sobhani, Azam

    2012-04-01

    CdS Semiconductor nanostructures were synthesized by using two different methods. Using triphenylphosphine (C18H15P) and oleylamine (C18H37N) as surfactant, CdS semiconductor nanocrystals with a size ranging from 30 to 90 nm can be synthesized by thermal decomposition of precursor [bis(thiosemicarbazide)cadmium(II)]. CdS nanoflowers were synthesized via hydrothermal decomposition of [bis(thiosemicarbazide) cadmium(II)] without any surfactant. X-ray diffraction (XRD) patterns confirm that the resulting samples were a pure hexagonal phase of CdS. The optical property test indicates that the absorption peak of the samples shifts towards short wavelength, and the blue shift phenomenon might be ascribed to the quantum effect.

  18. Structural, optical and photovoltaic properties of P3HT and Mn-doped CdS quantum dots based bulk hetrojunction hybrid layers

    Science.gov (United States)

    Jabeen, Uzma; Adhikari, Tham; Pathak, Dinesh; Shah, Syed Mujtaba; Nunzi, Jean-Michel

    2018-04-01

    Cadmium sulphide (CdS) and Mn-doped CdS nanocrystals were synthesized by co-precipitation method. The nanocrystals were characterized by Fluorescence, Fourier Transformed Infra-red Spectrometer (FTIR), UV-Visible, X-ray diffraction (XRD), X-ray photoelectron spectrometer (XPS), Field Emission Scanning Electron Microscope (FESEM), and High Resolution Transmission Electron Microscope (HRTEM). A considerable blue shift of absorption band with respect to the cadmium sulphide was observed by the Mn concentration (0.5 M) in the doped sample with decreasing the size of nanocrystals. Other reason for this may be Mn doping. Subsequently the band gap was altered from 2.11 to 2.21 eV due to quantum confinement effect. Scanning electron microscope supplemented with EDAX was operated to find grain size and chemical composition of the synthesized nanomaterials. The PL spectrum of Mn-doped CdS nanocrystals displays three PL bands the first one, within the range of 500 nm and the second band at 537 nm, and the third one around 713 nm is labelled red band emission due to attributed to a 4T1→6A1 transition within the 3d shell of divalent manganese. XRD analysis showed that the material was in cubic crystalline state. A comparative study of surfaces of un-doped and metal doped CdS nanocrystals were investigated using X-ray Photoelectron Spectroscopy (XPS). The synthesized nanomaterial in combination with polymer, poly (3-hexyl thiophene) was operated in the construction of photovoltaic cells. The photovoltaic devices with CdS nanocrystals exhibited power conversion efficiency of 0.34% without annealing and 0.38% with annealing. However, the power conversion efficiency was enhanced by a factor of 0.35 without annealing and 0.42 with annealing with corporation of Mn impurity in CdS lattice. Atomic Force Microscopy was employed for morphology and packing behavior of blend of nanocrystals with organic polymer.

  19. CDS User survey

    CERN Multimedia

    CERN Document Service

    2011-01-01

      The CERN Document Server is launching a user survey in order to collect information relative to its search engine, submission interfaces, collaborative features and content organisation. With the view of re-shaping its collections and interfaces and to better integrate with the new INSPIRE platform that serves all HEP literature, CERN Document Server team invites you to take part in the survey. Your input is essential to provide us with useful information before setting up the new service and improve your interactions with CDS. Thanks for participating !  

  20. Ready fabrication of thin-film electrodes from building nanocrystals for micro-supercapacitors.

    Science.gov (United States)

    Chen, Zheng; Weng, Ding; Wang, Xiaolei; Cheng, Yanhua; Wang, Ge; Lu, Yunfeng

    2012-04-18

    Thin-film pseudocapacitor electrodes with ultrafast lithium storage kinetics, high capacitance and excellent cycling stability were fabricated from monodispersed TiO(2) building nanocrystals, providing a novel approach towards next-generation micro-supercapacitor applications. This journal is © The Royal Society of Chemistry 2012

  1. Synthesis of TOPO-capped Nanocrystals of Copper Sulphide from a ...

    African Journals Online (AJOL)

    Nearly mono-dispersed TOPO-capped copper sulphide nanocrystals of ca. 4.5 nm (diameter) have been ... aqueous sols,1 monolayers,2 bilayer lipid membranes,3,4 LB films,5 ... addition of an excess of methanol to the yellow solution a thin.

  2. Synthesis of CdS hollow/solid nanospheres and their chain-structures by membrane technique

    International Nuclear Information System (INIS)

    Duan Shumin; Wu Qingsheng; Jia Runping; Liu Xinbo

    2008-01-01

    CdS hollow/solid nanospheres and their chain-structures were successfully synthesized through supporting liquid membrane (SLM) system with bio-membrane. X-ray powder diffraction (XRD), transmission electron microscopy (TEM), UV-Vis spectroscopy, and photoluminescence (PL) spectroscopy have been used for the characterization of the products. The average diameters of CdS solid/hollow spheres are about 10, 40 nm, respectively. The wall of the hollow spheres is about 5 nm. CdS products are all cubic face-centered structure with the cell constant a = 5.830 A. We also explore the morphology, structure and possible synthesis mechanism. A possible template mechanism has been proposed for the production of the hollow CdS nanocrystals, that is, CdS nanoparticles grow along the non-soakage interface between CHCl3 and reactant solution. During this process, the organic functional groups were crucial to the control of crystal morphologies

  3. Safe-haven CDS Premia

    DEFF Research Database (Denmark)

    Klingler, Sven; Lando, David

    We argue that Credit Default Swap (CDS) premia for safe-haven sovereigns, like Germany and the United States, are driven to a large extent by regulatory requirements under which derivatives dealing banks have an incentive to buy CDS to hedge counterparty credit risk of their counterparties. We...

  4. Preparation of CdS nanoparticels with spin-coating assisted successive ionic layer reaction and their photoelectrochemical properties

    Directory of Open Access Journals (Sweden)

    Bao SUN

    2017-10-01

    Full Text Available In order to settle the problems in the traditional SILAR method for CdS deposition, such as smaller particles and being difficult to enhance the sensitive layers, an improved spin-coating assisted successive ionic layer reaction method (S-SILR substituted for the traditional SILAR method is used to deposit the CdS nanocrystals. The comparison between the improved and traditional methods is studied after depositing the CdS nanocrystals onto the ZnO nanorod arrays with the two approaches. Different analysis methods, SEM, XRD, UV-vis and the transit photocurrent measurement are conducted to characterize the morphologies and structures of the samples, as well as investigating the light absorption properties, and the photoelectric conversion performance of the electrodes. The results indicate that the CdS nanocrystals photosensitive layers could be totally coated onto the ZnO nanorod arrays more easily by the improved S-SILR method; the light absorption properties and the photoelectric conversion performance of the electrodes prepared by the improved S-SILR method are more excellent compared with those electrodes prepared by the traditional SILAR method. The improvement of the CdS deposition method has certain guiding significance in enhancing the operability of the preparation technology and the photovoltaic performance of the solar cells.

  5. Synthesis and spectroscopic properties of silica-dye-semiconductor nanocrystal hybrid particles.

    Science.gov (United States)

    Ren, Ting; Erker, Wolfgang; Basché, Thomas; Schärtl, Wolfgang

    2010-12-07

    We prepared silica-dye-nanocrystal hybrid particles and studied the energy transfer from semiconductor nanocrystals (= donor) to organic dye molecules (= acceptor). Multishell CdSe/CdS/ZnS semiconductor nanocrystals were adsorbed onto monodisperse Stöber silica particles with an outer silica shell of thickness 2-23 nm containing organic dye molecules (Texas Red). The thickness of this dye layer has a strong effect on the energy transfer efficiency, which is explained by the increase in the number of dye molecules homogeneously distributed within the silica shell, in combination with an enhanced surface adsorption of nanocrystals with increasing dye amount. Our conclusions were underlined by comparison of the experimental results with numerically calculated FRET efficiencies and by control experiments confirming attractive interaction between the nanocrystals and Texas Red freely dissolved in solution.

  6. Monodispersed Zinc Oxide Nanoparticle-Dye Dyads and Triads

    Energy Technology Data Exchange (ETDEWEB)

    Gladfelter, Wayne L. [Univ. of Minnesota, Minneapolis, MN (United States). Dept. of Chemistry; Blank, David A. [Univ. of Minnesota, Minneapolis, MN (United States). Dept. of Chemistry; Mann, Kent R. [Univ. of Minnesota, Minneapolis, MN (United States). Dept. of Chemistry

    2017-06-22

    The overall energy conversion efficiency of photovoltaic cells depends on the combined efficiencies of light absorption, charge separation and charge transport. Dye-sensitized solar cells are photovoltaic devices in which a molecular dye absorbs light and uses this energy to initiate charge separation. The most efficient dye-sensitized solar cells (DSSCs) use nanocrystal titanium dioxide films to which are attached ruthenium complexes. Numerous studies have provided valuable insight into the dynamics of these and analogous photosystems, but the lack of site homogeneity in binding dye molecules to metal oxide films and nanocrystals (NCs) is a significant impediment to extracting fundamental details about the electron transfer across the interface. Although zinc oxide is emerging as a potential semiconducting component in DSSCs, there is less known about the factors controlling charge separation across the dye/ZnO interface. Zinc oxide crystallizes in the wurtzite lattice and has a band gap of 3.37 eV. One of the features that makes ZnO especially attractive is the remarkable ability to control the morphology of the films. Using solution deposition processes, one can prepare NCs, nanorods and nanowires having a variety of shapes and dimensions. This project solved problems associated with film heterogeneity through the use of dispersible sensitizer/ZnO NC ensembles. The overarching goal of this research was to study the relationship between structure, energetics and dynamics in a set of synthetically controlled donor-acceptor dyads and triads. These studies provided access to unprecedented understanding of the light absorption and charge transfer steps that lie at the heart of DSSCs, thus enabling significant future advances in cell efficiencies. The approach began with the construction of well-defined dye-NC dyads that were sufficiently dispersible to allow the use of state of the art pulsed laser spectroscopic and kinetic methods to understand the charge transfer

  7. Strasbourg Astronomical Data Center (CDS

    Directory of Open Access Journals (Sweden)

    F Genova

    2013-01-01

    Full Text Available The Centre de Donnees astronomiques de Strasbourg (CDS, created in 1972, has been a pioneer in the dissemination of digital scientific data. Ensuring sustainability for several decades has been a major issue because science and technology evolve continuously and the data flow increases endlessly. The paper briefly describes CDS activities, major services, and its R&D strategy to take advantage of new technologies. The next frontiers for CDS are the new Web 2.0/3.0 paradigm and, at a more general level, global interoperability of astronomical on-line resources in the Virtual Observatory framework.

  8. Synthesis and Characterization of Colloidal Metal and Photovoltaic Semiconductor Nanocrystals

    KAUST Repository

    Abulikemu, Mutalifu

    2014-11-05

    method was used for the in situ synthesis of gold nanoparticles as a model system. Relatively monodisperse gold nanoparticles were produced. The size and shape of gold nanoparticles can be controlled by the gold precursor and surfactant concentration in the ‘ink.’ This approach can be extended to the synthesis of other nanocrystals and is thus a truly impactful process for the low-cost synthesis of materials and devices incorporating nanocrystals.

  9. Silicon Nanocrystal Synthesis in Microplasma Reactor

    Science.gov (United States)

    Nozaki, Tomohiro; Sasaki, Kenji; Ogino, Tomohisa; Asahi, Daisuke; Okazaki, Ken

    Nanocrystalline silicon particles with grains smaller than 5 nm are widely recognized as a key material in optoelectronic devices, lithium battery electrodes, and bio-medical labels. Another important characteristic is that silicon is an environmentally safe material that is used in numerous silicon technologies. To date, several synthesis methods such as sputtering, laser ablation, and plasma-enhanced chemical vapor deposition (PECVD) based on low-pressure silane chemistry (SiH4) have been developed for precise control of size and density distributions of silicon nanocrystals. In this study, we explore the possibility of microplasma technologies for efficient production of mono-dispersed nanocrystalline silicon particles on a micrometer-scale, continuous-flow plasma reactor operated at atmospheric pressure. Mixtures of argon, hydrogen, and silicon tetrachloride were activated using a very-high-frequency (144 MHz) power source in a capillary glass tube with volume of less than 1 μl. Fundamental plasma parameters of the microplasma were characterized using optical emission spectroscopy, which respectively indicated electron density of 1015 cm-3, argon excitation temperature of 5000 K, and rotational temperature of 1500 K. Such high-density non-thermal reactive plasma can decompose silicon tetrachloride into atomic silicon to produce supersaturated silicon vapor, followed by gas-phase nucleation via three-body collision: particle synthesis in high-density plasma media is beneficial for promoting nucleation processes. In addition, further growth of silicon nuclei can be terminated in a short-residence-time reactor. Micro-Raman scattering spectra showed that as-deposited particles are mostly amorphous silicon with a small fraction of silicon nanocrystals. Transmission electron micrography confirmed individual 3-15 nm silicon nanocrystals. Although particles were not mono-dispersed, they were well separated and not coagulated.

  10. Synthesis of Silicon Nanocrystals in Microplasma Reactor

    Science.gov (United States)

    Nozaki, Tomohiro; Sasaki, Kenji; Ogino, Tomohisa; Asahi, Daisuke; Okazaki, Ken

    Nanocrystalline silicon particles with a grain size of at least less than 10 nm are widely recognized as one of the key materials in optoelectronic devices, electrodes of lithium battery, bio-medical labels. There is also important character that silicon is safe material to the environment and easily gets involved in existing silicon technologies. To date, several synthesis methods such as sputtering, laser ablation, and plasma enhanced chemical vapor deposition (PECVD) based on low-pressure silane chemistry (SiH4) have been developed for precise control of size and density distributions of silicon nanocrystals. We explore the possibility of microplasma technologies for the efficient production of mono-dispersed nanocrystalline silicon particles in a micrometer-scale, continuous-flow plasma reactor operated at atmospheric pressure. Mixtures of argon, hydrogen, and silicon tetrachloride were activated using very high frequency (VHF = 144 MHz) power source in a capillary glass tube with a volume of less than 1 μ-liter. Fundamental plasma parameters of VHF capacitively coupled microplasma were characterized by optical emission spectroscopy, showing electron density of approximately 1015 cm-3 and rotational temperature of 1500 K, respectively. Such high-density non-thermal reactive plasma has a capability of decomposing silicon tetrachloride into atomic silicon to produce supersaturated atomic silicon vapor, followed by gas phase nucleation via three-body collision. The particle synthesis in high-density plasma media is beneficial for promoting nucleation process. In addition, further growth of silicon nuclei was able to be favorably terminated in a short-residence time reactor. Micro Raman scattering spectrum showed that as-deposited particles were mostly amorphous silicon with small fraction of silicon nanocrystals. Transmission electron micrograph confirmed individual silicon nanocrystals of 3-15 nm size. Although those particles were not mono-dispersed, they were

  11. Nanocrystal quantum dots

    CERN Document Server

    Klimov, Victor I

    2010-01-01

    ""Soft"" Chemical Synthesis and Manipulation of Semiconductor Nanocrystals, J.A. Hollingsworth and V.I. Klimov Electronic Structure in Semiconductor Nanocrystals: Optical Experiment, D.J. NorrisFine Structure and Polarization Properties of Band-Edge Excitons in Semiconductor Nanocrystals, A.L. EfrosIntraband Spectroscopy and Dynamics of Colloidal Semiconductor Quantum Dots, P. Guyot-Sionnest, M. Shim, and C. WangMultiexciton Phenomena in Semiconductor Nanocrystals, V.I. KlimovOptical Dynamics in Single Semiconductor Quantum Do

  12. Influence of Cetyltrimethylammonium Bromide on Gold Nanocrystal Formation Studied by in Situ Liquid Cell Scanning Transmission Electron Microscopy

    DEFF Research Database (Denmark)

    Canepa, Silvia A.; Sneed, Brian T.; Sun, Hongyu

    2018-01-01

    The synthesis of monodisperse size- and shape-controlled Au nanocrystals is often achieved with cetyltrimethylammonium bromide (CTAB) surfactant; however, its role in the growth of such tailored nanostructures is not well understood. To elucidate the formation mechanism(s) and evolution of the mo...

  13. Chemistry of the Colloidal Group II-VI Nanocrystal Synthesis

    International Nuclear Information System (INIS)

    Liu, Haitao

    2007-01-01

    In the last two decades, the field of nanoscience and nanotechnology has witnessed tremendous advancement in the synthesis and application of group II-VI colloidal nanocrystals. The synthesis based on high temperature decomposition of organometallic precursors has become one of the most successful methods of making group II-VI colloidal nanocrystals. This method is first demonstrated by Bawendi and coworkers in 1993 to prepare cadmium chalcogenide colloidal quantum dots and later extended by others to prepare other group II-VI quantum dots as well as anisotropic shaped colloidal nanocrystals, such as nanorod and tetrapod. This dissertation focuses on the chemistry of this type of nanocrystal synthesis. The synthesis of group II-VI nanocrystals was studied by characterizing the molecular structures of the precursors and products and following their time evolution in the synthesis. Based on these results, a mechanism was proposed to account for the 2 reaction between the precursors that presumably produces monomer for the growth of nanocrystals. Theoretical study based on density functional theory calculations revealed the detailed free energy landscape of the precursor decomposition and monomer formation pathway. Based on the proposed reaction mechanism, a new synthetic method was designed that uses water as a novel reagent to control the diameter and the aspect ratio of CdSe and CdS nanorods

  14. Simple model for the power-law blinking of single semiconductor nanocrystals

    NARCIS (Netherlands)

    Verberk, Rogier; Oijen, Antoine M. van; Orrit, Michel

    2002-01-01

    We assign the blinking of nanocrystals to electron tunneling towards a uniform spatial distribution of traps. This naturally explains the power-law distribution of off times, and the power-law correlation function we measured on uncapped CdS dots. Capped dots, on the other hand, present extended on

  15. Controlled synthesis of thorium and uranium oxide nano-crystals

    International Nuclear Information System (INIS)

    Hudry, Damien; Apostolidis, Christos; Walter, Olaf; Gouder, Thomas; Courtois, Eglantine; Kubel, Christian; Meyer, Daniel

    2013-01-01

    Very little is known about the size and shape effects on the properties of actinide compounds. As a consequence, the controlled synthesis of well-defined actinide-based nano-crystals constitutes a fundamental step before studying their corresponding properties. In this paper, we report on the non-aqueous surfactant-assisted synthesis of thorium and uranium oxide nano-crystals. The final characteristics of thorium and uranium oxide nano-crystals can be easily tuned by controlling a few experimental parameters such as the nature of the actinide precursor and the composition of the organic system (e.g., the chemical nature of the surfactants and their relative concentrations). Additionally, the influence of these parameters on the outcome of the synthesis is highly dependent on the nature of the actinide element (thorium versus uranium). By using optimised experimental conditions, monodisperse isotropic uranium oxide nano-crystals with different sizes (4.5 and 10.7 nm) as well as branched nano-crystals (overall size ca. 5 nm), nano-dots (ca. 4 nm) and nano-rods (with ultra-small diameters of 1 nm) of thorium oxide were synthesised. (authors)

  16. Enriching The Metadata On CDS

    CERN Document Server

    Chhibber, Nalin

    2014-01-01

    The project report revolves around the open source software package called Invenio. It provides the tools for management of digital assets in a repository and drives CERN Document Server. Primary objective is to enhance the existing metadata in CDS with data from other libraries. An implicit part of this task is to manage disambiguation (within incoming data), removal of multiple entries and handle replications between new and existing records. All such elements and their corresponding changes are integrated within Invenio to make the upgraded metadata available on the CDS. Latter part of the report discuss some changes related to the Invenio code-base itself.

  17. An improved pyrolysis route to synthesize carbon-coated CdS quantum dots with fluorescence enhancement effect

    International Nuclear Information System (INIS)

    Zhang Kejie; Liu Xiaoheng

    2011-01-01

    Well-dispersed carbon-coated CdS (CdS-C) quantum dots were successfully prepared via the improved pyrolysis of bis(1-dodecanethiol)-cadmium(II) under nitrogen atmosphere. This simple method effectively solved the sintered problem resulted from conventional pyrolysis process. The experimental results indicated that most of the as-prepared nanoparticles displayed well-defined core-shell structures. The CdS cores with diameter of ∼5 nm exhibited hexagonal crystal phase, the carbon shells with thickness of ∼2 nm acted as a good dispersion medium to prevent CdS particles from aggregation, and together with CdS effectively formed a monodisperse CdS-Carbon nanocomposite. This composite presented a remarkable fluorescence enhancement effect, which indicated that the prepared nanoparticles might be a promising photoresponsive material or biosensor. This improved pyrolysis method might also offer a facile way to prepare other carbon-coated semiconductor nanostructures. - Graphical abstract: We demonstrated a facile approach to synthesize well-dispersed carbon-coated CdS quantum dots. The as-prepared nanoparticles presented remarkable fluorescence enhancement effect. Highlights: → Carbon-coated CdS quantum dots were synthesized by an one-step pyrolysis method. → Well-dispersed CdS-carbon nanoparticles were obtained by an acid treatment process. → As-prepared nanoparticles presented remarkable fluorescence enhancement effect.

  18. СHIRAL RECOGNITION OF CYSTEINE MOLECULES BY CHIRAL CdSe AND CdS QUANTUM DOTS

    Directory of Open Access Journals (Sweden)

    M. V. Mukhina

    2015-11-01

    Full Text Available Here, we report the investigation of mechanism of chiral molecular recognition of cysteine biomolecules by chiral CdSe and CdS semiconductor nanocrystals. To observe chiral recognition process, we prepared enantioenriched ensembles of the nanocrystals capped with achiral ligand. The enantioenriched samples of intrinsically chiral CdSe quantum dots were prepared by separation of initial racemic mixture of the nanocrystals using chiral phase transfer from chloroform to water driven by L- and D-cysteine. Chiral molecules of cysteine and penicillamine were substituted for achiral molecules of dodecanethiol on the surfaces of CdSe and CdS samples, respectively, via reverse phase transfer from water to chloroform. We estimated an efficiency of the hetero- (d-L or l-D and homocomplexes (l-L formation by comparing the extents of corresponding complexing reactions. Using circular dichroism spectroscopy data we show an ability of nanocrystals enantiomers to discriminate between left-handed and right-handed enantiomers of biomolecules via preferential formation of heterocomplexes. Development of approaches for obtaining chiral nanocrystals via chiral phase transfer offers opportunities for investigation of molecular recognition at the nano/bio interfaces.

  19. Luminescent nanocomposites of conducting polymers and in-situ grown CdS quantum dots

    International Nuclear Information System (INIS)

    Borriello, C.; Masala, S.; Nenna, G.; Minarini, C.; Di Luccio, T.; Bizzarro, V.; Re, M.; Pesce, E.

    2010-01-01

    Luminescent PVK:CdS and P3HT:CdS nanocomposites with enhanced electrooptical properties have been synthesized. The nucleation and growth of CdS nanoparticles have been obtained by the thermolysis of a single Cd and S precursor dispersed in the polymers. The size distribution and morphology of the nanoparticles have been studied by TEM analyses. Monodispersive and very small nanoparticles of diameter below 3 nm in PVK and 2 nm in P3HT, have been obtained. The application of such nanocomposites as emitting layers in OLED devices is discussed.

  20. Surface modification-a novel way of attaching cocatalysts on CdS semiconductors for photocatalytic hydrogen evolution

    KAUST Repository

    Yu, Weili

    2014-08-22

    Noble metals as cocatalysts for hydrogen evolution are widely investigated for semiconductor photocatalytic water splitting. In this paper, we present a novel way to attach not only noble metals, but also transitional metals onto CdS nanocrystals as cocatalysts for hydrogen evolution. The hydrogen evolution performances for each metal were compared and result shows that Pd attached CdS gives the highest hydrogen evolution rate of 250 μmol/h. The amounts of metal ions attached on the surface were measured by inductively coupled plasma optical emission spectrometry (ICP-OES). This work confirms that surface modification is a promising way of attaching cocatalysts onto semiconductor photocatalysts.

  1. Surface modification-a novel way of attaching cocatalysts on CdS semiconductors for photocatalytic hydrogen evolution

    KAUST Repository

    Yu, Weili; Isimjan, Tayirjan; Lin, Bin; Takanabe, Kazuhiro

    2014-01-01

    Noble metals as cocatalysts for hydrogen evolution are widely investigated for semiconductor photocatalytic water splitting. In this paper, we present a novel way to attach not only noble metals, but also transitional metals onto CdS nanocrystals as cocatalysts for hydrogen evolution. The hydrogen evolution performances for each metal were compared and result shows that Pd attached CdS gives the highest hydrogen evolution rate of 250 μmol/h. The amounts of metal ions attached on the surface were measured by inductively coupled plasma optical emission spectrometry (ICP-OES). This work confirms that surface modification is a promising way of attaching cocatalysts onto semiconductor photocatalysts.

  2. ORF Sequence: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >gnl|CMER|CME069C hypothetical protein MQSGSSEERVSSHMEARDSAPTASSMPSLRLTATATATATAR...LTYAHVSRPRPPAHLPRSDAYGGSPSASTTSSSTATARPTCAHEAAHPPQVHHLGSGACGGSPSASTTSSSTATARPTCAHEAAHPPQVHHLGSGACDGSPSASTTSSSTATAR...PTCAHEAAHPPQVHRLGSGACGGSPSASTTSSSTATARPTCAHEAAHPPQVHRLGSGACGGSPSASTTSSSTATARPTCAHEADHPPQVHRQGSDVSHINHTTKKLLSLWLLARPTATVKATVKVLRSDARRCGPDLSTTAEQARCNCREQCRSRTHR

  3. ORF Sequence: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available KGSWTFYIMLLASFRIFFGLGLSLSPMESWTIMNVVHAGVTFIVFHWIKGNPFHTPWVDMMGKGEKQTWWEQIDGSVQNTPSRKFLICVVVFLYLAAVHSTPFERQFFFVHAVNLIAFLVVFVAKLPFMHGVRIFGINR ... cds gnl|CMER >gnl|CMER|CMQ020C hypothetical protein, conserved MQSGHGETRFDVGVEWLRA

  4. Optimal Financing with CDS Markets

    NARCIS (Netherlands)

    Matta, R.

    2013-01-01

    One could argue that CDSs improve risk sharing, hence credit supply and financing terms for firms. Accordingly, one would expect risky borrowers to benefit the most from CDS insurance. This is in contrast, however, with recent empirical evidence (Ashcraft and Santos (2009) and Hirtle (2009)). This

  5. Nuclear magnetic relaxation studies of semiconductor nanocrystals and solids

    Energy Technology Data Exchange (ETDEWEB)

    Sachleben, Joseph Robert [Lawrence Berkeley Lab., CA (United States); California Univ., Berkeley, CA (United States). Dept. of Chemistry

    1993-09-01

    Semiconductor nanocrystals, small biomolecules, and 13C enriched solids were studied through the relaxation in NMR spectra. Surface structure of semiconductor nanocrystals (CdS) was deduced from high resolution 1H and 13C liquid state spectra of thiophenol ligands on the nanocrystal surfaces. The surface coverage by thiophenol was found to be low, being 5.6 and 26% for nanocrystal radii of 11.8 and 19.2 Å. Internal motion is estimated to be slow with a correlation time > 10-8 s-1. The surface thiophenol ligands react to form a dithiophenol when the nanocrystals were subjected to O2 and ultraviolet. A method for measuring 14N-1H J-couplings is demonstrated on pyridine and the peptide oxytocin; selective 2D T1 and T2 experiments are presented for measuring relaxation times in crowded spectra with overlapping peaks in 1D, but relaxation effects interfere. Possibility of carbon-carbon cross relaxation in 13C enriched solids is demonstrated by experiments on zinc acetate and L-alanine.

  6. Microwave Synthesis of Nearly Monodisperse Core/Multishell Quantum Dots with Cell Imaging Applications

    Directory of Open Access Journals (Sweden)

    Xu Hengyi

    2010-01-01

    Full Text Available Abstract We report in this article the microwave synthesis of relatively monodisperse, highly crystalline CdSe quantum dots (QDs overcoated with Cd0.5Zn0.5S/ZnS multishells. The as-prepared QDs exhibited narrow photoluminescence bandwidth as the consequence of homogeneous size distribution and uniform crystallinity, which was confirmed by transmission electron microscopy. A high photoluminescence quantum yield up to 80% was measured for the core/multishell nanocrystals. Finally, the resulting CdSe/Cd0.5Zn0.5S/ZnS core/multishell QDs have been successfully applied to the labeling and imaging of breast cancer cells (SK-BR3.

  7. Structural and optical characterization of CdS nanorods synthesized by a PVA-assisted solvothermal method

    International Nuclear Information System (INIS)

    Wang Hongmei; Fang Pengfei; Chen Zhe; Wang Shaojie

    2008-01-01

    Cadmium sulphide (CdS) 1D nanocrystals were prepared using a simple poly(vinyl-alcohol) (PVA)-assisted solvothermal method which employed ethylenediamine (en) as solvent. The obtained nanorods were characterized by X-ray diffraction (XRD), transmission electron microscopy (TEM), high-resolution transmission electron microscopy (HRTEM), ultraviolet-visible (UV-vis) absorption, and photoluminescence (PL) spectra. XRD results show that the nanorods are hexagonal phase. The TEM results indicate that the synthesized CdS nanorods with PVA-assisted showed larger aspect ratio and uniform faces compared with the sample prepared in the absence of PVA. The results of the photoluminescence and UV-vis spectroscopy measurements reveal that the as-prepared CdS nanorods show a quantum confinement effect. It is also found that the dosage of PVA is a vital factor in the morphology and optical properties of CdS nanorods. Moreover, when the best dosage of 3 g PVA/70 ml en was used, CdS nanorods with regular morphology and longer length were obtained. The probable mechanism for PVA-assisted solvothermal synthesis of CdS nanorods was also discussed

  8. In situ generated CdS nanostructure induced enhanced photoluminescence from Dy{sup 3+} ions doped dielectric nanocomposites

    Energy Technology Data Exchange (ETDEWEB)

    Dey, Chirantan; Karmakar, Basudeb [Glass Science and Technology Section, Glass Division, CSIR-Central Glass and Ceramic Research Institute, Kolkata (India)

    2017-08-15

    We report CdS nanostructure induced enhanced photoluminescence (PL) from Dy{sup +3}:CdS co-doped dielectric-nanocomposites synthesized by the conventional melt-quench technique. CdS nanocrystals (NCs) were synthesized as in situ within the dielectric medium and their growth was controlled by heat treatment duration. Nanoparticles were investigated with absorption spectroscopy, X-ray diffraction (XRD), transmission electron microscopy (TEM), field emission scanning electron microscopy (FESEM), and Raman spectroscopy. The experimentally obtained sizes of the NCs are found to increase from 5-11 nm to 50-80 nm. Bandgap enhancement for the carrier confinement was found to alter within the range of 0.20-0.38 eV. Phonon confinement effect has been confirmed by blue shifting of Raman peak for CdS NCs at 303 cm{sup -1}. Enhanced highly intense sharp PL peak at 576 nm was detected, and different parameters associated with the PL enhancement including energy transfer from CdS NCs to Dy{sup 3+} ions have been studied. This PL enhancement was steered by varying CdS NC sizes. Enhanced PL of these nanocomposites finds their potential applications as gain medium in the field of solid state lasers. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  9. Enhanced photocatalytic hydrogen evolution from in situ formation of few-layered MoS2/CdS nanosheet-based van der Waals heterostructures.

    Science.gov (United States)

    Iqbal, Shahid; Pan, Ziwei; Zhou, Kebin

    2017-05-25

    Here we report for the first time that the H 2 bubbles generated by photocatalytic water splitting are effective in the layer-by-layer exfoliation of MoS 2 nanocrystals (NCs) into few layers. The as-obtained few layers can be in situ assembled with CdS nanosheets (NSs) into van der Waals heterostructures (vdWHs) of few-layered MoS 2 /CdS NSs which, in turn, are effective in charge separation and transfer, leading to enhanced photocatalytic H 2 production activity. The few-layered MoS 2 /CdS vdWHs exhibited a H 2 evolution rate of 140 mmol g (CdS) -1 h -1 and achieved an apparent quantum yield of 66% at 420 nm.

  10. Production of Monodisperse Nanoparticles and Application of Discrete-Monodisperse Model in Plasma Reactors

    International Nuclear Information System (INIS)

    Kim, Dong-Joo; Kim, Kyo-Seon; Zhao, Qian-Qiu

    2003-01-01

    The particle growth in plasma reactor were investigated by using the discrete-monodisperse (D-M) model for various process conditions. The monodisperse large sized particle distribution predicted by the D-M model are in good agreement with the large sized particles by the discrete-sectional model and also in the experiments by Shiratani et al. (1996). Some fractions of the small size particles are in a neutral state or even charged positively, but most of the large sized monodisperse particles are charged negatively. As the mass generation rate of monomers increases, the large sized particles grow more quickly and the production rate of nanoparticles of 100nm by plasma reactor increases. As the initial electron concentration or the monomer diameter increases, it takes longer time for the large sized particles to grow up to 100nm, but the large sized particle concentration of 100nm increases and the resulting production rate of large sized particles of 100nm increases. As the residence time increases, the time for the large sized particles to grow up to 100nm decreases and the large sized particle concentration of 100nm increases and, as a result, the production rate of large sized particles of 100nm increases. We propose that the plasma reactor can be a good candidate to produce monodisperse nanoparticles

  11. Progress in Preparation of Monodisperse Polymer Microspheres

    Science.gov (United States)

    Zhang, Hongyan

    2017-12-01

    The monodisperse crosslinked polymer microspheres have attracted much attention because of their superior thermal and solvent resistance, mechanical strength, surface activity and adsorption properties. They are of wide prospects for using in many fields such as biomedicine, electronic science, information technology, analytical chemistry, standard measurement and environment protection etc. Functional polymer microspheres prepared by different methods have the outstanding surface property, quantum size effect and good potential future in applications with its designable structure, controlled size and large ratio of surface to volume. Scholars of all over the world have focused on this hot topic. The preparation method and research progress in functional polymer microspheres are addressed in the paper.

  12. A configurable CDS for the production laboratory

    CERN Document Server

    Meek, Irish

    2003-01-01

    Various aspects of a configurable chromatography data system (CDS) for the production laboratory are discussed. The Atlas CDS can be configured extensively to fit the production laboratory work flow and meet the needs of analysts. The CDS can also be configured to automatically create a sample sequence with the required number of injections and download methods to the dedicated instrument. The Atlas Quick Start wizard offers uses quick way of generating a sequence from a predefined template and starting a run. (Edited abstract).

  13. Size-tunable phosphorescence in colloidal metastable gamma-Ga2O3 nanocrystals.

    Science.gov (United States)

    Wang, Ting; Farvid, Shokouh S; Abulikemu, Mutalifu; Radovanovic, Pavle V

    2010-07-14

    We report a colloidal synthesis of gallium oxide (Ga(2)O(3)) nanocrystals having metastable cubic crystal structure (gamma phase) and uniform size distribution. Using the synthesized nanocrystal size series we demonstrate for the first time a size-tunable photoluminescence in Ga(2)O(3) from ultraviolet to blue, with the emission shifting to lower energies with increasing nanocrystal size. The observed photoluminescence is dominated by defect-based donor-acceptor pair recombination and has a lifetime of several milliseconds. Importantly, the decay of this phosphorescence is also size dependent. The phosphorescence energy and the decay rate increase with decreasing nanocrystal size, owing to a reduced donor-acceptor separation. These results allow for a rational and predictable tuning of the optical properties of this technologically important material and demonstrate the possibility of manipulating the localized defect interactions via nanocrystal size. Furthermore, the same defect states, particularly donors, are also implicated in electrical conductivity rendering monodispersed Ga(2)O(3) nanocrystals a promising material for multifunctional optoelectronic structures and devices.

  14. Simultaneous control of nanocrystal size and nanocrystal ...

    Indian Academy of Sciences (India)

    applications such as a photo-sensor [11]. Thus, it is desirable to have, not only a control on the size of the nanocrystals, but also an independent tunability of the ... 1-thioglycerol) in 25 ml methanol under inert atmosphere. 10 ml of 0.2 M sodium sulfide solution is then added to the reaction mixture dropwise and the reaction.

  15. Elongational viscosity of monodisperse and bidisperse polystyrene melts

    DEFF Research Database (Denmark)

    Nielsen, Jens Kromann; Rasmussen, Henrik K.; Hassager, Ole

    2006-01-01

    The start-up and steady uniaxial elongational viscosity have been measured for two monodisperse polystyrene melts with molecular weights of 52 and 103 kg/mole, and for three bidisperse polystyrene melts. The monodisperse melts show a maximum in the steady elongational viscosity vs. the elongational...

  16. The Generation And Properties Of Solid Monodisperse Aerosols Of ...

    African Journals Online (AJOL)

    A monodisperse aerosol generator (MAGE) was used to generate calibration or monodisperse aerosols containing stearic acid and carnauba wax. Some of the factors affecting the size of aerosol particles generated with the MAGE were determined. The factors include: temperature of operation of the MAGE, type and purity ...

  17. Eco-friendly intracellular biosynthesis of CdS quantum dots without changing Escherichia coli's antibiotic resistance.

    Science.gov (United States)

    Yan, Zheng-Yu; Du, Qing-Qing; Qian, Jing; Wan, Dong-Yu; Wu, Sheng-Mei

    2017-01-01

    In the paper, a green and efficient biosynthetical technique was reported for preparing cadmium sulfide (CdS) quantum dots, in which Escherichia coli (E. coli) was chosen as a biomatrix. Fluorescence emission spectra and fluorescent microscopic photographs revealed that as-produced CdS quantum dots had an optimum fluorescence emission peak located at 470nm and emitted a blue-green fluorescence under ultraviolet excitation. After extracted from bacterial cells and located the nanocrystals' foci in vivo, the CdS quantum dots showed a uniform size distribution by transmission electron microscope. Through the systematical investigation of the biosynthetic conditions, including culture medium replacement, input time point of cadmium source, working concentrations of raw inorganic ions, and co-cultured time spans of bacteria and metal ions in the bio-manufacture, the results revealed that CdS quantum dots with the strongest fluorescence emission were successfully prepared when E. coli cells were in stationary phase, with the replacement of culture medium and following the incubation with 1.0×10 -3 mol/L cadmium source for 2 days. Results of antimicrobial susceptibility testing indicated that the sensitivities to eight types of antibiotics of E. coli were barely changed before and after CdS quantum dots were prepared in the mild temperature environment, though a slight fall of antibiotic resistance could be observed, suggesting hinted the proposed technique of producing quantum dots is a promising environmentally low-risk protocol. Copyright © 2016 Elsevier Inc. All rights reserved.

  18. Nanocrystals Technology for Pharmaceutical Science.

    Science.gov (United States)

    Cheng, Zhongyao; Lian, Yumei; Kamal, Zul; Ma, Xin; Chen, Jianjun; Zhou, Xinbo; Su, Jing; Qiu, Mingfeng

    2018-05-17

    Nanocrystals technology is a promising method for improving the dissolution rate and enhancing the bioavailability of poorly soluble drugs. In recent years, it has been developing rapidly and applied to drug research and engineering. Nanocrystal drugs can be formulated into various dosage forms. This review mainly focused on the nanocrystals technology and its application in pharmaceutical science. Firstly, different preparation methods of nanocrystal technology and the characterization of nanocrystal drugs are briefly described. Secondly, the application of nanocrystals technology in pharmaceutical science is mainly discussed followed by the introduction of sustained release formulations. Then, the scaling up process, marketed nanocrystal drug products and regulatory aspects about nanodrugs are summarized. Finally, the specific challenges and opportunities of nanocrystals technology for pharmaceutical science are summarized and discussed. This review will provide a comprehensive guide for scientists and engineers in the field of pharmaceutical science and biochemical engineering. Copyright© Bentham Science Publishers; For any queries, please email at epub@benthamscience.org.

  19. Logarithmic Exchange Kinetics in Monodisperse Copolymeric Micelles

    Science.gov (United States)

    García Daza, Fabián A.; Bonet Avalos, Josep; Mackie, Allan D.

    2017-06-01

    Experimental measurements of the relaxation kinetics of copolymeric surfactant exchange for micellar systems unexpectedly show a peculiar logarithmic decay. Several authors use polydispersity as an explanation for this behavior. However, in coarse-grained simulations that preserve microscopic details of the surfactants, we find evidence of the same logarithmic behavior. Since we use a strictly monodisperse distribution of chain lengths such a relaxation process cannot be attributed to polydispersity, but has to be caused by an inherent physical process characteristic of this type of system. This is supported by the fact that the decay is specifically logarithmic and not a power law with an exponent inherited from the particular polydispersity distribution of the sample. We suggest that the degeneracy of the energy states of the hydrophobic block in the core, which is broken on leaving the micelle, can qualitatively explain the broad distribution of energy barriers, which gives rise to the observed nonexponential relaxation.

  20. Synthesis and characterization of monodispersed silver nanoparticles

    Science.gov (United States)

    Jegatha Christy, A.; Umadevi, M.

    2012-09-01

    Synthesis of silver nanoparticles (NPs) has become a fascinating and important field of applied chemical research. In this paper silver NPs were prepared using silver nitrate (AgNO3), gelatin, and cetyl trimethyl ammonium bromide (CTAB). The prepared silver NPs were exposed under the laser ablation. In our photochemical procedure, gelatin acts as a biopolymer and CTAB acts as a reducing agent. The appearance of surface plasmon band around 410 nm indicates the formation of silver NPs. The nature of the prepared silver NPs in the face-centered cubic (fcc) structure are confirmed by the peaks in the x-ray diffraction (XRD) pattern corresponding to (111), (200), (220) and (311) planes. Monodispersed, stable, spherical silver NPs with diameter about 10 nm were obtained and confirmed by high-resolution transmission electron microscope (HRTEM).

  1. Synthesis and characterization of monodispersed silver nanoparticles

    International Nuclear Information System (INIS)

    Christy, A Jegatha; Umadevi, M

    2012-01-01

    Synthesis of silver nanoparticles (NPs) has become a fascinating and important field of applied chemical research. In this paper silver NPs were prepared using silver nitrate (AgNO 3 ), gelatin, and cetyl trimethyl ammonium bromide (CTAB). The prepared silver NPs were exposed under the laser ablation. In our photochemical procedure, gelatin acts as a biopolymer and CTAB acts as a reducing agent. The appearance of surface plasmon band around 410 nm indicates the formation of silver NPs. The nature of the prepared silver NPs in the face-centered cubic (fcc) structure are confirmed by the peaks in the x-ray diffraction (XRD) pattern corresponding to (111), (200), (220) and (311) planes. Monodispersed, stable, spherical silver NPs with diameter about 10 nm were obtained and confirmed by high-resolution transmission electron microscope (HRTEM). (paper)

  2. Synthesis of optimized indium phosphide/zinc sulfide core/shell nanocrystals and titanium dioxide nanotubes for quantum dot sensitized solar cells

    Science.gov (United States)

    Lee, Seungyong

    Synthesis of InP/ZnS core/shell nanocrystals and TiO 2 nanotubes and the optimization study to couple them together were explored for quantum dot sensitized solar cells. Its intrinsic nontoxicity makes the direct band gap InP/ZnS core/shell be one of the most promising semiconductor nanocrystals for optoelectric applications, with the advantage of tuning the optical absorption range in the desired solar spectrum region. Highly luminescent and monodisperse InP/ZnS nanocrystals were synthesized in a non-coordinating solvent. By varying the synthesis scheme, different size InP/ZnS nanocrystals with emission peaks ranging from 520 nm to 620 nm were grown. For the purpose of ensuring air stability, a ZnS shell was grown. The ZnS shell improves the chemical stability in terms of oxidation prevention. Transmission electron microscopy (TEM) image shows that the nanocrystals are highly crystalline and monodisperse. Free-standing TiO2 nanotubes were produced by an anodization method using ammonium fluoride. The free-standing nanotubes were formed under the condition that the chemical dissolution speed associated with fluoride concentration was faster than the speed of Ti oxidation. Highly ordered free-standing anatase form TiO2 nanotubes, which are transformed by annealing at the optimized temperature, are expected to be ideal for coupling with the prepared InP/ZnS nanocrystals. Electrophoretic deposition was carried out to couple the InP/ZnS nanocrystals with the TiO2 nanotubes. Under the adjusted applied voltage condition, the current during the electrophoretic deposition decreased continuously with time. The amount of the deposited nanocrystals was estimated by calculation and the evenly deposited nanocrystals on the TiO2 nanotubes were observed by TEM.

  3. Tuning light emission of PbS nanocrystals from infrared to visible range by cation exchange

    KAUST Repository

    Binetti, Enrico

    2015-10-27

    Colloidal semiconductor nanocrystals, with intense and sharp-line emission between red and near-infrared spectral regions, are of great interest for optoelectronic and bio-imaging applications. The growth of an inorganic passivation layer on nanocrystal surfaces is a common strategy to improve their chemical and optical stability and their photoluminescence quantum yield. In particular, cation exchange is a suitable approach for shell growth at the expense of the nanocrystal core size. Here, the cation exchange process is used to promote the formation of a CdS passivation layer on the surface of very small PbS nanocrystals (2.3 nm in diameter), blue shifting their optical spectra and yielding luminescent and stable nanostructures emitting in the range of 700–850 nm. Structural, morphological and compositional investigation confirms the nanocrystal size contraction after the cation-exchange process, while the PbS rock-salt crystalline phase is retained. Absorption and photoluminescence spectroscopy demonstrate the growth of a passivation layer with a decrease of the PbS core size, as inferred by the blue-shift of the excitonic peaks. The surface passivation strongly increases the photoluminescence intensity and the excited state lifetime. In addition, the nanocrystals reveal increased stability against oxidation over time. Thanks to their absorption and emission spectral range and the slow recombination dynamics, such highly luminescent nano-objects can find interesting applications in sensitized photovoltaic cells and light-emitting devices.

  4. Tuning light emission of PbS nanocrystals from infrared to visible range by cation exchange

    KAUST Repository

    Binetti, Enrico; Striccoli, Marinella; Sibillano, Teresa; Giannini, Cinzia; Brescia, Rosaria; Falqui, Andrea; Comparelli, Roberto; Corricelli, Michela; Tommasi, Raffaele; Agostiano, Angela; Curri, M Lucia

    2015-01-01

    Colloidal semiconductor nanocrystals, with intense and sharp-line emission between red and near-infrared spectral regions, are of great interest for optoelectronic and bio-imaging applications. The growth of an inorganic passivation layer on nanocrystal surfaces is a common strategy to improve their chemical and optical stability and their photoluminescence quantum yield. In particular, cation exchange is a suitable approach for shell growth at the expense of the nanocrystal core size. Here, the cation exchange process is used to promote the formation of a CdS passivation layer on the surface of very small PbS nanocrystals (2.3 nm in diameter), blue shifting their optical spectra and yielding luminescent and stable nanostructures emitting in the range of 700–850 nm. Structural, morphological and compositional investigation confirms the nanocrystal size contraction after the cation-exchange process, while the PbS rock-salt crystalline phase is retained. Absorption and photoluminescence spectroscopy demonstrate the growth of a passivation layer with a decrease of the PbS core size, as inferred by the blue-shift of the excitonic peaks. The surface passivation strongly increases the photoluminescence intensity and the excited state lifetime. In addition, the nanocrystals reveal increased stability against oxidation over time. Thanks to their absorption and emission spectral range and the slow recombination dynamics, such highly luminescent nano-objects can find interesting applications in sensitized photovoltaic cells and light-emitting devices.

  5. Nanocrystal Solar Cells

    Energy Technology Data Exchange (ETDEWEB)

    Gur, Ilan [Univ. of California, Berkeley, CA (United States)

    2006-01-01

    This dissertation presents the results of a research agenda aimed at improving integration and stability in nanocrystal-based solar cells through advances in active materials and device architectures. The introduction of 3-dimensional nanocrystals illustrates the potential for improving transport and percolation in hybrid solar cells and enables novel fabrication methods for optimizing integration in these systems. Fabricating cells by sequential deposition allows for solution-based assembly of hybrid composites with controlled and well-characterized dispersion and electrode contact. Hyperbranched nanocrystals emerge as a nearly ideal building block for hybrid cells, allowing the controlled morphologies targeted by templated approaches to be achieved in an easily fabricated solution-cast device. In addition to offering practical benefits to device processing, these approaches offer fundamental insight into the operation of hybrid solar cells, shedding light on key phenomena such as the roles of electrode-contact and percolation behavior in these cells. Finally, all-inorganic nanocrystal solar cells are presented as a wholly new cell concept, illustrating that donor-acceptor charge transfer and directed carrier diffusion can be utilized in a system with no organic components, and that nanocrystals may act as building blocks for efficient, stable, and low-cost thin-film solar cells.

  6. Dynamic Modeling of CDS Index Tranche Spreads

    DEFF Research Database (Denmark)

    Dorn, Jochen

    This paper provides a Market Model which implies a dynamics for standardized CDS index tranche spreads, i.e. tranches which securitise CDS index series and dispose of predefined subordination. This model is useful for pricing options on tranches with future Issue Dates as well as for modeling...... options on structured credit derivatives. With the upcoming regulation of the CDS market in perspective, the model presented here is also an attempt to face the effects on pricing approaches provoked by an eventual Clearing Chamber . It becomes also possible to calibrate Index Tranche Options with bespoke...... tenors/tranche subordination to market data obtained by more liquid Index Tranche Options with standard characteristics....

  7. Silica-modified monodisperse hexagonal lanthanide nanocrystals: synthesis and biological properties

    Czech Academy of Sciences Publication Activity Database

    Kostiv, Uliana; Janoušková, Olga; Šlouf, Miroslav; Kotov, Nikolay; Engstová, Hana; Smolková, Katarína; Ježek, Petr; Horák, Daniel

    2015-01-01

    Roč. 7, č. 43 (2015), s. 18096-18104 ISSN 2040-3364 R&D Projects: GA ČR(CZ) GA15-01897S Institutional support: RVO:61389013 ; RVO:67985823 Keywords : upconverting * nanoparticles * lanthanide Subject RIV: CD - Macromolecular Chemistry; FD - Oncology ; Hematology (FGU-C) Impact factor: 7.760, year: 2015

  8. What do we know about speculation in the CDS market?

    NARCIS (Netherlands)

    L. Norden (Lars); K. Radoeva (Kristina)

    2012-01-01

    textabstractWe measure speculation in the CDS market and investigate its determinants. The CDS volume on a firm that exceeds its outstanding debt (= naked CDS) indicates speculation since hedging can be ruled out. Using weekly CDS trading volume data for actively traded U.S. firms during 2008-2012,

  9. Characterization of a monodispersed aerosol exposure system for beagle dogs

    International Nuclear Information System (INIS)

    Cannon, W.C.; Herring, J.P.; Craig, D.K.

    1978-01-01

    A monodispersed aerosol exposure system for dogs is described and data are presented on aerosol depositions in the exposure system which could affect the aerosol presented to the animals by reducing the concentration and changing the particle size distribution

  10. A general approach for monodisperse colloidal perovskites, Chemistry of Materials

    NARCIS (Netherlands)

    Demirors, A.F.; Imhof, A.

    2009-01-01

    We describe a novel general method for synthesizing monodisperse colloidal perovskite particles at room temperature by postsynthesis addition of metal hydroxides to amorphous titania colloids. In previous work, we used titania particles to synthesize homogenously mixed silica-titania composite

  11. Biotemplated preparation of CdS nanoparticles/bacterial cellulose hybrid nanofibers for photocatalysis application

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Jiazhi; Yu, Junwei [Key Laboratory of Soft Chemistry and Functional Materials (Ministry of Education), Nanjing University of Science and Technology, Nanjing 210094 (China); Fan, Jun [School of Environment, Nanjing University, Nanjing 210093 (China); Sun, Dongping [Key Laboratory of Soft Chemistry and Functional Materials (Ministry of Education), Nanjing University of Science and Technology, Nanjing 210094 (China); Tang, Weihua [Key Laboratory of Soft Chemistry and Functional Materials (Ministry of Education), Nanjing University of Science and Technology, Nanjing 210094 (China); Yang, Xuejie [Key Laboratory of Soft Chemistry and Functional Materials (Ministry of Education), Nanjing University of Science and Technology, Nanjing 210094 (China)

    2011-05-15

    In this work, we describe a novel facile and effective strategy to prepare micrometer-long hybrid nanofibers by deposition of CdS nanoparticles onto the substrate of hydrated bacterial cellulose nanofibers (BCF). Hexagonal phase CdS nanocrystals were achieved via a simple hydrothermal reaction between CdCl{sub 2} and thiourea at relatively low temperature. The prepared pristine BCF and the CdS/BCF hybrid nanofibers were characterized by transmission electron microscopy (TEM), X-ray diffraction (XRD), thermogravimetric analysis (TGA), UV-vis absorption spectroscopy (UV-vis), and X-ray photoelectron spectroscopy (XPS). The results reveal that the CdS nanoparticles were homogeneously deposited on the BCF surface and stabilized via coordination effect. The CdS/BCF hybrid nanofibers demonstrated high-efficiency photocatalysis with 82% methyl orange (MO) degradation after 90 min irradiation and good recyclability. The results indicate that the CdS/BCF hybrid nanofibers are promising candidate as robust visible light responsive photocatalysts.

  12. Biotemplated preparation of CdS nanoparticles/bacterial cellulose hybrid nanofibers for photocatalysis application

    International Nuclear Information System (INIS)

    Yang, Jiazhi; Yu, Junwei; Fan, Jun; Sun, Dongping; Tang, Weihua; Yang, Xuejie

    2011-01-01

    In this work, we describe a novel facile and effective strategy to prepare micrometer-long hybrid nanofibers by deposition of CdS nanoparticles onto the substrate of hydrated bacterial cellulose nanofibers (BCF). Hexagonal phase CdS nanocrystals were achieved via a simple hydrothermal reaction between CdCl 2 and thiourea at relatively low temperature. The prepared pristine BCF and the CdS/BCF hybrid nanofibers were characterized by transmission electron microscopy (TEM), X-ray diffraction (XRD), thermogravimetric analysis (TGA), UV-vis absorption spectroscopy (UV-vis), and X-ray photoelectron spectroscopy (XPS). The results reveal that the CdS nanoparticles were homogeneously deposited on the BCF surface and stabilized via coordination effect. The CdS/BCF hybrid nanofibers demonstrated high-efficiency photocatalysis with 82% methyl orange (MO) degradation after 90 min irradiation and good recyclability. The results indicate that the CdS/BCF hybrid nanofibers are promising candidate as robust visible light responsive photocatalysts.

  13. Biotemplated preparation of CdS nanoparticles/bacterial cellulose hybrid nanofibers for photocatalysis application.

    Science.gov (United States)

    Yang, Jiazhi; Yu, Junwei; Fan, Jun; Sun, Dongping; Tang, Weihua; Yang, Xuejie

    2011-05-15

    In this work, we describe a novel facile and effective strategy to prepare micrometer-long hybrid nanofibers by deposition of CdS nanoparticles onto the substrate of hydrated bacterial cellulose nanofibers (BCF). Hexagonal phase CdS nanocrystals were achieved via a simple hydrothermal reaction between CdCl(2) and thiourea at relatively low temperature. The prepared pristine BCF and the CdS/BCF hybrid nanofibers were characterized by transmission electron microscopy (TEM), X-ray diffraction (XRD), thermogravimetric analysis (TGA), UV-vis absorption spectroscopy (UV-vis), and X-ray photoelectron spectroscopy (XPS). The results reveal that the CdS nanoparticles were homogeneously deposited on the BCF surface and stabilized via coordination effect. The CdS/BCF hybrid nanofibers demonstrated high-efficiency photocatalysis with 82% methyl orange (MO) degradation after 90 min irradiation and good recyclability. The results indicate that the CdS/BCF hybrid nanofibers are promising candidate as robust visible light responsive photocatalysts. Copyright © 2011 Elsevier B.V. All rights reserved.

  14. HDR-Clinical Data Service (CDS)

    Data.gov (United States)

    Department of Veterans Affairs — CDS is a SOAP/REST web service interface that supports Create, Retrieve, Update, and Delete (CRUD) operations against HDR data stores over secure Hypertext Transfer...

  15. Improving the Formatting Tools of CDS Invenio

    CERN Document Server

    Caffaro, J; Pu Faltings, Pearl

    2006-01-01

    CDS Invenio is the web-based integrated digital library system developed at CERN. It is a strategical tool that supports the archival and open dissemination of documents produced by CERN researchers. This paper reports on my Master’s thesis work done on BibFormat, a module in CDS Invenio, which formats documents metadata. The goal of this project was to implement a completely new formatting module for CDS Invenio. In this report a strong emphasis is put on the user-centered design of the new BibFormat. The bibliographic formatting process and its requirements are discussed. The task analysis and its resulting interaction model are detailed. The document also shows the implemented user interface of BibFormat and gives the results of the user evaluation of this interface. Finally the results of a small usability study of the formats included in CDS Invenio are discussed.

  16. Evolvement of soft templates in surfactant/cosurfactant system for shape control of ZnSe nanocrystals

    International Nuclear Information System (INIS)

    Hou Bo; Liu Yongjun; Li Yanjuan; Yuan Bo; Jia Mingfen; Jiang Fengzhi

    2012-01-01

    Highlights: ► Soft templates were found in the shape control synthesis of ZnSe nanocrystals. ► Micelle formation model in the soft templates system was proposed and proved. ► Different shapes of ZnSe nanocrystals were prepared and explained by proposed model. - Abstract: The evolution of soft templates in the synthesis of ZnSe nanocrystals realized through a surfactant/cosurfactant system was investigated and a micelle formation process model was proposed. Through freeze-fracture electron microscopy, it was proven that template micelles were formed in the zinc precursors. Furthermore, it was found that a long stirring period was essential for achieving the lowest energy state of the soft templates which were used for synthesizing monodisperse ZnSe quantum dots.

  17. Evolvement of soft templates in surfactant/cosurfactant system for shape control of ZnSe nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Hou Bo [Key Laboratory of Medicinal Chemistry for Natural Resource, Ministry of Education, School of Chemical Science and Technology, Yunnan University, Kunming 650091 (China); Liu Yongjun [Advanced Analysis and Measurement Center, Yunnan University, Kunming 650091 (China); Li Yanjuan [Key Laboratory of Medicinal Chemistry for Natural Resource, Ministry of Education, School of Chemical Science and Technology, Yunnan University, Kunming 650091 (China); Yuan Bo [Advanced Analysis and Measurement Center, Yunnan University, Kunming 650091 (China); Jia Mingfen [Key Laboratory of Medicinal Chemistry for Natural Resource, Ministry of Education, School of Chemical Science and Technology, Yunnan University, Kunming 650091 (China); Jiang Fengzhi, E-mail: fengzhij@ynu.edu.cn [Key Laboratory of Medicinal Chemistry for Natural Resource, Ministry of Education, School of Chemical Science and Technology, Yunnan University, Kunming 650091 (China); Advanced Analysis and Measurement Center, Yunnan University, Kunming 650091 (China)

    2012-03-25

    Highlights: Black-Right-Pointing-Pointer Soft templates were found in the shape control synthesis of ZnSe nanocrystals. Black-Right-Pointing-Pointer Micelle formation model in the soft templates system was proposed and proved. Black-Right-Pointing-Pointer Different shapes of ZnSe nanocrystals were prepared and explained by proposed model. - Abstract: The evolution of soft templates in the synthesis of ZnSe nanocrystals realized through a surfactant/cosurfactant system was investigated and a micelle formation process model was proposed. Through freeze-fracture electron microscopy, it was proven that template micelles were formed in the zinc precursors. Furthermore, it was found that a long stirring period was essential for achieving the lowest energy state of the soft templates which were used for synthesizing monodisperse ZnSe quantum dots.

  18. Evidence of ferromagnetism in Zn1-xMxO (M = Ni,Cu) nanocrystals for spintronics

    International Nuclear Information System (INIS)

    Perales-Perez, O; Parra-Palomino, A; Singhal, R; Voyles, P M; Zhu, Y; Jia, W; Tomar, M S

    2007-01-01

    We present the conditions for room-temperature synthesis of bare, Ni-and Cu-doped ZnO nanocrystals in ethanol and their characterization. The formation of a ZnO host structure was delayed when dopant ions co-existed in the starting solutions. After ageing in mother liquors, well-crystallized doped nanocrystals were produced. Monodispersity of the nanocrystals (5-8 nm) was shown by high resolution transmission electron microscopy (HRTEM). Ultraviolet-visible (UV-vis) and photoluminescence (PL) measurements also confirmed the nanocrystalline nature and the continuous growth of the crystals when aged at room temperature. Room-temperature SQUID measurements showed weak but noticeable ferromagnetism, which was dependent on synthesis conditions

  19. Chemistry of the Colloidal Group II-VI Nanocrystal Synthesis

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Haitao [Univ. of California, Berkeley, CA (United States)

    2007-05-17

    In the last two decades, the field of nanoscience andnanotechnology has witnessed tremendous advancement in the synthesis andapplication of group II-VI colloidal nanocrystals. The synthesis based onhigh temperature decomposition of organometallic precursors has becomeone of the most successful methods of making group II-VI colloidalnanocrystals. This methodis first demonstrated by Bawendi and coworkersin 1993 to prepare cadmium chalcogenide colloidal quantum dots and laterextended by others to prepare other group II-VI quantum dots as well asanisotropic shaped colloidal nanocrystals, such as nanorod and tetrapod.This dissertation focuses on the chemistry of this type of nanocrystalsynthesis. The synthesis of group II-VI nanocrystals was studied bycharacterizing the molecular structures of the precursors and productsand following their time evolution in the synthesis. Based on theseresults, a mechanism was proposed to account for the 2 reaction betweenthe precursors that presumably produces monomer for the growth ofnanocrystals. Theoretical study based on density functional theorycalculations revealed the detailed free energy landscape of the precursordecomposition and monomerformation pathway. Based on the proposedreaction mechanism, a new synthetic method was designed that uses wateras a novel reagent to control the diameter and the aspect ratio of CdSeand CdS nanorods.

  20. Large-scale, rapid synthesis and application in surface-enhanced Raman spectroscopy of sub-micrometer polyhedral gold nanocrystals

    International Nuclear Information System (INIS)

    Guo Shaojun; Wang Yuling; Wang Erkang

    2007-01-01

    Macromolecule-protected sub-micrometer polyhedral gold nanocrystals have been facilely prepared by heating an aqueous solution containing poly (N-vinyl-2-pyrrolidone) (PVP) and HAuCl 4 without adding other reducing agents. Scanning electron microscopy (SEM), energy-dispersive x-ray spectroscopy (EDX), ultraviolet-visible-near-infrared spectroscopy (UV-vis-NIR), and x-ray diffraction (XRD) were employed to characterize the obtained polyhedral gold nanocrystals. It is found that the 10:1 molar ratio of PVP to gold is a key factor for obtaining quasi-monodisperse polyhedral gold nanocrystals. Furthermore, the application of polyhedral gold nanocrystals in surface-enhanced Raman scattering (SERS) was investigated by using 4-aminothiophenol (4-ATP) as a probe molecule. The results indicated that the sub-micrometer polyhedral gold nanocrystals modified on the ITO substrate exhibited higher SERS activity compared to the traditional gold nanoparticle modified film. The enhancement factor (EF) on polyhedral gold nanocrystals was about six times larger than that obtained on aggregated gold nanoparticles (∼25 nm)

  1. Effect of Gd{sup 3+} doping and reaction temperature on structural and optical properties of CdS nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Pandey, Gajanan, E-mail: pandeygajanan@rediffmail.com [Department of Applied Chemistry, Babasaheb Bhimrao Ambedkar University, Lucknow, 226025, (U.P.) (India); Dixit, Supriya; Shrivastava, A.K. [School of Studies in Physics, Jiwaji University, Gwalior, 474011, (M.P.) (India)

    2015-10-15

    Graphical abstract: - Highlights: • Cd{sub 1−x}Gd{sub x}S nanoparticles have been prepared in aqueous medium in presence of CTAB. • From XRD, EDX and ICP-OES study, successful doping of Gd{sup 3+} in CdS has been proved. • Gd{sup 3+} doping reduced size of NCs, while temperature increased size and altered shape. • Gd{sup 3+} doping and reaction temperature influenced the optical properties of NCs. - Abstract: CdS and Gd{sup 3+} ions doped CdS nanoparticles have been prepared at two reaction temperatures 90 and 120 °C in aqueous medium in presence of cationic surfactant cetyltrimethylammonium bromide. X-ray diffraction study revealed predominant formation of zinc blend CdS and Gd:CdS at 90 °C, while at 120 °C, phase pure wurtzite CdS and Gd:CdS were formed. From EDX spectra and ICP-OES analysis, successful doping of Gd{sup 3+} ions in CdS host has been proved. Fourier transform infrared spectroscopy results show the interaction of CTAB through headgroup at the nanoparticles surface. In the transmission electron microscopy images, it has been observed that the reaction temperature and Gd{sup 3+} doping played critical role on size and shape of nanocrystals. In UV–visible absorption as well as photoluminescence emission spectra, size and shape-dependent quantum confinement effect has been observed. On Gd{sup 3+} doping, surface states related emission peak shifted to higher wavelength, while intensity of peaks increased on increasing temperature.

  2. Optical properties and ensemble characteristics of size purified Silicon nanocrystals

    Science.gov (United States)

    Miller, Joseph Bradley

    molecular weight, phase separation can be supressed; we use this to build a prototype nanocomposite printing device. Finally, the nanocrystals are PEGylated and introduced into an aqueous biological environment to demonstrate their potential for use in biological labelling and sensing devices. The development of superlattice structures from monodisperse SiNC fractions and their use in solid-state lighting and solar cell applications are also explored.

  3. Sorting fluorescent nanocrystals with DNA

    Energy Technology Data Exchange (ETDEWEB)

    Gerion, Daniele; Parak, Wolfgang J.; Williams, Shara C.; Zanchet, Daniela; Micheel, Christine M.; Alivisatos, A. Paul

    2001-12-10

    Semiconductor nanocrystals with narrow and tunable fluorescence are covalently linked to oligonucleotides. These biocompounds retain the properties of both nanocrystals and DNA. Therefore, different sequences of DNA can be coded with nanocrystals and still preserve their ability to hybridize to their complements. We report the case where four different sequences of DNA are linked to four nanocrystal samples having different colors of emission in the range of 530-640 nm. When the DNA-nanocrystal conjugates are mixed together, it is possible to sort each type of nanoparticle using hybridization on a defined micrometer -size surface containing the complementary oligonucleotide. Detection of sorting requires only a single excitation source and an epifluorescence microscope. The possibility of directing fluorescent nanocrystals towards specific biological targets and detecting them, combined with their superior photo-stability compared to organic dyes, opens the way to improved biolabeling experiments, such as gene mapping on a nanometer scale or multicolor microarray analysis.

  4. A comparative study on CdS: PEO and CdS: PMMA nanocomposite solid films

    International Nuclear Information System (INIS)

    Padmaja, S.; Jayakumar, S.; Balaji, R.; Vaideki, K.

    2016-01-01

    Cadmium Sulphide (CdS) nanoparticles were reinforced in Poly(ethylene Oxide) (PEO) and Poly(methyl methacrylate) (PMMA) matrices by in situ technique. The presence of CdS in PEO and PMMA matrix was confirmed using X-ray photoelectron spectroscopy (XPS). Fourier Transform Infrared spectroscopy (FTIR) analysis disclosed the co-ordination of CdS in the matrices. Thermal analysis of the nanocomposites was carried out using Differential Scanning calorimetric studies (DSC). The optical studies using UV–vis spectroscopy were carried out to find the band gap of the materials and the absorption onset. The CdS particle size in the matrices was found by Effective Mass Approximation (EMA) model using the band gap values and was confirmed by TEM studies. The surface trapped emissions of the nanocomposites were observed from the photoluminescence (PL) spectra. The distribution of CdS particles in the polymer matrices were presented by Atomic force microscopic studies (AFM).

  5. A comparative study on CdS: PEO and CdS: PMMA nanocomposite solid films

    Energy Technology Data Exchange (ETDEWEB)

    Padmaja, S. [Thin film centre, PSG College of Technology, Coimbatore (India); Jayakumar, S., E-mail: s_jayakumar_99@yahoo.com [Department of Physics, PSG Institute of Technology and Applied Research, Coimbatore (India); Balaji, R.; Vaideki, K. [Thin film centre, PSG College of Technology, Coimbatore (India)

    2016-08-15

    Cadmium Sulphide (CdS) nanoparticles were reinforced in Poly(ethylene Oxide) (PEO) and Poly(methyl methacrylate) (PMMA) matrices by in situ technique. The presence of CdS in PEO and PMMA matrix was confirmed using X-ray photoelectron spectroscopy (XPS). Fourier Transform Infrared spectroscopy (FTIR) analysis disclosed the co-ordination of CdS in the matrices. Thermal analysis of the nanocomposites was carried out using Differential Scanning calorimetric studies (DSC). The optical studies using UV–vis spectroscopy were carried out to find the band gap of the materials and the absorption onset. The CdS particle size in the matrices was found by Effective Mass Approximation (EMA) model using the band gap values and was confirmed by TEM studies. The surface trapped emissions of the nanocomposites were observed from the photoluminescence (PL) spectra. The distribution of CdS particles in the polymer matrices were presented by Atomic force microscopic studies (AFM).

  6. Nanocrystal synthesis and thin film formation for earth abundant photovoltaics

    Science.gov (United States)

    Carter, Nathaniel J.

    Providing access to on-demand energy at the global scale is a grand challenge of our time. The fabrication of solar cells from nanocrystal inks comprising earth abundant elements represents a scalable and sustainable photovoltaic technology with the potential to meet the global demand for electricity. Solar cells with Cu2ZnSn(S,Se)4 (CZTSSe) absorber layers are of particular interest due to the high absorption coefficient of CZTSSe, its band gap in the ideal range for efficient photovoltaic power conversion, and the relative abundance of its constituent elements in the earth's crust. Despite the promise of this material system, CZTSSe solar cell efficiencies reported throughout literature have failed to exceed 12.6%, principally due to the low open-circuit voltage (VOC) achieved in these devices compared to the absorber band gap. The work presented herein primarily aims to address the low VOC problem. First, the fundamental cause for such low VOC's is investigated. Interparticle compositional inhomogeneities identified in the synthesized CZTS nanocrystals and their effect on the absorber layer formation and device performance are characterized. Real-time energy-dispersive x-ray diffraction (EDXRD) elucidates the role of these inhomogeneities in the mechanism by which a film of CZTS nanocrystals converts into a dense absorber layer comprising micron-sized CZTSSe grains upon annealing in a selenium atmosphere (selenization). Additionally, a direct correlation between the nanocrystal inhomogeneities and the VOC in completed devices is observed. Detailed characterization of CZTSSe solar cells identifies electrical potential fluctuations in the CZTSSe absorber - due to spatial composition variations not unlike those observed in the nanocrystals - as a primary V OC inhibitor. Additional causes for low VOC's in CZTSSe solar cells proposed in the literature involve recombination at the interface between the CZTSSe absorber and: (1) the n-type, CdS buffer layer, or (2) the

  7. Synthesis, characterization and magnetic properties of highly monodispersed PtNi nanoparticles

    International Nuclear Information System (INIS)

    Du, Juan-Juan; Yang, Yi; Zhang, Rong-Hua; Zhou, Xin-Wen

    2015-01-01

    In this paper, we report the controlled-synthesis of PtNi nanoparticles through galvanic displacement reaction and chemical reduction. The size, composition and morphology of the products are characterized by transmission electron microscopy (TEM), powder X-ray diffraction (XRD), energy dispersed X-ray spectroscopy (EDS) and X-ray photoelectron spectroscopy (XPS) analyses. The structure and composition of the PtNi nanoparticles can be controlled by adjusting the synthetic conditions. The possible formation mechanism is obtained from the academic analysis and experimental studies. The results of the magnetic measurement illustrate that the PtNi nanoparticles show a superparamagnetic behavior with a blocking temperature (T B ) about 8.0 K. - Highlights: • Highly monodispersed PtNi nanoparticles were synthesized by galvanic displacement reaction. • The formation of Pt nanocrystals was the foremost step because of its self-catalysis effect. • The PtNi nanoparticles show a superparamagnetic behavior with a T B about 8.0 K

  8. Optical properties of monodispersive FePt nanoparticle films

    Energy Technology Data Exchange (ETDEWEB)

    Lee, S.J.; Lo, C.C.H. [Ames Laboratory, Iowa State University, Ames, IA 50011 (United States); Yu, A.C.C. [Sony Corporation, Sendai Technology Center, 3-4-1 Sakuragi, Miyagi 985-0842 (Japan); Fan, M. [Center for Sustainable Environmental Technologies, Iowa State University, Ames, IA 50011 (United States)

    2004-10-01

    The optical properties of monodispersive FePt nanoparticle films were investigated using spectroscopic ellipsometry in the energy range of 1.5 to 5.5 eV. The monodispersive FePt nanoparticle film was stabilized on a Si substrate by means of an organosilane coupling film, resulting in the formation of a (Si/SiO{sub 2}/APTS/FePt nanoparticles monolayer) structure. Multilayer optical models were employed to study the contribution of the FePt nanoparticles to the measured optical properties of the monodispersive FePt nanoparticle film, and to estimate the optical properties of the FePt nanoparticle layer. (copyright 2004 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  9. A fast bottom-up route for preparing CdS quantum dots using laser ablation in a liquid environment

    Energy Technology Data Exchange (ETDEWEB)

    Mendonça, Leonardo T.B; Azevedo, Walter M. de, E-mail: wma@ufpe.br

    2016-03-15

    In this paper bright, water-dispersible and very stable CdS quantum dots (QDs) emitting from 400 to 700 nm with a narrow size distribution were synthesized in aqueous medium using a combination of the laser ablation technique and the action of thioglycerol as a catalyst for the hydrolysis of thiosulfate and as a stabilizing agent for the nanoparticles. In this case, instead of using a conventional, highly toxic sulfur source like H{sub 2}S, the decomposition of thiosulfate catalyzed by thioglycerol is used to produce S{sup 2−} ions that interact with Cd{sup 2+} ions produced by the ablation of a Cd foil by the second order light of a pulsed Nd:YAG laser. The ejected Cd{sup 2+} ions react with S{sup 2−} to form CdS quantum dots. Spectroscopic, X-ray and TEM measurement analysis showed that 2.75 nm monodisperse CdS QDots were synthesized and exhibited bright photoluminescence in the yellow-orange region of the spectra when excited with 355 nm with a quantum yield of 3.25%.

  10. Patterning nanocrystals using DNA

    Energy Technology Data Exchange (ETDEWEB)

    Williams, Shara Carol [Univ. of California, Berkeley, CA (United States)

    2003-01-01

    One of the goals of nanotechnology is to enable programmed self-assembly of patterns made of various materials with nanometer-sized control. This dissertation describes the results of experiments templating arrangements of gold and semiconductor nanocrystals using 2'-deoxyribonucleic acid (DNA). Previously, simple DNA-templated linear arrangements of two and three nanocrystals structures have been made.[1] Here, we have sought to assemble larger and more complex nanostructures. Gold-DNA conjugates with 50 to 100 bases self-assembled into planned arrangements using strands of DNA containing complementary base sequences. We used two methods to increase the complexity of the arrangements: using branched synthetic doublers within the DNA covalent backbone to create discrete nanocrystal groupings, and incorporating the nanocrystals into a previously developed DNA lattice structure [2][3] that self-assembles from tiles made of DNA double-crossover molecules to create ordered nanoparticle arrays. In the first project, the introduction of a covalently-branched synthetic doubler reagent into the backbone of DNA strands created a branched DNA ''trimer.'' This DNA trimer templated various structures that contained groupings of three and four gold nanoparticles, giving promising, but inconclusive transmission electron microscopy (TEM) results. Due to the presence of a variety of possible structures in the reaction mixtures, and due to the difficulty of isolating the desired structures, the TEM and gel electrophoresis results for larger structures having four particles, and for structures containing both 5 and 10 nm gold nanoparticles were inconclusive. Better results may come from using optical detection methods, or from improved sample preparation. In the second project, we worked toward making two-dimensional ordered arrays of nanocrystals. We replicated and improved upon previous results for making DNA lattices, increasing the size of the lattices

  11. Synthesis and characterization of ZnSe:Fe/ZnSe core/shell nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Yang, Lin; Zhu, Jianguo, E-mail: yanglin_1028@163.com; Xiao, Dingquan

    2014-04-15

    High-quality ZnSe:Fe/ZnSe core/shell nanocrystals were prepared via a hydrothermal microemulsion technique. Effective surface passivation of monodisperse ZnSe:Fe nanocrystals is achieved by overcoating them with a ZnSe shell. The samples were characterized by means of XRD, EDX, TEM, PSD, XPS, photoluminescence, and Raman spectrum. The results show that the as-synthesized nanocrystals are cubic zinc blende ZnSe structure with high purity and the average particle size of ZnSe:Fe/ZnSe core/shell nanocrystal is larger than that of ZnSe:Fe core. The growth of ZnSe shell causes a small red shift in PL spectra, and then the PL quantum yield (QY) increases from 16% before shell growth to the maximum of 37% after increasing shell thickness up to 1.2 monolayers (ML). Moreover, both transverse optic (TO) and longitudinal optic (LO) phonon modes of ZnSe are shifted toward lower frequency as compared with the reported ones. -- Highlights: • ZnSe:Fe/ZnSe core/shell QDs were prepared by a hydrothermal microemulsion method. • ZnSe shell efficiently passivates surface defects by serving as a physical barrier. • The particle size and PL properties can be turned with the growth of ZnSe shell. • The luminescence efficiency and stability of QDs could be improved in this manner.

  12. Method of synthesizing pyrite nanocrystals

    Science.gov (United States)

    Wadia, Cyrus; Wu, Yue

    2013-04-23

    A method of synthesizing pyrite nanocrystals is disclosed which in one embodiment includes forming a solution of iron (III) diethyl dithiophosphate and tetra-alkyl-ammonium halide in water. The solution is heated under pressure. Pyrite nanocrystal particles are then recovered from the solution.

  13. Nanocrystal/sol-gel nanocomposites

    Science.gov (United States)

    Petruska, Melissa A [Los Alamos, NM; Klimov, Victor L [Los Alamos, NM

    2007-06-05

    The present invention is directed to solid composites including colloidal nanocrystals within a sol-gel host or matrix and to processes of forming such solid composites. The present invention is further directed to alcohol soluble colloidal nanocrystals useful in formation of sol-gel based solid composites.

  14. Excitons in semiconducting quantum filaments of CdS and CdSe with dielectric barriers

    CERN Document Server

    Dneprovskij, V S; Shalygina, O A; Lyaskovskij, V L; Mulyarov, E A; Gavrilov, S A; Masumoto, I

    2002-01-01

    The peculiarities of the luminescence spectra obtained by different polarization and intensity of the pumping excitation and luminescence kinetics of the CdS and CdSe nanocrystals are explained by the exciton transitions in the semiconducting quantum threads with dielectric barriers. The exciton transition energies correspond to the calculated ones with an account of both their dimensional quantization and the effect of the excitons dielectric intensification. It is shown that the excitons transition energies do not change by the change in the quantum threads diameter within the wide range, while the increase in the one-dimensional forbidden zone width of quantum thread by the decrease in its diameter is compensated through the decrease in the excitons binding energy

  15. ORF Alignment: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >1g8pA 7 306 385 684 6e-05 ... emb|CAD25272.1| DNA REPLICATION LICENSING... FACTOR MCM2 [Encephalitozoon cuniculi ... GB-M1] ref|NP_584768.1| DNA REPLICATION LICENSING FACTOR ...

  16. ORF Alignment: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >1wfiA 3 125 209 328 1e-34 ... ref|NP_705268.1| nuclear movement protein..., putative [Plasmodium falciparum 3D7] ... emb|CAD52505.1| nuclear movement protein, putative ...

  17. ORF Alignment: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >1a320 1 85 35 119 3e-17 ... gb|AAK39926.1| plastidal 30S ribosomal prot...ein S15 [Guillardia theta] pir||G90099 ... plastidal 30S ribosomal protein S15 [imported] - ... ... ... Guillardia theta nucleomorph ref|NP_113370.1| plastidal ... 30S ribosomal protein S15 [Guillardia t

  18. ORF Alignment: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >1e79I 1 47 1 47 1e-07 ... pdb|1E79|I Chain I, Bovine F1-Atpase Inhibite...d By Dccd ... (Dicyclohexylcarbodiimide) pdb|1H8E|I Chain I, ... (Adp.Alf4)2(Adp.So4) Bovine F1-Atpase

  19. Arabidopsis CDS blastp result: AK068433 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK068433 J013156D16 At1g20620.2 catalase 3 (SEN2) almost identical to catalase 3 SP...:Q42547, GI:3123188 from [Arabidopsis thaliana]; identical to catalase 3 (SEN2) mRNA, partial cds GI:3158369 1e-63 ...

  20. ORF Alignment: cds [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available cds gnl|CMER >1sg6B 30 343 72 371 7e-54 ... dbj|BAD07382.1| putative 2-epi-5-epi-valiolone synthase [Actinopla...nes sp. A40644] ... Length = 300 ... Query: 89 ... SRRFCVVDDSVWAIYGEKLKAYFDERNIASK

  1. Segmented block copolymers with monodisperse aramide end-segments

    NARCIS (Netherlands)

    Araichimani, A.; Gaymans, R.J.

    2008-01-01

    Segmented block copolymers were synthesized using monodisperse diaramide (TT) as hard segments and PTMO with a molecular weight of 2 900 g · mol-1 as soft segments. The aramide: PTMO segment ratio was increased from 1:1 to 2:1 thereby changing the structure from a high molecular weight multi-block

  2. FeNi{sub 3} alloy nanocrystals grown on graphene: Controllable synthesis, in-depth characterization and enhanced electromagnetic performance

    Energy Technology Data Exchange (ETDEWEB)

    Ma, Teng; Yuan, Mengwei [Beijing Key Laboratory of Energy Conversion and Storage Materials and College of Chemistry, Beijing Normal University, Beijing 100875 (China); Islam, Saiful M. [Department of Chemistry, Northwestern University, 2145 Sheridan Road, Evanston, IL 60208 (United States); Li, Huifeng [Beijing Key Laboratory of Energy Conversion and Storage Materials and College of Chemistry, Beijing Normal University, Beijing 100875 (China); Ma, Shulan, E-mail: mashulan@bnu.edu.cn [Beijing Key Laboratory of Energy Conversion and Storage Materials and College of Chemistry, Beijing Normal University, Beijing 100875 (China); Sun, Genban, E-mail: gbsun@bnu.edu.cn [Beijing Key Laboratory of Energy Conversion and Storage Materials and College of Chemistry, Beijing Normal University, Beijing 100875 (China); Department of Materials Physics and Chemistry, University of Science and Technology Beijing, Beijing 100083 (China); Yang, Xiaojing [Beijing Key Laboratory of Energy Conversion and Storage Materials and College of Chemistry, Beijing Normal University, Beijing 100875 (China)

    2016-09-05

    FeNi{sub 3} nanocrystals as an ideal candidate for EM-wave-absorption material have a great advantage due to their excellent magnetic properties. However, its large permittivity and poor chemical stability confine its application. A strategy to improve electromagnetic performance of FeNi{sub 3}via phase-controlled synthesis of FeNi{sub 3} nanostructures grown on graphene networks has been employed in this work. The phases, structures, sizes and morphologies of FeNi{sub 3} nanocomposites were in-depth characterized by using scanning electron microscopy (SEM), high-resolution transmission electron microscopy (HRTEM), powder X-ray diffraction (XRD), Fourier transform infrared spectra (FT-IR), and Raman spectroscopy. The results of electromagnetic performance tests for the as-synthesized FeNi{sub 3} nanocomposites showed excellent microwave absorbability in comparison with the corresponding FeNi{sub 3} nanocrystals, especially in the low (2–6 GHz) and middle (6–12 GHz) frequencies. The one-pot method we utilized is simple and effective, and because of its versatility, it may be extended to prepare some magnetic metal or alloy materials via this route. - Highlights: • Monodispersed FeNi{sub 3} alloy nanocrystals have been successfully assembled on 2D graphene via a one-pot strategy. • The process ensures different crystal phase and controlled morphology and size in the monodispersed particles. • The nanocomposites exhibit excellent microwave absorbability, which is stronger than the corresponding alloy monomer.

  3. Proton exchange mechanism of synthesizing CdS quantum dots in nafion

    International Nuclear Information System (INIS)

    Nandakumar, P.; Vijayan, C.; Murti, Y.V.G.S.; Dhanalakshmi, K.; Sundararajan, G.

    1999-01-01

    Nanocrystals of CdS are synthesized in the proton exchange membrane nafion in different sizes in the range 1.6 to 6 nm. To understand the process leading to the formation of these quantum dots, we have probed the proton exchange by ac conductance measurements in the frequency range 100 Hz to 13 MHz. Nafion shows good electrical conductivity due to proton transport probably via the Grothus mechanism. Incorporation of cadmium ions by replacement of the hydrogen ions in the sulphonic acid group resulted in a large decrease in conductance indicating the reduction of the mobile carrier density. The conductivity plots all show strong frequency dependence with higher conductance towards the higher frequencies where a near-flat frequency response is seen. After the formation of CdS clusters, there is a partial recovery of conductance corresponding to the reinstatement of the protonic carriers on the side groups. The conductivity of the nafion films embedded with the semiconductor quantum dots exhibits a size-dependence with the highest conductivity obtained for the largest clusters. These findings lend clear experimental evidence for the model of synthesis of quantum dots in nafion by the exchange mechanism. (author)

  4. Surfactant-assisted hydrothermal synthesis of CdS nanotips: optical and magnetic properties

    International Nuclear Information System (INIS)

    Mondal, Biswajit; Saha, Shyamal Kumar

    2012-01-01

    CdS nanotips with size 5–8 nm are synthesized by hydrothermal process using polyacrylamide (PAM) as surfactant. The shape of nanocrystals (NCs) changes from particles to nanorods or nanotips depending upon the amount of PAM used. Optical properties of the CdS NCs vary with hydrothermal temperature (T H ) due to formation of “S” vacancies. The Rietveld refinement of XRD data shows that “S” site occupancy decreases with increase in T H and amount of PAM indicating the formation of “S” vacancies. Size-dependent magnetic properties in these NCs indicate that the micron-size rods are diamagnetic in nature while the microrods ended with sharp tips show ferromagnetism even at room temperature. The origin of this ferromagnetism in nanotips is explained by the variation in density of “S” defects at the nanotips as well as in the nanorods. These ferromagnetic nanotips grown in the rods as side growth have potential applications in magnetic force microscopes.

  5. Biomolecular Assembly of Gold Nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Micheel, Christine Marya [Univ. of California, Berkeley, CA (United States)

    2005-05-20

    Over the past ten years, methods have been developed to construct discrete nanostructures using nanocrystals and biomolecules. While these frequently consist of gold nanocrystals and DNA, semiconductor nanocrystals as well as antibodies and enzymes have also been used. One example of discrete nanostructures is dimers of gold nanocrystals linked together with complementary DNA. This type of nanostructure is also known as a nanocrystal molecule. Discrete nanostructures of this kind have a number of potential applications, from highly parallel self-assembly of electronics components and rapid read-out of DNA computations to biological imaging and a variety of bioassays. My research focused in three main areas. The first area, the refinement of electrophoresis as a purification and characterization method, included application of agarose gel electrophoresis to the purification of discrete gold nanocrystal/DNA conjugates and nanocrystal molecules, as well as development of a more detailed understanding of the hydrodynamic behavior of these materials in gels. The second area, the development of methods for quantitative analysis of transmission electron microscope data, used computer programs written to find pair correlations as well as higher order correlations. With these programs, it is possible to reliably locate and measure nanocrystal molecules in TEM images. The final area of research explored the use of DNA ligase in the formation of nanocrystal molecules. Synthesis of dimers of gold particles linked with a single strand of DNA possible through the use of DNA ligase opens the possibility for amplification of nanostructures in a manner similar to polymerase chain reaction. These three areas are discussed in the context of the work in the Alivisatos group, as well as the field as a whole.

  6. Storage of optical excitations in colloidal semiconductor nanocrystals

    International Nuclear Information System (INIS)

    Kraus, Robert

    2009-01-01

    In the present theis it is described, how colloidal semiconductor nanocrystals can be used under influence of an electric field to store optical excitation energy at room temperature, to alter, and to supply controlledly. For this the photoluminescence emission of an ensemble of heterogeneous nanocrystals was manipulated and spectroscopically studied. The applied od-shaped particles consist of a spherical core of CdSe, on which an elongated shell of CdS is monocrystallinely be grown. The electron is in such an asymmetric geometry delocalized over the hole nanorod, whereas the hole because of the high potential barrier remains bound in the CdSe core. The wave-function overlap of the charge carriers can therefore be influenced both by the length of the nanorod and by an external electric field. In the regime of prompt fluorescence the manipulation of the charge-carrier separation by an electric field led to a suppression of the radiative recombination. As consequence a fluorescence suppression of about 40% could be observed. After the removal of the electric field the separation was reduced and the stored energy is in an fluorescence increasement directedly liberated again. The strength of the storage efficiency lies with the strength of the electric field in a linear connection. Furthermore in this time range a quantum-confined Stark effect of upt o 14 meV could be detected at room temperature, although the effect is complicated by the different orientations and sizes of the nanorods in the ensemble. Hereby it is of advance to can adress with the applied detection technique a subensemble of nanocrystals. Furthermore a significant storage of the ensmble emission by up to 100 μs conditioned by the electric electric fieldcould be demonstrated, which exceeds the fluorescence lifetime of these particles by the 10 5 fold. As also could be shown by experiments on CdSe/ZnS nanocrystals surface states play a relevent role for the emission dynamics of nanocrystals. The

  7. Synthesis and Doping of Silicon Nanocrystals for Versatile Nanocrystal Inks

    Science.gov (United States)

    Kramer, Nicolaas Johannes

    The impact of nanotechnology on our society is getting larger every year. Electronics are becoming smaller and more powerful, the "Internet of Things" is all around us, and data generation is increasing exponentially. None of this would have been possible without the developments in nanotechnology. Crystalline semiconductor nanoparticles (nanocrystals) are one of the latest developments in the field of nanotechnology. This thesis addresses three important challenges for the transition of silicon nanocrystals from the lab bench to the marketplace: A better understanding of the nanocrystal synthesis was obtained, the electronic properties of the nanocrystals were characterized and tuned, and novel silicon nanocrystal inks were formed and applied using simple coating technologies. Plasma synthesis of nanocrystals has numerous advantages over traditional solution-based synthesis methods. While the formation of nanoparticles in low pressure nonthermal plasmas is well known, the heating mechanism leading to their crystallization is poorly understood. A combination of comprehensive plasma characterization with a nanoparticle heating model presented here reveals the underlying plasma physics leading to crystallization. The model predicts that the nanoparticles reach temperatures as high as 900 K in the plasma as a result of heating reactions on the nanoparticle surface. These temperatures are well above the gas temperature and sufficient for complete nanoparticle crystallization. Moving the field of plasma nanoparticle synthesis to atmospheric pressures is important for lowering its cost and making the process attractive for industrial applications. The heating and charging model for silicon nanoparticles was adapted in Chapter 3 to study plasmas maintained over a wide range of pressures (10 -- 105 Pa). The model considers three collisionality regimes and determines the dominant contribution of each regime under various plasma conditions. Strong nanoparticle cooling at

  8. Low-cost fabrication of ternary CuInSe{sub 2} nanocrystals by colloidal route using a novel combination of volatile and non-volatile capping agents

    Energy Technology Data Exchange (ETDEWEB)

    Chawla, Parul; Narain Sharma, Shailesh, E-mail: shailesh@nplindia.org; Singh, Son

    2014-11-15

    Wet-route synthesis of CuInSe{sub 2} (CISe) nanocrystals has been envisaged with the utilization of the unique combination of coordinating ligand and non coordinating solvent. Our work demonstrates the formation of a single-phase, nearly stoichiometric and monodispersive, stable and well-passivated colloidal ternary CISe nanocrystals (band gap (E{sub g})∼1.16 eV) using a novel combination of ligands; viz. volatile arylamine aniline and non-volatile solvent 1-octadecene. The synthesis and growth conditions have been manoeuvred using the colligative properties of the mixture and thus higher growth temperature (∼250 °C) could be attained that promoted larger grain growth. The beneficial influence of the capping agents (aniline and 1-octadecene) on the properties of chalcopyrite nanocrystals has enabled us to pictorally model the structural, morphological and optoelectronic aspects of CISe nanoparticles. - Graphical abstract: Without resorting to any post-selenization process and using the colligative properties of the mixture comprising of volatile aniline and non-volatile 1-octadecene to manoeuvre the growth conditions to promote Ostwald ripening, a single phase, monodispersive and nearly stoichiometric ternary CISe nanocrystals are formed by wet-synthesis route. - Highlights: • Wet-route synthesis of CISe nanocrystals reported without post-selenization process. • Single-phase, stable and well-passivated colloidal ternary CISe nanocrystals formed. • Novel combination of capping agents: volatile aniline and non-volatile 1-octadecene. • Higher growth temperature attained using the colligative properties of the mixture. • Metallic salts presence explains exp. and theoretical boiling point difference.

  9. Optimizing colloidal nanocrystals for applications

    International Nuclear Information System (INIS)

    Sytnyk, M.

    2015-01-01

    In the scientific literature colloidal nanocrystals are presented as promising materials for multiple applications, in areas covering optoelectronics, photovoltaics, spintronics, catalysis, and bio-medicine. On the marked are, however, only a very limited number of examples found, indeed implementing colloidal nanocrystals. Thus the scope of this thesis was to modify nanocrystals and to tune their properties to fulfill specific demands. While some modifications could be achieved by post synthetic treatments, one key problem of colloidal nanocrystals, hampering there widespread application is the toxicity of their constituents. To develop nanocrystals from non-toxic materials has been a major goal of this thesis as well. Roughly, the results in this thesis could be subdivided into three parts: (i) the development of ion exchange methods to tailor the properties of metallic and metal-oxide based nanocrystal heterostructures, (ii), the synthesis of semiconductor nanocrystals from non-toxic materials, and (iii) the characterization of the nanocrystals by measurements of their morphology, chemical composition, magnetic-, optical-, and electronic properties. In detail, the thesis is subdivided into an introductory chapter, 4 chapters reporting on scientific results, a chapter reporting the used methods, and the conclusions. The 4 chapters devoted to the scientific results correspond to manuscripts, which are either currently in preparation, or have been published in highly ranked scientific journals such as NanoLetters (chapter 2), ACS Nano (chapter 4), or JACS (chapter 5). Thus, these chapters provide also an extra introduction and conclusion section, as well as separate reference lists. Chapter 2 describes a cation exchange process which is used to tune and improve the magnetic properties of different iron-oxide based colloidal nanocrystal-heterostructures. The superparamagnetic blocking temperature, magnetic remanence, and coercivity is tuned by replacing Fe2+ by Co2

  10. Synthesis and characterization of monodisperse, mesoporous, and magnetic sub-micron particles doped with a near-infrared fluorescent dye

    International Nuclear Information System (INIS)

    Le Guevel, Xavier; Nooney, Robert; McDonagh, Colette; MacCraith, Brian D.

    2011-01-01

    Recently, multifunctional silica nanoparticles have been investigated extensively for their potential use in biomedical applications. We have prepared sub-micron monodisperse and stable multifunctional mesoporous silica particles with a high level of magnetization and fluorescence in the near infrared region using an one-pot synthesis technique. Commercial magnetite nanocrystals and a conjugated-NIR-dye were incorporated inside the particles during the silica condensation reaction. The particles were then coated with polyethyleneglycol to stop aggregation. X-ray diffraction, N 2 adsorption analysis, TEM, fluorescence and absorbance measurements were used to structurally characterize the particles. These mesoporous silica spheres have a large surface area (1978 m 2 /g) with 3.40 nm pore diameter and a high fluorescence in the near infrared region at λ=700 nm. To explore the potential of these particles for drug delivery applications, the pore accessibility to hydrophobic drugs was simulated by successfully trapping a hydrophobic ruthenium dye complex inside the particle with an estimated concentration of 3 wt%. Fluorescence imaging confirmed the presence of both NIR dye and the post-grafted ruthenium dye complex inside the particles. These particles moved at approximately 150 μm/s under the influence of a magnetic field, hence demonstrating the multifunctionality and potential for biomedical applications in targeting and imaging. - Graphical Abstract: Hydrophobic fluorescent Ruthenium complex has been loaded into the mesopores as a surrogate drug to simulate drug delivery and to enhance the multifunctionality of the magnetic NIR emitting particles. Highlights: → Monodisperse magnetic mesoporous silica particles emitting in the near infrared region are obtained in one-pot synthesis. → We prove the capacity of such particles to uptake hydrophobic dye to mimic drug loading. → Loaded fluorescent particles can be moved under a magnetic field in a microfluidic

  11. Green synthesis and antimicrobial activity of monodisperse silver nanoparticles synthesized using Ginkgo Biloba leaf extract

    Energy Technology Data Exchange (ETDEWEB)

    Ren, Yan-yu [School of Food and Biological Engineering, Shaanxi University of Science & Technology, Xi' an 710021 (China); Yang, Hui, E-mail: 549456369@qq.com [School of Food and Biological Engineering, Shaanxi University of Science & Technology, Xi' an 710021 (China); Wang, Tao [School of Food and Biological Engineering, Shaanxi University of Science & Technology, Xi' an 710021 (China); Wang, Chuang [Department of Highway & Bridge, Shaanxi Railway Institute, Weinan 714000 (China)

    2016-11-25

    Various parts of plants can be used as a raw material for the synthesis of nanoparticles, which is eco-friendly way and does not involve any harmful chemicals. In this project, Ginkgo biloba leaf, an abundantly available medicinal plant in China, was for the first time adopted as a reducing and stabilizing agent to synthesize smaller sized and stable silver nanoparticles (AgNPs). To improve the quality of AgNPs, the reduction was accelerated by changing the concentrations of initial Ag{sup +} (0.02, 0.04, 0.06 and 0.08 mol/L) of the reaction mixture consisting of silver nitrate solution (AgNO{sub 3}) and Ginkgo biloba leaf extract. At pH = 8 and lower AgNO{sub 3} concentration (0.02 mol/L), a colloid consisting of well-dispersed spherical nanoparticles was obtained. The synthesized nanocrystals were successfully characterized by UV–vis and XRD. TEM images revealed the size of the spherical AgNPs ranged between 10–16 nm. FTIR analysis revealed that biological macromolecules with groups of −NH{sub 2}, −OH, and others were distributed on the surface of the nanoparticles. The biosynthesized AgNPs exhibited good antibacterial activities against gram-negative bacteria and gram-positive bacteria. Compared to traditional chemical methods, Ginkgo biloba leaf extract provides an easy green synthetical way. It is anticipated that the biosynthesized AgNPs can be used in areas such as cosmetics, foods and medical applications. - Highlights: • Monodisperse silver nanoparticles were first prepared by a green synthetical way through Ginkgo Biloba leaf extract. • The synthesized AgNPs is of high crystallinity, stable and good dispersion with smaller sizes between 10–16 nm. • The achieved AgNPs exhibits good antibacterial activities. • The biosynthesis method is advantageous for its cost effectiveness, availability, portability, nontoxic and environmentally benign.

  12. Green synthesis and antimicrobial activity of monodisperse silver nanoparticles synthesized using Ginkgo Biloba leaf extract

    International Nuclear Information System (INIS)

    Ren, Yan-yu; Yang, Hui; Wang, Tao; Wang, Chuang

    2016-01-01

    Various parts of plants can be used as a raw material for the synthesis of nanoparticles, which is eco-friendly way and does not involve any harmful chemicals. In this project, Ginkgo biloba leaf, an abundantly available medicinal plant in China, was for the first time adopted as a reducing and stabilizing agent to synthesize smaller sized and stable silver nanoparticles (AgNPs). To improve the quality of AgNPs, the reduction was accelerated by changing the concentrations of initial Ag + (0.02, 0.04, 0.06 and 0.08 mol/L) of the reaction mixture consisting of silver nitrate solution (AgNO 3 ) and Ginkgo biloba leaf extract. At pH = 8 and lower AgNO 3 concentration (0.02 mol/L), a colloid consisting of well-dispersed spherical nanoparticles was obtained. The synthesized nanocrystals were successfully characterized by UV–vis and XRD. TEM images revealed the size of the spherical AgNPs ranged between 10–16 nm. FTIR analysis revealed that biological macromolecules with groups of −NH 2 , −OH, and others were distributed on the surface of the nanoparticles. The biosynthesized AgNPs exhibited good antibacterial activities against gram-negative bacteria and gram-positive bacteria. Compared to traditional chemical methods, Ginkgo biloba leaf extract provides an easy green synthetical way. It is anticipated that the biosynthesized AgNPs can be used in areas such as cosmetics, foods and medical applications. - Highlights: • Monodisperse silver nanoparticles were first prepared by a green synthetical way through Ginkgo Biloba leaf extract. • The synthesized AgNPs is of high crystallinity, stable and good dispersion with smaller sizes between 10–16 nm. • The achieved AgNPs exhibits good antibacterial activities. • The biosynthesis method is advantageous for its cost effectiveness, availability, portability, nontoxic and environmentally benign.

  13. A co-flow-focusing monodisperse microbubble generator

    KAUST Repository

    Zhang, Jiaming; Li, Erqiang; Thoroddsen, Sigurdur T

    2014-01-01

    We use a simple and inexpensive microfluidic device, which is based on microscope glass slides and two tapered glass capillaries, to produce monodisperse microbubbles. The innermost capillary used for transporting the gas is inserted into the second capillary, with its 2 μm sharp tip aligned with the center of the converging-diverging throat of the second capillary. This configuration provides a small and smooth gas flow rate, and a high velocity gradient at the tube outlet. Highly monodisperse microbubbles with diameters ranging from 3.5 to 60 microns have been successfully produced at a rate of up to 40 kHz. A simple scaling law, which is based on the capillary number and liquid-to-gas flow rate ratio, successfully predicts the bubble size. © 2014 IOP Publishing Ltd.

  14. A co-flow-focusing monodisperse microbubble generator

    KAUST Repository

    Zhang, Jiaming

    2014-02-14

    We use a simple and inexpensive microfluidic device, which is based on microscope glass slides and two tapered glass capillaries, to produce monodisperse microbubbles. The innermost capillary used for transporting the gas is inserted into the second capillary, with its 2 μm sharp tip aligned with the center of the converging-diverging throat of the second capillary. This configuration provides a small and smooth gas flow rate, and a high velocity gradient at the tube outlet. Highly monodisperse microbubbles with diameters ranging from 3.5 to 60 microns have been successfully produced at a rate of up to 40 kHz. A simple scaling law, which is based on the capillary number and liquid-to-gas flow rate ratio, successfully predicts the bubble size. © 2014 IOP Publishing Ltd.

  15. Synthesis of Monodisperse Iron Oxide Nanoparticles without Surfactants

    Directory of Open Access Journals (Sweden)

    Xiao-Chen Yang

    2014-01-01

    Full Text Available Monodisperse iron oxide nanoparticles could be successfully synthesized with two kinds of precipitants through a precipitation method. As-prepared nanoparticles in the size around 10 nm with regular spherical-like shape were achieved by adjusting pH values. NaOH and NH3·H2O were used as two precipitants for comparison. The average size of nanoparticles with NH3·H2O precipitant got smaller and represented better dispersibility, while nanoparticles with NaOH precipitant represented better magnetic property. This work provided a simple method without using any organic solvents, organic metal salts, or surfactants which could easily obtain monodisperse nanoparticles with tunable morphology.

  16. Laboratory evaluation of a vibrating orifice monodisperse aerosol generator

    International Nuclear Information System (INIS)

    Everitt, N.M.; Snelling, K.W.

    1985-02-01

    The Berglund-Liu vibrating orifice aerosol generator is capable of producing monodisperse particles in the diameter range 5 to 50 μm. Experiments have been carried out to set up and evaluate such a generator for the preparation of standard liquid (olive oil) and solid (methylene blue) aerosols in the size range 8 to 13 μm. Modifications have been made to the apparatus to improve its performance and increase its particle output. (author)

  17. The size control of silver nanocrystals with different polyols and its application to low-reflection coating materials

    Energy Technology Data Exchange (ETDEWEB)

    Park, Keum Hwan; Park, O Ok [Department of Chemical and Biomolecular Engineering, Korea Advanced Institute of Science and Technology (KAIST), 291 Daehak-ro, Yuseong-gu, Daejeon 305-701 (Korea, Republic of); Im, Sang Hyuk, E-mail: imromy@krict.re.kr, E-mail: ookpark@kaist.ac.kr [Korea Research Institute of Chemical Technology (KRICT), 19 Singsungno, Yuseong-gu, Daejeon 305-600 (Korea, Republic of)

    2011-01-28

    The size of silver nanocrystals in polyol synthesis can be simply controlled by tuning the viscosity of the reaction medium such as ethylene glycol, 1,2-propanediol, 1,4-butanediol and 1,5-pentanediol. We found that a higher viscose medium (1,5-pentanediol) led to monodispersed smaller particles thanks to the slow addition of silver atoms into the nuclei. Size-controlled silver nanocrystals of 30 nm were obtained in a viscosity controlled medium of 1,5-pentanediol to synthesize a low refractive index filler by coating with silica and subsequent etching of the silver core. The coated low-reflection layer from the hollow silica nanoparticles on polyethylene terephthalate (PET) film can greatly reduce the reflection of the PET film from 10% to 2% over the entire visible region.

  18. Cellulose nanocrystal submonolayers by spin coating

    NARCIS (Netherlands)

    Kontturi, E.J.; Johansson, L.S.; Kontturi, K.S.; Ahonen, P.; Thune, P.C.; Laine, J.

    2007-01-01

    Dilute concentrations of cellulose nanocrystal solutions were spin coated onto different substrates to investigate the effect of the substrate on the nanocrystal submonolayers. Three substrates were probed: silica, titania, and amorphous cellulose. According to atomic force microscopy (AFM) images,

  19. TiO2 nanocrystals decorated Z-schemed core-shell CdS-CdO nanorod arrays as high efficiency anodes for photoelectrochemical hydrogen generation.

    Science.gov (United States)

    Li, Chia-Hsun; Hsu, Chan-Wei; Lu, Shih-Yuan

    2018-07-01

    TiO 2 nanocrystals decorated core-shell CdS-CdO nanorod arrays, TiO 2 @CdO/CdS NR, were fabricated as high efficiency anodes for photoelctrochemical hydrogen generation. The novel sandwich heterostructure was constructed from first growth of CdS nanorod arrays on a fluorine doped tin oxide (FTO) substrate with a hydrothermal process, followed by in situ generation of CdO thin films of single digit nanometers from the CdS nanorod surfaces through thermal oxidation, and final decoration of TiO 2 nanocrystals of 10-20 nm via a successive ionic layer absorption and reaction process. The core-shell CdS-CdO heterostructure possesses a Z-scheme band structure to enhance interfacial charge transfer, facilitating effective charge separation to suppress electron-hole recombination within CdS for much improved current density generation. The final decoration of TiO 2 nanocrystals passivates surface defects and trap states of CdO, further suppressing surface charge recombination for even higher photovoltaic conversion efficiencies. The photoelectrochemical performances of the plain CdS nanorod array were significantly improved with the formation of the sandwich heterostructure, achieving a photo current density of 3.2 mA/cm 2 at 1.23 V (vs. RHE), a 141% improvement over the plain CdS nanorod array and a 32% improvement over the CdO/CdS nanorod array. Copyright © 2018 Elsevier Inc. All rights reserved.

  20. Nanocrystal thin film fabrication methods and apparatus

    Science.gov (United States)

    Kagan, Cherie R.; Kim, David K.; Choi, Ji-Hyuk; Lai, Yuming

    2018-01-09

    Nanocrystal thin film devices and methods for fabricating nanocrystal thin film devices are disclosed. The nanocrystal thin films are diffused with a dopant such as Indium, Potassium, Tin, etc. to reduce surface states. The thin film devices may be exposed to air during a portion of the fabrication. This enables fabrication of nanocrystal-based devices using a wider range of techniques such as photolithography and photolithographic patterning in an air environment.

  1. C. pneumoniae CdsL regulates CdsN ATPase activity, and disruption with a peptide mimetic prevents bacterial invasion

    Directory of Open Access Journals (Sweden)

    Chris Blair Stone

    2011-02-01

    Full Text Available Chlamydiae are obligate intracellular pathogens that likely require type III secretion (T3S to invade cells and replicate intracellulary within a cytoplasmic vacuole called an inclusion body. C. pneumoniae possess a YscL ortholog, CdsL, that has been shown to interact with the T3S ATPase (CdsN. In this report we demonstrate that CdsL down-regulates CdsN enzymatic activity in a dose-dependent manner. Using PepScan epitope mapping we identified two separate binding domains to which CdsL binds viz. CdsN 221-229 and CdsN265-270. We confirmed the binding domains using a pull-down assay and showed that GST-CdsN221-270, which encompasses these peptides, co-purified with His-CdsL. Next, we used orthology modeling based on the crystal structure of a T3S ATPase ortholog from E. coli, EscN, to map the binding domains on the predicted three dimensional structure of CdsN. The CdsL binding domains mapped to the catalytic domain of the ATPase, one in the central channel of the ATPase hexamer and one on the outer face. Since peptide mimetics have been used to disrupt essential protein interactions of the chlamydial T3S system and inhibit T3S-mediated invasion of HeLa cells, we hypothesized that if CdsL – CdsN binding is essential for regulating T3S then a CdsN peptide mimetic could be used to potentially block T3S and Chlamydial invasion. Treatment of EBs with a CdsN peptide mimetic inhibited C. pneumoniae invasion into HeLa cells in a dose-dependent fashion. This report represents the first use of Pepscan technology to identify binding domains for specific T3S proteins viz. CdsL on the ATPase, CdsN, and demonstrates that peptide mimetics can be used as anti-virulence factors to block bacterial invasion.

  2. Supercritical synthesis and in situ deposition of PbS nanocrystals with oleic acid passivation for quantum dot solar cells

    Energy Technology Data Exchange (ETDEWEB)

    Tavakoli, M.M. [Department of Materials Science and Engineering, Sharif University of Technology, 14588 Tehran (Iran, Islamic Republic of); Simchi, A., E-mail: simchi@sharif.edu [Department of Materials Science and Engineering, Sharif University of Technology, 14588 Tehran (Iran, Islamic Republic of); Institute for Nanoscience and Nanotechnology, Sharif University of Technology, 14588 Tehran (Iran, Islamic Republic of); Aashuri, H. [Department of Materials Science and Engineering, Sharif University of Technology, 14588 Tehran (Iran, Islamic Republic of)

    2015-04-15

    Colloidal quantum dot solar cells have recently attracted significant attention due to their low-processing cost and surging photovoltaic performance. In this paper, a novel, reproducible, and simple solution-based process based on supercritical fluid toluene is presented for in situ growth and deposition PbS nanocrystals with oleic-acid passivation. A lead precursor containing sulfur was mixed with oleic acid in toluene and processed in a supercritical fluid condition at different temperatures of 140, 270 and 330 °C for 20 min. The quantum dots were deposited on a fluorine-doped tin oxide glass substrate inside the supercritical reactor. Transmission electron microscopy, X-ray diffraction, absorption and dynamic light scattering showed that the nanocrystals processed at the supercritical condition (330 °C) are fully crystalline with a narrow size distribution of ∼3 nm with an absorption wavelength of 915 nm (bandgap of 1.3 eV). Fourier transform infrared spectroscopy indicated that the PbS quantum dots are passivated by oleic acid molecules during the growth. Photovoltaic characteristics of Schottky junction solar cells showed an improvement over devices prepared by spin-coating. - Highlights: • Supercritical fluid processing and in situ deposition of PbS QDs are presented. • The prepared nanocrystals are mono-dispersed with an optical bandgap of 1.3 eV. • Photovoltaic performance of the in situ deposited nanocrystals is reported. • An improved PV performance compared to spin coated Schottky solar cells is shown.

  3. Controllable 5-sulfosalicylic acid assisted solvothermal synthesis of monodispersed superparamagnetic Fe{sub 3}O{sub 4} nanoclusters with tunable size

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Wentao [State Key Laboratory of Fine Chemicals, Dalian University of Technology, Dalian 116024 (China); Tang, Bingtao, E-mail: tangbt@dlut.edu.cn [State Key Laboratory of Fine Chemicals, Dalian University of Technology, Dalian 116024 (China); Wu, Suli; Gao, Zhanming; Ju, Benzhi [State Key Laboratory of Fine Chemicals, Dalian University of Technology, Dalian 116024 (China); Teng, Xiaoxu [School of Chemistry and Chemical Engineering, Yangtze Normal University, Chongqing 408100 (China); Zhang, Shufen [State Key Laboratory of Fine Chemicals, Dalian University of Technology, Dalian 116024 (China)

    2017-02-01

    Monodispersed Fe{sub 3}O{sub 4} nanoclusters were synthesized in a one-pot solvothermal route with 5-sulfosalicylic acid (SSA) as the functional ligand in a mixed-solvent system of diethylene glycol/ethylene glycol (DEG/EG). Nucleation and aggregation growth model was responsible for the formation of secondary structure of the clusters. In the process, the size of the clusters can be effectively controlled by varying the amounts of SSA and the volume ratio of DEG/EG. The nanoclusters exhibited superparamagnetic properties with high saturation magnetization value of about 68.7 emu g{sup −1} at room temperature. The water-soluble small-molecule SSA grafted on the surface of Fe{sub 3}O{sub 4} nanocrystals rendered the superparamagnetic clusters dispersible in water, which is crucial for potential applications in biomedical fields. - Graphical abstract: 5-sulfosalicylic acid assisted solvothermal synthesis of monodispersed superparamagnetic Fe{sub 3}O{sub 4} nanoclusters with tunable size by a mixed-solvent system of DEG/EG. - Highlights: • Monodispersed Fe{sub 3}O{sub 4} nanoclusters were synthesized in a one-pot 5-sulfosalicylic acid assisted solvothermal route. • The size of the clusters are tunable by varying the amounts of 5-sulfosalicylic acid and the volume ratio of DEG/EG. • The nanoclusters exhibited superparamagnetic properties with high saturation magnetization value. • The 5-sulfosalicylic acid grafted Fe{sub 3}O{sub 4} nanoclusters can be dispersed in water.

  4. Highly luminescent nanostructures of CdS and ZnS prepared by microwaves heating: effect of sulphide concentration

    Energy Technology Data Exchange (ETDEWEB)

    Ortiz, Samuel; Gomez, Idalia; Elizondo, Perla [Facultad de Ciencias Quimicas, Universidad Autonoma de Nuevo Leon, Av. Universidad s/n, C.P. 66450 San Nicolas de los Garza (Mexico); Cavazos, Jose [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, Av. Universidad s/n, C.P. 66450 San Nicolas de los Garza (Mexico)

    2010-11-15

    Nearly monodisperse and highly luminescent ZnS and CdS NPs were obtained by microwave irradiation. The ZnS and CdS NPs solutions were prepared by adding freshly prepared ZnSO{sub 4} or CdSO{sub 4} solution to a thioacetamide solution at pH 8 in the presence of sodium citrate in solution used as stabilizer. The precursors concentration were such that the sulphide ion concentrations were 3 x 10{sup -2} M, 6 x 10{sup -2} M and 8 x 10{sup -2} M, for each of these [S] concentrations the [Zn] or [Cd] content were fixed at 3 x 10{sup -2} M. NPs were prepared under microwave irradiation for 1 min at 905 W of power. The NPs samples were taken when the temperature descended to ambient temperature for further analysis. Effect of concentration of Cd and Zn ions were studied in the luminescence property. RXD, AFM, TEM and UV-Vis were used too as analytical equipment for characterization. (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

  5. Photoluminescence and electrical impedance measurements on alloyed Zn{sub (1-x)}Cd{sub x}S nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Saravanan, R. Sakthi Sudar, E-mail: rsakthiss@yahoo.com [Physics Research Centre, S.T. Hindu College, Nagercoil 629 002 (India); Mahadevan, C.K. [Physics Research Centre, S.T. Hindu College, Nagercoil 629 002 (India)

    2012-11-15

    Highlights: Black-Right-Pointing-Pointer High yield synthesis of Zn-Cd-S QDs. is achieved by solvothermal-microwave heating. Black-Right-Pointing-Pointer The samples are highly crystalline and the average particle size is {approx}3.5 nm. Black-Right-Pointing-Pointer High luminescent quantum yield and narrow emission spectral widths are obtained. Black-Right-Pointing-Pointer High conduction activation energy is observed in the case of Zn-Cd coexisting QDs. - Abstract: A series of wurtzite Zn{sub (1-x)}Cd{sub x}S (x = 0, 0.25, 0.5, 0.75 and 1) nanocrystals with average crystallite size of 1.98, 1.82, 1.80, 2.04 and 2.51 nm, respectively, have been synthesized by simple solvothermal microwave heating method. The photoluminescence yield is found to be higher in the case of alloyed nanocrystals (x = 0.25, 0.5, 0.75) as compared to ZnS (x = 0) and CdS (x = 1). The optical emission is tuned from blue (440 nm) to orange (575 nm) with the increase of Cd composition in Zn{sub (1-x)}Cd{sub x}S nanocrystal. The impedance analysis for Zn{sub (1-x)}Cd{sub x}S nanocrystals has been measured as a function of frequency and temperature. The real and imaginary part of complex impedance plots exhibit semicircle behavior in the complex plane. The AC activation energies of ZnS, Zn{sub 0.75}Cd{sub 0.25}S, Zn{sub 0.5}Cd{sub 0.5}S, Zn{sub 0.25}Cd{sub 0.75}S and CdS nanocrystals were calculated from electrical conductivity analysis and are found to be 0.188, 0.378, 0.456, 0.284 and 0.255 eV, respectively. The conductivity of the alloyed nanocrystals was higher than that of ZnS and CdS.

  6. Morphologically and size uniform monodisperse particles and their shape-directed self-assembly

    Energy Technology Data Exchange (ETDEWEB)

    Collins, Joshua E.; Bell, Howard Y.; Ye, Xingchen; Murray, Christopher Bruce

    2017-09-12

    Monodisperse particles having: a single pure crystalline phase of a rare earth-containing lattice, a uniform three-dimensional size, and a uniform polyhedral morphology are disclosed. Due to their uniform size and shape, the monodisperse particles self assemble into superlattices. The particles may be luminescent particles such as down-converting phosphor particles and up-converting phosphors. The monodisperse particles of the invention have a rare earth-containing lattice which in one embodiment may be an yttrium-containing lattice or in another may be a lanthanide-containing lattice. The monodisperse particles may have different optical properties based on their composition, their size, and/or their morphology (or shape). Also disclosed is a combination of at least two types of monodisperse particles, where each type is a plurality of monodisperse particles having a single pure crystalline phase of a rare earth-containing lattice, a uniform three-dimensional size, and a uniform polyhedral morphology; and where the types of monodisperse particles differ from one another by composition, by size, or by morphology. In a preferred embodiment, the types of monodisperse particles have the same composition but different morphologies. Methods of making and methods of using the monodisperse particles are disclosed.

  7. Semiconductor Nanocrystals for Biological Imaging

    Energy Technology Data Exchange (ETDEWEB)

    Fu, Aihua; Gu, Weiwei; Larabell, Carolyn; Alivisatos, A. Paul

    2005-06-28

    Conventional organic fluorophores suffer from poor photo stability, narrow absorption spectra and broad emission feature. Semiconductor nanocrystals, on the other hand, are highly photo-stable with broad absorption spectra and narrow size-tunable emission spectra. Recent advances in the synthesis of these materials have resulted in bright, sensitive, extremely photo-stable and biocompatible semiconductor fluorophores. Commercial availability facilitates their application in a variety of unprecedented biological experiments, including multiplexed cellular imaging, long-term in vitro and in vivo labeling, deep tissue structure mapping and single particle investigation of dynamic cellular processes. Semiconductor nanocrystals are one of the first examples of nanotechnology enabling a new class of biomedical applications.

  8. Rapid biosynthesis of cadmium sulfide (CdS) nanoparticles using ...

    African Journals Online (AJOL)

    Rapid biosynthesis of cadmium sulfide (CdS) nanoparticles using culture supernatants of Escherichia coli ATCC 8739, Bacillus subtilis ATCC 6633 and Lactobacillus ... The process of extracellular and fast biosynthesis may help in the development of an easy and eco-friendly route for the synthesis of CdS nanoparticles.

  9. Regime-dependent determinants of Euro area sovereign CDS spreads

    NARCIS (Netherlands)

    Blommestein, H.J.; Eijffinger, Sylvester; Qian, Zongxin

    We study the determinants of sovereign CDS spreads of five Euro area countries (Greece, Ireland, Italy, Portugal, and Spain) after the collapse of Lehman Brothers. We find that global and/or European Monetary Union (EMU)-wide factors are the main drivers of changes in the sovereign CDS spreads in

  10. Biosynthesis of CdS nanoparticles in banana peel extract.

    Science.gov (United States)

    Zhou, Guang Ju; Li, Shuo Hao; Zhang, Yu Cang; Fu, Yun Zhi

    2014-06-01

    Cadmium sulfide (CdS) nanoparticles (NPs) were synthesized by using banana peel extract as a convenient, non-toxic, eco-friendly 'green' capping agent. Cadmium nitrate and sodium sulfide are main reagents. A variety of CdS NPs are prepared through changing reaction conditions (banana extracts, the amount of banana peel extract, solution pH, concentration and reactive temperature). The prepared CdS colloid displays strong fluorescence spectrum. X-ray diffraction analysis demonstrates the successful formation of CdS NPs. Fourier transform infra-red (FTIR) spectrogram indicates the involvement of carboxyl, amine and hydroxyl groups in the formation of CdS NPs. Transmission electron microscope (TEM) result reveals that the average size of the NPs is around 1.48 nm.

  11. Elongational viscosity of monodisperse and bidisperse polystyrene melts

    DEFF Research Database (Denmark)

    Nielsen, Jens Kromann; Rasmussen, Henrik Koblitz; Hassager, Ole

    2005-01-01

    The startup and steady uniaxial elongational viscosity have been measured for two monodisperse polystyrene melts with molecular weights of 52 kg/mole (PS52K) and 103 kg/mole (PS103K), and for three bidisperse polystyrene melts. The bidisperse melts consist of PS103K or PS52K and a monodisperse...... (closed loop proportional regulator) using the laser in such a way that the stretch rate at the neck is kept constant. The rheometer has been described in more detail in (A. Bach, H.K. Rasmussen and O. Hassager, Journal of Rheology, 47 (2003) 429). PS390K show a decrease in the steady viscosity as a power......-law function of the elongational rate (A. Bach, K. Almdal, H.K. Rasmussen and O. Hassager, Macromolecules 36 (2003) 5174). PS52K and PS103K show that the steady viscosity has a maximum that is respectively 100% and 50% above 3 times the zero-shear-rate viscosity. The bidisperse melts show a significant...

  12. Hydrogenation of 4-nitrophenol to 4-aminophenol at room temperature: Boosting palladium nanocrystals efficiency by coupling with copper via liquid phase pulsed laser ablation

    International Nuclear Information System (INIS)

    Park, Hanbit; Reddy, D. Amaranatha; Kim, Yujin; Lee, Seunghee; Ma, Rory; Lim, Manho; Kim, Tae Kyu

    2017-01-01

    Highlights: • PdCu bimetallic nanospheres fabricated by laser ablation. • Physical characterizations of synthesized PdCu nanospheres. • Assessments of catalytic performance of PdCu nanospheres for the reduction of nitrophenol. • Significant improvement of the catalytic activity in PdCu bimetallic nanocrystals. - Abstract: Ultra-dispersed bimetallic nanomaterials have attracted much attention in the hydrogenation of highly toxic aromatic nitro compounds to aromatic amines owing to their high stability, superior activity, reusability, and unique optical and electronic properties, as compared to monometalic nanocrystals. However, the lack of facile and economically controllable strategies of producing highly pure ultra-dispersed bimetallic nanocatalysts limits their practical industrial applications. Considering the above obstacles, we present a simple and effective strategy for the formation of bimetallic (PdCu) nanocrystals by liquid phase pulsed laser ablation using a bulk Pd metal plate submerged in CuCl 2 solutions with different concentrations, in contrast to the complex and costly experimental methods used previously. The microstructural and optical properties of the synthesized nanocrystals indicate that the obtained bimetallic nanostructures are highly pure and monodispersed. Moreover, bimetallic PdCu nanostructures show a higher catalytic activity than monometallic Pd nanocrystals for the hydrogenation of 4-nitrophenol to 4-aminophenol at room temperature, also exhibiting high stability for up to four recycles. The mechanism of the enhanced catalytic activity and stability of bimetallic nanocrystals is discussed in detail. Finally, we believe that the presented design strategy and utilization of bimetallic nanocrystals for catalytic applications enables the development of novel bimetallic nanostructures by liquid phase pulsed laser ablation and their catalytic application for environmental remediation.

  13. Hydrogenation of 4-nitrophenol to 4-aminophenol at room temperature: Boosting palladium nanocrystals efficiency by coupling with copper via liquid phase pulsed laser ablation

    Energy Technology Data Exchange (ETDEWEB)

    Park, Hanbit; Reddy, D. Amaranatha; Kim, Yujin; Lee, Seunghee; Ma, Rory; Lim, Manho, E-mail: mhlim@pusan.ac.kr; Kim, Tae Kyu, E-mail: tkkim@pusan.ac.kr

    2017-04-15

    Highlights: • PdCu bimetallic nanospheres fabricated by laser ablation. • Physical characterizations of synthesized PdCu nanospheres. • Assessments of catalytic performance of PdCu nanospheres for the reduction of nitrophenol. • Significant improvement of the catalytic activity in PdCu bimetallic nanocrystals. - Abstract: Ultra-dispersed bimetallic nanomaterials have attracted much attention in the hydrogenation of highly toxic aromatic nitro compounds to aromatic amines owing to their high stability, superior activity, reusability, and unique optical and electronic properties, as compared to monometalic nanocrystals. However, the lack of facile and economically controllable strategies of producing highly pure ultra-dispersed bimetallic nanocatalysts limits their practical industrial applications. Considering the above obstacles, we present a simple and effective strategy for the formation of bimetallic (PdCu) nanocrystals by liquid phase pulsed laser ablation using a bulk Pd metal plate submerged in CuCl{sub 2} solutions with different concentrations, in contrast to the complex and costly experimental methods used previously. The microstructural and optical properties of the synthesized nanocrystals indicate that the obtained bimetallic nanostructures are highly pure and monodispersed. Moreover, bimetallic PdCu nanostructures show a higher catalytic activity than monometallic Pd nanocrystals for the hydrogenation of 4-nitrophenol to 4-aminophenol at room temperature, also exhibiting high stability for up to four recycles. The mechanism of the enhanced catalytic activity and stability of bimetallic nanocrystals is discussed in detail. Finally, we believe that the presented design strategy and utilization of bimetallic nanocrystals for catalytic applications enables the development of novel bimetallic nanostructures by liquid phase pulsed laser ablation and their catalytic application for environmental remediation.

  14. Doping effect in Si nanocrystals

    Science.gov (United States)

    Li, Dongke; Xu, Jun; Zhang, Pei; Jiang, Yicheng; Chen, Kunji

    2018-06-01

    Intentional doping in semiconductors is a fundamental issue since it can control the conduction type and ability as well as modify the optical and electronic properties. To realize effective doping is the basis for developing semiconductor devices. However, by reducing the size of a semiconductor, like Si, to the nanometer scale, the doping effects become complicated due to the coupling between the quantum confinement effect and the surfaces and/or interfaces effect. In particular, by introducing phosphorus or boron impurities as dopants into material containing Si nanocrystals with a dot size of less than 10 nm, it exhibits different behaviors and influences on the physical properties from its bulk counterpart. Understanding the doping effects in Si nanocrystals is currently a challenge in order to further improve the performance of the next generation of nano-electronic and photonic devices. In this review, we present an overview of the latest theoretical studies and experimental results on dopant distributions and their effects on the electronic and optical properties of Si nanocrystals. In particular, the advanced characterization techniques on dopant distribution, the carrier transport process as well as the linear and nonlinear optical properties of doped Si nanocrystals, are systematically summarized.

  15. "Nanocrystal bilayer for tandem catalysis"

    Energy Technology Data Exchange (ETDEWEB)

    Yamada, Yusuke; Tsung, Chia Kuang; Huang, Wenyu; Huo, Ziyang; E.Habas, Susan E; Soejima, Tetsuro; Aliaga, Cesar E; Samorjai, Gabor A; Yang, Peidong

    2011-01-24

    Supported catalysts are widely used in industry and can be optimized by tuning the composition and interface of the metal nanoparticles and oxide supports. Rational design of metal-metal oxide interfaces in nanostructured catalysts is critical to achieve better reaction activities and selectivities. We introduce here a new class of nanocrystal tandem catalysts that have multiple metal-metal oxide interfaces for the catalysis of sequential reactions. We utilized a nanocrystal bilayer structure formed by assembling platinum and cerium oxide nanocube monolayers of less than 10 nm on a silica substrate. The two distinct metal-metal oxide interfaces, CeO2-Pt and Pt-SiO2, can be used to catalyse two distinct sequential reactions. The CeO2-Pt interface catalysed methanol decomposition to produce CO and H2, which were subsequently used for ethylene hydroformylation catalysed by the nearby Pt-SiO2 interface. Consequently, propanal was produced selectively from methanol and ethylene on the nanocrystal bilayer tandem catalyst. This new concept of nanocrystal tandem catalysis represents a powerful approach towards designing high-performance, multifunctional nanostructured catalysts

  16. Efficient solution route to transparent ZnO semiconductor films using colloidal nanocrystals

    Directory of Open Access Journals (Sweden)

    Satoshi Suehiro

    2016-09-01

    Full Text Available ZnO nanocrystals (NCs were synthesized by heating Zn (II acetylacetonate in oleic acid/oleylamine in the presence of 1,2-hexadecanediol at 220 °C. Transmission electron microscopy (TEM and dynamic light scattering (DLS measurements revealed the formation of monodispersed ZnO NCs of ca. 7 nm. ZnO NC assembled films were fabricated on a glass substrate by deposition with the colloidal ZnO NCs dispersed in toluene. The film composed of the NCs showed good optical transparency in the visible to near-infrared region. A device coupling the ZnO NC film with a p-type Cu2ZnSnS4 (CZTS NC film exhibited an obvious diode-like current–voltage behavior. The results suggest that the transparent ZnO film has a potentiality to be used for an n-type window layer in some optoelectronic applications.

  17. Design of free patterns of nanocrystals with ad hoc features via templated dewetting

    Energy Technology Data Exchange (ETDEWEB)

    Aouassa, M.; Berbezier, I.; Favre, L.; Ronda, A. [IM2NP, CNRS, AMU, Marseille (France); Bollani, M.; Sordan, R. [LNES, Como (Italy); Delobbe, A.; Sudraud, P. [Orsay Physics, Fuveau (France)

    2012-07-02

    Design of monodisperse ultra-small nanocrystals (NCs) into large scale patterns with ad hoc features is demonstrated. The process makes use of solid state dewetting of a thin film templated through alloy liquid metal ion source focused ion beam (LMIS-FIB) nanopatterning. The solid state dewetting initiated at the edges of the patterns controllably creates the ordering of NCs with ad hoc placement and periodicity. The NC size is tuned by varying the nominal thickness of the film while their position results from the association of film retraction from the edges of the lay out and Rayleigh-like instability. The use of ultra-high resolution LMIS-FIB enables to produce monocrystalline NCs with size, periodicity, and placement tunable as well. It provides routes for the free design of nanostructures for generic applications in nanoelectronics.

  18. An electroluminescence device for printable electronics using coprecipitated ZnS:Mn nanocrystal ink

    International Nuclear Information System (INIS)

    Toyama, T; Hama, T; Adachi, D; Nakashizu, Y; Okamoto, H

    2009-01-01

    Electroluminescence (EL) devices for printable electronics using coprecipitated ZnS:Mn nanocrystal (NC) ink are demonstrated. The EL properties of these devices were investigated along with the structural and optical properties of ZnS:Mn NCs with an emphasis on their dependence on crystal size. Transmission electron microscopy and x-ray diffraction studies revealed that the NCs, with a crystal size of 3-4 nm, are nearly monodisperse; the crystal size can be controlled by the Zn 2+ concentration in the starting solution for coprecipitation. The results of optical studies indicate the presence of quantum confinement effects; in addition, the NC surfaces are well passivated, regardless of the crystal size. Finally, an increase in the luminance of EL devices with a decrease in crystal size is observed, which suggests the excitation mechanism of ZnS:Mn NC EL devices.

  19. Technical training: CERN Document Server (CDS), Inspire and Library Services

    CERN Multimedia

    IT & GS Departments

    2012-01-01

    A new training course, “CERN Document Server (CDS), Inspire and Library Services”, is available since the beginning of the year. The training course is given by members of CERN’s CDS Team (IT-CIS group) and the Library Services (GIS SIS group) and is intended for all members of personnel of CERN. This course will present CDS and inspirehep.net and the content, scope and scientific information available in or with CDS, as much as the classification and organization of the documents. It is intended to give you the training needed to know how to use CDS most efficiently and in particular covers: the main characteristics and advanced features for the search of documents (scientific, multimedia, etc). the collaborative tools : baskets, alerts, comments, evaluation, etc. the submission of documents in CDS and examples of workflows. An important part of the training is composed of various exercises, designed to acquire practical ability to work with CDS in cases similar to re...

  20. Analysis of the influence of synthetic paramaters on the structure and physico-chemical properties of non-spherical iron oxide nanocrystals and their biological stability and compatibility.

    Science.gov (United States)

    Pardo, Alberto; Pujales, Rosa; Blanco, Mateo; Villar-Alvarez, Eva M; Barbosa, Silvia; Taboada, Pablo; Mosquera, Víctor

    2016-01-14

    In this work, we analyzed the effects of subtle changes in the synthetic conditions and synthetic parameters on the resulting size, shape, monodispersity, crystallinity and magnetic properties of iron oxide nanocrystals (IONCs) obtained through a modified one pot method for the production of mainly cubic-shaped nanoparticles (NPs). Cubic, octahedral and cuboctahedral shapes with different sizes and monodispersity could be obtained by slightly changing the stabilizer/precursor molar ratio, the precursor concentration, the reaction time and temperature and/or the heating rate. Their physical properties were evaluated using high-resolution transmission electron microscopy (HRTEM), X-ray powder diffraction (XRD), selected-area electron diffraction (SAED) and a superconducting quantum interference (SQUID) device. It was found that monodisperse cubic nanocrystals from ca. 25 to 94 nm could be obtained either by changing the precursor concentration, the heating rate or the reaction time. These cubic nanocrystals were ferrimagnetic in the whole temperature rage analyzed, with saturation magnetization values even larger than those of bulk magnetite. In addition, slightly truncated octahedral NPs could be achieved at relatively large heating ramp rates, whereas cubooctahedral NPs were derived by simply increasing the stabilizer/precursor molar ratio. The saturation magnetization of both types of NPs was slightly lower than the cubic ones, but they were still ferrimagnetic in the whole temperature range analyzed. Moreover, transfer to aqueous solution was possible by a ligand exchange with dimercaptosuccinic acid (DMSA) providing, at the same time, chemical groups for additional functionalization if required. The DMSA-coated cubic IONCs were fairly stable in culture medium, allowing their internalization by different cell types. The NPs inside the cells were located in the cytoplasm and most of them showed a perinuclear distribution. Moreover, a great cytocompatibility in a

  1. Phase transitions and doping in semiconductor nanocrystals

    Science.gov (United States)

    Sahu, Ayaskanta

    Colloidal semiconductor nanocrystals are a promising technological material because their size-dependent optical and electronic properties can be exploited for a diverse range of applications such as light-emitting diodes, bio-labels, transistors, and solar cells. For many of these applications, electrical current needs to be transported through the devices. However, while their solution processability makes these colloidal nanocrystals attractive candidates for device applications, the bulky surfactants that render these nanocrystals dispersible in common solvents block electrical current. Thus, in order to realize the full potential of colloidal semiconductor nanocrystals in the next-generation of solid-state devices, methods must be devised to make conductive films from these nanocrystals. One way to achieve this would be to add minute amounts of foreign impurity atoms (dopants) to increase their conductivity. Electronic doping in nanocrystals is still very much in its infancy with limited understanding of the underlying mechanisms that govern the doping process. This thesis introduces an innovative synthesis of doped nanocrystals and aims at expanding the fundamental understanding of charge transport in these doped nanocrystal films. The list of semiconductor nanocrystals that can be doped is large, and if one combines that with available dopants, an even larger set of materials with interesting properties and applications can be generated. In addition to doping, another promising route to increase conductivity in nanocrystal films is to use nanocrystals with high ionic conductivities. This thesis also examines this possibility by studying new phases of mixed ionic and electronic conductors at the nanoscale. Such a versatile approach may open new pathways for interesting fundamental research, and also lay the foundation for the creation of novel materials with important applications. In addition to their size-dependence, the intentional incorporation of

  2. Water-Soluble CdTe/CdS Core/Shell Semiconductor Nanocrystals: How Their Optical Properties Depend on the Synthesis Methods

    Directory of Open Access Journals (Sweden)

    Brener R. C. Vale

    2016-10-01

    Full Text Available We conducted a comparative synthesis of water-soluble CdTe/CdS colloidal nanocrystalline semiconductors of the core/shell type. We prepared the CdS shell using two different methods: a one-pot approach and successive ionic layer adsorption and reaction (SILAR; in both cases, we used 3-mercaptopropionic acid (MPA as the surface ligand. In the one-pot approach, thiourea was added over the freshly formed CdTe dispersion, and served as the sulfur source. We achieved thicker CdS layers by altering the Cd:S stoichiometric ratio (1:1, 1:2, 1:4, and 1:8. The Cd:S ratios 1:1 and 1:2 furnished the best optical properties; these ratios also made the formation of surface defects less likely. For CdTe/CdS obtained using SILAR, we coated the surface of three differently sized CdTe cores (2.17, 3.10, and 3.45 nm with one to five CdS layers using successive injections of the Cd2+ and S2– ions. The results showed that the core size influenced the optical properties of the materials. The deposition of three to five layers over the surface of smaller CdTe colloidal nanocrystals generated strain effects on the core/shell structure.

  3. TiO2-CdS Nanocomposites: Effect of CdS Oxidation on the Photocatalytic Activity

    Directory of Open Access Journals (Sweden)

    A. Hamdi

    2016-01-01

    Full Text Available Nanocomposites TiO2-CdS with different relative contents of CdS (molar ratios Cd/Ti = 0.02, 0.03, 0.05, 0.1, 0.2, and 0.5 were studied. The structural, photophysical, and chemical properties were investigated using XRD, Raman spectroscopy, XPS, GSDR, and LIL. XRD and Raman results confirmed the presence of TiO2 and CdS with intensities dependent on the ratio Cd/Ti. The presence of CdSO4 was detected by XPS at the surface of all TiO2-CdS composites. The relative amount of sulphate was dependent on the CdS loading. Luminescence time-resolved spectra clearly proved the existence of an excitation transfer process from CdS to TiO2 through the luminescence emission from TiO2 after excitation of CdS at λexc=410 nm, where no direct excitation of TiO2 occurs. Photodegradation of a series of aromatic carboxylic acids—benzoic, salicylic, 4-bromobenzoic, 3-phenylpropionic, and veratric acids—showed a great enhancement in the photocatalytic efficiency of the TiO2-CdS composites, which is due, mainly, to the effect of the charge carriers’ increased lifetime. In addition, it was shown that the oxidation of CdS to CdSO4 did not result in the deactivation of the photocatalytic properties and even contributed to enhance the degradation efficiency.

  4. Large low-field magnetoresistance of Fe3O4 nanocrystal at room temperature

    International Nuclear Information System (INIS)

    Mi, Shu; Liu, Rui; Li, Yuanyuan; Xie, Yong; Chen, Ziyu

    2017-01-01

    Superparamagnetic magnetite (Fe 3 O 4 ) nanoparticles with an average size of 6.5 nm and good monodispersion were synthesized and investigated by X-ray diffraction, Raman spectrometer, transmission electron microscopy and vibrating sample magnetometer. Corresponding low-field magnetoresistance (LFMR) was tested by physical property measurement system. A quite high LFMR has been observed at room temperature. For examples, at a field of 3000 Oe, the LFMR is −3.5%, and when the field increases to 6000 Oe, the LFMR is up to −5.1%. The electron spin polarization was estimated at 25%. This result is superior to the previous reports showing the LFMR of no more than 2% at room temperature. The conduction mechanism is proposed to be the tunneling of conduction electrons between adjacent grains considering that the monodisperse nanocrystals may supply more grain boundaries increasing the tunneling probability, and consequently enhancing the overall magnetoresistance. - Highlights: • Superparamagnetic Fe3O4 nanoparticles with small size were synthesized. • A quite high LFMR has been observed at room temperature. • The more grain boundaries increase the tunneling probability and enlarge the MR. • The fast response of the sample increase the MR at a low field.

  5. Flow and Failure in Extension of Monodisperse Polymer Melts

    DEFF Research Database (Denmark)

    Rasmussen, Henrik K.

    is commonly referred to be of either brittle (e.g. cohesive type) or of liquid (e.g. necking type) nature. Here the focus will be on monodisperse polymers, to study numerically the sample flow dynamics in dual wind-up extensional rheometers. The computations are within the ideas of the microstructural......It is well known that failure or rupture phenomenon appears in the extension of polymer melts. These appear not only as failure in extension rheometers, but also as sharkskin, developments of holes in thin polymeric films etc. Sometime these ruptures appear spontaneous as well. The rupture...... 'interchain pressure' theory based on the molecular stress function constitutive model for the polymer melt flow. The purpose is twofold. Primarily to present to what extend the experimentally observed failure, appearing during or after (e.g. as a spontaneous failure) extension, can be explained within...

  6. Laser ablation synthesis of monodispersed magnetic alloy nanoparticles

    International Nuclear Information System (INIS)

    Seto, Takafumi; Koga, Kenji; Akinaga, Hiroyuki; Takano, Fumiyoshi; Orii, Takaaki; Hirasawa, Makoto

    2006-01-01

    Monodispersed CoPt alloy nanoparticles were synthesized by a pulsed laser ablation (PLA) technique coupled with a low-pressure operating differential mobility analyzer (LP-DMA). The CoPt alloy nanoparticles were generated by laser ablating a solid Co-Pt target. In CoPt alloy nanoparticles synthesized from a target with a Co composition of 75 at%, the nanoparticle surfaces were covered by an oxide layer and exhibited a core-shell structure. In contrast, no shell was observed in particles generated from a target with a Co:Pt ratio of 50:50 at%. According to an EDX analysis, the compositions of the individual nanoparticles were almost the same as that of the target material. Finally, the magnetic hysteresis loops of the CoPt alloy nanoparticles exhibited ferromagnetism

  7. Monodisperse Silver Nanoparticles Synthesized by a Microwave-Assisted Method

    International Nuclear Information System (INIS)

    Shao-Peng, Zhu; Shao-Chun, Tang; Xiang-Kang, Meng

    2009-01-01

    Silver nanoparticles with an average size of about 20 nm are synthesized in a colloidal solution with the aid of microwave irradiation. Neither additional reductant nor stabilizer is required in this microwave-assisted method. The color of the colloidal solution is found to be dark green, different from the characteristic yellow of silver colloidal solutions. The silver nanoparticles in the colloidal solution have a narrow size distribution and large yield quantity. UV-visible absorption spectroscopy analysis reveals that the as-synthesized monodisperse silver nanoparticles have exceptional optical properties. Raman spectroscopy measurements demonstrate that these silver nanoparticles exhibit a notable surface-enhanced Raman scattering ability. (cross-disciplinary physics and related areas of science and technology)

  8. Laser ablation synthesis of monodispersed magnetic alloy nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Seto, Takafumi, E-mail: t.seto@aist.go.jp; Koga, Kenji; Akinaga, Hiroyuki; Takano, Fumiyoshi; Orii, Takaaki; Hirasawa, Makoto [National Institute of Advanced Industrial Science and Technology (AIST), Research Consortium for Synthetic Nano-Function Materials Project (SYNAF) (Japan)

    2006-08-15

    Monodispersed CoPt alloy nanoparticles were synthesized by a pulsed laser ablation (PLA) technique coupled with a low-pressure operating differential mobility analyzer (LP-DMA). The CoPt alloy nanoparticles were generated by laser ablating a solid Co-Pt target. In CoPt alloy nanoparticles synthesized from a target with a Co composition of 75 at%, the nanoparticle surfaces were covered by an oxide layer and exhibited a core-shell structure. In contrast, no shell was observed in particles generated from a target with a Co:Pt ratio of 50:50 at%. According to an EDX analysis, the compositions of the individual nanoparticles were almost the same as that of the target material. Finally, the magnetic hysteresis loops of the CoPt alloy nanoparticles exhibited ferromagnetism.

  9. Monodisperse Magneto-Fluorescent Bifunctional Nanoprobes for Bioapplications

    Science.gov (United States)

    Zhang, Hongwang; Huang, Heng; Pralle, Arnd; Zeng, Hao

    2013-03-01

    We present the work on the synthesis of dye-doped monodisperse Fe/SiO2 core/shell nanoparticles as bifunctional probes for bioapplications. Magnetic nanoparticles (NP) have been widely studied as nano-probes for bio-imaging, sensing as well as for cancer therapy. Among all the NPs, Fe NPs have been the focus because they have very high magnetization. However, Fe NPs are usually not stable in ambient due to the fast surface oxidation of the NPs. On the other hand, dye molecules have long been used as probes for bio-imaging. But they are sensitive to environmental conditions. It requires passivation for both so that they can be stable for applications. In this work, monodisperse Fe NPs with sizes ranging from 13-20 nm have been synthesized through the chemical thermal-decomposition in a solution. Silica shells were then coated on the Fe NPs by a two-phase oil-in-water method. Dye molecules were first bonded to a silica precursor and then encapsulated into the silica shell during the coating process. The silica shells protect both the Fe NPs and dye molecules, which makes them as robust probes. The dye doped Fe/SiO2 core/shell NPs remain both highly magnetic and highly fluorescent. The stable dye doped Fe/SiO2NPs have been used as a dual functional probe for both magnetic heating and local nanoscale temperature sending, and their performance will be reported. Research supported by NSF DMR 0547036, DMR1104994.

  10. Noncovalent functionalization of graphene by CdS nanohybrids for electrochemical applications

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Li [Chemical Engineering Research Center, School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 (China); Qi, Wei, E-mail: qiwei@tju.edu.cn [Chemical Engineering Research Center, School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 (China); State Key Laboratory of Chemical Engineering, Tianjin University, Tianjin 300072 (China); Tianjin Key Laboratory of Membrane Science and Desalination Technology, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineering, Tianjin 300072 (China); Su, Rongxin [Chemical Engineering Research Center, School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 (China); State Key Laboratory of Chemical Engineering, Tianjin University, Tianjin 300072 (China); Tianjin Key Laboratory of Membrane Science and Desalination Technology, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineering, Tianjin 300072 (China); He, Zhimin [Chemical Engineering Research Center, School of Chemical Engineering and Technology, Tianjin University, Tianjin 300072 (China); State Key Laboratory of Chemical Engineering, Tianjin University, Tianjin 300072 (China); Collaborative Innovation Center of Chemical Science and Engineering, Tianjin 300072 (China)

    2014-10-01

    Graphene–CdS (GR–CdS) nanocomposites were synthesized via a noncovalent functionalization process. To retain the intrinsic electronic and mechanical properties of graphene, the pristine graphene was firstly modified with 1-aminopyrene based on a strong π–π bond between the pyrenyl groups and the carbon rings of the graphene. Then the CdS nanocrystals were uniformly grown on the amino-graphene. The GR–CdS nanocomposites were characterized by UV–vis spectroscopy and scanning electron microscopy. A glucose biosensor was then fabricated based on the as-prepared GR–CdS nanocomposite by immobilizing glucose oxidase (GOD) in a chitosan thin film on a glassy carbon electrode. Direct electron transfer between GOD and the electrode was achieved and the biosensor showed good electrocatalytic activity with glucose ranging from 0.5 to 7.5 mM and a sensitivity of 45.4 μA mM{sup −1} cm{sup −2}. This work provided a simple and nondestructive functionalization strategy to fabricate graphene-based hybrid nanomaterials and it is expected that this composite film may find more potential applications in biosensors and biocatalysis. - Highlights: • A simple noncovalent approach to synthesize graphene–CdS (GR–CdS) nanocomposites • Direct electrochemistry of glucose oxidase based on synergistic effect of GR–CdS • A sensitive glucose biosensor was fabricated based on the GR–CdS hybrids.

  11. Noncovalent functionalization of graphene by CdS nanohybrids for electrochemical applications

    International Nuclear Information System (INIS)

    Wang, Li; Qi, Wei; Su, Rongxin; He, Zhimin

    2014-01-01

    Graphene–CdS (GR–CdS) nanocomposites were synthesized via a noncovalent functionalization process. To retain the intrinsic electronic and mechanical properties of graphene, the pristine graphene was firstly modified with 1-aminopyrene based on a strong π–π bond between the pyrenyl groups and the carbon rings of the graphene. Then the CdS nanocrystals were uniformly grown on the amino-graphene. The GR–CdS nanocomposites were characterized by UV–vis spectroscopy and scanning electron microscopy. A glucose biosensor was then fabricated based on the as-prepared GR–CdS nanocomposite by immobilizing glucose oxidase (GOD) in a chitosan thin film on a glassy carbon electrode. Direct electron transfer between GOD and the electrode was achieved and the biosensor showed good electrocatalytic activity with glucose ranging from 0.5 to 7.5 mM and a sensitivity of 45.4 μA mM −1 cm −2 . This work provided a simple and nondestructive functionalization strategy to fabricate graphene-based hybrid nanomaterials and it is expected that this composite film may find more potential applications in biosensors and biocatalysis. - Highlights: • A simple noncovalent approach to synthesize graphene–CdS (GR–CdS) nanocomposites • Direct electrochemistry of glucose oxidase based on synergistic effect of GR–CdS • A sensitive glucose biosensor was fabricated based on the GR–CdS hybrids

  12. Summer Student Project: Collecting and disseminating CDS KPIs

    CERN Document Server

    Alvarez Perez, Carmen

    2010-01-01

    CDS (CERN Document Server) stores over 900,000 bibliographic records, including 360,000 fulltext documents, of interest to people working in particle physics and related areas. My project consisted on extracting KPIs (Key Performance Indicators) from it and feeding them to a central IT KPI system. To achieve this, I learned the CDS-Invenio open source digital library software, and worked with its statistic module.

  13. Photophysical Properties of II-VI Semiconductor Nanocrystals

    Science.gov (United States)

    Gong, Ke

    As it is well known, semiconductor nanocrystals (also called quantum dots, QDs) are being actively pursued for use in many different types of luminescent optical materials. These materials include the active media for luminescence downconversion in artificial lighting, lasers, luminescent solar concentrators and many other applications. Chapter 1 gives general introduction of QDs, which describe the basic physical properties and optical properties. Based on the experimental spectroscopic study, a semiquantitative method-effective mass model is employed to give theoretical prediction and guide. The following chapters will talks about several topics respectively. A predictive understanding of the radiative lifetimes is therefore a starting point for the understanding of the use of QDs for these applications. Absorption intensities and radiative lifetimes are fundamental properties of any luminescent material. Meantime, achievement of high efficiency with high working temperature and heterostructure fabrication with manipulation of lattice strain are not easy and need systematic investigation. To make accurate connections between extinction coefficients and radiative recombination rates, chapter 2 will consider three closely related aspects of the size dependent spectroscopy of II-VI QDs. First, it will consider the existing literature on cadmium selenide (CdSe) QD absorption spectra and extinction coefficients. From these results and fine structure considerations Boltzmann weighted radiative lifetimes are calculated. These lifetimes are compared to values measured on very high quality CdSe and CdSe coated with zinc selenide (ZnSe) shells. Second, analogous literature data are analyzed for cadmium telluride (CdTe) nanocrystals and compared to lifetimes measured for very high quality QDs. Furthermore, studies of the absorption and excitation spectra and measured radiative lifetimes for CdTe/CdSe Type-II core/shell QDs are reported. These results are also analyzed in

  14. Designing Selectivity in Metal-Semiconductor Nanocrystals: Synthesis, Characterization, and Self-Assembly

    Science.gov (United States)

    Pavlopoulos, Nicholas George

    This dissertation contains six chapters detailing recent advances that have been made in the synthesis and characterization of metal-semiconductor hybrid nanocrystals (HNCs), and the applications of these materials. Primarily focused on the synthesis of well-defined II-VI semiconductor nanorod (NR) and tetrapod (TP) based constructs of interest for photocatalytic and solar energy applications, the research described herein discusses progress towards the realization of key design rules for the synthesis of functional semiconductor nanocrystals (NCs). As such, a blend of novel synthesis, advanced characterization, and direct application of heterostructured nanoparticles are presented. The first chapter is a review summarizing the design, synthesis, properties, and applications of multicomponent nanomaterials composed of disparate semiconductor and metal domains. By coupling two compositionally distinct materials onto a single nanocrystal, synergistic properties can arise that are not present in the isolated components, ranging from self-assembly to photocatalysis. For semiconductor nanomaterials, this was first realized in the ability to tune nanomaterial dimensions from 0-D quantum dot (QD) structures to cylindrical (NR) and branched (TP) structures by exploitation of advanced colloidal synthesis techniques and understandings of NC facet reactivities. The second chapter is focused on the synthesis and characterization of well-defined CdSe-seeded-CdS (CdSe CdS) NR systems synthesized by overcoating of wurtzite (W) CdSe quantum dots with W-CdS shells. 1-dimensional NRs have been interesting constructs for applications such as solar concentrators, optical gains, and photocatalysis. Through synthetic control over CdSe CdS NR systems, materials with small and large CdSe seeds were prepared, and for each seed size, multiple NR lengths were prepared. Through transient absorption studies, it was found that band alignment did not affect the efficiency of charge localization

  15. Template synthesis of highly crystalline and monodisperse iron oxide pigments of nanosize

    International Nuclear Information System (INIS)

    Sreeram, Kalarical Janardhanan; Indumathy, Ramasamy; Rajaram, Ananthanarayanan; Nair, Balachandran Unni; Ramasami, Thirumalachari

    2006-01-01

    Synthesis of highly crystalline and monodisperse iron oxide nanoparticles is reported. The separation of Fe centers through site-specific binding to a polysaccharide-alginate matrix enables the generation of particles with a monodisperse or narrow size distribution character, resulting in transparent pigments. Site-specific interactions coupled with gel like character of alginate is proposed as the mechanism behind generation of lower particle sizes. Alginate-Fe complexes developed were subjected to heat treatment to provide for crystalline character and development of hematite (α-Fe 2 O 3 ). Conditions most ideal for achieving monodispersity and lower sizes have been optimized and confirmed through microscopic and photon correlation spectroscopic measurements

  16. Visualization of nanocrystal breathing modes at extreme strains

    Science.gov (United States)

    Szilagyi, Erzsi; Wittenberg, Joshua S.; Miller, Timothy A.; Lutker, Katie; Quirin, Florian; Lemke, Henrik; Zhu, Diling; Chollet, Matthieu; Robinson, Joseph; Wen, Haidan; Sokolowski-Tinten, Klaus; Lindenberg, Aaron M.

    2015-03-01

    Nanoscale dimensions in materials lead to unique electronic and structural properties with applications ranging from site-specific drug delivery to anodes for lithium-ion batteries. These functional properties often involve large-amplitude strains and structural modifications, and thus require an understanding of the dynamics of these processes. Here we use femtosecond X-ray scattering techniques to visualize, in real time and with atomic-scale resolution, light-induced anisotropic strains in nanocrystal spheres and rods. Strains at the percent level are observed in CdS and CdSe samples, associated with a rapid expansion followed by contraction along the nanosphere or nanorod radial direction driven by a transient carrier-induced stress. These morphological changes occur simultaneously with the first steps in the melting transition on hundreds of femtosecond timescales. This work represents the first direct real-time probe of the dynamics of these large-amplitude strains and shape changes in few-nanometre-scale particles.

  17. One-pot size-controlled growth of graphene-encapsulated germanium nanocrystals

    Science.gov (United States)

    Lee, Jae-Hyun; Lee, Eun-Kyung; Kang, Seog-Gyun; Jung, Su-Ho; Son, Seok-Kyun; Nam, Woo Hyun; Kim, Tae-Hoon; Choi, Byong Lyong; Whang, Dongmok

    2018-05-01

    To realize graphene-encapsulated semiconductor nanocrystals (NCs), an additional graphene coating process, which causes shape destruction and chemical contamination, has so far been inevitable. We report herein one-pot growth of uniform graphene-germanium core-shell nanocrystals (Ge@G NCs) in gram scale by the addition of methane as a carbon source during the thermal pyrolysis of germane. The methane plays a critical role in the growth of the graphene shell, as well as in the determination of the nucleation density and diameter of the NCs, similar to a surfactant in the liquid-phase growth of monodisperse NCs. By adjusting the gas ratio of precursors, a mixture of germane and methane, we can control the size of the Ge@G NCs in the range of ∼5-180 nm. The Ge@G NCs were characterized by various microscopic and spectroscopic tools, which indicated that the Ge core is single crystalline, and is completely covered by the graphene shell. We further investigated the merits of the graphene shell, which can enhance the electrical conductivity of nanocrystalline materials.

  18. Structure Map for Embedded Binary Alloy Nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Yuan, C.W.; Shin, S.J.; Liao, C.Y.; Guzman, J.; Stone, P.R.; Watanabe, M.; Ager III, J.W.; Haller, E.E.; Chrzan, D.C.

    2008-09-20

    The equilibrium structure of embedded nanocrystals formed from strongly segregating binary-alloys is considered within a simple thermodynamic model. The model identifies two dimensionlessinterface energies that dictate the structure, and allows prediction of the stable structure for anychoice of these parameters. The resulting structure map includes three distinct nanocrystal mor-phologies: core/shell, lobe/lobe, and completely separated spheres.

  19. Hollow nanocrystals and method of making

    Science.gov (United States)

    Alivisatos, A Paul [Oakland, CA; Yin, Yadong [Moreno Valley, CA; Erdonmez, Can Kerem [Berkeley, CA

    2011-07-05

    Described herein are hollow nanocrystals having various shapes that can be produced by a simple chemical process. The hollow nanocrystals described herein may have a shell as thin as 0.5 nm and outside diameters that can be controlled by the process of making.

  20. Synthesis, spectroscopy and simulation of doped nanocrystals

    NARCIS (Netherlands)

    Suyver, Jan Frederik

    2003-01-01

    This thesis deals with the properties of semiconductor nanocrystals (ZnS or ZnSe) in the size range (diameter) of 2 nm to 10 nm. The nanocrystals under investigation are doped with the transition metal ions manganese or copper. The goal is to study photoluminescence and electroluminescence from

  1. Electronic displays using optically pumped luminescent semiconductor nanocrystals

    Science.gov (United States)

    Weiss, Shimon [Pinole, CA; Schlamp, Michael C [Plainsboro, NJ; Alivisatos, A Paul [Oakland, CA

    2011-09-27

    A multicolor electronic display is based on an array of luminescent semiconductor nanocrystals. Nanocrystals which emit light of different colors are grouped into pixels. The nanocrystals are optically pumped to produce a multicolor display. Different sized nanocrystals are used to produce the different colors. A variety of pixel addressing systems can be used.

  2. Symmetry breaking during seeded growth of nanocrystals.

    Science.gov (United States)

    Xia, Xiaohu; Xia, Younan

    2012-11-14

    Currently, most of the reported noble-metal nanocrystals are limited to a high level of symmetry, as constrained by the inherent, face-centered cubic (fcc) lattice of these metals. In this paper, we report, for the first time, a facile and versatile approach (backed up by a clear mechanistic understanding) for breaking the symmetry of an fcc lattice and thus obtaining nanocrystals with highly unsymmetrical shapes. The key strategy is to induce and direct the growth of nanocrystal seeds into unsymmetrical modes by manipulating the reduction kinetics. With silver as an example, we demonstrated that the diversity of possible shapes taken by noble-metal nanocrystals could be greatly expanded by incorporating a series of new shapes drastically deviated from the fcc lattice. This work provides a new method to investigate shape-controlled synthesis of metal nanocrystal.

  3. Measuring the Valence of Nanocrystal Surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Owen, Jonathan Scharle [Columbia Univ., New York, NY (United States)

    2016-11-30

    The goal of this project is to understand and control the interplay between nanocrystal stoichiometry, surface ligand binding and exchange, and the optoelectronic properties of semiconductor nanocrystals in solution and in thin solid films. We pursued three research directions with this goal in mind: 1) We characterized nanocrystal stoichiometry and its influence on the binding of L-type and X-type ligands, including the thermodynamics of binding and the kinetics of ligand exchange. 2) We developed a quantitative understanding of the relationship between surface ligand passivation and photoluminescence quantum yield. 3) We developed methods to replace the organic ligands on the nanocrystal with halide ligands and controllably deposit these nanocrystals into thin films, where electrical measurements were used to investigate the electrical transport and internanocrystal electronic coupling.

  4. Co-sensitization of quantum dot sensitized solar cells composed of TiO2 nanocrystalline photoanode with CdS and PbS nanoparticles and effect of PbS on the performance of solar cell

    Directory of Open Access Journals (Sweden)

    Maziar Marandi

    2017-09-01

    Full Text Available In this research, CdS and PbS quantum dots were applied as the light sensitizers in TiO2 based nanostructured solar cells. The PbS quantum dots could absorb a wide range of the sunlight spectrum on earth due to their low bandgap energy. As a result, the cell sensitization is more effective by application of both CdS and PbS quantum dots sensitizers. The TiO2 nanocrystals were synthesized through a hydrothermal process and deposited on FTO glass substrates as the photoanode scaffold. Then PbS quantum dots were grown on the surface of this nanocrystalline layer by a successive ionic layer adsorption and reaction (SILAR method. The CdS quantum dots were over-grown in the next step through a similar deposition method. Finally this sensitized layer was applied as the photoelectrode of the corresponding quantum dot sensitized solar cells. The results demonstrated that the maximum efficiency was achieved for the cell with a photoanode made of co-sensitization through 2 and 6 cycles of PbS and CdS deposition, respectively. The photovoltaic parameters of this cell were measured as Jsc of 10.81 mA/cm2, Voc of 590 mv and energy conversion efficiency of 2.7+0.2%.

  5. Simple and inexpensive microfluidic devices for the generation of monodisperse multiple emulsions

    KAUST Repository

    Li, Erqiang; Zhang, Jiaming; Thoroddsen, Sigurdur T

    2013-01-01

    of expensive apparatus and a complex manufacturing procedure. Here, we report the design and fabrication of simple and inexpensive microfluidic devices based on microscope glass slides and pulled glass capillaries, for generating monodisperse multiple emulsions

  6. Application of monodisperse fibers and discs to evaluation of the aerodynamic particle sizer

    International Nuclear Information System (INIS)

    Hoover, M.D.; Lipowicz, P.J.; Hanson, R.W.; Yeh, H.C.; Casalnuovo, S.A.

    1988-01-01

    Monodisperse fibers, μm in width and lengths of 5, 10, 20, and 40 μm, as well as monodisperse discs, 2 4 8, or 12 μm in diameter, were prepared using an integrated circuit microchip fabrication technique. Particles were silicon dioxide with thickness of 1 μm. Examination of the particles using a scanning electron microscope showed that they were uniform in shape, with well-defined edges. The particles were suspended in distilled water and aerosolized with a Lovelace nebullizer. The monodisperse particles were used to evaluate the TSI Aerodynamic Particle Sizer (APS). Carbon fibers that were monodisperse in diameter (count median diameter 3.42 μm, geometric standard deviation 1.06) and polydisperse in length (count median length = 28 μm, geometric standard deviation 2.2) were also used. The APS was found to be insensitive to fiber length and only weakly sensitive to disc diameter. (author)

  7. Facile and Scalable Synthesis of Monodispersed Spherical Capsules with a Mesoporous Shell

    KAUST Repository

    Qi, Genggeng

    2010-05-11

    Monodispersed HMSs with tunable particle size and shell thickness were successfully synthesized using relatively concentrated polystyrene latex templates and a silica precursor in a weakly basic ethanol/water mixture. The particle size of the capsules can vary from 100 nm to micrometers. These highly engineered monodispersed capsules synthesized by a facile and scalable process may find applications in drug delivery, catalysis, separationm or as biological and chemical microreactors. © 2010 American Chemical Society.

  8. Biotemplate synthesis of monodispersed iron phosphate hollow microspheres

    International Nuclear Information System (INIS)

    Cao Feng; Li Dongxu

    2010-01-01

    Monodispersed iron phosphate hollow microspheres with a high degree of crystallization were prepared through a facile in situ deposition method using rape pollen grains as a biotemplate. The functional group on the surface of the pollen grains could adsorb Fe 3+ , which provided the nucleation sites for growth of iron phosphate nanoparticles. After being sintered at 600 deg. C for 10 h, the pollen grains were removed and iron phosphate hollow microspheres were obtained. A scanning electron microscope and x-ray diffraction were applied to characterize the morphology and crystalline structure of the pollen grains, iron phosphate-coated pollen grains and iron phosphate hollow microspheres. Differential scanning calorimetry and thermogravity analyses were performed to investigate the thermal behavior of the iron phosphate-coated pollen grains during the calcinations. Energy dispersive spectroscopy and Fourier transform infrared spectroscopy were utilized to investigate the interaction between the pollen grains and iron phosphate. The effect of the pollen wall on the surface morphology of these iron phosphate hollow microspheres was also proven in this work.

  9. Biotemplate synthesis of monodispersed iron phosphate hollow microspheres

    Energy Technology Data Exchange (ETDEWEB)

    Cao Feng; Li Dongxu, E-mail: dongxuli@njut.edu.c [College of Materials Science and Engineering, Nanjing University of Technology, Jiangsu Nanjing 210009 (China)

    2010-03-15

    Monodispersed iron phosphate hollow microspheres with a high degree of crystallization were prepared through a facile in situ deposition method using rape pollen grains as a biotemplate. The functional group on the surface of the pollen grains could adsorb Fe{sup 3+}, which provided the nucleation sites for growth of iron phosphate nanoparticles. After being sintered at 600 deg. C for 10 h, the pollen grains were removed and iron phosphate hollow microspheres were obtained. A scanning electron microscope and x-ray diffraction were applied to characterize the morphology and crystalline structure of the pollen grains, iron phosphate-coated pollen grains and iron phosphate hollow microspheres. Differential scanning calorimetry and thermogravity analyses were performed to investigate the thermal behavior of the iron phosphate-coated pollen grains during the calcinations. Energy dispersive spectroscopy and Fourier transform infrared spectroscopy were utilized to investigate the interaction between the pollen grains and iron phosphate. The effect of the pollen wall on the surface morphology of these iron phosphate hollow microspheres was also proven in this work.

  10. Monodisperse Platinum and Rhodium Nanoparticles as Model Heterogeneous Catalysts

    Energy Technology Data Exchange (ETDEWEB)

    Grass, Michael Edward [Univ. of California, Berkeley, CA (United States)

    2008-09-01

    Model heterogeneous catalysts have been synthesized and studied to better understand how the surface structure of noble metal nanoparticles affects catalytic performance. In this project, monodisperse rhodium and platinum nanoparticles of controlled size and shape have been synthesized by solution phase polyol reduction, stabilized by polyvinylpyrrolidone (PVP). Model catalysts have been developed using these nanoparticles by two methods: synthesis of mesoporous silica (SBA-15) in the presence of nanoparticles (nanoparticle encapsulation, NE) to form a composite of metal nanoparticles supported on SBA-15 and by deposition of the particles onto a silicon wafer using Langmuir-Blodgett (LB) monolayer deposition. The particle shapes were analyzed by transmission electron microscopy (TEM) and high resolution TEM (HRTEM) and the sizes were determined by TEM, X-ray diffraction (XRD), and in the case of NE samples, room temperature H2 and CO adsorption isotherms. Catalytic studies were carried out in homebuilt gas-phase reactors. For the nanoparticles supported on SBA-15, the catalysts are in powder form and were studied using the homebuilt systems as plug-flow reactors. In the case of nanoparticles deposited on silicon wafers, the same systems were operated as batch reactors. This dissertation has focused on the synthesis, characterization, and reaction studies of model noble metal heterogeneous catalysts. Careful control of particle size and shape has been accomplished though solution phase synthesis of Pt and Rh nanoparticles in order to elucidate further structure-reactivity relationships in noble metal catalysis.

  11. Grafted SiC nanocrystals

    DEFF Research Database (Denmark)

    Saini, Isha; Sharma, Annu; Dhiman, Rajnish

    2017-01-01

    ), raman spectroscopy and X-ray diffraction (XRD) measurements. UV–Visible absorption spectroscopy was used to study optical properties such as optical energy gap (Eg), Urbach's energy (Eu), refractive index (n), real (ε1) and imaginary (ε2) parts of dielectric constant of PVA as well as PVA......Polyvinyl alcohol (PVA) grafted SiC (PVA-g-SiC)/PVA nanocomposite was synthesized by incorporating PVA grafted silicon carbide (SiC) nanocrystals inside PVA matrix. In-depth structural characterization of resulting nanocomposite was carried out using fourier transform infrared spectroscopy (FTIR...

  12. Development Considerations for Nanocrystal Drug Products.

    Science.gov (United States)

    Chen, Mei-Ling; John, Mathew; Lee, Sau L; Tyner, Katherine M

    2017-05-01

    Nanocrystal technology has emerged as a valuable tool for facilitating the delivery of poorly water-soluble active pharmaceutical ingredients (APIs) and enhancing API bioavailability. To date, the US Food and Drug Administration (FDA) has received over 80 applications for drug products containing nanocrystals. These products can be delivered by different routes of administration and are used in a variety of therapeutic areas. To aid in identifying key developmental considerations for these products, a retrospective analysis was performed on the submissions received by the FDA to date. Over 60% of the submissions were for the oral route of administration. Based on the Biopharmaceutics Classification System (BCS), most nanocrystal drugs submitted to the FDA are class II compounds that possess low aqueous solubility and high intestinal permeability. Impact of food on drug bioavailability was reduced for most nanocrystal formulations as compared with their micronized counterparts. For all routes of administration, dose proportionality was observed for some, but not all, nanocrystal products. Particular emphasis in the development of nanocrystal products was placed on the in-process tests and controls at critical manufacturing steps (such as milling process), mitigation and control of process-related impurities, and the stability of APIs or polymorphic form (s) during manufacturing and upon storage. This emphasis resulted in identifying challenges to the development of these products including accurate determination of particle size (distribution) of drug substance and/or nanocrystal colloidal dispersion, identification of polymorphic form (s), and establishment of drug substance/product specifications.

  13. Optical Sensor Based on a Single CdS Nanobelt

    Directory of Open Access Journals (Sweden)

    Lei Li

    2014-04-01

    Full Text Available In this paper, an optical sensor based on a cadmium sulfide (CdS nanobelt has been developed. The CdS nanobelt was synthesized by the vapor phase transportation (VPT method. X-Ray Diffraction (XRD and Transmission Electron Microscopy (TEM results revealed that the nanobelt had a hexagonal wurtzite structure of CdS and presented good crystal quality. A single nanobelt Schottky contact optical sensor was fabricated by the electron beam lithography (EBL technique, and the device current-voltage results showed back-to-back Schottky diode characteristics. The photosensitivity, dark current and the decay time of the sensor were 4 × 104, 31 ms and 0.2 pA, respectively. The high photosensitivity and the short decay time were because of the exponential dependence of photocurrent on the number of the surface charges and the configuration of the back to back Schottky junctions.

  14. Optical sensor based on a single CdS nanobelt.

    Science.gov (United States)

    Li, Lei; Yang, Shuming; Han, Feng; Wang, Liangjun; Zhang, Xiaotong; Jiang, Zhuangde; Pan, Anlian

    2014-04-23

    In this paper, an optical sensor based on a cadmium sulfide (CdS) nanobelt has been developed. The CdS nanobelt was synthesized by the vapor phase transportation (VPT) method. X-Ray Diffraction (XRD) and Transmission Electron Microscopy (TEM) results revealed that the nanobelt had a hexagonal wurtzite structure of CdS and presented good crystal quality. A single nanobelt Schottky contact optical sensor was fabricated by the electron beam lithography (EBL) technique, and the device current-voltage results showed back-to-back Schottky diode characteristics. The photosensitivity, dark current and the decay time of the sensor were 4 × 10⁴, 31 ms and 0.2 pA, respectively. The high photosensitivity and the short decay time were because of the exponential dependence of photocurrent on the number of the surface charges and the configuration of the back to back Schottky junctions.

  15. Mn2+ anchored CdS polymer nanocomposites: An efficient alternative for Mn2+ doped CdS nanoparticles

    International Nuclear Information System (INIS)

    Saikia, Bhaskar Jyoti; Nath, Bikash Chandra; Borah, Chandramika; Dolui, Swapan Kumar

    2015-01-01

    A chelating bi-functional polymer brushes was prepared via atom transfer radical polymerization using grafting-from methodology. Mn 2+ -anchored CdS-polymer nanocomposites were synthesized using this graft copolymer by simple chelation method resulting in emission at about 620 nm which originates from the fluorescence of manganese ions embedded on the surface of CdS nanoparticles. This method provides an efficient straightforward substitute of Mn 2+ dopped CdS nanoparticles. Optical properties of the composites were investigated which indicates that simple Mn 2+ chelation and subsequent binding of CdS in a polymer matrix can have similar effect in the luminescence property as those synthesized via complex doping methods. Moreover this methodology can be applied for synthesis of any metal anchored nanocomposites proficiently and cost effectively in large-scale production. - Highlights: • A chelating bifunctional copolymer brush was synthesized via ATRP. • CdS nanoparticles and Mn 2+ were coupled with the bifunctional polymer. • Composites showed emission properties similar to Mn 2+ doped CdS nanoparticles. • Side chain length of the polymers also affect the emission properties of the composites.

  16. Mechanochemical Synthesis of Nanocrystalline CdS in a Laboratory and Industrial Mill

    Directory of Open Access Journals (Sweden)

    Eberhard Gock

    2004-12-01

    Full Text Available Nanocrystalline materials have been of interest of more than 20 years and this interest is still increasing. The preparation and characterization of different chalcogenides have attracted a considerable attention due to their important nonlinear properties, luminiscent properties and other important physical and chemical properties. The main cause is in their unusual properties based on the high concentration of atoms in interfacial structures and the relatively simple ways of their preparation. Nanoparticles of semiconductors have many potential applications in the area of advanced materials. These materials can be synthesized via solid state reactions where the recovery degree can be strongly enhanced by the intervention of mechanical activation. Mechanochemical synthesis belongs among the synthesis route which can effectively control and regulate the course of solid state reactions.This paper describes structural and surface properties of cadmium sulphide nanoparticles synthesized in a planetary mill and in an eccentric vibratory mill. The main aim of this paper was to illustrate the potential of this technique for the large-scale production of CdS nanopowder.CdS nanoparticles were successfully synthesized by the mechanochemical route from the cadmium acetate and natrium sulphide. Structure properties of the as-prepared products were characterized by X-ray powder diffraction. X-ray diffraction patterns reveal the crystalline nature of CdS nanoparticles. Hexagonal ƒ¿-CdS greenockite together with cubic hawleyite ƒÀ-CdS are present among the products of mechanochemical synthesis. The methods of SEM, particle size analysis and low temperature nitrogen sorption were used to analyze the surface composition. The SEM measurements show the aggregates of small nanocrystals in which particle sizes of 5-9 nm were estimated by ScherrerLs formula.The cadmium sulphide nanoparticles are obtained in the simple step, making the process attractive for

  17. A CDO option market model on standardized CDS index tranches

    DEFF Research Database (Denmark)

    Dorn, Jochen

    We provide a market model which implies a dynamic for standardized CDS index tranche spreads. This model is useful for pricing options on tranches with future Issue Dates as well as for modeling emerging options on struc- tured credit derivatives. With the upcoming regulation of the CDS market...... in perspective, the model presented here is also an attempt to face the e ects on pricing approaches provoked by an eventual Clearing Chamber . It becomes also possible to calibrate Index Tranche Options with bespoke tenors/tranche subordination to market data obtained by more liquid Index Tranche Options...

  18. Controlled synthesis and magnetic properties of monodispersed ceria nanoparticles

    Directory of Open Access Journals (Sweden)

    Sumeet Kumar

    2015-02-01

    Full Text Available In the present study, monodispersed CeO2 nanoparticles (NPs of size 8.5 ± 1.0, 11.4 ± 1.0 and 15.4 ± 1.0 nm were synthesized using the sol-gel method. Size-dependent structural, optical and magnetic properties of as-prepared samples were investigated by X-ray diffraction (XRD, field emission scanning electron microscope (FE-SEM, high resolution transmission electron microscopy (HR-TEM, ultra-violet visible (UV-VIS spectroscopy, Raman spectroscopy and vibrating sample magnetometer (VSM measurements. The value of optical band gap is calculated for each particle size. The decrease in the value of optical band gap with increase of particle size may be attributed to the quantum confinement, which causes to produce localized states created by the oxygen vacancies due to the conversion of Ce4+ into Ce3+ at higher calcination temperature. The Raman spectra showed a peak at ∼461 cm-1 for the particle size 8.5 nm, which is attributed to the 1LO phonon mode. The shift in the Raman peak could be due to lattice strain developed due to variation in particle size. Weak ferromagnetism at room temperature is observed for each particle size. The values of saturation magnetization (Ms, coercivity (Hc and retentivity (Mr are increased with increase of particle size. The increase of Ms and Mr for larger particle size may be explained by increase of density of oxygen vacancies at higher calcination temperature. The latter causes high concentrations of Ce3+ ions activate more coupling between the individual magnetic moments of the Ce ions, leading to an increase of Ms value with the particle size. Moreover, the oxygen vacancies may also produce magnetic moment by polarizing spins of f electrons of cerium (Ce ions located around oxygen vacancies, which causes ferromagnetism in pure CeO2 samples.

  19. Formation of monodisperse mesoporous silica microparticles via spray-drying.

    Science.gov (United States)

    Waldron, Kathryn; Wu, Winston Duo; Wu, Zhangxiong; Liu, Wenjie; Selomulya, Cordelia; Zhao, Dongyuan; Chen, Xiao Dong

    2014-03-15

    In this work, a protocol to synthesize monodisperse mesoporous silica microparticles via a unique microfluidic jet spray-drying route is reported for the first time. The microparticles demonstrated highly ordered hexagonal mesostructures with surface areas ranging from ~900 up to 1500 m(2)/g and pore volumes from ~0.6 to 0.8 cm(3)/g. The particle size could be easily controlled from ~50 to 100 μm from the same diameter nozzle via changing the initial solute content, or changing the drying temperature. The ratio of the surfactant (CTAB) and silica (TEOS), and the amount of water in the precursor were found to affect the degree of ordering of mesopores by promoting either the self-assembly of the surfactant-silica micelles or the condensation of the silica as two competing processes in evaporation induced self-assembly. The drying rate and the curvature of particles also affected the self-assembly of the mesostructure. The particle mesostructure is not influenced by the inlet drying temperature in the range of 92-160 °C, with even a relatively low temperature of 92 °C producing highly ordered mesoporous microparticles. The spray-drying derived mesoporous silica microparticles, while of larger sizes and more rapidly synthesized, showed a comparable performance with the conventional mesoporous silica MCM-41 in controlled release of a dye, Rhodamine B, indicating that these spray dried microparticles could be used for the immobilisation and controlled release of small molecules. Copyright © 2013 Elsevier Inc. All rights reserved.

  20. Storage of optical excitations in colloidal semiconductor nanocrystals; Speicherung optischer Anregungen in kolloidalen Halbleiter-Nanokristallen

    Energy Technology Data Exchange (ETDEWEB)

    Kraus, Robert

    2009-07-22

    In the present theis it is described, how colloidal semiconductor nanocrystals can be used under influence of an electric field to store optical excitation energy at room temperature, to alter, and to supply controlledly. For this the photoluminescence emission of an ensemble of heterogeneous nanocrystals was manipulated and spectroscopically studied. The applied od-shaped particles consist of a spherical core of CdSe, on which an elongated shell of CdS is monocrystallinely be grown. The electron is in such an asymmetric geometry delocalized over the hole nanorod, whereas the hole because of the high potential barrier remains bound in the CdSe core. The wave-function overlap of the charge carriers can therefore be influenced both by the length of the nanorod and by an external electric field. In the regime of prompt fluorescence the manipulation of the charge-carrier separation by an electric field led to a suppression of the radiative recombination. As consequence a fluorescence suppression of about 40% could be observed. After the removal of the electric field the separation was reduced and the stored energy is in an fluorescence increasement directedly liberated again. The strength of the storage efficiency lies with the strength of the electric field in a linear connection. Furthermore in this time range a quantum-confined Stark effect of upt o 14 meV could be detected at room temperature, although the effect is complicated by the different orientations and sizes of the nanorods in the ensemble. Hereby it is of advance to can adress with the applied detection technique a subensemble of nanocrystals. Furthermore a significant storage of the ensmble emission by up to 100 {mu}s conditioned by the electric electric fieldcould be demonstrated, which exceeds the fluorescence lifetime of these particles by the 10{sup 5} fold. As also could be shown by experiments on CdSe/ZnS nanocrystals surface states play a relevent role for the emission dynamics of nanocrystals

  1. The CDS and the Government Bonds Markets During the Last Financial Crisis

    Directory of Open Access Journals (Sweden)

    Križanič France

    2015-11-01

    Full Text Available Financial market had developed a special instrument to insure the buyers of bonds. This instrument is so called Credit Default Swap (CDS. The CDS price is a kind of insurance premium that the buyer of CDS pays to the seller of CDS in exchange for compensation of possible loss in operation. Paper analyses causality between CDS price and dynamics of bond yields and influence of macroeconomic factors on it in four selected countries during the last financial crisis. Analysis results show that there is no important macroeconomic variable included in the analysis that preceded the CDS prices connected with German government bonds. Sellers of CDS were apparently aware of the systemic nature of the financial crisis in the euro area. In the case of the United Kingdom, Russia and Slovenia we can observe the unemployment rate as the most important macroeconomic variable that preceded the CDS prices for government bonds.

  2. Charge transport in a CoPt3 nanocrystal microwire

    International Nuclear Information System (INIS)

    Beecher, P.; De Marzi, G.; Quinn, A.J.; Redmond, G.; Shevchenko, E.V.; Weller, H.

    2004-01-01

    The electrical characteristics of single CoPt 3 nanocrystal microwires formed by magnetic field-directed growth from colloidal solutions are presented. The wires comprise disordered assemblies of discrete nanocrystals, separated from each other by protective organic ligand shells. Electrical data indicate that the activated charge transport properties of the wires are determined by the nanocrystal charging energy, governed by the size and capacitance of the individual nanocrystals. Focused ion beam-assisted deposition of Pt metal at the wire-electrode junctions is employed to optimize the wire-electrode contacts, whilst maintaining the nanocrystal-dominated transport characteristics of these one-dimensional nanocrystal structures

  3. Composite material including nanocrystals and methods of making

    Science.gov (United States)

    Bawendi, Moungi G.; Sundar, Vikram C.

    2010-04-06

    Temperature-sensing compositions can include an inorganic material, such as a semiconductor nanocrystal. The nanocrystal can be a dependable and accurate indicator of temperature. The intensity of emission of the nanocrystal varies with temperature and can be highly sensitive to surface temperature. The nanocrystals can be processed with a binder to form a matrix, which can be varied by altering the chemical nature of the surface of the nanocrystal. A nanocrystal with a compatibilizing outer layer can be incorporated into a coating formulation and retain its temperature sensitive emissive properties.

  4. High Temperature AL-Nanocrystal Alloy Synthesis

    National Research Council Canada - National Science Library

    Perepezko, J

    2001-01-01

    Aluminum-rich metallic glasses containing transition metals and rare earth elements have been found to yield finely mixed microstructures of Al nanocrystals embedded in an amorphous matrix and exhibit...

  5. Semiconductor-nanocrystal/conjugated polymer thin films

    Science.gov (United States)

    Alivisatos, A. Paul; Dittmer, Janke J.; Huynh, Wendy U.; Milliron, Delia

    2014-06-17

    The invention described herein provides for thin films and methods of making comprising inorganic semiconductor-nanocrystals dispersed in semiconducting-polymers in high loading amounts. The invention also describes photovoltaic devices incorporating the thin films.

  6. Green synthesis of water soluble semiconductor nanocrystals and their applications

    Science.gov (United States)

    Wang, Ying

    II-VI semiconductor nanomaterials, e.g. CdSe and CdTe, have attracted great attention over the past decades due to their fascinating optical and electrical properties. The research presented here focuses on aqueous semiconductor nanomaterials. The work can be generally divided into three parts: synthesis, property study and application. The synthetic work is devoted to develop new methods to prepare shape- and structure-controlled II-VI semiconductor nanocrystals including nanoparticles and nanowires. CdSe and CdSe CdS semiconductor nanocrystals have been synthesized using sodium citrate as a stabilizer. Upon prolonged illumination with visible light, photoluminescence quantum yield of those quantum dots can be enhanced up to 5000%. The primary reason for luminescence enhancement is considered to be the removing of specific surface states (photocorrosion) and the smoothing of the CdSe core surface (photoannealing). CdTe nanowires are prepared through self-organization of stabilizer-depleted CdTe nanoparticles. The dipolar-dipolar attraction is believed to be the driving force of nanowire formation. The rich surface chemistry of CdTe nanowire is reflected by the formation of silica shell with different morphologies when nanowires with different capping ligands are used. Te and Se nanowires are prepared by chemical decomposition of CdTe and CdSe nanoparticles in presence of an external chemical stimulus, EDTA. These results not only provide a new example of NP→NW transformation, but also lead to a better understanding of the molecular process occurring in the stabilizer-depleted nanoparticles. The applications of those semiconductor materials are primarily based on the construction of nano-structured ultrathin films with desirable functions by using layer-by-layer technique (LBL). We demonstrate that light-induced micro-scale multicolor luminescent patterns can be obtained on photoactivable CdSe/CdS nanoparticles thin films by combining the advantages of LBL as

  7. White emitting CdS quantum dot nanoluminophores hybridized on near-ultraviolet LEDs for high-quality white light generation and tuning

    International Nuclear Information System (INIS)

    Nizamoglu, Sedat; Mutlugun, Evren; Akyuz, Ozgun; Perkgoz, Nihan Kosku; Demir, Hilmi Volkan; Liebscher, Lydia; Sapra, Sameer; Gaponik, Nikolai; Eychmueller, Alexander

    2008-01-01

    To generate white light using semiconductor nanocrystal (NC) quantum dots integrated on light emitting diodes (LEDs), multiple hybrid device parameters (emission wavelengths of the NCs and the excitation platform, order of the NCs with different sizes, amount of the different types of NCs, etc) need to be carefully designed and properly implemented. In this study, we introduce and demonstrate white LEDs based on simple device hybridization using only a single type of white emitting CdS quantum dot nanoluminophores on near-ultraviolet LEDs. Here we present their design, synthesis-growth, fabrication and characterization. With these hybrid devices, we achieve high color rendering index (>70), despite using only a single NC type. Furthermore, we conveniently tune their photometric properties including the chromaticity coordinates, correlated color temperature, and color rendering index with the number of hybridized nanoluminophores in a controlled manner

  8. Photoluminescence of nanocrystals embedded in oxide matrices

    International Nuclear Information System (INIS)

    Estrada, C.; Gonzalez, J.A.; Kunold, A.; Reyes-Esqueda, J.A.; Pereyra, P.

    2006-12-01

    We used the theory of finite periodic systems to explain the photoluminescence spectra dependence on the average diameter of nanocrystals embedded in oxide matrices. Because of the broad matrix band gap, the photoluminescence response is basically determined by isolated nanocrystals and sequences of a few of them. With this model we were able to reproduce the shape and displacement of the experimentally observed photoluminescence spectra. (author)

  9. Applying analytical ultracentrifugation to nanocrystal suspensions

    Energy Technology Data Exchange (ETDEWEB)

    Jamison, Jennifer A; Krueger, Karl M; Mayo, J T; Yavuz, Cafer T; Redden, Jacina J; Colvin, Vicki L, E-mail: colvin@rice.ed [Department of Chemistry, Rice University, 6100 Main Street, MS-60, Houston, TX 77005 (United States)

    2009-09-02

    While applied frequently in physical biochemistry to the study of protein complexes, the quantitative use of analytical ultracentrifugation (AUC) for nanocrystal analysis is relatively rare. Its application in nanoscience is potentially very powerful as it provides a measure of nanocrystal density, size and structure directly in the solution phase. Towards that end, this paper examines the best practices for applying data collection and analysis methods for AUC, geared towards the study of biomolecules, to the unique problems of nanoparticle analysis. Using uniform nanocrystals of cadmium selenide, we compared several schemes for analyzing raw sedimentation data. Comparable values of the mean sedimentation coefficients (s-value) were found using several popular analytical approaches; however, the distribution in sample s-values is best captured using the van Holde-Weischt algorithm. Measured s-values could be reproducibly collected if sample temperature and concentration were controlled; under these circumstances, the variability for average sedimentation values was typically 5%. The full shape of the distribution in s-values, however, is not easily subjected to quantitative interpretation. Moreover, the selection of the appropriate sedimentation speed is crucial for AUC of nanocrystals as the density of inorganic nanocrystals is much larger than that of solvents. Quantitative analysis of sedimentation properties will allow for better agreement between experimental and theoretical models of nanocrystal solution behavior, as well as providing deeper insight into the hydrodynamic size and solution properties of nanomaterials.

  10. The use of CDS/ISIS software in Africa | Abboy | Innovation

    African Journals Online (AJOL)

    CDS/ISIS is free-of-charge software that has been developed by UNESCO and is distributed through a network of country distributors and more recently through the World Wide Web. CDS/ISIS is ideally suited for the manipulation of bibliographic data. Literature sources reveal that the use of CDS/ISIS is widespread in Africa ...

  11. Dielectric properties of CdS nanoparticles synthesized by soft ...

    Indian Academy of Sciences (India)

    If the field applied to the condenser is time-dependent (as in an alternating current), so ... tematically the dielectric properties of CdS synthesized by a soft chemical method .... The real parts of conductivity spectra can be explained by the power ...

  12. The Learning Management System Evolution. CDS Spotlight Report. Research Bulletin

    Science.gov (United States)

    Lang, Leah; Pirani, Judith A.

    2014-01-01

    This Spotlight focuses on data from the 2013 Core Data Service (CDS) to better understand how higher education institutions approach learning management systems (LMSs). Information provided for this Spotlight was derived from Module 8 of the Core Data Service, which contains several questions regarding information systems and applications.…

  13. CdS films deposited by chemical bath under rotation

    International Nuclear Information System (INIS)

    Oliva-Aviles, A.I.; Patino, R.; Oliva, A.I.

    2010-01-01

    Cadmium sulfide (CdS) films were deposited on rotating substrates by the chemical bath technique. The effects of the rotation speed on the morphological, optical, and structural properties of the films were discussed. A rotating substrate-holder was fabricated such that substrates can be taken out from the bath during the deposition. CdS films were deposited at different deposition times (10, 20, 30, 40 and 50 min) onto Corning glass substrates at different rotation velocities (150, 300, 450, and 600 rpm) during chemical deposition. The chemical bath was composed by CdCl 2 , KOH, NH 4 NO 3 and CS(NH 2 ) 2 as chemical reagents and heated at 75 deg. C. The results show no critical effects on the band gap energy and the surface roughness of the CdS films when the rotation speed changes. However, a linear increase on the deposition rate with the rotation energy was observed, meanwhile the stoichiometry was strongly affected by the rotation speed, resulting a better 1:1 Cd/S ratio as speed increases. Rotation effects may be of interest in industrial production of CdTe/CdS solar cells.

  14. CdS films deposited by chemical bath under rotation

    Energy Technology Data Exchange (ETDEWEB)

    Oliva-Aviles, A.I., E-mail: aoliva@mda.cinvestav.mx [Centro de Investigacion y de Estudios Avanzados Unidad Merida, Departamento de Fisica Aplicada. A.P. 73-Cordemex, 97310 Merida, Yucatan (Mexico); Patino, R.; Oliva, A.I. [Centro de Investigacion y de Estudios Avanzados Unidad Merida, Departamento de Fisica Aplicada. A.P. 73-Cordemex, 97310 Merida, Yucatan (Mexico)

    2010-08-01

    Cadmium sulfide (CdS) films were deposited on rotating substrates by the chemical bath technique. The effects of the rotation speed on the morphological, optical, and structural properties of the films were discussed. A rotating substrate-holder was fabricated such that substrates can be taken out from the bath during the deposition. CdS films were deposited at different deposition times (10, 20, 30, 40 and 50 min) onto Corning glass substrates at different rotation velocities (150, 300, 450, and 600 rpm) during chemical deposition. The chemical bath was composed by CdCl{sub 2}, KOH, NH{sub 4}NO{sub 3} and CS(NH{sub 2}){sub 2} as chemical reagents and heated at 75 deg. C. The results show no critical effects on the band gap energy and the surface roughness of the CdS films when the rotation speed changes. However, a linear increase on the deposition rate with the rotation energy was observed, meanwhile the stoichiometry was strongly affected by the rotation speed, resulting a better 1:1 Cd/S ratio as speed increases. Rotation effects may be of interest in industrial production of CdTe/CdS solar cells.

  15. Electroluminescent Cu-doped CdS quantum dots

    NARCIS (Netherlands)

    Stouwdam, J.W.; Janssen, R.A.J.

    2009-01-01

    Incorporating Cu-doped CdS quantum dots into a polymer host produces efficient light-emitting diodes. The Cu dopant creates a trap level that aligns with the valence band of the host, enabling the direct injection of holes into the quantum dots, which act as emitters. At low current densities, the

  16. Extraction of CdS pigment from waste polyethylene

    NARCIS (Netherlands)

    Wanrooij, P.H.P.; Agarwal, U.S.; Meuldijk, J.; Kasteren, van J.M.N.; Lemstra, P.J.

    2006-01-01

    Cadmium sulfide has often been used as a pigment in plastics such as high-density polyethylene (HDPE). Removal of CdS after the useful life of plastics is desired since it poses an environmental hazard in the waste phase of these plastics. In this study, a process is investigated to convert the

  17. Characterization of chemically synthesized CdS nanoparticles

    Indian Academy of Sciences (India)

    Similar to the effects of charge carriers on optical properties, confinement of optical and acoustic phonons leads to interesting changes in the phonon spectra. In the present work, we have synthesized nanoparticles of CdS using chemical precipitation technique. The crystal structure and grain size of the particles are studied ...

  18. Bright trions in direct-bandgap silicon nanocrystals revealed bylow-temperature single-nanocrystal spectroscopy

    Czech Academy of Sciences Publication Activity Database

    Kůsová, Kateřina; Pelant, Ivan; Valenta, J.

    2015-01-01

    Roč. 4, Oct (2015), e336 ISSN 2047-7538 R&D Projects: GA ČR(CZ) GBP108/12/G108; GA ČR GPP204/12/P235 Institutional support: RVO:68378271 Keywords : silicon nanocrystals * single-nanocrystal spectroscopy * luminescing trions Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 13.600, year: 2015

  19. Solution synthesis of germanium nanocrystals

    Science.gov (United States)

    Gerung, Henry [Albuquerque, NM; Boyle, Timothy J [Kensington, MD; Bunge, Scott D [Cuyahoga Falls, OH

    2009-09-22

    A method for providing a route for the synthesis of a Ge(0) nanometer-sized material from. A Ge(II) precursor is dissolved in a ligand heated to a temperature, generally between approximately 100.degree. C. and 400.degree. C., sufficient to thermally reduce the Ge(II) to Ge(0), where the ligand is a compound that can bond to the surface of the germanium nanomaterials to subsequently prevent agglomeration of the nanomaterials. The ligand encapsulates the surface of the Ge(0) material to prevent agglomeration. The resulting solution is cooled for handling, with the cooling characteristics useful in controlling the size and size distribution of the Ge(0) materials. The characteristics of the Ge(II) precursor determine whether the Ge(0) materials that result will be nanocrystals or nanowires.

  20. Polyimide Cellulose Nanocrystal Composite Aerogels

    Science.gov (United States)

    Nguyen, Baochau N.; Meador, Mary Ann; Rowan, Stuart; Cudjoe, Elvis; Sandberg, Anna

    2014-01-01

    Polyimide (PI) aerogels are highly porous solids having low density, high porosity and low thermal conductivity with good mechanical properties. They are ideal for various applications including use in antenna and insulation such as inflatable decelerators used in entry, decent and landing operations. Recently, attention has been focused on stimuli responsive materials such as cellulose nano crystals (CNCs). CNCs are environmentally friendly, bio-renewable, commonly found in plants and the dermis of sea tunicates, and potentially low cost. This study is to examine the effects of CNC on the polyimide aerogels. The CNC used in this project are extracted from mantle of a sea creature called tunicates. A series of polyimide cellulose nanocrystal composite aerogels has been fabricated having 0-13 wt of CNC. Results will be discussed.

  1. 2009 Clusters, Nanocrystals & Nanostructures GRC

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Lai-Sheng [Washington State Univ., Pullman, WA (United States)

    2009-07-19

    For over thirty years, this Gordon Conference has been the premiere meeting for the field of cluster science, which studies the phenomena that arise when matter becomes small. During its history, participants have witnessed the discovery and development of many novel materials, including C60, carbon nanotubes, semiconductor and metal nanocrystals, and nanowires. In addition to addressing fundamental scientific questions related to these materials, the meeting has always included a discussion of their potential applications. Consequently, this conference has played a critical role in the birth and growth of nanoscience and engineering. The goal of the 2009 Gordon Conference is to continue the forward-looking tradition of this meeting and discuss the most recent advances in the field of clusters, nanocrystals, and nanostructures. As in past meetings, this will include new topics that broaden the field. In particular, a special emphasis will be placed on nanomaterials related to the efficient use, generation, or conversion of energy. For example, we anticipate presentations related to batteries, catalysts, photovoltaics, and thermoelectrics. In addition, we expect to address the controversy surrounding carrier multiplication with a session in which recent results addressing this phenomenon will be discussed and debated. The atmosphere of the conference, which emphasizes the presentation of unpublished results and lengthy discussion periods, ensures that attendees will enjoy a valuable and stimulating experience. Because only a limited number of participants are allowed to attend this conference, and oversubscription is anticipated, we encourage all interested researchers from academia, industry, and government institutions to apply as early as possible. An invitation is not required. We also encourage all attendees to submit their latest results for presentation at the poster sessions. We anticipate that several posters will be selected for 'hot topic' oral

  2. Large low-field magnetoresistance of Fe{sub 3}O{sub 4} nanocrystal at room temperature

    Energy Technology Data Exchange (ETDEWEB)

    Mi, Shu, E-mail: mishu@buaa.edu.cn; Liu, Rui, E-mail: liurui1987@buaa.edu.cn; Li, Yuanyuan, E-mail: buaaliyuan@163.com; Xie, Yong, E-mail: xiey@buaa.edu.cn; Chen, Ziyu, E-mail: chenzy@buaa.edu.cn

    2017-04-15

    Superparamagnetic magnetite (Fe{sub 3}O{sub 4}) nanoparticles with an average size of 6.5 nm and good monodispersion were synthesized and investigated by X-ray diffraction, Raman spectrometer, transmission electron microscopy and vibrating sample magnetometer. Corresponding low-field magnetoresistance (LFMR) was tested by physical property measurement system. A quite high LFMR has been observed at room temperature. For examples, at a field of 3000 Oe, the LFMR is −3.5%, and when the field increases to 6000 Oe, the LFMR is up to −5.1%. The electron spin polarization was estimated at 25%. This result is superior to the previous reports showing the LFMR of no more than 2% at room temperature. The conduction mechanism is proposed to be the tunneling of conduction electrons between adjacent grains considering that the monodisperse nanocrystals may supply more grain boundaries increasing the tunneling probability, and consequently enhancing the overall magnetoresistance. - Highlights: • Superparamagnetic Fe3O4 nanoparticles with small size were synthesized. • A quite high LFMR has been observed at room temperature. • The more grain boundaries increase the tunneling probability and enlarge the MR. • The fast response of the sample increase the MR at a low field.

  3. Hydrazine-mediated construction of nanocrystal self-assembly materials.

    Science.gov (United States)

    Zhou, Ding; Liu, Min; Lin, Min; Bu, Xinyuan; Luo, Xintao; Zhang, Hao; Yang, Bai

    2014-10-28

    Self-assembly is the basic feature of supramolecular chemistry, which permits to integrate and enhance the functionalities of nano-objects. However, the conversion of self-assembled structures to practical materials is still laborious. In this work, on the basis of studying one-pot synthesis, spontaneous assembly, and in situ polymerization of aqueous semiconductor nanocrystals (NCs), NC self-assembly materials are produced and applied to design high performance white light-emitting diode (WLED). In producing self-assembly materials, the additive hydrazine (N2H4) is curial, which acts as the promoter to achieve room-temperature synthesis of aqueous NCs by favoring a reaction-controlled growth, as the polyelectrolyte to weaken inter-NC electrostatic repulsion and therewith facilitate the one-dimensional self-assembly, and in particular as the bifunctional monomers to polymerize with mercapto carboxylic acid-modified NCs via in situ amidation reaction. This strategy is versatile for mercapto carboxylic acid-modified aqueous NCs, for example CdS, CdSe, CdTe, CdSe(x)Te(1-x), and Cd(y)Hg(1-y)Te. Because of the multisite modification with carboxyl, the NCs act as macromonomers, thus producing cross-linked self-assembly materials with excellent thermal, solvent, and photostability. The assembled NCs preserve strong luminescence and avoid unpredictable fluorescent resonance energy transfer, the main problem in design WLED from multiple NC components. These advantages allow the fabrication of NC-based WLED with high color rendering index (86), high luminous efficacy (41 lm/W), and controllable color temperature.

  4. Assembling a Lasing Hybrid Material With Supramolecular Polymers and Nanocrystals

    National Research Council Canada - National Science Library

    Li, Leiming

    2003-01-01

    .... In the system containing ZnO nanocrystals as the inorganic component, both phases are oriented in the hybrid material forming an ultraviolet lasing medium with a lower threshold relative to pure ZnO nanocrystals.

  5. Surface treatment of nanocrystal quantum dots after film deposition

    Science.gov (United States)

    Sykora, Milan; Koposov, Alexey; Fuke, Nobuhiro

    2015-02-03

    Provided are methods of surface treatment of nanocrystal quantum dots after film deposition so as to exchange the native ligands of the quantum dots for exchange ligands that result in improvement in charge extraction from the nanocrystals.

  6. Synthesis and Characterization of Colloidal Metal and Photovoltaic Semiconductor Nanocrystals

    KAUST Repository

    Abulikemu, Mutalifu

    2014-01-01

    -performing photovoltaic nanocrystals contain toxic elements, such as Pb, or scarce elements, such as In; thus, the production of solution-processable nanocrystals from earth-abundant materials using environmentally benign synthesis and processing methods has become a

  7. Near-infrared light emitting device using semiconductor nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Supran, Geoffrey J.S.; Song, Katherine W.; Hwang, Gyuweon; Correa, Raoul Emile; Shirasaki, Yasuhiro; Bawendi, Moungi G.; Bulovic, Vladimir; Scherer, Jennifer

    2018-04-03

    A near-infrared light emitting device can include semiconductor nanocrystals that emit at wavelengths beyond 1 .mu.m. The semiconductor nanocrystals can include a core and an overcoating on a surface of the core.

  8. Light Scattering Spectroscopies of Semiconductor Nanocrystals (Quantum Dots)

    International Nuclear Information System (INIS)

    Yu, Peter Y; Gardner, Grat; Nozaki, Shinji; Berbezier, Isabelle

    2006-01-01

    We review the study of nanocrystals or quantum dots using inelastic light scattering spectroscopies. In particular recent calculations of the phonon density of states and low frequency Raman spectra in Ge nanocrystals are presented for comparison with experimental results

  9. Zinc-doping enhanced cadmium sulfide electrochemiluminescence behavior based on Au-Cu alloy nanocrystals quenching for insulin detection.

    Science.gov (United States)

    Zhu, Wenjuan; Wang, Chao; Li, Xiaojian; Khan, Malik Saddam; Sun, Xu; Ma, Hongmin; Fan, Dawei; Wei, Qin

    2017-11-15

    Novel and sensitive sandwich-type electrochemiluminescence (ECL) immunosensor was fabricated for insulin detection. Au-ZnCd 14 S combined nitrogen doping mesoporous carbons (Au-ZnCd 14 S/NH 2 -NMCs) acted as sensing platform and Au-Cu alloy nanocrystals were employed as labels to quench the ECL of Au-ZnCd 14 S/NH 2 -NMCs. Zinc-doping promoted the ECL behavior of CdS nanocrystals, with the best ECL emission obtained when the molar ratio of Zn/Cd was 1:14. Simultaneously, the modification of gold nanoparticles (Au NPs) and combination with NH 2 -NMC further enhanced the ECL emission of ZnCd 14 S due to its excellent conductivity and large specific surface area, which is desirable for the immunosensor construction. Au-Cu alloy nanocrystals were employed in the ECL system of ZnCd 14 S/K 2 S 2 O 8 triggering ECL quenching effects. The ECL spectra of ZnCd 14 S, acting as the energy donor, exhibited well overlaps with the absorption band of Au-Cu alloy nanocrystals which acted as the energy acceptor, leading to an effective ECL resonance energy transfer (ECL-RET). On the basis of the ECL quenching effects, a sensitive ECL immunosensor for insulin detection was successfully constructed with a linear response range of insulin concentration from 0.1pg/mL to 30ng/mL and the limit of detection was calculated to be 0.03pg/mL (S/N = 3). Copyright © 2017 Elsevier B.V. All rights reserved.

  10. Nanocrystal Bioassembly: Asymmetry, Proximity, and Enzymatic Manipulation

    Energy Technology Data Exchange (ETDEWEB)

    Claridge, Shelley A. [Univ. of California, Berkeley, CA (United States)

    2008-05-01

    Research at the interface between biomolecules and inorganic nanocrystals has resulted in a great number of new discoveries. In part this arises from the synergistic duality of the system: biomolecules may act as self-assembly agents for organizing inorganic nanocrystals into functional materials; alternatively, nanocrystals may act as microscopic or spectroscopic labels for elucidating the behavior of complex biomolecular systems. However, success in either of these functions relies heavily uponthe ability to control the conjugation and assembly processes.In the work presented here, we first design a branched DNA scaffold which allows hybridization of DNA-nanocrystal monoconjugates to form discrete assemblies. Importantly, the asymmetry of the branched scaffold allows the formation of asymmetric2assemblies of nanocrystals. In the context of a self-assembled device, this can be considered a step toward the ability to engineer functionally distinct inputs and outputs.Next we develop an anion-exchange high performance liquid chromatography purification method which allows large gold nanocrystals attached to single strands of very short DNA to be purified. When two such complementary conjugates are hybridized, the large nanocrystals are brought into close proximity, allowing their plasmon resonances to couple. Such plasmon-coupled constructs are of interest both as optical interconnects for nanoscale devices and as `plasmon ruler? biomolecular probes.We then present an enzymatic ligation strategy for creating multi-nanoparticle building blocks for self-assembly. In constructing a nanoscale device, such a strategy would allow pre-assembly and purification of components; these constructs can also act as multi-label probes of single-stranded DNA conformational dynamics. Finally we demonstrate a simple proof-of-concept of a nanoparticle analog of the polymerase chain reaction.

  11. Microwave synthesis of high-quality and uniform 4 nm ZnFe2O4 nanocrystals for application in energy storage and nanomagnetics

    Directory of Open Access Journals (Sweden)

    Christian Suchomski

    2016-09-01

    Full Text Available Magnetic nanocrystals with a narrow size distribution hold promise for many applications in different areas ranging from biomedicine to electronics and energy storage. Herein, the microwave-assisted sol–gel synthesis and thorough characterization of size-monodisperse zinc ferrite nanoparticles of spherical shape is reported. X-ray diffraction, 57Fe Mössbauer spectroscopy and X-ray photoelectron spectroscopy all show that the material is both chemically and phase-pure and adopts a partially inverted spinel structure with Fe3+ ions residing on tetrahedral and octahedral sites according to (Zn0.32Fe0.68tet[Zn0.68Fe1.32]octO4±δ. Electron microscopy and direct-current magnetometry confirm the size uniformity of the nanocrystals, while frequency-dependent alternating-current magnetic susceptibility measurements indicate the presence of a superspin glass state with a freezing temperature of about 22 K. Furthermore, as demonstrated by galvanostatic charge–discharge tests and ex situ X-ray absorption near edge structure spectroscopy, the as-prepared zinc ferrite nanocrystals can be used as a high-capacity anode material for Li-ion batteries, showing little capacity fade – after activation – over hundreds of cycles. Overall, in addition to the good material characteristics, it is remarkable that the microwave-based synthetic route is simple, easily reproducible and scalable.

  12. Syringe-vacuum microfluidics: A portable technique to create monodisperse emulsions.

    Science.gov (United States)

    Abate, Adam R; Weitz, David A

    2011-03-16

    We present a simple method for creating monodisperse emulsions with microfluidic devices. Unlike conventional approaches that require bulky pumps, control computers, and expertise with device physics to operate devices, our method requires only the microfluidic device and a hand-operated syringe. The fluids needed for the emulsion are loaded into the device inlets, while the syringe is used to create a vacuum at the device outlet; this sucks the fluids through the channels, generating the drops. By controlling the hydrodynamic resistances of the channels using hydrodynamic resistors and valves, we are able to control the properties of the drops. This provides a simple and highly portable method for creating monodisperse emulsions.

  13. Ultrasound-driven Megahertz Faraday Waves for Generation of Monodisperse Micro Droplets and Applications

    Science.gov (United States)

    Tsai, Chen S.; Mao, Rong W.; Lin, Shih K.; Tsai, Shirley C.; Boss, Gerry; Brenner, Matt; Smaldone, Gerry; Mahon, Sari; Shahverdi, Kaveh; Zhu, Yun

    Our theoretical findings on instability of Faraday waves at megahertz (MHz) drive frequency and realization of silicon-based MHz multiple-Fourier horn ultrasonic nozzles (MFHUNs) together have enabled generation of mono-disperse droplets of controllable diameter (2.5-6.0 μm) at very low electrical drive power (generator has imminent application to pulmonary (inhalation) drug delivery and other potential applications. Here an update of advances on analysis and design of the MHz MFHUNs and the underlying physical mechanism for generation of mono-disperse micro droplets, and the nebulizer platform for application to detoxification of cyanide poisoning are presented.

  14. Emulsifier-free emulsion polymerization produces highly charged, monodisperse particles for near infrared photonic crystals.

    Science.gov (United States)

    Reese, Chad E; Asher, Sanford A

    2002-04-01

    We have developed emulsifier-free, emulsion polymerization recipes for the synthesis of highly charged, monodisperse latex particles of diameters between 500 and 1100 nm. These latexes consist of poly[styrene-(co-2-hydroxyethyl methacrylate)] spherical particles whose surfaces are functionalized with sulfate and carboxylic acid groups. These highly charged, monodisperse particles readily self-assemble into robust, three-dimensionally ordered crystalline colloidal array photonic crystals that Bragg diffract light in the near infrared spectral region. By altering the particle number density, the diffraction wavelength can be tuned from approximately 1000 to approximately 4000 nm.

  15. An optimized multilayer structure of CdS layer for CdTe solar cells application

    International Nuclear Information System (INIS)

    Han Junfeng; Liao Cheng; Jiang Tao; Spanheimer, C.; Haindl, G.; Fu, Ganhua; Krishnakumar, V.; Zhao Kui; Klein, A.; Jaegermann, W.

    2011-01-01

    Research highlights: → Two different methods to prepare CdS films for CdTe solar cells. → A new multilayer structure of window layer for the CdTe solar cell. → Thinner CdS window layer for the solar cell than the standard CdS layer. → Higher performance of solar cells based on the new multilayer structure. - Abstract: CdS layers grown by 'dry' (close space sublimation) and 'wet' (chemical bath deposition) methods are deposited and analyzed. CdS prepared with close space sublimation (CSS) has better crystal quality, electrical and optical properties than that prepared with chemical bath deposition (CBD). The performance of CdTe solar cell based on the CSS CdS layer has higher efficiency than that based on CBD CdS layer. However, the CSS CdS suffers from the pinholes. And consequently it is necessary to prepare a 150 nm thin film for CdTe/CdS solar cell. To improve the performance of CdS/CdTe solar cells, a thin multilayer structure of CdS layer (∼80 nm) is applied, which is composed of a bottom layer (CSS CdS) and a top layer (CBD CdS). That bi-layer film can allow more photons to pass through it and significantly improve the short circuit current of the CdS/CdTe solar cells.

  16. The fluorescence quenching mechanism of coumarin 120 with CdS nanoparticles in aqueous suspension

    Energy Technology Data Exchange (ETDEWEB)

    Acar, Murat; Bozkurt, Ebru; Meral, Kadem; Arık, Mustafa; Onganer, Yavuz, E-mail: yonganer@atauni.edu.tr

    2015-01-15

    The interaction of coumarin 120 (C120) with CdS nanoparticles (CdS NPs) in aqueous suspension was examined by using UV–vis absorption, steady-state, time-resolved fluorescence, and electron paramagnetic resonance (EPR) spectroscopy techniques. The fluorescence intensity of C120 was quenched with increasing the amount of CdS NPs in the aqueous suspension. The spectroscopic data revealed that the C120 molecules adsorbed on CdS NPs via electrostatic interactions. The apparent association constant (K{sub app}) and the degree of association (α) for C120/CdS NPs were determined as 130.3 M{sup −1} and 0.51 for 4 nm CdS NPs and 624.3 M{sup −1} and 0.71 for 8 nm CdS NPs, respectively. The photoinduced EPR studies exhibited that no electron transfers between CdS and C120 taking place. The results revealed that the fluorescence quenching of C120 with different CdS NPs is due to the formation of a non-fluorescent complex. - Highlights: • Interaction of C120 with CdS NPs in aqueous solution was spectroscopically examined. • Nonfluorescent C120–CdS NPs complexes in aqueous solution were formed. • In the system, CdS NPs in aqueous solution acted as a fluorescence quencher.

  17. The fluorescence quenching mechanism of coumarin 120 with CdS nanoparticles in aqueous suspension

    International Nuclear Information System (INIS)

    Acar, Murat; Bozkurt, Ebru; Meral, Kadem; Arık, Mustafa; Onganer, Yavuz

    2015-01-01

    The interaction of coumarin 120 (C120) with CdS nanoparticles (CdS NPs) in aqueous suspension was examined by using UV–vis absorption, steady-state, time-resolved fluorescence, and electron paramagnetic resonance (EPR) spectroscopy techniques. The fluorescence intensity of C120 was quenched with increasing the amount of CdS NPs in the aqueous suspension. The spectroscopic data revealed that the C120 molecules adsorbed on CdS NPs via electrostatic interactions. The apparent association constant (K app ) and the degree of association (α) for C120/CdS NPs were determined as 130.3 M −1 and 0.51 for 4 nm CdS NPs and 624.3 M −1 and 0.71 for 8 nm CdS NPs, respectively. The photoinduced EPR studies exhibited that no electron transfers between CdS and C120 taking place. The results revealed that the fluorescence quenching of C120 with different CdS NPs is due to the formation of a non-fluorescent complex. - Highlights: • Interaction of C120 with CdS NPs in aqueous solution was spectroscopically examined. • Nonfluorescent C120–CdS NPs complexes in aqueous solution were formed. • In the system, CdS NPs in aqueous solution acted as a fluorescence quencher

  18. Cellulose nanocrystal: electronically conducting polymer nanocomposites for supercapacitors

    OpenAIRE

    Liew, Soon Yee

    2012-01-01

    This thesis describes the use of cellulose nanocrystals for the fabrication of porous nanocomposites with electronic conducting polymers for electrochemical supercapacitor applications. The exceptional strength and negatively charged surface functionalities on cellulose nanocrystals are utilised in these nanocomposites. The negatively charged surface functionalities on cellulose nanocrystals allow their simultaneous incorporation into electropolymerised, positively charged conducting polymer ...

  19. Room temperature ferromagnetism in magic-sized Cr-doped CdS diluted magnetic semiconducting quantum dots

    International Nuclear Information System (INIS)

    Srivastava, Punita; Kumar, Pushpendra; Singh, Kedar

    2011-01-01

    Manipulation of carrier spins in semiconductors for spintronics applications has received great attention driven by improved functionalities and higher speed operation. Doping of semiconductor nanocrystals by transition-metal ions pronounced as diluted magnetic semiconductors (DMS) has attracted tremendous attention. Such doping is, however, difficult to achieve in low-dimensional strongly quantum-confined nanostructures by conventional growth procedures. In the present case, magic-sized, pure, and Cr-doped CdS DM-QDs have been synthesized by solution phase chemistry (lyothermal method). Structural, optical, and magnetic investigation suggest an intrinsic nature of ferromagnetism with highly quantum-confined system. Optical and magnetic results of pure and doped QDs reveal major physical consequences of dopant localization within the capacity to engineer dopant-carrier exchange interactions introducing magnetic functionalities within the host semiconductor lattice. Unpaired Cr ions in Cd substitutional sites could create spin ordering and ferromagnetic coupling. The results presented herein illustrate some of the remarkable and unexpected complexities that can arise in doped QDs.

  20. REGIME SWITCHING DETERMINANTS OF SOVEREIGN CDS SPREADS: EVIDENCE FROM TURKEY

    Directory of Open Access Journals (Sweden)

    Umurcan Polat

    2017-12-01

    Full Text Available In this study, it is assessed the main determinants of sovereign CDS spreads in Turkey from January 2006 to December 2015. Before delving into the nonlinear Markov regime-switching model estimation, a conventional one-state linear model is estimated answering to what extent the sovereign credit risk is affected in between global and country-specific market variables and by credit ratings announcement changes. In broad strokes, the regime-switching analysis reveals that among domestic variables, it is the foreign exchange rate that affects the sovereign credit risk more in more volatile periods and among global variables, the indicators standing for global volatility risk premiums and international liquidity primarily influence the changes in the sovereign CDS spread in turbulent regimes whereas proxies for global risk free rate are significant more in tranquil regimes.

  1. Comportamiento óptico no-lineal de nanocristales semiconductores de CdS en una matriz de gel de sílice

    Directory of Open Access Journals (Sweden)

    de la Rosa-Fox, N.

    2000-06-01

    Full Text Available Nanocrystals embedded in a dielectric matrix can be obtained through sol-gel method, it permits the control of several kinetic parameters during the nanocrystal growth. The size and size distribution have been studied by means small-angle neutron scattering techniques (SANS, that allow a spatial resolution from 1 to 50 nm. High intensity optical excitation from a Nd:YAG laser (6 ns pulse at 10 Hz repetition rate was focused on the sample to study the photoluminescence yield at rigth angle. The spectrum shows radiative process from intrinsic transitions (2.76 eV and a broad band in the lower energy side (1.65 eV that correspond to crystal surface traps. The photoluminescence yield grows superlineary giving rise to amplified intensity (60 cm-1 due to biexciton species, this fact can be interpreted as a non-linear optical behaviour coming from the CdS nanocrystals.

    La inclusión de nanocristales en una matriz dieléctrica puede realizarse mediante el método sol-gel, permitiendo el control de parámetros cinéticos en el crecimiento de los cristales. El tamaño y distribución de dichos nanocristales se han estudiado por medio de difusión de neutrones a bajo ángulo (SANS, con una resolución espacial entre 1 y 50 nm. Bajo excitación óptica de alta intensidad, usando un láser (Nd:YAG con pulsos de 6 ns y una frecuencia de repetición de 10 Hz, se focalizó en la muestra para registrar la señal de fotoluminiscencia en la dirección perpendicular. El espectro indica procesos radiativos debidos a transiciones intrínsecas (2.76 eV y una banda ancha a más baja energía (1.65 eV correspondiente a recombinaciones en los defectos superficiales. La señal de fotoluminiscencia crece superlinealmente dando lugar a una amplificación (60 cm-1 debida principalmente a biexcitones que indican un comportamiento óptico no-lineal de los nanocristales de CdS.

  2. Preliminary Results from Coordinated UVCS-CDS-Ulysses Observations

    Science.gov (United States)

    Parenti, S.; Bromage, B. J.; Poletto, G.; Suess, S. T.; Raymond, J. C.; Noci, G.; Bromage, G. E.; Rose, M. Franklin (Technical Monitor)

    2001-01-01

    The June 2000 quadrature between the Sun, Earth, and Ulysses took place with Ulysses at a distance of 3.35 AU from the Sun and at heliocentric latitude 58.2 deg south, in the southeast quadrant. This provided an opportunity to observe the corona close to the Sun with Coronal Diagnostic Spectrometer (CDS) and Ultraviolet Coronograph Spectrometer (UVCS) and, subsequently, to sample the same plasma when it reached Ulysses. Here we focus on simultaneous observations of UVCS and CDS made on June 12, 13, 16 and 17. The UVCS data were acquired at heliocentric altitudes ranging from 1.6 to 2.2 solar radii, using different grating positions, in order to get a wide wavelength range. CDS data consisted of Normal Incidence Spectrometer (NIS) full wavelength rasters of 120" x 150" centered at altitudes up to 1.18 solar radii, together with Grazing Incidence Spectrometer (GIS) 4" x 4" rasters within the same field of view, out to 1.2 solar radii. The radial direction to Ulysses passed through a high latitude streamer, throughout the 4 days of observations, Analysis of the spectra taken by UVCS shows a variation of the element abundances in the streamer over our observing interval: however, because the observations were in slightly different parts of the streamer on different days, the variation could be ascribed either to a temporal or spatial effect. The oxygen abundance, however, seems to increase at the edge of the streamer, as indicated by previous analyses. This suggests the variation may be a function of position within the streamer, rather than a temporal effect. Oxygen abundances measured by SWICS on Ulysses are compared with the CDS and UVCS results to see whether changes measured in situ follow the same pattern.

  3. A simple route to shape controlled CdS nanoparticles

    Science.gov (United States)

    Nejo, Ayorinde O.; Nejo, Adeola A.; Pullabhotla, Rajasekhar V. S. R.; Revaprasadu, Neerish

    2013-02-01

    We report the synthesis of CdS nanoparticles in the form of spheres, triangles and wire-like structures. The method involves the reaction of reduced sulfur with a cadmium salt followed by thermolysis in hexadecylamine (HDA). The different shapes were obtained by variation of reaction conditions such as reaction time, temperature and cadmium source. The optical studies show the particles to be quantum confined and luminescent at room temperature.

  4. Hydrothermal synthesis of tungsten doped tin dioxide nanocrystals

    Science.gov (United States)

    Zhou, Cailong; Li, Yufeng; Chen, Yiwen; Lin, Jing

    2018-01-01

    Tungsten doped tin dioxide (WTO) nanocrystals were synthesized through a one-step hydrothermal method. The structure, composition and morphology of WTO nanocrystals were characterized by x-ray diffraction, x-ray photoelectron spectroscopy, energy dispersive x-ray spectroscopy, UV-vis diffuse reflectance spectra, zeta potential analysis and high-resolution transmission electron microscopy. Results show that the as-prepared WTO nanocrystals were rutile-type structure with the size near 13 nm. Compared with the undoped tin dioxide nanocrystals, the WTO nanocrystals possessed better dispersity in ethanol phase and formed transparent sol.

  5. Crystallization and Growth of Colloidal Nanocrystals

    CERN Document Server

    Leite, Edson Roberto

    2012-01-01

    Since the size, shape, and microstructure of nanocrystalline materials strongly impact physical and chemical properties, the development of new synthetic routes to  nanocrystals with controlled composition and morphology is a key objective of the nanomaterials community. This objective is dependent on control of the nucleation and growth mechanisms that occur during the synthetic process, which in turn requires a fundamental understanding of both classical nucleation and growth and non-classical growth processes in nanostructured materials.  Recently, a novel growth process called Oriented Attachment (OA) was identified which appears to be a fundamental mechanism during the development of nanoscale  materials. OA is a special case of aggregation that provides an important route by which nanocrystals grow, defects are formed, and unique—often symmetry-defying—crystal morphologies can be produced. This growth mechanism involves reversible self-assembly of primary nanocrystals followed by reorientati...

  6. Shaping metal nanocrystals through epitaxial seeded growth

    Energy Technology Data Exchange (ETDEWEB)

    Habas, Susan E.; Lee, Hyunjoo; Radmilovic, Velimir; Somorjai,Gabor A.; Yang, Peidong

    2008-02-17

    Morphological control of nanocrystals has becomeincreasingly important, as many of their physical and chemical propertiesare highly shape-dependent. Nanocrystal shape control for both single andmultiple material systems, however, remains fairly empirical andchallenging. New methods need to be explored for the rational syntheticdesign of heterostructures with controlled morphology. Overgrowth of adifferent material on well-faceted seeds, for example, allows for the useof the defined seed morphology to control nucleation and growth of thesecondary structure. Here, we have used highly faceted cubic Pt seeds todirect the epitaxial overgrowth of a secondary metal. We demonstrate thisconcept with lattice matched Pd to produce conformal shape-controlledcore-shell particles, and then extend it to lattice mismatched Au to giveanisotropic growth. Seeding with faceted nanocrystals may havesignificant potential towards the development of shape-controlledheterostructures with defined interfaces.

  7. The structure and morphology of semiconductor nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Kadavanich, Andreas V. [Univ. of California, Berkeley, CA (United States). Dept. of Chemistry

    1997-11-01

    Colloidal semiconductor nanocrystals were studied using High Resolution Transmission Electron Microscopy (HRTEM). Organically capped nanocrystals were found to have faceted shapes consistent with Wulff polyhedra after the effects of capping ligands on surface energies were taken into account. The basic shape thus derived for wurtzite (WZ) structure CdSe nanocrystals capped by tri-octyl phosphine oxide (TOPO) was a truncated hexagonal prism, elongated alone the <001> axis with (100) and (002) facets. This structure has C{sub 3v} point group symmetry. The main defect in this structure is a stacking fault (a single layer of zinc blende type stacking), which does not significantly affect the shape (does not alter the point group).

  8. Strained interface defects in silicon nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Benjamin G.; Stradins, Paul [National Center for Photovoltaics, National Renewable Energy Laboratory, Golden, CO (United States); Hiller, Daniel; Zacharias, Margit [IMTEK - Faculty of Engineering, Albert-Ludwigs-University Freiburg (Germany); Luo, Jun-Wei; Beard, Matthew C. [Chemical and Materials Science, National Renewable Energy Laboratory, Golden, CO (United States); Semonin, Octavi E. [Chemical and Materials Science, National Renewable Energy Laboratory, Golden, CO (United States); Department of Physics, University of Colorado, Boulder, CO (United States)

    2012-08-07

    The surface of silicon nanocrystals embedded in an oxide matrix can contain numerous interface defects. These defects strongly affect the nanocrystals' photoluminescence efficiency and optical absorption. Dangling-bond defects are nearly eliminated by H{sub 2} passivation, thus decreasing absorption below the quantum-confined bandgap and enhancing PL efficiency by an order of magnitude. However, there remain numerous other defects seen in absorption by photothermal deflection spectroscopy; these defects cause non-radiative recombination that limits the PL efficiency to <15%. Using atomistic pseudopotential simulations, we attribute these defects to two specific types of distorted bonds: Si-Si and bridging Si-O-Si bonds between two Si atoms at the nanocrystal surface. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  9. Developing New Nanoprobes from Semiconductor Nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Fu, Aihua [Univ. of California, Berkeley, CA (United States)

    2006-01-01

    In recent years, semiconductor nanocrystal quantum dots havegarnered the spotlight as an important new class of biological labelingtool. Withoptical properties superior to conventional organicfluorophores from many aspects, such as high photostability andmultiplexing capability, quantum dots have been applied in a variety ofadvanced imaging applications. This dissertation research goes along withlarge amount of research efforts in this field, while focusing on thedesign and development of new nanoprobes from semiconductor nanocrystalsthat are aimed for useful imaging or sensing applications not possiblewith quantum dots alone. Specifically speaking, two strategies have beenapplied. In one, we have taken advantage of the increasing capability ofmanipulating the shape of semiconductor nanocrystals by developingsemiconductor quantum rods as fluorescent biological labels. In theother, we have assembled quantum dots and gold nanocrystals into discretenanostructures using DNA. The background information and synthesis,surface manipulation, property characterization and applications of thesenew nanoprobes in a few biological experiments are detailed in thedissertation.

  10. Assembly of Fe3O4 nanoparticles on SiO2 monodisperse spheres

    Indian Academy of Sciences (India)

    Assembly of Fe3O4 nanoparticles on SiO2 monodisperse spheres. K C BARICK and D BAHADUR*. Department of Metallurgical Engineering and Materials Science, Indian Institute of Technology Bombay,. Mumbai 400 076, India. Abstract. The assembly of superparamagnetic Fe3O4 nanoparticles on submicroscopic SiO2 ...

  11. Tri-block copolymers with mono-disperse crystallizable diamide segments: synthesis, analysis and rheological properties

    NARCIS (Netherlands)

    Araichimani, A.; Gaymans, R.J.

    2008-01-01

    Tri-block copolymers with polyether mid-segments and mono-disperse amide end segments were synthesized, analyzed and some properties studied. The end segment was an aromatic diamide (diaramide, TΦB). The polyether mid-segment was a difunctional poly(tetramethylene oxide) (PTMO, 1000 and 2900 g/mol).

  12. Hydrophilic segmented block copolymers based on poly(ethylene oxide) and monodisperse amide segments

    NARCIS (Netherlands)

    Husken, D.; Feijen, Jan; Gaymans, R.J.

    2007-01-01

    Segmented block copolymers based on poly(ethylene oxide) (PEO) flexible segments and monodisperse crystallizable bisester tetra-amide segments were made via a polycondensation reaction. The molecular weight of the PEO segments varied from 600 to 4600 g/mol and a bisester tetra-amide segment (T6T6T)

  13. Room temperature vortex fluidic synthesis of monodispersed amorphous proto-vaterite.

    Science.gov (United States)

    Peng, Wenhong; Chen, Xianjue; Zhu, Shenmin; Guo, Cuiping; Raston, Colin L

    2014-10-11

    Monodispersed particles of amorphous calcium carbonate (ACC) 90 to 200 nm in diameter are accessible at room temperature in ethylene glycol and water using a vortex fluidic device (VFD). The ACC material is stable for at least two weeks under ambient conditions.

  14. Plasmonic Properties of Silicon Nanocrystals Doped with Boron and Phosphorus.

    Science.gov (United States)

    Kramer, Nicolaas J; Schramke, Katelyn S; Kortshagen, Uwe R

    2015-08-12

    Degenerately doped silicon nanocrystals are appealing plasmonic materials due to silicon's low cost and low toxicity. While surface plasmonic resonances of boron-doped and phosphorus-doped silicon nanocrystals were recently observed, there currently is poor understanding of the effect of surface conditions on their plasmonic behavior. Here, we demonstrate that phosphorus-doped silicon nanocrystals exhibit a plasmon resonance immediately after their synthesis but may lose their plasmonic response with oxidation. In contrast, boron-doped nanocrystals initially do not exhibit plasmonic response but become plasmonically active through postsynthesis oxidation or annealing. We interpret these results in terms of substitutional doping being the dominant doping mechanism for phosphorus-doped silicon nanocrystals, with oxidation-induced defects trapping free electrons. The behavior of boron-doped silicon nanocrystals is more consistent with a strong contribution of surface doping. Importantly, boron-doped silicon nanocrystals exhibit air-stable plasmonic behavior over periods of more than a year.

  15. Luminescence in colloidal Mn2+-doped semiconductor nanocrystals

    International Nuclear Information System (INIS)

    Beaulac, Remi; Archer, Paul I.; Gamelin, Daniel R.

    2008-01-01

    Recent advances in nanocrystal doping chemistries have substantially broadened the variety of photophysical properties that can be observed in colloidal Mn 2+ -doped semiconductor nanocrystals. A brief overview is provided, focusing on Mn 2+ -doped II-VI semiconductor nanocrystals prepared by direct chemical synthesis and capped with coordinating surface ligands. These Mn 2+ -doped semiconductor nanocrystals are organized into three major groups according to the location of various Mn 2+ -related excited states relative to the energy gap of the host semiconductor nanocrystals. The positioning of these excited states gives rise to three distinct relaxation scenarios following photoexcitation. A brief outlook on future research directions is provided. - Graphical abstract: Mn 2+ -doped semiconductor nanocrystals are organized into three major groups according to the location of various Mn 2+ -related excited states relative to the energy gap of the host semiconductor nanocrystals. The positioning of these excited states gives rise to three distinct relaxation scenarios following photoexcitation

  16. Characterization of Semiconductor Nanocrystal Assemblies as Components of Optoelectronic Devices

    Science.gov (United States)

    Malfavon-Ochoa, Mario

    dispersions of core and core/shell NCs will be shown to produce close packed assemblies of NCs forming near-wavelength luminescent superstructures separated in space. We show the dominant contribution of a two-monolayer thick sharp interface CdS shell to the diffraction efficiency, and necessarily the refractive index, of the NCs, independent of core size. Utilization of these gratings as in-coupling elements at various positions within a device architecture are also examined. These new observations were achieved by unprecedented control of NC architecture during dispersion processing, while maintaining high luminescence, made possible by optimized NC surface passivation. These studies enable the formation of new LED architectures, and new optoelectronic devices based on angle resolved, monochromatic fluorescence from diffraction gratings prepared from simple solution processing approaches. Further, the novel observation of angle amplified interfering fluorescence from these features is argued to be a result of long range radiative coupling and superradiance enabled by the monodispersity and high-quality NC surface passivation described herein.

  17. Cloning nanocrystal morphology with soft templates

    Science.gov (United States)

    Thapa, Dev Kumar; Pandey, Anshu

    2016-08-01

    In most template directed preparative methods, while the template decides the nanostructure morphology, the structure of the template itself is a non-general outcome of its peculiar chemistry. Here we demonstrate a template mediated synthesis that overcomes this deficiency. This synthesis involves overgrowth of silica template onto a sacrificial nanocrystal. Such templates are used to copy the morphologies of gold nanorods. After template overgrowth, gold is removed and silver is regrown in the template cavity to produce a single crystal silver nanorod. This technique allows for duplicating existing nanocrystals, while also providing a quantifiable breakdown of the structure - shape interdependence.

  18. Modification of optical and electrical properties of chemical bath deposited CdS using plasma treatments

    International Nuclear Information System (INIS)

    Gonzalez, G.; Krishnan, B.; Avellaneda, D.; Castillo, G. Alan; Das Roy, T.K.; Shaji, S.

    2011-01-01

    Cadmium sulphide (CdS) is a well known n-type semiconductor that is widely used in solar cells. Here we report preparation and characterization of chemical bath deposited CdS thin films and modification of their optical and electrical properties using plasma treatments. CdS thin films were prepared from a chemical bath containing Cadmium chloride, Triethanolamine and Thiourea under various deposition conditions. Good quality thin films were obtained during deposition times of 5, 10 and 15 min. CdS thin films prepared for 10 min. were treated using a glow discharge plasma having nitrogen and argon carrier gases. The changes in morphology, optical and electrical properties of these plasma treated CdS thin films were analyzed in detail. The results obtained show that plasma treatment is an effective technique in modification of the optical and electrical properties of chemical bath deposited CdS thin films.

  19. Modification of optical and electrical properties of chemical bath deposited CdS using plasma treatments

    Energy Technology Data Exchange (ETDEWEB)

    Gonzalez, G. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); Krishnan, B. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); CIIDIT, Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico); Avellaneda, D.; Castillo, G. Alan; Das Roy, T.K. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); Shaji, S., E-mail: sshajis@yahoo.com [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, San Nicolas de los Garza, Nuevo Leon, C.P 66450 (Mexico); CIIDIT, Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico)

    2011-08-31

    Cadmium sulphide (CdS) is a well known n-type semiconductor that is widely used in solar cells. Here we report preparation and characterization of chemical bath deposited CdS thin films and modification of their optical and electrical properties using plasma treatments. CdS thin films were prepared from a chemical bath containing Cadmium chloride, Triethanolamine and Thiourea under various deposition conditions. Good quality thin films were obtained during deposition times of 5, 10 and 15 min. CdS thin films prepared for 10 min. were treated using a glow discharge plasma having nitrogen and argon carrier gases. The changes in morphology, optical and electrical properties of these plasma treated CdS thin films were analyzed in detail. The results obtained show that plasma treatment is an effective technique in modification of the optical and electrical properties of chemical bath deposited CdS thin films.

  20. Synthesis and Characterization of CdS Nanoparticles with Strong Electrolyte Behavior

    International Nuclear Information System (INIS)

    Zhang Yu; Fu, Degang; Liu Juzheng

    2000-01-01

    The CdS nanoparticles whose structure is similar to a strong electrolyte were synthesized by the colloidal chemical method. The CdS nanoparticles with Cd 2+ -rich surface are capped by the electrically neutral ligand of 2,2'-bipyridine (bpy), and the counterion, BPh 4 - , is adsorbed around the particle as balance charge. The ω donation from 2,2'-bipyridine at 2-position to the Cd 2+ -rich surface of the CdS nanoparticles was characterized by X-ray photoelectron spectroscopy (XPS). These CdS nanoparticles can redisperse in pyridine (py) or DMF, and have high stability. The determination of electroconductivity and the electrophoresis deposition in dilute solution containing the CdS nanoparticles further prove the rationality of the above electrolyte structure of the CdS nanoparticles

  1. Silk fibroin/gold nanocrystals: a new example of biopolymer-based nanocomposites

    Science.gov (United States)

    Noinville, S.; Garnier, A.; Courty, A.

    2017-05-01

    The dispersion of nanoparticles in ordered polymer nanostructures can provide control over particle location and orientation, and pave the way for tailored nanomaterials that have enhanced mechanical, electrical, or optical properties. Here we used silk fibroin, a natural biopolymer, to embed gold nanocrystals (NCs), so as to obtain well-ordered structures such as nanowires and self-assembled triangular nanocomposites. Monodisperse gold NCs synthesized in organic media are mixed to silk fibroin and the obtained nanocomposites are characterized by UV-visible spectroscopy, transmission electron microscopy (TEM), scanning electron microscopy (FE-SEM), atomic force microscopy (AFM) and Infrared spectroscopy. The optical properties study of gold NCs and silk-gold nanocomposites shows that the Surface Plasmon band is blue shifted compared to gold NCs. The size and shape of NCs gold superlattices can be well controlled by the presence of silk fibroin giving nanowires and also self-assembled triangular nanocomposites as characterized by TEM, FE-SEM and AFM. The strong interaction between gold NCs and silk fibroin is also revealed by the conformation change of silk protein in presence of gold NCs, as shown by FTIR analysis. The formation of such ordered nanocomposites (gold NCs/silk fibroin) will provide new nanoplasmonic devices.

  2. Direct-Indirect Nature of the Bandgap in Lead-Free Perovskite Nanocrystals

    KAUST Repository

    Zhang, Yuhai

    2017-06-23

    With record efficiencies achieved in lead halide perovskite-based photovoltaics, urgency has shifted toward finding alternative materials that are stable and less toxic. Bismuth-based perovskite materials are currently one of the most promising candidates among those alternatives. However, the band structures of these materials, including the nature of the bandgaps, remain elusive due to extremely low photoluminescence quantum yield (PLQY) and scattering issues in their thin-film form. Here, we reveal the specific nature of the material\\'s electronic transitions by realizing monodisperse colloidal nanocrystals (NCs) of hexagonal-phase Cs3Bi2X9 perovskites, which afford well-resolved PL features. Interestingly, the PL profile exhibits a dual-spectral feature at room temperature with comparable intensities, based on which we propose an exciton recombination process involving both indirect and direct transitions simultaneously-an observation further supported by temperature-dependent and density functional theory (DFT) calculations. Our findings provide experimental and theoretical insights into the nature of the bandgaps in bismuth halide materials-essential information for assessing their viability in solar cells and optoelectronics.

  3. Superparamagnetic nickel colloidal nanocrystal clusters with antibacterial activity and bacteria binding ability

    Science.gov (United States)

    Peng, Bo; Zhang, Xinglin; Aarts, Dirk G. A. L.; Dullens, Roel P. A.

    2018-06-01

    Recent progress in synthetic nanotechnology and the ancient use of metals in food preservation and the antibacterial treatment of wounds have prompted the development of nanometallic materials for antimicrobial applications1-4. However, the materials designed so far do not simultaneously display antimicrobial activity and the capability of binding and capturing bacteria and spores. Here, we develop a one-step pyrolysis procedure to synthesize monodisperse superparamagnetic nickel colloidal nanocrystal clusters (SNCNCs), which show both antibacterial activity and the ability to bind Gram-positive (Bacillus subtilis) and Gram-negative (Escherichia coli) bacteria, as well as bacterial spores. The SNCNCs are formed from a rapid burst of nickel nanoparticles, which self-assemble slowly into clusters. The clusters can magnetically extract 99.99% of bacteria and spores and provide a promising approach for the removal of microbes, including hard-to-treat microorganisms. We believe that our work illustrates the exciting opportunities that nanotechnology offers for alternative antimicrobial strategies and other applications in microbiology.

  4. Re-dispersible Li+ and Eu3+ co-doped CdS nanoparticles ...

    Indian Academy of Sciences (India)

    Also, it can be used as sensor for drug delivery in our body [12,13]. In the present work, we prepare re-dispersible CdS, Li+- and Eu3+-doped CdS nanoparticles in organic solvent by urea hydrolysis at 170◦C and their lumines- cence properties are studied. We propose the mechanism of re-dispersion of CdS nanoparticles ...

  5. Chemical synthesis of porous web-structured CdS thin films for photosensor applications

    Energy Technology Data Exchange (ETDEWEB)

    Gosavi, S.R., E-mail: srgosavi.taloda@gmail.com [C. H. C. Arts, S. G. P. Commerce, and B. B. J. P. Science College, Taloda, Dist., Nandurbar 425413, M. S. (India); Nikam, C.P. [B.S.S.P.M.S. Arts, Commerce and Science College, Songir, Dist., Dhule 424309, M. S. (India); Shelke, A.R.; Patil, A.M. [Department of Physics, Shivaji University, Kolhapur 416004, M.S. (India); Ryu, S.-W. [Department of Physics, Chonnam National University, Gwangju 500-757 (Korea, Republic of); Bhat, J.S. [Department of Physics, Karnatak University, Dharwad 580003 (India); Deshpande, N.G., E-mail: nicedeshpande@yahoo.co.in [Department of Physics, Shivaji University, Kolhapur 416004, M.S. (India)

    2015-06-15

    The photo-activity of chemically deposited cadmium sulphide (CdS) thin film has been studied. The simple chemical route nucleates the CdS films with size up to the mean free path of the electron. Growth Kinematics of crystalline hexagonal CdS phase in the thin film form was monitored using X-ray diffraction. The time limitation set for the formation of the amorphous/nano-crystalline material is 40 and 60 min. Thereafter enhancement of the crystalline orientation along the desired plane was identified. Web-like porous structured surface morphology of CdS thin film over the entire area is observed. With decrease in synthesis time, increase of band gap energy i.e., a blue spectral shift was seen. The activation energy of CdS thin film at low and high temperature region was examined. It is considered that this activation energy corresponds to the donor levels associated with shallow traps or surface states of CdS thin film. The photo-electrochemical performance of CdS thin films in polysulphide electrolyte showed diode-like characteristics. Exposure of light on the CdS electrode increases the photocurrent. This suggests the possibility of production of free carriers via excited ions and also the light harvesting mechanism due to porous web-structured morphology. These studies hint that the obtained CdS films can work as a photosensor. - Highlights: • Photoactivity of chemically synthesized cadmium sulphide (CdS) thin films was studied. • Web-like porous structured surface morphology of CdS thin film over the entire area was observed. • Blue spectral shift with lowering of the synthesis time suggests films can act as a window layer over the absorber layer. • Porous web-structured CdS thin films can be useful in light harvesting.

  6. Chemical synthesis of porous web-structured CdS thin films for photosensor applications

    International Nuclear Information System (INIS)

    Gosavi, S.R.; Nikam, C.P.; Shelke, A.R.; Patil, A.M.; Ryu, S.-W.; Bhat, J.S.; Deshpande, N.G.

    2015-01-01

    The photo-activity of chemically deposited cadmium sulphide (CdS) thin film has been studied. The simple chemical route nucleates the CdS films with size up to the mean free path of the electron. Growth Kinematics of crystalline hexagonal CdS phase in the thin film form was monitored using X-ray diffraction. The time limitation set for the formation of the amorphous/nano-crystalline material is 40 and 60 min. Thereafter enhancement of the crystalline orientation along the desired plane was identified. Web-like porous structured surface morphology of CdS thin film over the entire area is observed. With decrease in synthesis time, increase of band gap energy i.e., a blue spectral shift was seen. The activation energy of CdS thin film at low and high temperature region was examined. It is considered that this activation energy corresponds to the donor levels associated with shallow traps or surface states of CdS thin film. The photo-electrochemical performance of CdS thin films in polysulphide electrolyte showed diode-like characteristics. Exposure of light on the CdS electrode increases the photocurrent. This suggests the possibility of production of free carriers via excited ions and also the light harvesting mechanism due to porous web-structured morphology. These studies hint that the obtained CdS films can work as a photosensor. - Highlights: • Photoactivity of chemically synthesized cadmium sulphide (CdS) thin films was studied. • Web-like porous structured surface morphology of CdS thin film over the entire area was observed. • Blue spectral shift with lowering of the synthesis time suggests films can act as a window layer over the absorber layer. • Porous web-structured CdS thin films can be useful in light harvesting

  7. Prospects of Colloidal Copper Chalcogenide Nanocrystals

    NARCIS (Netherlands)

    van der Stam, W.; Berends, A.C.; de Mello-Donega, Celso

    2016-01-01

    Over the past few years, colloidal copper chalcogenide nanocrystals (NCs) have emerged as promising alternatives to conventional Cd and Pb chalcogenide NCs. Owing to their wide size, shape, and composition tunability, Cu chalcogenide NCs hold great promise for several applications, such as

  8. Hafnium carbide nanocrystal chains for field emitters

    International Nuclear Information System (INIS)

    Tian, Song; Li, Hejun; Zhang, Yulei; Ren, Jincui; Qiang, Xinfa; Zhang, Shouyang

    2014-01-01

    A hafnium carbide (HfC) nanostructure, i.e., HfC nanocrystal chain, was synthesized by a chemical vapor deposition (CVD) method. X-ray diffractometer, field-emission scanning electron microscope, transmission electron microscope, and energy-dispersive X-ray spectrometer were employed to characterize the product. The synthesized one-dimensional (1D) nanostructures with many faceted octahedral nanocrystals possess diameters of tens of nanometers to 500 nm and lengths of a few microns. The chain-like structures possess a single crystalline structure and preferential growth direction along the [1 0 0] crystal orientation. The growth of the chains occurred through the vapor–liquid–solid process along with a negative-feedback mechanism. The field emission (FE) properties of the HfC nanocrystal chains as the cold cathode emitters were examined. The HfC nanocrystal chains display good FE properties with a low turn-on field of about 3.9 V μm −1 and a high field enhancement factor of 2157, implying potential applications in vacuum microelectronics.

  9. Atomic force microscopy characterization of cellulose nanocrystals

    Science.gov (United States)

    Roya R. Lahiji; Xin Xu; Ronald Reifenberger; Arvind Raman; Alan Rudie; Robert J. Moon

    2010-01-01

    Cellulose nanocrystals (CNCs) are gaining interest as a “green” nanomaterial with superior mechanical and chemical properties for high-performance nanocomposite materials; however, there is a lack of accurate material property characterization of individual CNCs. Here, a detailed study of the topography, elastic and adhesive properties of individual wood-derived CNCs...

  10. Biocompatibility of bio based calcium carbonate nanocrystals ...

    African Journals Online (AJOL)

    Background: Currently, there has been extensive research interest for inorganic nanocrystals such as calcium phosphate, iron oxide, silicone, carbon nanotube and layered double hydroxide as a drug delivery system especially in cancer therapy. However, toxicological screening of such particles is paramount importance ...

  11. Solvothermal synthesis and characterization of CZTS nanocrystals

    Science.gov (United States)

    Dumasiya, Ajay; Shah, N. M.

    2017-05-01

    Cu2ZnSnS4 (CZTS) is a promising thin film absorber material for low cost solar cell applications. CZTS nanoparticle ink synthesized using solvothermal route is an attractive option to deposit absorber layer using screen printing or spin coating method in CZTS thin film solar cell. In this study we have synthesized CZTS nanocrystals using solvothermal method from aqueous solution of Copper nitrate [Cu(NO3)2], Zinc nitrate [Zn(NO3)2], tin chloride [SnCl4] and thiourea with varying concentration of Cu(NO3)2 (viz 0.82 mmol,1.4 mmol, 1.7 mmol) keeping concentrations of rest of solutions constant. As synthesized CZTS nanocrystals are characterized using Energy Dispersive Analysis of X-rays (EDAX) to verify stoichiometry of elements. Analysis of EDAX data suggests that CZTS nanocrystals having Copper nitrate [Cu (NO3)2] concentration of 1.4 m mole is near stoichiometric. X-ray diffraction analysis study of CZTS nanocrystals having Copper nitrate [Cu (NO3)2] concentration of 1.4 m mole reveals the preferred orientation of the grains in (112), (220) and (312) direction confirming Kesterite structure of CZTS.

  12. Thick-shell nanocrystal quantum dots

    Science.gov (United States)

    Hollingsworth, Jennifer A [Los Alamos, NM; Chen, Yongfen [Eugene, OR; Klimov, Victor I [Los Alamos, NM; Htoon, Han [Los Alamos, NM; Vela, Javier [Los Alamos, NM

    2011-05-03

    Colloidal nanocrystal quantum dots comprising an inner core having an average diameter of at least 1.5 nm and an outer shell, where said outer shell comprises multiple monolayers, wherein at least 30% of the quantum dots have an on-time fraction of 0.80 or greater under continuous excitation conditions for a period of time of at least 10 minutes.

  13. Biodegradation behaviors of cellulose nanocrystals -PVA nanocomposites

    Directory of Open Access Journals (Sweden)

    Mahdi Rohani

    2014-11-01

    Full Text Available In this research, biodegradation behaviors of cellulose nanocrystals-poly vinyl alcohol nanocomposites were investigated. Nanocomposite films with different filler loading levels (3, 6, 9 and 12% by wt were developed by solvent casting method. The effect of cellulose nanocrystals on the biodegradation behaviors of nanocomposite films was studied. Water absorption and water solubility tests were performed by immersing specimens into distilled water. The characteristic parameter of diffusion coefficient and maximum moisture content were determined from the obtained water absorption curves. The water absorption behavior of the nanocomposites was found to follow a Fickian behavior. The maximum water absorption and diffusion coefficients were decreased by increasing the cellulose nanocrystals contents, however the water solubility decrease. The biodegradability of the films was investigated by immersing specimens into cellulase enzymatic solution as well as by burial in soil. The results showed that adding cellulose nanocrystals increase the weight loss of specimens in enzymatic solution but decrease it in soil media. The limited biodegradability of specimens in soil media attributed to development of strong interactions with solid substrates that inhibit the accessibility of functional groups. Specimens with the low degree of hydrolysis underwent extensive biodegradation in both enzymatic and soil media, whilst specimens with the high degree of hydrolysis showed recalcitrance to biodegradation under those conditions.

  14. Silicon nanocrystal films for electronic applications

    Energy Technology Data Exchange (ETDEWEB)

    Lechner, Robert W.

    2009-02-06

    Whether nanoparticles of silicon are really suited for such applications, whether layers fabricated from this exhibit semiconducting properties, whether they can be doped, and whether for instance via the doping the conductivity can be tuned, was studied in the present thesis. Starting material for this were on the one hand spherical silicon nanocrystals with a sharp size distribution and mean diameters in the range from 4-50 nm. Furthermore silicon particle were available, which are with 50-500 nm distinctly larger and exhibit a broad distribution of the mean size and a polycrystalline fine structure with strongly bifurcated external morphology. The small conductivities and tje low mobility values of the charge carriers in the layers of silicon nanocrystals suggest to apply suited thermal after-treatment procedures. So was found that the aluminium-induced layer exchange (ALILE) also can be transferred to the porous layers of nanocrystals. With the deuteron passivation a method was available to change the charge-carrier concentration in the polycrystalline layers. Additionally to ALILE laser crystallization as alternative after-treatment procedure of the nanocrystal layers was studied.

  15. Biomimetic synthesis of noble metal nanocrystals

    Science.gov (United States)

    Chiu, Chin-Yi

    At the nanometer scale, the physical and chemical properties of materials heavily depend on their sizes and shapes. This fact has triggered considerable efforts in developing controllable nanomaterial synthesis. The controlled growth of colloidal nanocrystal is a kinetic process, in which high-energy facets grow faster and then vanish, leading to a nanocrystal enclosed by low-energy facets. Identifying a surfactant that can selectively bind to a particular crystal facet and thus lower its surface energy, is critical and challenging in shape controlled synthesis of nanocrystals. Biomolecules exhibiting exquisite molecular recognition properties can be exploited to precisely engineer nanostructured materials. In the first part of my thesis, we employed the phage display technique to select a specific multifunctional peptide sequence which can bind on Pd surface and mediate Pd crystal nucleation and growth, achieving size controlled synthesis of Pd nanocrystals in aqueous solution. We further demonstrated a rational biomimetic approach to the predictable synthesis of nanocrystals enclosed by a particular facet in the case of Pt. Specifically, Pt {100} and Pt {111} facet-specific peptides were identified and used to synthesize Pt nanocubes and Pt nano-tetrahedrons, respectively. The mechanistic studies of Pt {111} facet-specific peptide had led us to study the facet-selective adsorption of aromatic molecules on noble metal surfaces. The discoveries had achieved the development of design strategies to select facet-selective molecules which can synthesize nanocrystals with expected shapes in both Pt and Pd system. At last, we exploited Pt facet-specific peptides and controlled the molecular interaction to produce one- and three- dimensional nanostructures composed of anisotropic nanoparticles in synthetic conditions without supramolecular pre-organization, demonstrating the full potential of biomolecules in mediating material formation process. My research on biomimetic

  16. Microwave assisted synthesis of CdS nanoparticles and their size evolution

    International Nuclear Information System (INIS)

    Lopez, I. A.; Vazquez, A.; Gomez, I.

    2013-01-01

    The study of the size evolution of CdS nanoparticles in aqueous dispersion is presented in this paper. The sodium citrate was employed as stabilizer of CdS nanoparticles synthesized by microwave assisted synthesis. Analysis of this study was carried out by UV-Vis spectrophotometry, by comparison of the band gap energy using theoretical and empirical models. Results obtained show that the synthesis conditions produce CdS nanoparticles with diameters below of 6 nm, which remains stabilized by at least 14 days. These characteristics were confirmed by transmission electron microscopy. The X-ray diffraction pattern confirms cubic phase of the CdS nanoparticles. (Author)

  17. Microwave assisted synthesis of CdS nanoparticles and their size evolution

    Energy Technology Data Exchange (ETDEWEB)

    Lopez, I. A.; Vazquez, A.; Gomez, I., E-mail: idaliagomezmx@yahoo.com.mx [Universidad Autonoma de Nuevo Leon, Facultad de Ciencias Quimicas, Laboratorio de Materiales I, Av. Universidad, Cd. Universitaria, 66451 San Nicolas de los Garza, Nuevo Leon (Mexico)

    2013-05-01

    The study of the size evolution of CdS nanoparticles in aqueous dispersion is presented in this paper. The sodium citrate was employed as stabilizer of CdS nanoparticles synthesized by microwave assisted synthesis. Analysis of this study was carried out by UV-Vis spectrophotometry, by comparison of the band gap energy using theoretical and empirical models. Results obtained show that the synthesis conditions produce CdS nanoparticles with diameters below of 6 nm, which remains stabilized by at least 14 days. These characteristics were confirmed by transmission electron microscopy. The X-ray diffraction pattern confirms cubic phase of the CdS nanoparticles. (Author)

  18. High-speed monodisperse droplet generation by ultrasonically controlled micro-jet breakup

    Science.gov (United States)

    Frommhold, Philipp Erhard; Lippert, Alexander; Holsteyns, Frank Ludwig; Mettin, Robert

    2014-04-01

    A liquid jet that is ejected from a nozzle into air will disintegrate into drops via the well-known Plateau-Rayleigh instability within a certain range of Ohnesorge and Reynolds numbers. With the focus on the micrometer scale, we investigate the control of this process by superimposing a suitable ultrasonic signal, which causes the jet to break up into a very precise train of monodisperse droplets. The jet leaves a pressurized container of liquid via a small orifice of about 20 μm diameter. The break-up process and the emerging droplets are recorded via high-speed imaging. An extended parameter study of exit speed and ultrasonic frequency is carried out for deionized water to evaluate the jet's state and the subsequent generation of monodisperse droplets. Maximum exit velocities obtained reach almost 120 m s-1, and frequencies have been applied up to 1.8 MHz. Functionality of the method is confirmed for five additional liquids for moderate jet velocities 38 m s-1. For the uncontrolled jet disintegration, the drop size spectra revealed broad distributions and downstream drop growth by collision, while the acoustic control generated monodisperse droplets with a standard deviation less than 0.5 %. By adjustment of the acoustic excitation frequency, drop diameters could be tuned continuously from about 30 to 50 μm for all exit speeds. Good agreement to former experiments and theoretical approaches is found for the relation of overpressure and jet exit speed, and for the observed stability regions of monodisperse droplet generation in the parameter plane of jet speed and acoustic excitation frequency. Fitting of two free parameters of the general theory to the liquids and nozzles used is found to yield an even higher precision. Furthermore, the high-velocity instability limit of regular jet breakup described by von Ohnesorge has been superseded by more than a factor of two without entering the wind-induced instability regime, and monodisperse droplet generation was

  19. Synthesis of nanocrystals and nanocrystal self-assembly

    Science.gov (United States)

    Chen, Zhuoying

    Chapter 1. A general introduction is presented on nanomaterials and nanoscience. Nanoparticles are discussed with respect to their structure and properties. Ferroelectric materials and nanoparticles in particular are highlighted, especially in the case of the barium titanate, and their potential applications are discussed. Different nanocrystal synthetic techniques are discussed. Nanoparticle superlattices, the novel "meta-materials" built from self-assembly at the nanoscale, are introduced. The formation of nanoparticle superlattices and the importance and interest of synthesizing these nanostructures is discussed. Chapter 2. Advanced applications for high k dielectric and ferroelectric materials in the electronics industry continues to demand an understanding of the underlying physics in decreasing dimensions into the nanoscale. The first part of this chapter presents the synthesis, processing, and electrical characterization of nanostructured thin films (thickness ˜100 nm) of barium titanate BaTiO3 built from uniform nanoparticles (alcohols were used to study the effect of size and morphological control over the nanocrystals. Techniques including X-ray diffraction, transmission electron microscopy, selected area electron diffraction, and high-resolution electron microscopy are used to examine crystallinity and morphology. Chapter 3. By investigating the self-assembly of cadmium selenide-gold (CdSe-Au) nanoparticle mixtures by transmission electron microscopy after solvent evaporation, the effect of solvents in the formation process of CdSe-Au binary nanoparticle superlattices (BNSLs) was studied. 1-dodecanethiol was found to be critical in generating conditions necessary for superlattice formation, prior to the other factors that likely determine structure, highlighting the dual role of this organic polar molecule as both ligand and high boiling point/crystallization solvent. The influence of thiol was investigated under various concentrations (and also

  20. Cambridge English First 2 audio CDs : authentic examination papers

    CERN Document Server

    2016-01-01

    Four authentic Cambridge English Language Assessment examination papers for the Cambridge English: First (FCE) exam. These examination papers for the Cambridge English: First (FCE) exam provide the most authentic exam preparation available, allowing candidates to familiarise themselves with the content and format of the exam and to practise useful exam techniques. The Audio CDs contain the recorded material to allow thorough preparation for the Listening paper and are designed to be used with the Student's Book. A Student's Book with or without answers and a Student's Book with answers and downloadable Audio are available separately. These tests are also available as Cambridge English: First Tests 5-8 on Testbank.org.uk

  1. Temperature profiles for laser-induced heating of nanocrystals embedded in glass matrices

    Science.gov (United States)

    Bhatnagar, Promod K.; Nagpal, Swati

    2001-05-01

    Quantum confined nanostructures are very important because of their application towards optoelectronic devices. Commercial colored glass filters, which have large semiconductor particles, are being used to manufacture nanocrystals by suitable heat treatments. The progress in this area has been hampered by high size dispersion of these dots in the glass matrix which leads to reduction in higher order susceptibility thereby reducing non-linearity. In the present paper attempt has been made to theoretically model the temperature profiles of a laser irradiated CdS doped Borosilicate sample. Laser being used has a beam diameter of 1.5 mm and energy for 10 nsec pulse is 10 mJ. Two different particle radii of 5 nm and 10 nm have been considered. It is found that larger particles reach higher temperatures for the same pulse characteristics. This is because smaller particles have larger surface to volume ratio and hence dissipates out heat faster to the surrounding. Hence bigger particles will reach dissolution temperature faster than smaller particle and particle beyond a certain size should dissolve in the glass matrix when a sample is heat treated by laser. This could lead to a reduction in size dispersion of the nanocrystals. Also photodarkening effect found in semiconductor doped glasses is a big handicap for practical application of these materials in fast optical switching and non-linear optical devices. Photodarkening effect has been established to be a photochemical effect and it is important to study the temperature profiles around a particle since it will effect the impurity migration.

  2. Simple and inexpensive microfluidic devices for the generation of monodisperse multiple emulsions

    KAUST Repository

    Li, Erqiang

    2013-12-16

    Droplet-based microfluidic devices have become a preferred versatile platform for various fields in physics, chemistry and biology. Polydimethylsiloxane soft lithography, the mainstay for fabricating microfluidic devices, usually requires the usage of expensive apparatus and a complex manufacturing procedure. Here, we report the design and fabrication of simple and inexpensive microfluidic devices based on microscope glass slides and pulled glass capillaries, for generating monodisperse multiple emulsions. The advantages of our method lie in a simple manufacturing procedure, inexpensive processing equipment and flexibility in the surface modification of the designed microfluidic devices. Different types of devices have been designed and tested and the experimental results demonstrated their robustness for preparing monodisperse single, double, triple and multi-component emulsions. © 2014 IOP Publishing Ltd.

  3. Self-diffusion in monodisperse three-dimensional magnetic fluids by molecular dynamics simulations

    Energy Technology Data Exchange (ETDEWEB)

    Dobroserdova, A.B. [Ural Federal University, Lenin Av. 51, Ekaterinburg (Russian Federation); Kantorovich, S.S., E-mail: alla.dobroserdova@urfu.ru [Ural Federal University, Lenin Av. 51, Ekaterinburg (Russian Federation); University of Vienna, Sensengasse 8, Vienna (Austria)

    2017-06-01

    In the present work we study the self-diffusion behaviour in the three-dimensional monodisperse magnetic fluids using the Molecular Dynamics Simulation and Density Functional Theory. The peculiarity of computer simulation is to study two different systems: dipolar and soft sphere ones. In the theoretical method, it is important to choose the approximation for the main structures, which are chains. We compare the theoretical results and the computer simulation data for the self-diffusion coefficient as a function of the particle volume fraction and magnetic dipole-dipole interaction parameter and find the qualitative and quantitative agreement to be good. - Highlights: • The paper deals with the study of the self-diffusion in monodisperse three-dimensional magnetic fluids. • The theoretical approach contains the free energy density functional minimization. • Computer simulations are performed by the molecular dynamics method. • We have a good qualitative and quantitative agreement between the theoretical results and computer simulation data.

  4. Design of monodisperse and well-defined polypeptide-based polyvalent inhibitors of anthrax toxin.

    Science.gov (United States)

    Patke, Sanket; Boggara, Mohan; Maheshwari, Ronak; Srivastava, Sunit K; Arha, Manish; Douaisi, Marc; Martin, Jacob T; Harvey, Ian B; Brier, Matthew; Rosen, Tania; Mogridge, Jeremy; Kane, Ravi S

    2014-07-28

    The design of polyvalent molecules, presenting multiple copies of a specific ligand, represents a promising strategy to inhibit pathogens and toxins. The ability to control independently the valency and the spacing between ligands would be valuable for elucidating structure-activity relationships and for designing potent polyvalent molecules. To that end, we designed monodisperse polypeptide-based polyvalent inhibitors of anthrax toxin in which multiple copies of an inhibitory toxin-binding peptide were separated by flexible peptide linkers. By tuning the valency and linker length, we designed polyvalent inhibitors that were over four orders of magnitude more potent than the corresponding monovalent ligands. This strategy for the rational design of monodisperse polyvalent molecules may not only be broadly applicable for the inhibition of toxins and pathogens, but also for controlling the nanoscale organization of cellular receptors to regulate signaling and the fate of stem cells. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  5. Fabrication of monodisperse magnetic nanoparticles released in solution using a block copolymer template

    Science.gov (United States)

    Morcrette, Mélissa; Ortiz, Guillermo; Tallegas, Salomé; Joisten, Hélène; Tiron, Raluca; Baron, Thierry; Hou, Yanxia; Lequien, Stéphane; Bsiesy, Ahmad; Dieny, Bernard

    2017-07-01

    This paper describes a fabrication process of monodisperse magnetic nanoparticles released in solution, based on combined ‘top-down’ and ‘bottom-up’ approaches. The process involves the use of a self-assembled PS-PMMA block copolymer formed on a sacrificial layer. Such an approach was so far mostly explored for the preparation of patterned magnetic media for ultrahigh density magnetic storage. It is here extended to the preparation of released monodisperse nanoparticles for biomedical applications. A special sacrificial layer had to be developed compatible with the copolymer self-organization. The resulting nanoparticles exhibit very narrow size dispersion (≈7%) and can be good candidates as contrast agents for medical imaging i.e. magnetic resonance imaging or magnetic particle imaging. The approach provides a great freedom in the choice of the particles shapes and compositions. In particular, they can be made of biocompatible magnetic material.

  6. Fabrication of monodisperse magnetic nanoparticles released in solution using a block copolymer template

    International Nuclear Information System (INIS)

    Morcrette, Mélissa; Ortiz, Guillermo; Joisten, Hélène; Dieny, Bernard; Tallegas, Salomé; Baron, Thierry; Bsiesy, Ahmad; Tiron, Raluca; Hou, Yanxia; Lequien, Stéphane

    2017-01-01

    This paper describes a fabrication process of monodisperse magnetic nanoparticles released in solution, based on combined ‘top-down’ and ‘bottom-up’ approaches. The process involves the use of a self-assembled PS-PMMA block copolymer formed on a sacrificial layer. Such an approach was so far mostly explored for the preparation of patterned magnetic media for ultrahigh density magnetic storage. It is here extended to the preparation of released monodisperse nanoparticles for biomedical applications. A special sacrificial layer had to be developed compatible with the copolymer self-organization. The resulting nanoparticles exhibit very narrow size dispersion (≈7%) and can be good candidates as contrast agents for medical imaging i.e. magnetic resonance imaging or magnetic particle imaging. The approach provides a great freedom in the choice of the particles shapes and compositions. In particular, they can be made of biocompatible magnetic material. (paper)

  7. Structure and transformation of tactoids in cellulose nanocrystal suspensions

    Science.gov (United States)

    Wang, Pei-Xi; Hamad, Wadood Y.; MacLachlan, Mark J.

    2016-05-01

    Cellulose nanocrystals obtained from natural sources are of great interest for many applications. In water, cellulose nanocrystals form a liquid crystalline phase whose hierarchical structure is retained in solid films after drying. Although tactoids, one of the most primitive components of liquid crystals, are thought to have a significant role in the evolution of this phase, they have evaded structural study of their internal organization. Here we report the capture of cellulose nanocrystal tactoids in a polymer matrix. This method allows us to visualize, for the first time, the arrangement of cellulose nanocrystals within individual tactoids by electron microscopy. Furthermore, we can follow the structural evolution of the liquid crystalline phase from tactoids to iridescent-layered films. Our insights into the early nucleation events of cellulose nanocrystals give important information about the growth of cholesteric liquid crystalline phases, especially for cellulose nanocrystals, and are crucial for preparing photonics-quality films.

  8. In-site synthesis of monodisperse, oleylamine-capped Ag nanoparticles through microemulsion approach

    Science.gov (United States)

    Chen, Shun; Ju, Yanyun; Guo, Yi; Xiong, Chuanxi; Dong, Lijie

    2017-03-01

    Ag NPs were in-site synthesized through microemulsion method by reducing silver acetate with oleylamine-mediated at 70 °C with highly monodisperse and narrow size from 10 to 20 nm. The synthesis of Ag NPs was aided by oleylamine and the role of oleylamine was researched. This in-site synthesis approach to Ag NPs was reproducibility and high yield more than 80% with stable store about 6 months.

  9. In-site synthesis of monodisperse, oleylamine-capped Ag nanoparticles through microemulsion approach

    Energy Technology Data Exchange (ETDEWEB)

    Chen, Shun; Ju, Yanyun [Wuhan University of Technology, School of Materials Science and Engineering (China); Guo, Yi [Wuhan University of Technology, Center for Materials Research and Analysis (China); Xiong, Chuanxi; Dong, Lijie, E-mail: dong@whut.edu.cn [Wuhan University of Technology, School of Materials Science and Engineering (China)

    2017-03-15

    Ag NPs were in-site synthesized through microemulsion method by reducing silver acetate with oleylamine-mediated at 70 °C with highly monodisperse and narrow size from 10 to 20 nm. The synthesis of Ag NPs was aided by oleylamine and the role of oleylamine was researched. This in-site synthesis approach to Ag NPs was reproducibility and high yield more than 80% with stable store about 6 months.

  10. Environmentally friendly synthesis of highly monodisperse biocompatible gold nanoparticles with urchin-like shape.

    Science.gov (United States)

    Lu, Lehui; Ai, Kelong; Ozaki, Yukihiro

    2008-02-05

    We report a facile and environmentally friendly strategy for high-yield synthesis of highly monodisperse gold nanoparticles with urchin-like shape. A simple protein, gelatin, was first used for the control over shape and orientation of the gold nanoparticles. These nanoparticles, ready to use for biological systems, are promising in the optical imaging-based disease diagnostics and therapy because of their tunable surface plasmon resonance (SPR) and excellent surface-enhanced Raman scattering (SERS) activity.

  11. Organic inorganic hybrid coating (poly(methyl methacrylate)/monodisperse silica)

    Science.gov (United States)

    Rubio, E.; Almaral, J.; Ramírez-Bon, R.; Castaño, V.; Rodríguez, V.

    2005-04-01

    Polymethylmethacrylate-silica hybrid coatings were prepared from methyl methacrylate and monodisperse colloidal silica prepared by the Stöber method. The surfaces of the spheres were successfully modified by chemical reaction with 3-(trimethoxysilyl) propyl methacrylate (TMSPM) to compatibilise the organic and inorganic components of the precursor solution mixture. The coatings were deposited by dip-coating on glass substrates. They result with good properties of homogeneity, optical transparence, hardness and adhesion.

  12. Preparation of monodisperse porous silica particles using poly(glycidyl methacrylate) microspheres as a template

    Czech Academy of Sciences Publication Activity Database

    Grama, Silvia; Horák, Daniel

    2015-01-01

    Roč. 64, Suppl. 1 (2015), S11-S17 ISSN 0862-8408 R&D Projects: GA MŠk(CZ) EE2.3.30.0029; GA MŠk(CZ) ED1.1.00/02.0109 Institutional support: RVO:61389013 Keywords : microspheres * monodisperse * silica Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 1.643, year: 2015 http://www.biomed.cas.cz/physiolres/pdf/64%20Suppl%201/64_S11.pdf

  13. Temperature dependence of exchange anisotropy in monodisperse cobalt nanoparticles with a cobalt oxide shell

    International Nuclear Information System (INIS)

    Spasova, M.; Wiedwald, U.; Farle, M.; Radetic, T.; Dahmen, U.; Hilgendorff, M.; Giersig, M.

    2004-01-01

    Exchange anisotropy was studied by SQUID magnetometry on an array of monodisperse colloidal nanoparticles consisting of a 7-8 nm diameter FCC Co core covered with a 2-2.5 nm thick FCC CoO shell. Temperature-dependent measurements of the exchange bias field show that the exchange anisotropy vanishes when a magnetic field was applied during cooling below 150 K. The suppression of exchange anisotropy is due to uncompensated interfacial antiferromagnetic spins

  14. Monodisperse microbeads of hypercrosslinked polystyrene for liquid and supercritical fluid chromatography

    Science.gov (United States)

    Tsyurupa, M. P.; Blinnikova, Z. K.; Il'in, M. M.; Davankov, V. A.; Parenago, O. O.; Pokrovskii, O. I.; Usovich, O. I.

    2015-11-01

    Monodisperse styrene-divinylbenzene (1 wt %) copolymer microbeads are obtained via the elaborate method of high-productivity precipitation polymerization. The crosslinking of this copolymer with chloromethyl methyl ether in the presence of Friedel-Crafts catalyst yields porous hypercrosslinked polymers with degrees of crosslinking that range from 200 to 500%. Microbead sorbents are shown to be suited for selective stationary phases for high-performance liquid chromatography and supercritical fluid chromatography.

  15. Organization of silicon nanocrystals by localized electrochemical etching

    International Nuclear Information System (INIS)

    Ayari-Kanoun, Asma; Drouin, Dominique; Beauvais, Jacques; Lysenko, Vladimir; Nychyporuk, Tetyana; Souifi, Abdelkader

    2009-01-01

    An approach to form a monolayer of organized silicon nanocrystals on a monocrystalline Si wafer is reported. Ordered arrays of nanoholes in a silicon nitride layer were obtained by combining electron beam lithography and plasma etching. Then, a short electrochemical etching current pulse led to formation of a single Si nanocrystal per each nanohole. As a result, high quality silicon nanocrystal arrays were formed with well controlled and reproducible morphologies. In future, this approach can be used to fabricate single electron devices.

  16. Extracellular biosynthesis of monodispersed gold nanoparticles by a SAM capping route

    Energy Technology Data Exchange (ETDEWEB)

    Wen Li [Xiamen University, Department of Chemistry, College of Chemistry and Chemical Engineering (China); Lin Zhonghua [Xiamen University, State Key Laboratory of Physical Chemistry of Solid Surfaces (China); Gu Pingying [Xiamen University, Department of Chemistry, College of Chemistry and Chemical Engineering (China); Zhou Jianzhang [Xiamen University, State Key Laboratory of Physical Chemistry of Solid Surfaces (China); Yao Bingxing [Xiamen University, School of Life Sciences (China); Chen Guoliang; Fu Jinkun, E-mail: wenli_1976@163.co [Xiamen University, Department of Chemistry, College of Chemistry and Chemical Engineering (China)

    2009-02-15

    Monodispersed gold nanoparticles capped with a self-assembled monolayer of dodecanethiol were biosynthesized extracellularly by an efficient, simple, and environmental friendly procedure, which involved the use of Bacillus megatherium D01 as the reducing agent and the use of dodecanethiol as the capping ligand at 26 {sup o}C. The kinetics of gold nanoparticle formation was followed by transmission electron microscope (TEM) and UV-vis spectroscopy. It was shown that reaction time was an important parameter in controlling the morphology of gold nanoparticles. The effect of thiol on the shape, size, and dispersity of gold nanoparticles was also studied. The results showed that the presence of thiol during the biosynthesis could induce the formation of small size gold nanoparticles (<2.5 nm), hold the shape of spherical nanoparticles, and promote the monodispersity of nanoparticles. Through the modulation of reaction time and the use of thiol, monodispersed spherical gold nanoparticles capped with thiol of 1.9 {+-} 0.8 nm size were formed by using Bacillus megatherium D01.

  17. Sonochemical synthesis of (3-aminopropyl)triethoxysilane-modified monodispersed silica nanoparticles for protein immobilization

    International Nuclear Information System (INIS)

    Shen, Shou-Cang; Ng, Wai Kiong; Chia, Leonard; Dong, Yuan-Cai; Tan, Reginald B.H.

    2011-01-01

    Graphical abstract: 3-Aminopropyltriethoxysilane modified monodispersed silica nanoparticles were synthesized by rapid sonochemical co-condensation to achieve high capability for protein immobilization. Highlights: → Amino-modified monodispersed silica nanoparticles were synthesized by rapid co-condensation. → Strong positive charge was created by aminopropyl-modification. → Capability for immobilization of negatively charged protein was enhanced. → Electrostatic interaction between proteins and surface contributed to the enhanced adsorption. -- Abstract: 3-Aminopropyltriethoxysilane modified monodispersed silica nanoparticles were synthesized by a rapid sonochemical co-condensation synthesis procedure. The chemical nature of surface organic modifier on the obtained modified silica nanoparticle was characterized by 13 C and 29 Si MAS Nuclear Magnetic Resonance (NMR) spectroscopies, Fourier-transform infrared spectroscopy (FTIR), thermogravimetric analysis (TGA)- differential scanning calorimetry (DSC). Due to the strengthened positive surface charge of the silica nanoparticles by the modification with aminopropyl groups, the capability for bovine serum albumin (BSA) adsorption was significantly increased as compared with bare silica nanoparticles. 80 mg/g BSA was adsorbed on modified silica nanoparticles, whereas only 20 mg/g BSA could be loaded on pure silica nanoparticles. The enhanced positive surface charge repelled proteins with net positive charge and the modified silica nanoparticles exhibited negligible adsorption of lysozyme, thus a selective adsorption of proteins could be achieved.

  18. Synthesis of monodisperse silver nanoparticles for ink-jet printed flexible electronics

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Zhiliang; Zhang Xingye; Xin Zhiqing; Deng Mengmeng; Wen Yongqiang; Song Yanlin, E-mail: zhangxy@iccas.ac.cn, E-mail: ylsong@iccas.ac.cn [Beijing National Laboratory for Molecular Sciences (BNLMS), Key Lab of Organic Solids, Laboratory of New Materials, Institute of Chemistry, Chinese Academy of Sciences, Beijing 100190 (China)

    2011-10-21

    In this study, monodisperse silver nanoparticles were synthesized with a new reduction system consisting of adipoyl hydrazide and dextrose at ambient temperature. By this facile and rapid approach, high concentration monodisperse silver nanoparticles were obtained on a large scale at low protectant/AgNO{sub 3} mass ratio which was highly beneficial to low cost and high conductivity. Based on the synthesized monodisperse silver nanoparticles, conductive inks were prepared with water, ethanol and ethylene glycol as solvents, and were expected to be more environmentally friendly. A series of electrocircuits were fabricated by ink-jet printing silver nanoparticle ink on paper substrate with a commercial printer, and they had low resistivity in the range of 9.18 x 10{sup -8}-8.76 x 10{sup -8} {Omega} m after thermal treatment at 160 {sup 0}C for 30 min, which was about five times that of bulk silver (1.586 x 10{sup -8} {Omega} m). Moreover, a radio frequency identification (RFID) antenna was fabricated by ink-jet printing, and 6 m wireless identification was realized after an Alien higgs-3 chip was mounted on the printed antenna by the flip-chip method. These flexible electrocircuits produced by ink-jet printing would have enormous potential for low cost electrodes and sensor devices.

  19. Extracellular biosynthesis of monodispersed gold nanoparticles by a SAM capping route

    International Nuclear Information System (INIS)

    Wen Li; Lin Zhonghua; Gu Pingying; Zhou Jianzhang; Yao Bingxing; Chen Guoliang; Fu Jinkun

    2009-01-01

    Monodispersed gold nanoparticles capped with a self-assembled monolayer of dodecanethiol were biosynthesized extracellularly by an efficient, simple, and environmental friendly procedure, which involved the use of Bacillus megatherium D01 as the reducing agent and the use of dodecanethiol as the capping ligand at 26 o C. The kinetics of gold nanoparticle formation was followed by transmission electron microscope (TEM) and UV-vis spectroscopy. It was shown that reaction time was an important parameter in controlling the morphology of gold nanoparticles. The effect of thiol on the shape, size, and dispersity of gold nanoparticles was also studied. The results showed that the presence of thiol during the biosynthesis could induce the formation of small size gold nanoparticles (<2.5 nm), hold the shape of spherical nanoparticles, and promote the monodispersity of nanoparticles. Through the modulation of reaction time and the use of thiol, monodispersed spherical gold nanoparticles capped with thiol of 1.9 ± 0.8 nm size were formed by using Bacillus megatherium D01.

  20. Synthesis of monodisperse silver nanoparticles for ink-jet printed flexible electronics

    International Nuclear Information System (INIS)

    Zhang Zhiliang; Zhang Xingye; Xin Zhiqing; Deng Mengmeng; Wen Yongqiang; Song Yanlin

    2011-01-01

    In this study, monodisperse silver nanoparticles were synthesized with a new reduction system consisting of adipoyl hydrazide and dextrose at ambient temperature. By this facile and rapid approach, high concentration monodisperse silver nanoparticles were obtained on a large scale at low protectant/AgNO 3 mass ratio which was highly beneficial to low cost and high conductivity. Based on the synthesized monodisperse silver nanoparticles, conductive inks were prepared with water, ethanol and ethylene glycol as solvents, and were expected to be more environmentally friendly. A series of electrocircuits were fabricated by ink-jet printing silver nanoparticle ink on paper substrate with a commercial printer, and they had low resistivity in the range of 9.18 x 10 -8 -8.76 x 10 -8 Ω m after thermal treatment at 160 0 C for 30 min, which was about five times that of bulk silver (1.586 x 10 -8 Ω m). Moreover, a radio frequency identification (RFID) antenna was fabricated by ink-jet printing, and 6 m wireless identification was realized after an Alien higgs-3 chip was mounted on the printed antenna by the flip-chip method. These flexible electrocircuits produced by ink-jet printing would have enormous potential for low cost electrodes and sensor devices.

  1. Optimization of a simple technique for preparation of monodisperse poly(lactide-co-glycolide) nanospheres

    Energy Technology Data Exchange (ETDEWEB)

    Ito, Fuminori, E-mail: fuminoito@spice.ocn.ne.jp [Tokyo Metropolitan University, Department of Applied Chemistry, Graduate School of Urban Environmental Sciences (Japan)

    2016-09-15

    In this study, we report the optimization of a solvent evaporation technique for preparing monodisperse poly-(lactide-co-glycolide) (PLGA) nanospheres, from a mixture of solvents composed of ethanol and PVA solution. Various experimental conditions were investigated in order to control the particle size and size distribution of the nanospheres. In addition, nanospheres containing rifampicin (RFP, an antituberculosis drug), were prepared using PLGA of various molecular weights, to study the effects of RFP as a model hydrophobic drug. The results showed that a higher micro-homogenizer stirring rate facilitated the preparation of monodisperse PLGA nanospheres with a low coefficient of variation (~20 %), with sizes below 200 nm. Increasing the PLGA concentration from 0.1 to 0.5 g resulted in an increase in the size of the obtained nanospheres from 130 to 174 nm. The molecular weight of PLGA had little effect on the particle sizes and particle size distributions of the nanospheres. However, the drug loading efficiencies of the obtained RFP/PLGA nanospheres decreased when the molecular weight of PLGA was increased. Based on these experiments, an optimized technique was established for the preparation of monodisperse PLGA nanospheres, using the method developed by the authors.Graphical Abstract.

  2. Sonochemical synthesis of (3-aminopropyl)triethoxysilane-modified monodispersed silica nanoparticles for protein immobilization

    Energy Technology Data Exchange (ETDEWEB)

    Shen, Shou-Cang, E-mail: shen_shoucang@ices.a-star.edu.sg [Institute of Chemical and Engineering Sciences, A-STAR (Agency for Science, Technology and Research), 1 Pesek Road, Jurong Island, Singapore 627833 (Singapore); Ng, Wai Kiong; Chia, Leonard; Dong, Yuan-Cai [Institute of Chemical and Engineering Sciences, A-STAR (Agency for Science, Technology and Research), 1 Pesek Road, Jurong Island, Singapore 627833 (Singapore); Tan, Reginald B.H., E-mail: reginald_tan@ices.a-star.edu.sg [Institute of Chemical and Engineering Sciences, A-STAR (Agency for Science, Technology and Research), 1 Pesek Road, Jurong Island, Singapore 627833 (Singapore); Department of Chemical and Biomolecular Engineering, The National University of Singapore, 4 Engineering Drive 4, Singapore 117576 (Singapore)

    2011-10-15

    Graphical abstract: 3-Aminopropyltriethoxysilane modified monodispersed silica nanoparticles were synthesized by rapid sonochemical co-condensation to achieve high capability for protein immobilization. Highlights: {yields} Amino-modified monodispersed silica nanoparticles were synthesized by rapid co-condensation. {yields} Strong positive charge was created by aminopropyl-modification. {yields} Capability for immobilization of negatively charged protein was enhanced. {yields} Electrostatic interaction between proteins and surface contributed to the enhanced adsorption. -- Abstract: 3-Aminopropyltriethoxysilane modified monodispersed silica nanoparticles were synthesized by a rapid sonochemical co-condensation synthesis procedure. The chemical nature of surface organic modifier on the obtained modified silica nanoparticle was characterized by {sup 13}C and {sup 29}Si MAS Nuclear Magnetic Resonance (NMR) spectroscopies, Fourier-transform infrared spectroscopy (FTIR), thermogravimetric analysis (TGA)- differential scanning calorimetry (DSC). Due to the strengthened positive surface charge of the silica nanoparticles by the modification with aminopropyl groups, the capability for bovine serum albumin (BSA) adsorption was significantly increased as compared with bare silica nanoparticles. 80 mg/g BSA was adsorbed on modified silica nanoparticles, whereas only 20 mg/g BSA could be loaded on pure silica nanoparticles. The enhanced positive surface charge repelled proteins with net positive charge and the modified silica nanoparticles exhibited negligible adsorption of lysozyme, thus a selective adsorption of proteins could be achieved.

  3. Synthesis of highly monodisperse particles composed of a magnetic core and fluorescent shell.

    Science.gov (United States)

    Nagao, Daisuke; Yokoyama, Mikio; Yamauchi, Noriko; Matsumoto, Hideki; Kobayashi, Yoshio; Konno, Mikio

    2008-09-02

    Highly monodisperse particles composed of a magnetic silica core and fluorescent polymer shell were synthesized with a combined technique of heterocoagulation and soap-free emulsion polymerization. Prior to heterocoagulation, monodisperse, submicrometer-sized silica particles were prepared with the Stober method, and magnetic nanoparticles were prepared with a modified Massart method in which a cationic silane coupling agent of N-trimethoxysilylpropyl- N, N, N-trimethylammonium chloride was added just after coprecipitation of Fe (2+) and Fe (3+). The silica particles with negative surface potential were heterocoagulated with the magnetic nanoparticles with positive surface potential. The magnetic silica particles obtained with the heterocoagulation were treated with sodium silicate to modify their surfaces with silica. In the formation of a fluorescent polymer shell onto the silica-coated magnetic silica cores, an amphoteric initiator of 2,2'-azobis[ N-(2-carboxyethyl)-2-2-methylpropionamidine] (VA-057) was used to control the colloidal stability of the magnetic cores during the polymer coating. The polymerization of St in the presence of a hydrophobic fluorophore of pyrene could coat the cores with fluorescent polymer shells, resulting in monodisperse particles with a magnetic silica core and fluorescent polymer shell. Measurements of zeta potential for the composite particles in different pH values indicated that the composite particles had an amphoteric property originating from VA-057 initiator.

  4. Continuous and rapid synthesis of nanoclusters and nanocrystals using scalable microstructured reactors

    Science.gov (United States)

    Jin, Hyung Dae

    Recent advances in nanocrystalline materials production are expected to impact the development of next generation low-cost and/or high efficiency solar cells. For example, semiconductor nanocrystal inks are used to lower the fabrication cost of the absorber layers of the solar cells. In addition, some quantum confined nanocrystals display electron-hole pair generation phenomena with greater than 100% quantum yield, called multiple exciton generation (MEG). These quantum dots could potentially be used to fabricate solar cells that exceed the Schockley-Queisser limit. At present, continuous syntheses of nanoparticles using microreactors have been reported by several groups. Microreactors have several advantages over conventional batch synthesis. One advantage is their efficient heat transfer and mass transport. Another advantage is the drastic reduction in the reaction time, in many cases, down to minutes from hours. Shorter reaction time not only provides higher throughput but also provide better particle size control by avoiding aggregation and by reducing probability of oxidizing precursors. In this work, room temperature synthesis of Au11 nanoclusters and high temperature synthesis of chalcogenide nanocrystals were demonstrated using continuous flow microreactors with high throughputs. A high rate production of phosphine-stabilized Au11 nanoclusters was achieved using a layer-up strategy which involves the use of microlamination architectures; the patterning and bonding of thin layers of material (laminae) to create a multilayered micromixer in the range of 25-250 mum thick was used to step up the production of phosphine-stabilized Au11 nanoclusters. Continuous production of highly monodispersed phosphine-stabilized Au 11 nanoclusters at a rate of about 11.8 [mg/s] was achieved using a microreactor with a size of 1.687cm3. This result is about 30,000 times over conventional batch synthesis according to production rate/per reactor volume. We have elucidated the

  5. Microscopic theory of cation exchange in CdSe nanocrystals.

    Science.gov (United States)

    Ott, Florian D; Spiegel, Leo L; Norris, David J; Erwin, Steven C

    2014-10-10

    Although poorly understood, cation-exchange reactions are increasingly used to dope or transform colloidal semiconductor nanocrystals (quantum dots). We use density-functional theory and kinetic Monte Carlo simulations to develop a microscopic theory that explains structural, optical, and electronic changes observed experimentally in Ag-cation-exchanged CdSe nanocrystals. We find that Coulomb interactions, both between ionized impurities and with the polarized nanocrystal surface, play a key role in cation exchange. Our theory also resolves several experimental puzzles related to photoluminescence and electrical behavior in CdSe nanocrystals doped with Ag.

  6. Preparation of CdS Nanoparticles by First-Year Undergraduates

    Science.gov (United States)

    Winkelmann, Kurt; Noviello, Thomas; Brooks, Stephen

    2007-01-01

    The first year undergraduates use a simple method to synthesize 5-nm CdS nanoparticles in a water-in-oil microemulsion. The quantum size effect, the relationship between colors, optical absorbance, band-gap energy and the CdS particles affected by the formation of micelles are observed.

  7. Effect of precursor concentration, temperature and capping group on the morphology of CdS nanoparticles

    CSIR Research Space (South Africa)

    Moloto, N

    2008-01-01

    Full Text Available A novel ligand to the synthesis of nanoparticles has been employed in this study. A Tetramethylthiuram disulphide cadmium complex (abundant in sulphur atoms) was used as a single-source precursor for the synthesis of CdS nanoparticles. The CdS...

  8. Effect of temperature, precursor concentration and capping group on the shape of Cds nanoparticles

    CSIR Research Space (South Africa)

    Moloto, N

    2009-01-01

    Full Text Available A novel ligand to the synthesis of nanoparticles has been employed in this study. A Tetramethylthiuram disulphide cadmium complex (abundant in sulphur atoms) was used as a single-source precursor for the synthesis of CdS nanoparticles. The CdS...

  9. BI Reporting, Data Warehouse Systems, and Beyond. CDS Spotlight Report. Research Bulletin

    Science.gov (United States)

    Lang, Leah; Pirani, Judith A.

    2014-01-01

    This Spotlight focuses on data from the 2013 Core Data Service [CDS] to better understand how higher education institutions approach business intelligence (BI) reporting and data warehouse systems (see the Sidebar for definitions). Information provided for this Spotlight was derived from Module 8 of CDS, which contains several questions regarding…

  10. The Financial Management System: A Pivotal Tool for Fiscal Viability. CDS Spotlight. ECAR Research Bulletin

    Science.gov (United States)

    Lang, Leah; Pirani, Judith A.

    2014-01-01

    This spotlight focuses on data from the 2013 CDS to better understand how higher education institutions approach financial management systems. Information provided for this spotlight was derived from Module 8 of Core Data Service (CDS), which asked several questions regarding information systems and applications. Responses from 525 institutions…

  11. Study of optical phonon modes of CdS nanoparticles using Raman

    Indian Academy of Sciences (India)

    In this paper we report the study of optical phonon modes of nanoparticles of CdS using Raman spectroscopy. Nanoparticle sample for the present study was synthesized through chemical precipitation technique. The CdS nanoparticles were then subjected to heat treatment at low temperature (150°C) for extended time ...

  12. Synthesis of CdS nanoparticles based on DNA network templates

    International Nuclear Information System (INIS)

    Yao Yong; Song Yonghai; Wang Li

    2008-01-01

    CdS nanoparticles have been successfully synthesized by using DNA networks as templates. The synthesis was carried out by first dropping a mixture of cadmium acetate and DNA on a mica surface for the formation of the DNA network template and then transferring the sample into a heated thiourea solution. The Cd 2+ reacted with thiourea at high temperature and formed CdS nanoparticles on the DNA network template. UV-vis spectroscopy, photoluminescence, x-ray diffraction and atomic force microscopy (AFM) were used to characterize the CdS nanoparticles in detail. AFM results showed that the resulted CdS nanoparticles were directly aligned on the DNA network templates and that the synthesis and assembly of CdS nanoparticles was realized in one step. CdS nanoparticles fabricated with this method were smaller than those directly synthesized in a thiourea solution and were uniformly aligned on the DNA networks. By adjusting the density of the DNA networks and the concentration of Cd 2+ , the size and density of the CdS nanoparticles could be effectively controlled and CdS nanoparticles could grow along the DNA chains into nanowires. The possible growth mechanism has also been discussed in detail

  13. Chemically deposited TiO2/CdS bilayer system for ...

    Indian Academy of Sciences (India)

    FTO/TiO2/CdS bilayers system showed improved performance of PEC properties over individual ... form distribution of nanocrystalline CdS on TiO2 and this is unfavourable for the ... (TEA), the pH of the solution maintained at 12·0 by drop.

  14. Effects of bacteria on CdS thin films used in technological devices

    Science.gov (United States)

    Alpdoğan, S.; Adıgüzel, A. O.; Sahan, B.; Tunçer, M.; Metin Gubur, H.

    2017-04-01

    Cadmium sulfide (CdS) thin films were fabricated on glass substrates by the chemical bath deposition method at 70 {}^\\circ \\text{C} considering deposition times ranging from 2 h to 5 h. The optical band gaps of CdS thin films were found to be in the 2.42-2.37 eV range. CdS thin films had uniform spherical nano-size grains which had polycrystalline, hexagonal and cubic phases. The films had a characteristic electrical resistivity of the order of {{10}5} Ω \\text{cm} and n-type conductivity at room condition. CdS thin films were incubated in cultures of B.domonas aeruginosa and Staphylococcus aureus, which exist abundantly in the environment, and form biofilms. SEM images showed that S. aureus and K. pneumonia were detected significantly on the film surfaces with a few of P. aeruginosa and B. subtilis cells attached. CdS thin film surface exhibits relatively good resistance to the colonization of P. aeruginosa and B. subtilis. Optical results showed that the band gap of CdS thin films which interacted with the bacteria is 2.42 \\text{eV} . The crystal structure and electrical properties of CdS thin films were not affected by bacterial adhesion. The antimicrobial effect of CdS nanoparticles was different for different bacterial strains.

  15. A comparative study of CdS thin films deposited by different techniques

    Energy Technology Data Exchange (ETDEWEB)

    Pérez-Hernández, G., E-mail: german.perez@ujat.mx [Universidad Juárez Autónoma de Tabasco, Avenida Universidad s/n, Col. Magisterial, Villahermosa, Tabasco 86040 (Mexico); Pantoja-Enríquez, J. [Centro de Investigación y Desarrollo Tecnológico en Energías Renovables, UNICACH, Libramiento Norte No 1150, Tuxtla Gutiérrez, Chiapas 29039 (Mexico); Escobar-Morales, B. [Instituto Tecnológico de Cancún, Avenida Kábah Km 3, Cancún, Quintana Roo 77500 (Mexico); Martinez-Hernández, D.; Díaz-Flores, L.L.; Ricardez-Jiménez, C. [Universidad Juárez Autónoma de Tabasco, Avenida Universidad s/n, Col. Magisterial, Villahermosa, Tabasco 86040 (Mexico); Mathews, N.R.; Mathew, X. [Centro de Investigación en Energía, Universidad Nacional Autónoma de México, Temixco, Morelos 62580 (Mexico)

    2013-05-01

    Cadmium sulfide thin-films were deposited on glass slides and SnO{sub 2}:F coated glass substrates by chemical bath deposition, sputtering and close-spaced sublimation techniques. The films were studied for the structural and opto-electronic properties after annealing in an ambient identical to that employed in the fabrication of CdTe/CdS devices. Quantum efficiency of the CdTe/CdS solar cells fabricated with CdS buffer films prepared by the three methods were investigated to understand the role of CdS film preparation method on the blue response of the devices. The higher blue response observed for the devices fabricated with chemical bath deposited CdS film is discussed. - Highlights: ► CdS films were prepared by different techniques. ► Role of CdS on the blue response of device was studied. ► Structural and optical properties of CdS were analyzed. ► Chemically deposited CdS has high blue transmittance. ► CdS deposition method influences diffusion of S and Te.

  16. Cellulose nanocrystal properties and their applications

    Directory of Open Access Journals (Sweden)

    mahdi jonoobi

    2015-05-01

    Full Text Available The main purpose of this work is to provide an overview of recent research in the area of cellulose nonmaterials production from different sources. Due to their abundance, their renewability, high strength and stiffness, being eco-friendly, and low weight; numerous studies have been reported on the isolation of cellulose nanomaterials from different cellulosic sources and their use in high performance applications. This work covers an introduction into the nano cellulose definition as well as used methods for isolation of nanomaterials (nanocrystals from various sources. The rod-like cellulose nanocrystals (CNC can be isolated from sources like wood, plant fibers, agriculture and industrial bio residues, tunicates, and bacterial cellulose using acid hydrolysis process. Following this, the paper focused on characterization methods, materials properties and structure. The current review is a comprehensive literature regarding the nano cellulose isolation and demonstrates the potential of cellulose nanomaterials to be used in a wide range of high-tech applications.

  17. Tunable plasmonic lattices of silver nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Tao, Andrea; Sinsermsuksakul, Prasert; Yang, Peidong

    2008-02-18

    Silver nanocrystals are ideal building blocks for plasmonicmaterials that exhibit a wide range of unique and potentially usefuloptical phenomena. Individual nanocrystals display distinct opticalscattering spectra and can be assembled into hierarchical structures thatcouple strongly to external electromagnetic fields. This coupling, whichis mediated by surface plasmons, depends on their shape and arrangement.Here we demonstrate the bottom-up assembly of polyhedral silvernanocrystals into macroscopic two-dimensional superlattices using theLangmuir-Blodgett technique. Our ability to control interparticlespacing, density, and packing symmetry allows for tunability of theoptical response over the entire visible range. This assembly strategyoffers a new, practical approach to making novel plasmonic materials forapplication in spectroscopic sensors, sub-wavelength optics, andintegrated devices that utilize field enhancement effects.

  18. Sulfonsuccinate (AOT Capped Pure and Mn-Doped CdS Nanoparticles

    Directory of Open Access Journals (Sweden)

    D. Venkatesan

    2012-01-01

    Full Text Available CdS nanoparticles and thin films are well known for their excellent semiconducting properties. When transition metal ions are doped into the CdS, it exhibits magnetic properties in addition to semiconducting properties and they are termed as dilute magnetic semiconductors (DMSs. In this paper, we discuss the preparation of sodium bis(2-ethylhexyl sulfonsuccinate (AOT capped CdS nanoparticles and thin films doped with magnetic impurity Mn. Sodium bis(2-ethulexyl sulfonsuccinate (AOT, capping agent promotes the uniform formation of nanoparticles. Optical characterizations are made using the UV-Vis spectrometer, PL, and FTIR. XRD shows the hexagonal structure of the CdS. SEM images and EDS measurements were made for the thin films. EPR shows the clear hyperfine lines corresponding to Mn2+ ion in the CdS nanoparticles.

  19. Effects of precursors on the crystal structure and photoluminescence of CdS nanocrystalline

    International Nuclear Information System (INIS)

    Fu Zuoling; Zhou Shihong; Shi Jinsheng; Zhang Siyuan

    2005-01-01

    A series of cadmium sulfide (CdS) nanocrystalline were synthesized by precipitation from a mixture of aqueous solutions of cadmium salts and sulfur salts without adding any surface-termination agent. Their crystal structures and particle sizes were determined by X-ray diffraction (XRD). The CdS nanocrystalline precipitated from different precursors exhibited three cases: cubic phase, hexagonal phase and a hybrid of cubic and hexagonal phases. The photoluminescence (PL) of cadmium salt precursors and CdS nanocrystalline is also analyzed. Similar spectral band structure of cadmium salt precursors and CdS nanocrystalline is found. The PL of 3.4, 2.4 and 2.0 nm sized CdS nanocrystalline with the same crystal structure indicated quantum confinement effect

  20. Toxicity of cadmium sulfide (CdS) nanoparticles against Escherichia coli and HeLa cells

    International Nuclear Information System (INIS)

    Hossain, Sk Tofajjen; Mukherjee, Samir Kumar

    2013-01-01

    Highlights: • Toxic effect of CdS NPs on the growth and cell division in E. coli was studied. • CdS NPs affected cell surface topology and cell division. • Downregulation of both FtsZ and FtsQ was observed due to NPs exposure. • CdS NPs affected HeLa cell morphology with fragmented nuclei. • All such effects might be due to elevated oxidative stress. -- Abstract: The present study endeavours to assess the toxic effect of synthesized CdS nanoparticles (NPs) on Escherichia coli and HeLa cells. The CdS NPs were characterized by DLS, XRD, TEM and AFM studies and the average size of NPs was revealed as ∼3 nm. On CdS NPs exposure bacterial cells changed morphological features to filamentous form and damage of the cell surface was found by AFM study. The expression of two conserved cell division components namely ftsZ and ftsQ in E. coli was decreased both at transcriptional and translational levels upon CdS NPs exposure. CdS NPs inhibited proper cell septum formation without affecting the nucleoid segregation. Viability of HeLa cells declined with increasing concentration of CdS NPs and the IC 50 value was found to be 4 μg/mL. NPs treated HeLa cells showed changed morphology with condensed and fragmented nuclei. Increased level of reactive oxygen species (ROS) was found both in E. coli and HeLa cells on CdS NPs exposure. The inverse correlation between declined cell viabilities and elevated ROS level suggested that oxidative stress seems to be the key event by which NPs induce toxicity both in E. coli and HeLa cells

  1. Synthesis of CdS nanorods in soft template under gamma-irradiation.

    Science.gov (United States)

    Zhao, Bing; Wang, Yanli; Zhang, Haijiao; Jiao, Zheng; Wang, Haobo; Ding, Guoji; Wu, Minghong

    2009-02-01

    CdS nano material which has a band gap of 2.42 eV at room temperature is a typical II-VII semiconductor having many commercial or potential applications, e.g., light-emitting diodes, solar cell and optoelectronic devices. In this paper, we use a new strategy to synthesize CdS nanorods. CdS nanorods were prepared in soft template under gamma-irradiation though the reaction of cadmium sulphide and thiacetamide (TAA). The formation process and characters of CdS nanorods was investigated in detail by transmission electron microscopy (TEM), electron diffraction (ED) pattern, X-ray powder diffraction (XRD), ultraviolet spectrophotometer (UV) and photoluminescence spectrophotometer (PL). In the experiment we proposed that the irradiation of gamma-ray accelerated the formation of S(2-) under acidic condition (pH = 3) and vinyl acetate (VAc) monomer formed pre-organized nano polymer tubules which were used as both templates and nanoreacters for the growth of CdS nanorods. In this process, we have obtained the CdS polycrystal nanorods with PVAc nano tubules and CdS single-crystal nanorods. The result of X-ray powder diffraction confirms that the crystal type of CdS nanorods is cubic F-43 m (216). The results from transmission electron microscopy and electron diffraction show that the concentrations of reactants and the dose rate of gamma-ray are key to produce appropriate CdS nanorods. Relatively low concentrations (Cd2+: 0.008-0.02 mol/L, Cd2+ : S(2-) = 1 : 2) of reactants and long time (1-2 d) of irradiation in low dose rate (6-14 Gy/min) are propitious to form CdS single-crystal nanorods with small diameter (less than 100 nm) and well length (2-5 microm). UV and PL characterizations show the sample have well optical properties.

  2. Molecular Control of the Nanoscale: Effect of Phosphine–Chalcogenide Reactivity on CdS–CdSe Nanocrystal Composition and Morphology

    Energy Technology Data Exchange (ETDEWEB)

    Ruberu, T. Purnima A.; Albright, Haley R.; Callis, Brandon; Ward, Brittney; Cisneros, Joana; Fan, Hua-Jun; Vela, Javier

    2012-04-22

    We demonstrate molecular control of nanoscale composition, alloying, and morphology (aspect ratio) in CdS–CdSe nanocrystal dots and rods by modulating the chemical reactivity of phosphine–chalcogenide precursors. Specific molecular precursors studied were sulfides and selenides of triphenylphosphite (TPP), diphenylpropylphosphine (DPP), tributylphosphine (TBP), trioctylphosphine (TOP), and hexaethylphosphorustriamide (HPT). Computational (DFT), NMR (31P and 77Se), and high-temperature crossover studies unambiguously confirm a chemical bonding interaction between phosphorus and chalcogen atoms in all precursors. Phosphine–chalcogenide precursor reactivity increases in the order: TPPE < DPPE < TBPE < TOPE < HPTE (E = S, Se). For a given phosphine, the selenide is always more reactive than the sulfide. CdS1–xSex quantum dots were synthesized via single injection of a R3PS–R3PSe mixture to cadmium oleate at 250 °C. X-ray diffraction (XRD), transmission electron microscopy (TEM), and UV/Vis and PL optical spectroscopy reveal that relative R3PS and R3PSe reactivity dictates CdS1–xSex dot chalcogen content and the extent of radial alloying (alloys vs core/shells). CdS, CdSe, and CdS1–xSex quantum rods were synthesized by injection of a single R3PE (E = S or Se) precursor or a R3PS–R3PSe mixture to cadmium–phosphonate at 320 or 250 °C. XRD and TEM reveal that the length-to-diameter aspect ratio of CdS and CdSe nanorods is inversely proportional to R3PE precursor reactivity. Purposely matching or mismatching R3PS–R3PSe precursor reactivity leads to CdS1–xSex nanorods without or with axial composition gradients, respectively. We expect these observations will lead to scalable and highly predictable “bottom-up” programmed syntheses of finely heterostructured nanomaterials with well-defined architectures and properties that are tailored for precise applications.

  3. Extracting hot carriers from photoexcited semiconductor nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Zhu, Xiaoyang

    2014-12-10

    This research program addresses a fundamental question related to the use of nanomaterials in solar energy -- namely, whether semiconductor nanocrystals (NCs) can help surpass the efficiency limits, the so-called “Shockley-Queisser” limit, in conventional solar cells. In these cells, absorption of photons with energies above the semiconductor bandgap generates “hot” charge carriers that quickly “cool” to the band edges before they can be utilized to do work; this sets the solar cell efficiency at a limit of ~31%. If instead, all of the energy of the hot carriers could be captured, solar-to-electric power conversion efficiencies could be increased, theoretically, to as high as 66%. A potential route to capture this energy is to utilize semiconductor nanocrystals. In these materials, the quasi-continuous conduction and valence bands of the bulk semiconductor become discretized due to confinement of the charge carriers. Consequently, the energy spacing between the electronic levels can be much larger than the highest phonon frequency of the lattice, creating a “phonon bottleneck” wherein hot-carrier relaxation is possible via slower multiphonon emission. For example, hot-electron lifetimes as long as ~1 ns have been observed in NCs grown by molecular beam epitaxy. In colloidal NCs, long lifetimes have been demonstrated through careful design of the nanocrystal interfaces. Due to their ability to slow electronic relaxation, semiconductor NCs can in principle enable extraction of hot carriers before they cool to the band edges, leading to more efficient solar cells.

  4. Structural phase transitions in niobium oxide nanocrystals

    Science.gov (United States)

    Yuvakkumar, R.; Hong, Sun Ig

    2015-09-01

    Niobium oxide nanocrystals were successfully synthesized employing the green synthesis method. Phase formation, microstructure and compositional properties of 1, 4 and 7 days incubation treated samples after calcinations at 450 °C were examined using X-ray diffraction, Raman, photoluminescence (PL), infrared, X-ray photoelectron spectra and transmission electron microscopic characterizations. It was observed that phase formation of Nb2O5 nanocrystals was dependent upon the incubation period required to form stable metal oxides. The characteristic results clearly revealed that with increasing incubation and aging, the transformation of cubic, orthorhombic and monoclinic phases were observed. The uniform heating at room temperature (32 °C) and the ligation of niobium atoms due to higher phenolic constituents of utilized rambutan during aging processing plays a vital role in structural phase transitions in niobium oxide nanocrystals. The defects over a period of incubation and the intensities of the PL spectra changing over a period of aging were related to the amount of the defects induced by the phase transition.

  5. Spontaneous emission enhancement of colloidal perovskite nanocrystals

    Science.gov (United States)

    Yang, Zhili; Waks, Edo

    Halide perovskite semiconductors have emerged as prominent photovoltaic materials since their high conversion efficiency and promising light emitting materials in optoelectronics. In particular, easy-to-fabricated colloidal perovskite nanocrystals based on CsPbX3 quantum dots has been intensively investigated recently. Their luminescent wavelength could be tuned precisely by their chemical composition and size of growth. This opens new applications including light-emitting diodes, optical amplifiers and lasing since their promising performance as emitters. However, this potentially high-efficient emitter and gain material has not been fully investigated and realized in integrated photonic structures. Here we demonstrate Purcell enhancement effect of CsPbBr3 perovskite nanocrystals by coupling to an optimized photonic crystal nanobeam cavity as a first crucial step towards realization of integrated on-chip coherent light source with low energy consumption. We show clearly highly-enhanced photoluminescent spectrum and an averaged Purcell enhancement factor of 2.9 is achieved when they are coupled to nanobeam photonic crystal cavities compared to the ones on unpatterned surface in our lifetime measurement. Our success in enhancement of emission from CsPbX3 perovskite nanocrystals paves the way towards the realization of efficient light sources for integrated optoelectronic devices with low energy consumption.

  6. Fabrication and electronic transport studies of single nanocrystal systems

    Energy Technology Data Exchange (ETDEWEB)

    Klein, David Louis [Univ. of California, Berkeley, CA (United States). Dept. of Physics

    1997-05-01

    Semiconductor and metallic nanocrystals exhibit interesting electronic transport behavior as a result of electrostatic and quantum mechanical confinement effects. These effects can be studied to learn about the nature of electronic states in these systems. This thesis describes several techniques for the electronic study of nanocrystals. The primary focus is the development of novel methods to attach leads to prefabricated nanocrystals. This is because, while nanocrystals can be readily synthesized from a variety of materials with excellent size control, means to make electrical contact to these nanocrystals are limited. The first approach that will be described uses scanning probe microscopy to first image and then electrically probe surfaces. It is found that electronic investigations of nanocrystals by this technique are complicated by tip-sample interactions and environmental factors such as salvation and capillary forces. Next, an atomic force microscope technique for the catalytic patterning of the surface of a self assembled monolayer is described. In principle, this nano-fabrication technique can be used to create electronic devices which are based upon complex arrangements of nanocrystals. Finally, the fabrication and electrical characterization of a nanocrystal-based single electron transistor is presented. This device is fabricated using a hybrid scheme which combines electron beam lithography and wet chemistry to bind single nanocrystals in tunneling contact between closely spaced metallic leads. In these devices, both Au and CdSe nanocrystals show Coulomb blockade effects with characteristic energies of several tens of meV. Additional structure is seen the transport behavior of CdSe nanocrystals as a result of its electronic structure.

  7. Synthesis of Copper-Antimony-Sulfide Nanocrystals for Solution-Processed Solar Cells.

    Science.gov (United States)

    Suehiro, Satoshi; Horita, Keisuke; Yuasa, Masayoshi; Tanaka, Tooru; Fujita, Katsuhiko; Ishiwata, Yoichi; Shimanoe, Kengo; Kida, Tetsuya

    2015-08-17

    The p-type nanocrystals (NCs) of copper-based chalcogenides, such as CuInSe2 and Cu2ZnSnS4, have attracted increasing attention in photovoltaic applications due to their potential to produce cheap solution-processed solar cells. Herein, we report the synthesis of copper-antimony-sulfide (CAS) NCs with different crystal phases including CuSbS2, Cu3SbS4, and Cu12Sb4S13. In addition, their morphology, crystal phase, and optical properties were characterized using transmission electron microscopy, X-ray diffractometry, UV-vis-near-IR spectroscopy, and photoemission yield spectroscopy. The morphology, crystal phase, and electronic structure were significantly dependent on the chemical composition in the CAS system. Devices were fabricated using particulate films consisting of CAS NCs prepared by spin coating without a high-temperature treatment. The CAS NC-based devices exhibited a diode-like current-voltage characteristic when coupled with an n-type CdS layer. In particular, the CuSbS2 NC devices exhibited photovoltaic responses under simulated sunlight, demonstrating its applicability for use in solution-processed solar cells.

  8. CdS/ZnS core-shell nanocrystal photosensitizers for visible to UV upconversion.

    Science.gov (United States)

    Gray, Victor; Xia, Pan; Huang, Zhiyuan; Moses, Emily; Fast, Alexander; Fishman, Dmitry A; Vullev, Valentine I; Abrahamsson, Maria; Moth-Poulsen, Kasper; Lee Tang, Ming

    2017-08-01

    Herein we report the first example of nanocrystal (NC) sensitized triplet-triplet annihilation based photon upconversion from the visible to ultraviolet (vis-to-UV). Many photocatalyzed reactions, such as water splitting, require UV photons in order to function efficiently. Upconversion is one possible means of extending the usable range of photons into the visible. Vis-to-UV upconversion is achieved with CdS/ZnS core-shell NCs as the sensitizer and 2,5-diphenyloxazole (PPO) as annihilator and emitter. The ZnS shell was crucial in order to achieve any appreciable upconversion. From time resolved photoluminescence and transient absorption measurements we conclude that the ZnS shell affects the NC and triplet energy transfer (TET) from NC to PPO in two distinct ways. Upon ZnS growth the surface traps are passivated thus increasing the TET. The shell, however, also acts as a tunneling barrier for TET, reducing the efficiency. This leads to an optimal shell thickness where the upconversion quantum yield ( Φ ' UC ) is maximized. Here the maximum Φ ' UC was determined to be 5.2 ± 0.5% for 4 monolayers of ZnS shell on CdS NCs.

  9. Photophysics of size-selected InP nanocrystals: Exciton recombination kinetics

    International Nuclear Information System (INIS)

    Kim, S.; Wolters, R.H.; Heath, J.R.

    1996-01-01

    We report here on the size-dependent kinetics of exciton recombination in a III endash V quantum dot system, InP. The measurements reported include various frequency dependent quantum yields as a function of temperature, frequency dependent luminescence decay curves, and time-gated emission spectra. This data is fit to a three-state quantum model which has been previously utilized to explain photophysical phenomena in II endash VI quantum dots. The initial photoexcitation is assumed to place an electron in a (delocalized) bulk conduction band state. Activation barriers for trapping and detrapping of the electron to surface states, as well as activation barriers for surface-state radiationless relaxation processes are measured as a function of particle size. The energy barrier to detrapping is found to be the major factor limiting room temperature band-edge luminescence. This barrier increases with decreasing particle size. For 30 A particles, this barrier is found to be greater than 6 kJ/mol emdash a barrier which is more than an order of magnitude larger than that previously found for 32 A CdS nanocrystals. copyright 1996 American Institute of Physics

  10. Photon induced resonant Raman scattering in CdS

    International Nuclear Information System (INIS)

    Muzart, J.; Lluesma, E.G.; Arguello, C.A.; Leite, R.C.C.

    1975-01-01

    A novel aspect of resonant Raman scattering is observed in CdS by means of the ratio of Stokes to anti-Stokes intensities. With increasing temperature, as the forbidden band energy approaches a value that is twice the incident photon energy, (from a Nd-Yag-laser) a large enhancement of the above ratio is observed for both the LO and the 2LO phonon Raman intensities. The results indicate a resonance with the scattered photon. Resonance is only observed for high incident photon intensities. A possible explanation for the above observations is that flooding of the crystal with photons of energy hν induces states of energy hν displaced from the electronic bands by mixing of electronic and photon states

  11. Nanocrystals of Cesium Lead Halide Perovskites (CsPbX₃, X = Cl, Br, and I): Novel Optoelectronic Materials Showing Bright Emission with Wide Color Gamut.

    Science.gov (United States)

    Protesescu, Loredana; Yakunin, Sergii; Bodnarchuk, Maryna I; Krieg, Franziska; Caputo, Riccarda; Hendon, Christopher H; Yang, Ruo Xi; Walsh, Aron; Kovalenko, Maksym V

    2015-06-10

    Metal halides perovskites, such as hybrid organic-inorganic CH3NH3PbI3, are newcomer optoelectronic materials that have attracted enormous attention as solution-deposited absorbing layers in solar cells with power conversion efficiencies reaching 20%. Herein we demonstrate a new avenue for halide perovskites by designing highly luminescent perovskite-based colloidal quantum dot materials. We have synthesized monodisperse colloidal nanocubes (4-15 nm edge lengths) of fully inorganic cesium lead halide perovskites (CsPbX3, X = Cl, Br, and I or mixed halide systems Cl/Br and Br/I) using inexpensive commercial precursors. Through compositional modulations and quantum size-effects, the bandgap energies and emission spectra are readily tunable over the entire visible spectral region of 410-700 nm. The photoluminescence of CsPbX3 nanocrystals is characterized by narrow emission line-widths of 12-42 nm, wide color gamut covering up to 140% of the NTSC color standard, high quantum yields of up to 90%, and radiative lifetimes in the range of 1-29 ns. The compelling combination of enhanced optical properties and chemical robustness makes CsPbX3 nanocrystals appealing for optoelectronic applications, particularly for blue and green spectral regions (410-530 nm), where typical metal chalcogenide-based quantum dots suffer from photodegradation.

  12. Extraordinary Interfacial Stitching between Single All-Inorganic Perovskite Nanocrystals

    NARCIS (Netherlands)

    Gomez, Leyre; Lin, Junhao; De Weerd, Chris; Poirier, Lucas; Boehme, Simon C.; Von Hauff, Elizabeth; Fujiwara, Yasufumi; Suenaga, Kazutomo; Gregorkiewicz, Tom

    2018-01-01

    All-inorganic cesium lead halide perovskite nanocrystals are extensively studied because of their outstanding optoelectronic properties. Being of a cubic shape and typically featuring a narrow size distribution, CsPbX3 (X = Cl, Br, and I) nanocrystals are the ideal starting material for the

  13. Synthesis and preservation of graphene-supported uranium dioxide nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Ma, Hanyu [Department of Civil and Environmental Engineering and Earth Sciences, University of Notre Dame, 156 Fitzpatrick Hall, Notre Dame, IN 46556 (United States); Wang, Haitao [Department of Civil and Environmental Engineering and Earth Sciences, University of Notre Dame, 156 Fitzpatrick Hall, Notre Dame, IN 46556 (United States); Department of Civil, Environmental, and Construction Engineering, Texas Tech University, 911 Boston Ave., Lubbock, TX 79409 (United States); Burns, Peter C. [Department of Civil and Environmental Engineering and Earth Sciences, University of Notre Dame, 156 Fitzpatrick Hall, Notre Dame, IN 46556 (United States); Department of Chemistry and Biochemistry, University of Notre Dame, 251 Nieuwland Science Hall, Notre Dame, IN 46556 (United States); McNamara, Bruce K.; Buck, Edgar C. [Nuclear Chemistry & Engineering Group, Pacific Northwest National Laboratory, 902 Battelle Boulevard, Richland, WA 99352 (United States); Na, Chongzheng, E-mail: chongzheng.na@gmail.com [Department of Civil and Environmental Engineering and Earth Sciences, University of Notre Dame, 156 Fitzpatrick Hall, Notre Dame, IN 46556 (United States); Department of Civil, Environmental, and Construction Engineering, Texas Tech University, 911 Boston Ave., Lubbock, TX 79409 (United States)

    2016-07-15

    Graphene-supported uranium dioxide (UO{sub 2}) nanocrystals are potentially important fuel materials. Here, we investigate the possibility of synthesizing graphene-supported UO{sub 2} nanocrystals in polar ethylene glycol compounds by the polyol reduction of uranyl acetylacetone under boiling reflux, thereby enabling the use of an inexpensive graphene precursor graphene oxide into a one-pot process. We show that triethylene glycol is the most suitable solvent with an appropriate reduction potential for producing nanometer-sized UO{sub 2} crystals compared to monoethylene glycol, diethylene glycol, and polyethylene glycol. Graphene-supported UO{sub 2} nanocrystals synthesized with triethylene glycol show evidence of heteroepitaxy, which can be beneficial for facilitating heat transfer in nuclear fuel particles. Furthermore, we show that graphene-supported UO{sub 2} nanocrystals synthesized by polyol reduction can be readily stored in alcohols, impeding oxidation from the prevalent oxygen in air. Together, these methods provide a facile approach for preparing and storing graphene-supported UO{sub 2} nanocrystals for further investigation and development under ambient conditions. - Highlights: • UO{sub 2} nanocrystals are synthesized using polyol reduction method. • Triethylene glycol is the best reducing agent for nano-sized UO{sub 2} crystals. • UO{sub 2} nanocrystals grow on graphene through heteroepitaxy. • Graphene-supported UO{sub 2} nanocrystals can be stored in alcohols to prevent oxidation.

  14. Characterization of Ge-nanocrystal films with photoelectron spectroscopy

    International Nuclear Information System (INIS)

    Bostedt, C.; Buuren, T. van; Willey, T.M.; Nelson, A.J.; Franco, N.; Moeller, T.; Terminello, L.J.

    2003-01-01

    The Ge 3d core-levels of germanium nanocrystal films have been investigated by means of photoelectron spectroscopy. The experiments indicate bulk-like coordinated atoms in the nanocrystals and suggest structured disorder on the nanoparticle surface. The results underline the importance of the surface on the overall electronic structure of this class of nanostructured materials

  15. Group IV nanocrystals with ion-exchangeable surface ligands and methods of making the same

    Science.gov (United States)

    Wheeler, Lance M.; Nichols, Asa W.; Chernomordik, Boris D.; Anderson, Nicholas C.; Beard, Matthew C.; Neale, Nathan R.

    2018-01-09

    Methods are described that include reacting a starting nanocrystal that includes a starting nanocrystal core and a covalently bound surface species to create an ion-exchangeable (IE) nanocrystal that includes a surface charge and a first ion-exchangeable (IE) surface ligand ionically bound to the surface charge, where the starting nanocrystal core includes a group IV element.

  16. Photoluminescence from Si nanocrystals in silica: The effect of hydrogen

    International Nuclear Information System (INIS)

    Cheylan, S.; Elliman, R.G.

    2001-01-01

    The effect of H passivation on the PL emission of Si nanocrystals produced in silica by ion-implantion and annealing is shown to depend on the implant fluence. At low fluences, where the nanocrystals are small, passivation causes an enhancement of the emission intensity that is uniform over the full spectral range and therefore appears to be independent of nanocrystal size. For higher fluences, where the average size and size distribution of the nanocrystals are larger, the enhancement occurs preferentially at longer wavelengths, giving rise to a red-shift in the emission spectra. Both the enhancement and the red-shift increase monotonically with increasing fluence. These data are shown to be consistent with a model in which the probability to contain a non-radiative defect increases with nanocrystal size

  17. Isolating and moving single atoms using silicon nanocrystals

    Science.gov (United States)

    Carroll, Malcolm S.

    2010-09-07

    A method is disclosed for isolating single atoms of an atomic species of interest by locating the atoms within silicon nanocrystals. This can be done by implanting, on the average, a single atom of the atomic species of interest into each nanocrystal, and then measuring an electrical charge distribution on the nanocrystals with scanning capacitance microscopy (SCM) or electrostatic force microscopy (EFM) to identify and select those nanocrystals having exactly one atom of the atomic species of interest therein. The nanocrystals with the single atom of the atomic species of interest therein can be sorted and moved using an atomic force microscope (AFM) tip. The method is useful for forming nanoscale electronic and optical devices including quantum computers and single-photon light sources.

  18. Facile synthesis of water-soluble curcumin nanocrystals

    Directory of Open Access Journals (Sweden)

    Marković Zoran M.

    2015-01-01

    Full Text Available In this paper, facile synthesis of water soluble curcumin nanocrystals is reported. Solvent exchange method was applied to synthesize curcumin nanocrystals. Different techniques were used to characterize the structural and photophysical properties of curcumin nanocrystals. We found that nanocurcumin prepared by this method had good chemical and physical stability, could be stored in the powder form at room temperature, and was freely dispersible in water. It was established that the size of curcumin nanocrystals was varied in the range of 20-500 nm. Fourier transform infrared spectroscopy and UV-Vis analyses showed the presence of tetrahydrofuran inside the curcumin nanocrystals. Also, it was found that nanocurcumin emitted photoluminescencewith yellow-green colour. [Projekat Ministarstva nauke Republike Srbije, br. 172003

  19. Plasmonic light-sensitive skins of nanocrystal monolayers

    Science.gov (United States)

    Akhavan, Shahab; Gungor, Kivanc; Mutlugun, Evren; Demir, Hilmi Volkan

    2013-04-01

    We report plasmonically coupled light-sensitive skins of nanocrystal monolayers that exhibit sensitivity enhancement and spectral range extension with plasmonic nanostructures embedded in their photosensitive nanocrystal platforms. The deposited plasmonic silver nanoparticles of the device increase the optical absorption of a CdTe nanocrystal monolayer incorporated in the device. Controlled separation of these metallic nanoparticles in the vicinity of semiconductor nanocrystals enables optimization of the photovoltage buildup in the proposed nanostructure platform. The enhancement factor was found to depend on the excitation wavelength. We observed broadband sensitivity improvement (across 400-650 nm), with a 2.6-fold enhancement factor around the localized plasmon resonance peak. The simulation results were found to agree well with the experimental data. Such plasmonically enhanced nanocrystal skins hold great promise for large-area UV/visible sensing applications.

  20. Hexagonal pencil-like CdS nanorods: Facile synthesis and enhanced visible light photocatalytic performance

    Science.gov (United States)

    An, Liang; Wang, Guanghui; Zhao, Lei; Zhou, Yong; Gao, Fang; Cheng, Yang

    2015-07-01

    In the present study, hexagonal pencil-like CdS nanorods have been successfully synthesized through a typical facile and economical one-step hydrothermal method without using any surfactant or template. The product was characterized by X-ray powder diffraction (XRD), field-emission scanning electron microscopy (FE-SEM) and energy dispersive analysis of X-ray (EDX). The results revealed that the prepared CdS photocatalyst consisted of a large quantity of straight and smooth solid hexagonal nanorods and a few nanoparticles. The photocatalytic activities of CdS nanorods and commercial CdS powders were investigated by the photodegradation of Orange II (OII) in aqueous solution under visible light, and the CdS nanorods presented the highest photocatalytic activity. Its photocatalytic efficiency enhancement was attributed to the improved transmission of photogenerated electron-hole pairs in the CdS nanostructures. The present findings may provide a facile approach to synthesize high efficient CdS photocatalysts.

  1. Broad spectral response photodetector based on individual tin-doped CdS nanowire

    Directory of Open Access Journals (Sweden)

    Weichang Zhou

    2014-12-01

    Full Text Available High purity and tin-doped 1D CdS micro/nano-structures were synthesized by a convenient thermal evaporation method. SEM, EDS, XRD and TEM were used to examine the morphology, composition, phase structure and crystallinity of as-prepared samples. Raman spectrum was used to confirm tin doped into CdS effectively. The effect of impurity on the photoresponse properties of photodetectors made from these as-prepared pure and tin-doped CdS micro/nano-structures under excitation of light with different wavelength was investigated. Various photoconductive parameters such as responsivity, external quantum efficiency, response time and stability were analyzed to evaluate the advantage of doped nanowires and the feasibility for photodetector application. Comparison with pure CdS nanobelt, the tin-doped CdS nanowires response to broader spectral range while keep the excellect photoconductive parameters. Both trapped state induced by tin impurity and optical whispering gallery mode microcavity effect in the doped CdS nanowires contribute to the broader spectral response. The micro-photoluminescence was used to confirm the whispering gallery mode effect and deep trapped state in the doped CdS nanowires.

  2. General and Robust Strategies for Multifunctional Organic-Inorganic Nanocompositesvia Direct Growth of Monodisperse Nanocrystals Intimately and Permanently Connected with Polymers

    Science.gov (United States)

    2016-04-21

    cells: from complex nanostructure to planar heterojunction ”, Journal of Materials Chemistry A, 2, 5994 (2014). (featured on Cover of Journal of...naphthalenide solution. Trifluoroacetic acid (TFA, 99%), Yttrium(III) oxide (Y2O3, 99.99%), Ytterbium(III) oxide (Yb2O3, 99.9%), Erbium(III) oxide ...Er2O3, ≥99.99%) and Thulium(III) oxide (Tm2O3, 99.9%) were purchased from Sigma-Aldrich and used as received. Gold(III) chloride trihydrate (HAuCl4·3H2O

  3. Z-Contrast STEM Imaging and EELS of CdSe Nanocrystals: Towards the Analysis of Individual Nanocrystal Surfaces

    International Nuclear Information System (INIS)

    Erwin, M.; Kadavanich, A.V.; Kippeny, T.; Pennycook, S.J.; Rosenthal, S.J.

    1999-01-01

    We have applied Atomic Number Contract Scanning Transmission Electron Microscopy (Z-Contrast STEM) and STEM/EELS (Electron Energy Loss Spectroscopy) towards the study of colloidal CdSe semiconductor nanocrystals embedded in MEH-PPV polymer films. Unlike the case of conventional phase-contrast High Resolution TEM, Z-Contrast images are direct projections of the atomic structure. Hence they can be interpreted without the need for sophisticated image simulation and the image intensity is a direct measure of the thickness of a nanocrystal. Our thickness measurements are in agreement with the predicted faceted shape of these nanocrystals. Our unique 1.3A resolution STEM has successfully resolve3d the sublattice structure of these CdSe nanocrystals. In [010] projection (the polar axis in the image plane) we can distinguish Se atom columns from Cd columns. Consequently we can study the effects of lattice polarity on the nanocrystal morphology. Furthermore, since the STEM technique does not rely on diffraction, it is superbly suited to the study of non-periodic detail, such as the surface structure of the nanocrystals. EELS measurements on individual nanocrystals indicate a significant amount (equivalet to 0.5-1 surface monolayers) of oxygen on the nanocrystals, despite processing in an inert atmosphere. Spatially resolved measurements at 7A resolution suggest a surface oxide layer. However, the uncertainty in the measurement precludes definitive assignment at this time. The source of the oxygen is under investigation as well

  4. Nanoniobia modification of CdS photoanode for an efficient and stable photoelectrochemical cell.

    Science.gov (United States)

    Pareek, Alka; Paik, Pradip; Borse, Pramod H

    2014-12-30

    Herein we report the surface modification of a CdS film by niobia nanoparticles via thioglycerol as an organic linker and thus fabricate an efficient and a stable photoanode for a photoelectrochemical (PEC) cell. We have synthesized three differenly sized (∼3, ∼6 ,and ∼9 nm) niobia nanoparticles by a hydrothermal synthesis approach and have further investigated the particle-size-dependent PEC performance of the nanoparticle-modified CdS photoanode. Fourier transform infrared spectroscopy (FTIR) and X-ray photoelectron spectroscopy (XPS) confirm the formation of Nb2O5 nanoparticles that are prepared via decomposition of the niobium peroxo complex during the hydrothermal reaction and reveal the presence of surface OH(-) groups over niobia nanoparticles that impart a high catalytic property to a material. The nano-Nb2O5-modified photoanode displayed a 23-fold higher power conversion efficiency compared to that of CdS. This modified structure increases the open circuit voltage (OCV) from 0.65 to 0.77 V, which is attributed to the nano-Nb2O5-induced surface passivation effect over bare CdS. Linking of nanoparticles on the CdS surface improves the photocorrosion stability of the CdS photoanode for even longer than 4 h in contrast to the tens of minutes for the base CdS surface. The uniform coverage of the CdS photoanode surface by niobia nanoparticles is thus found to be the controlling parameter for achieving a higher PEC performance and stability of the photoanode. This finding directed us to design an improved CdS photoanode for efficient and prolonged PEC hydrogen generation from a PEC cell.

  5. Fullerene (C{sub 60})/CdS nanocomposite with enhanced photocatalytic activity and stability

    Energy Technology Data Exchange (ETDEWEB)

    Cai, Qiang [Key Laboratory of Advanced Ceramics and Machining Technology, Ministry of Education, School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China); Hu, Zhuofeng, E-mail: st04hzhf@gmail.com [Department of Chemistry, The Chinese University of Hong Kong, Shatin, New Territories, Hong Kong (China); Zhang, Qian; Li, Boyuan [Key Laboratory of Advanced Ceramics and Machining Technology, Ministry of Education, School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China); Shen, Zhurui, E-mail: shenzhurui@tju.edu.cn [Key Laboratory of Advanced Ceramics and Machining Technology, Ministry of Education, School of Materials Science and Engineering, Tianjin University, Tianjin 300072 (China)

    2017-05-01

    Highlights: • C{sub 60}/CdS nanocomposite has been fabricated as a novel visible-light-driven photocatalyst. • It exhibits enhanced photocatalytic activity and photostability than that of pure CdS reference. • The C{sub 60} improved the charge separation and transfer of nanocomposite due to its high electron affinity. - Abstract: Herein, the fullerene (C{sub 60})/CdS nanocomposite has been fabricated by a facile one-pot hydrothermal method. Its photocatatlytic hydrogen (H{sub 2}) evolution rate and degradation efficiency of Rhodamine B (Rh B) are evaluated under visible light irradiation (λ ≥ 420 nm). The content of C{sub 60} has been changed from 0.4 wt% to 8 wt%, and the optimal value for photocatalytic activity is determined to be 0.4 wt%. The H{sub 2} evolution rate over this optimal sample reaches 1.73 mmol h{sup −1} g{sup −1} and its apparent degradation rate of Rh B is 0.089 min{sup −1} (degradation efficiency of 97% within 40 min), which is 2.3 times and 1.5 times compared to that of pure CdS reference. Moreover, the photocorrosion of CdS in composite is effectively suppressed, and its photocatalytic activity can be well maintained after three recycles (97.8% retaining for composite vs. 84.4% retaining for CdS). Then, the enhanced photocatalytic activity and stability of C{sub 60}/CdS nanocomposite are further studied by spectroscopic and electrochemical methods. Results show that the C{sub 60} species covering on the surface of CdS can efficiently accelerate the separation and transfer of photoexcited charge carriers, which can improve its activity, and reduce the photocorrosion of CdS.

  6. Structural, morphological and optical properties of Na and K dual doped CdS thin film

    International Nuclear Information System (INIS)

    Mageswari, S.; Dhivya, L.; Palanivel, Balan; Murugan, Ramaswamy

    2012-01-01

    Highlights: ► Effect of incorporation of Na, K and Na,K dual dopants into CdS thin film was investigated. ► Thin films were prepared by simple chemical bath deposition technique. ► The XRD analysis revealed cubic phase for all the investigated films. ► AFM analysis revealed uniform surface with crack free and densely packed morphology for CdS:Na,K film. ► The band gap value increases for CdS:Na, CdS:K and CdS:Na,K thin films compared to CdS film. - Abstract: CdS, sodium doped CdS (CdS:Na), potassium doped CdS (CdS:K) and sodium and potassium dual doped CdS (CdS:Na,K) thin films were deposited on glass substrate by chemical bath deposition (CBD) technique. Structural, morphological and optical properties of the as-grown films were characterised using X-ray diffraction (XRD), scanning electron microscopy (SEM), energy dispersive X-ray analysis (EDAX), atomic force microscopy (AFM) and ultraviolet visible (UV–VIS) spectroscopy. The XRD analysis revealed cubic phase for ‘as-deposited’ CdS, CdS:Na, CdS:K and CdS:Na,K dual doped thin films. AFM analysis revealed uniform film surface with crack free and densely packed morphology for CdS:Na,K film. The absorption edge in the optical absorption spectra shifts towards the shorter wavelength for CdS:Na, CdS:K and CdS:Na,K thin films compared to CdS film. The optical band gap of CdS, CdS:Na, CdS:K and CdS:Na,K thin films was found to be 2.31, 2.35, 2.38 and 2.34 eV, respectively.

  7. Force chains in monodisperse spherical particle assemblies: Three-dimensional measurements using neutrons

    Science.gov (United States)

    Wensrich, C. M.; Kisi, E. H.; Luzin, V.; Garbe, U.; Kirstein, O.; Smith, A. L.; Zhang, J. F.

    2014-10-01

    The full triaxial stress state within individual particles in a monodisperse spherical granular assembly has been measured. This was made possible by neutron imaging and computed tomography combined with neutron diffraction strain measurement techniques and associated stress reconstruction. The assembly in question consists of 549 precision steel ball bearings under an applied axial load of 85 MPa in a cylindrical die. Clear evidence of force chains was observed in terms of both the shape of the probability distribution function for normal stresses and the network formed by highly loaded particles. An extensive analysis of the source and magnitude of uncertainty in these measurements is also presented.

  8. High Performance Affinity Chromatography of Antithrombin III Based on Monodisperse Poly (glycidyl methacrylate) Beads

    Institute of Scientific and Technical Information of China (English)

    2001-01-01

    A new approach for the separation of antithrombin III with high performance affinity chromatography (HPAC) was described. A novel monodisperse,non-porous,cross-linked poly (glycidyl methacrylate) beads (PGMA) were used as the affinity support. With the water-soluble carbodiimide,heparin was linked covalently to amino-PGMA-beads,which was prepared by amination of PGMA. The adsorbent obtained exhibits high binding activity to antithrombin III (ATIII),good resolution and excellent mechanical properties and can be used under high flow rate.

  9. Synthesis of Monodisperse CdSe QDs using Controlled Growth Temperatures

    International Nuclear Information System (INIS)

    Noor Razinah Rahmat; Akrajas Ali Umar; Muhammad Yahya; Muhamad Mat Salleh; Mohammad Hafizuddin Jumali

    2011-01-01

    The effect of growth temperatures on size of CdSe quantum dots (QDs) has been investigated. CdSe QDs were synthesized using thermolysis of organometallics precursor route using wet chemical method. The growth temperature was varied from 260-310 degree Celsius with growth period fixed at 60 s. As the growth temperature increased, the monodispersed CdSe QDs with diameter in the range 3-7 nm were obtained. Both absorption and PL spectra of the QDs revealed a strong red-shift supporting the increment size of QDs with the rise of growth temperature. (author)

  10. The Synthesis, Characterization and Catalytic Reaction Studies of Monodisperse Platinum Nanoparticles in Mesoporous Oxide Materials

    Energy Technology Data Exchange (ETDEWEB)

    Rioux, Robert M. [Univ. of California, Berkeley, CA (United States)

    2006-01-01

    A catalyst design program was implemented in which Pt nanoparticles, either of monodisperse size and/or shape were synthesized, characterized and studied in a number of hydrocarbon conversion reactions. The novel preparation of these materials enables exquisite control over their physical and chemical properties that could be controlled (and therefore rationally tuned) during synthesis. The ability to synthesize rather than prepare catalysts followed by thorough characterization enable accurate structure-function relationships to be elucidated. This thesis emphasizes all three aspects of catalyst design: synthesis, characterization and reactivity studies. The precise control of metal nanoparticle size, surface structure and composition may enable the development of highly active and selective heterogeneous catalysts.

  11. Can a droplet break up under flow without elongating? Fragmentation of smectic monodisperse droplets

    Science.gov (United States)

    Courbin, L.; Engl, W.; Panizza, P.

    2004-06-01

    We study the fragmentation under shear flow of smectic monodisperse droplets at high volume fraction. Using small angle light scattering and optical microscopy, we reveal the existence of a break-up mechanism for which the droplets burst into daughter droplets of the same size. Surprisingly, this fragmentation process, which is strain controlled and occurs homogeneously in the cell, does not require any transient elongation of the droplets. Systematic experiments as a function of the initial droplet size and the applied shear rate show that the rupture is triggered by an instability of the inner droplet structure.

  12. Note: A simple vibrating orifice monodisperse droplet generator using a hard drive actuator arm

    Energy Technology Data Exchange (ETDEWEB)

    Kosch, Sebastian, E-mail: skosch@mie.utoronto.ca, E-mail: ashgriz@mie.utoronto.ca; Ashgriz, Nasser, E-mail: skosch@mie.utoronto.ca, E-mail: ashgriz@mie.utoronto.ca [Department of Industrial and Mechanical Engineering, University of Toronto, Toronto, Ontario M5S 3G8 (Canada)

    2015-04-15

    We propose that the rotary voice coil actuators found in magnetic hard drives are fit to supercede loudspeakers as expedient vibration sources in the laboratory setting. A specific use case is the excitation of a liquid jet to induce controlled breakup into monodisperse droplets. Like loudspeakers, which are typically used for prototyping such devices, hard drive actuators are cheap and ubiquitous, but they are less unwieldy and supply greater amplitudes without producing noise. Frequencies between 0 and 17 kHz, and likely beyond, can be reproduced reliably. No machining tools or amplifying electronics are needed for the construction and operation of the presented droplet generator.

  13. CdS loaded on coal based activated carbon nanofibers with enhanced photocatalytic property

    Science.gov (United States)

    Guo, Jixi; Guo, Mingxi; Jia, Dianzeng; Song, Xianli; Tong, Fenglian

    2016-08-01

    The coal based activated carbon nanofibers (CBACFs) were prepared by electrospinning a mixture of polyacrylonitrile (PAN) and acid treated coal. Cadmium sulfide (CdS) nanoparticles loaded on CBACFs were fabricated by solvothermal method. The obtained samples were characterized by FESEM, TEM, and XRD. The results reveal that the CdS nanoparticles are homogeneously dispersed on the surfaces of CBACFs. The CdS/CBACFs nanocomposites exhibited higher photoactivity for photodegradation of methyl blue (MB) under visible light irradiation than pure CdS nanoparticles. CBACFs can be used as low cost support materials for the preparation of nanocomposites with high photocatalytic activity.

  14. Raman spectroscopy of optical properties in CdS thin films

    Directory of Open Access Journals (Sweden)

    Trajić J.

    2015-01-01

    Full Text Available Properties of CdS thin films were investigated applying atomic force microscopy (AFM and Raman spectroscopy. CdS thin films were prepared by using thermal evaporation technique under base pressure 2 x 10-5 torr. The quality of these films was investigated by AFM spectroscopy. We apply Raman scattering to investigate optical properties of CdS thin films, and reveal existence of surface optical phonon (SOP mode at 297 cm-1. Effective permittivity of mixture were modeled by Maxwell - Garnet approximation. [Projekat Ministarstva nauke Republike Srbije, br. 45003

  15. Influence of Ag doping concentration on structural and optical properties of CdS thin film

    International Nuclear Information System (INIS)

    Kumar, Pragati; Saxena, Nupur; Gupta, Vinay; Agarwal, Avinash

    2015-01-01

    This work shows the influence of Ag concentration on structural properties of pulsed laser deposited nanocrystalline CdS thin film. X-ray photoelectron spectroscopy (XPS) studies confirm the dopant concentration in CdS films and atomic concentration of elements. XPS studies show that the samples are slightly sulfur deficient. GAXRD scan reveals the structural phase transformation from cubic to hexagonal phase of CdS without appearance of any phase of CdO, Ag 2 O or Ag 2 S suggesting the substitutional doping of Ag ions. Photoluminescence studies illustrate that emission intensity increases with increase in dopant concentration upto 5% and then decreases for higher dopant concentration

  16. Influence of Irradiation Time on properties of CdS Nanoparticles Synthesized using Microwave Irradiation

    International Nuclear Information System (INIS)

    Nayereh Soltani; Elias SSaion; Maryam Erfani; Mohd Zobir Hussein; Robiah Yunus

    2011-01-01

    Different sizes of cadmium sulfide nanoparticles which exhibit obvious quantum confinement effect have been synthesized of cadmium chloride and thioacetamide through the simple and rapid microwave method. The properties of these CdS nanoparticles were examined with varying irradiation time from 10 to 40 min using a pulse regime. The obtained CdS particles were characterized by X-ray diffraction (XRD), transition electron microscopy (TEM) and UV-visible (UV-Vis) spectroscopy. The effects of irradiation time on the size, degree of crystallinity, yield of reaction and optical band gap of CdS nanoparticles are investigated. (author)

  17. Chemical Bath Deposition and Characterization of CdS layer for CZTS Thin Film Solar Cell

    OpenAIRE

    Kamal, Tasnim; Parvez, Sheikh; Matin, Rummana; Bashar, Mohammad Shahriar; Hossain, Tasnia; Sarwar, Hasan; Rashid, Mohammad Junaebur

    2016-01-01

    CZTS is a new type of an absorber and abundant materials for thin film solar cells (TFSC). Cadmium sulfide (CdS) is the n-type buffer layer of it with band gap of 2.42 eV. Cadmium sulfide (CdS) buffer layer of CZTS solar cell was deposited on soda-lime glass substrates by the Chemical Bath Deposition(CBD) method, using anhydrous Cadmium chloride(CdCl_2) and Thiourea (CS(NH_2)_2). Deposition of CdS using CBD is based on the slow release of Cd^ ions and S^ ions in an alkaline bath which is achi...

  18. Effect of the sulfur and fluorine concentration on physical properties of CdS films grown by chemical bath deposition

    Directory of Open Access Journals (Sweden)

    K.E. Nieto-Zepeda

    Full Text Available Undoped and F-doped CdS thin films were grown on glass slides by chemical bath deposition using thiourea, cadmium acetate and ammonium fluoride as sulfur, cadmium, and fluorine sources, respectively. Undoped CdS films were deposited varying the concentration of thiourea. Once the optimal thiourea concentration was determined, based on the crystalline quality of the samples, this concentration was maintained and ammonium fluoride was added at different concentrations in order to explore the effect of the F nominal concentration on properties of CdS films. Undoped and F-doped CdS films were characterized by X-ray diffraction, UV–Vis, room temperature photoluminescence, and four probe resistivity measurements. Results showed highly transparent F-doped CdS films with strong PL and low resistivity were obtained. Keywords: CdS films, F-doped CdS films, Chemical bath deposition, Optical properties, Room temperature photoluminescence

  19. Formation of noble metal nanocrystals in the presence of biomolecules

    Science.gov (United States)

    Burt, Justin Lockheart

    One of the most promising, yet least studied routes for producing biocompatible nanostructures involves synthesis in the presence of biomolecules. I hypothesized that globular proteins could provide a suitable framework to regulate the formation of noble metal nanocrystals. As proof of concept, I designed two novel synthesis protocols utilizing bovine serum albumin (BSA) protein to regulate the formation of gold nanocrystals. In the first case, the standard protocol for polyol reduction was modified by replacing ethylene glycol with glycerin, replacing synthetic polymers with BSA as protecting agent, and decreasing the reaction temperature. In the second case, the Brust-Schiffrin two-phase reduction was modified by replacing alkylthiols with BSA as protecting agent, which facilitated a strictly aqueous phase synthesis. Due to superior product yield and rapid reduction at room temperature, the aqueous protocol became the foundation for subsequent studies. I extended this approach to produce well-dispersed ˜2nm silver, gold, and platinum nanocrystals. Having demonstrated the feasibility of BSA-functionalized nanocrystals, some potential uses were explored. BSA-functionalized silver nanocrystals were employed in a broader study on the interaction of silver nanocrystals with HIV. BSA-functionalized gold nanocrystals were utilized for in vivo dosage of a contrast enhancing agent to bacteria. BSA-functionalized platinum nanocrystals were studied as hydrogenation catalysts. Since many intriguing uses for protein-functionalized nanocrystals involve incorporation into biosystems, I sought to enhance biocompatibility by using ascorbic acid as reducing agent. Initial experiments revealed elongated and branched nanocrystals. Such structures were not observed in previous synthesis protocols with BSA, so I hypothesized ascorbic acid was driving their formation. To test my assertion, I reduced ionic gold in an aqueous solution of ascorbic acid, thereby discovering a new method

  20. Optimization of the Photoanode of CdS Quantum Dot-Sensitized Solar Cells Using Light-Scattering TiO2 Hollow Spheres

    Science.gov (United States)

    Marandi, Maziar; Rahmani, Elham; Ahangarani Farahani, Farzaneh

    2017-12-01

    CdS quantum dot-sensitized solar cells (QDSCs) have been fabricated and their photoanode optimized by altering the thickness of the photoelectrode and CdS deposition conditions and applying a ZnS electron-blocking layer and TiO2 hollow spheres. Hydrothermally grown TiO2 nanocrystals (NCs) with dominant size of 20 nm were deposited as a sublayer in the photoanode with thickness in the range from 5 μm to 10 μm using a successive ionic layer adsorption and reaction (SILAR) method. The number of deposition cycles was altered over a wide range to obtain optimized sensitization. Photoanode thickness and number of CdS sensitization cycles around the optimum values were selected and used for ZnS deposition. ZnS overlayers were also deposited on the surface of the photoanodes using different numbers of cycles of the SILAR process. The best QDSC with the optimized photoelectrode demonstrated a 153% increase in efficiency compared with a similar cell with ZnS-free photoanode. Such bilayer photoelectrodes were also fabricated with different thicknesses of TiO2 sublayers and one overlayer of TiO2 hollow spheres (HSs) with external diameter of 500 nm fabricated by liquid-phase deposition with carbon spheres as template. The optimization was performed by changing the photoanode thickness using a wide range of CdS sensitizing cycles. The maximum energy conversion efficiency was increased by about 77% compared with a similar cell with HS-free photoelectrode. The reason was considered to be the longer path length of the incident light inside the photoanode and greater light absorption. A ZnS blocking layer was overcoated on the surface of the bilayer photoanode with optimized thickness. The number of CdS sensitization cycles was also changed around the optimized value to obtain the best QDSC performance. The number of ZnS deposition cycles was also altered in a wide range for optimization of the photovoltaic performance. It was shown that the maximum efficiency was increased by

  1. Semiconductor nanocrystals for novel optical applications

    Science.gov (United States)

    Moon, Jong-Sik

    Inspired by the promise of enhanced spectral response, photorefractive polymeric composites photosensitized with semiconductor nanocrystals have emerged as an important class of materials. Here, we report on the photosensitization of photorefractive polymeric composites at visible wavelengths through the inclusion of narrow band-gap semiconductor nanocrystals composed of PbS. Through this approach, internal diffraction efficiencies in excess of 82%, two-beam-coupling gain coefficients in excess of 211 cm-1, and response times 34 ms have been observed, representing some of the best figures-of-merit reported on this class of materials. In addition to providing efficient photosensitization, however, extensive studies of these hybrid composites have indicated that the inclusion of nanocrystals also provides an enhancement in the charge-carrier mobility and subsequent reduction in the photorefractive response time. Through this approach with PbS as charge-carrier, unprecedented response times of 399 micros were observed, opening the door for video and other high-speed applications. It is further demonstrated that this improvement in response time occurs with little sacrifice in photorefractive efficiency and with internal diffraction efficiencies of 72% and two- beam-coupling gain coefficients of 500 cm-1 being measured. A thorough analysis of the experimental data is presented, supporting the hypothesized mechanism of the enhanced charge mobility without the accompaniment of superfluous traps. Finally, water soluble InP/ZnS and CdSe/ZnS quantum dots interacted with CPP and Herceptin to apply them as a bio-maker. Both of quantum dots showed the excellent potential for use in biomedical imaging and drug delivery applications. It is anticipated that these approaches can play a significant role in the eventual commercialization of these classes of materials.

  2. Synthesis of Monodispersed Spherical Single Crystalline Silver Particles by Wet Chemical Process; Shisshiki kagakuho ni yoru tanbunsankyujo tankesshoginryushi no gose

    Energy Technology Data Exchange (ETDEWEB)

    Ueyama, Ryousuke.; Harada, Masahiro.; Ueyama, Tamotsu.; Harada, Akio. [Daiken Chemistry Industry Corporation, Osaka (Japan); Yamamoto, Takashi. [National Defence Academy, Kanagawa (Japan). Dept. of Electrical Engineering; Shiosaki, Tadashi. [Nara Institute of Science and Technology, Nara (Japan). Graduate School of Materials Science; Kuribayashi, Kiyoshi. [Teikyo University of Science and Technology, Yamanashi (Japan). Dept. of Materials

    1999-01-01

    Ultrafine silver monodispersed particle were prepared by wet chemical process. To decrease the reduction speed, an important factor in generating monodispersed particles is to control the following three factors: synthesis temperature, concentration of aggregation-relaxing agent added, and concentration of silver nitrate solution. Synthesis of monodispersed spherical Ag particles, used as metal powders for electrode, became possible using the nucleus grouwth reaction method. This process also allowed the control of the diameter of the powder particles. The silver particles were distributed in ta narrow particle diameter range with on average of 0.5 {mu}m. Transmission electron microscopy (TEM) revealed that single-crystalline silver particles were prepared by the present method. (author)

  3. Monodispersed macroporous architecture of nickel-oxide film as an anode material for thin-film lithium-ion batteries

    International Nuclear Information System (INIS)

    Wu, Mao-Sung; Lin, Ya-Ping

    2011-01-01

    A nickel-oxide film with monodispersed open macropores was prepared on a stainless-steel substrate by electrophoretic deposition of a polystyrene-sphere monolayer followed by anodic electrodeposition of nickel oxy-hydroxide. The deposited films convert to cubic nickel oxide after annealing at 400 o C for 1 h. Galvanostatic charge and discharge results indicate that the nickel-oxide film with monodispersed open macropores is capable of delivering a higher capacity than the bare nickel-oxide film, especially in high-rate charge and discharge processes. The lithiation capacity of macroporous nickel oxide reaches 1620 mA h g -1 at 1 C current discharge and decreases to 990 mA h g -1 at 15 C current discharge. The presence of monodispersed open macropores in the nickel-oxide film might facilitate the electrolyte penetration, diffusion, and migration. Electrochemical reactions between nickel oxide and lithium ions are therefore markedly improved by this tailored film architecture.

  4. Solvothermal crystallization of nanocrystals of metal oxides

    International Nuclear Information System (INIS)

    Furukawa, S; Amino, H; Iwamoto, S; Inoue, M

    2008-01-01

    Solvothermal crystallization of the hydroxide gels obtained by hydrolysis of alkoxides (Zr, Ta, Nb, ln, Sn, Ti and Al) was examined. Nanocrystals having high surface areas (S BET > 170 m 2 g -1 ) were obtained except for the product derived from indium isopropoxide. The effect of water in organic solvent upon the crystallinity of the product was investigated. The increase in the activity of water by using high concentration of alkoxide or intentional addition of water to the solvothermal medium led to crystal growth of the products. In contrast, decrease in activity of water by adding ethylene glycol before solvothermal treatment caused a decrease in crystallinity of the product

  5. Flame synthesis of zinc oxide nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Merchan-Merchan, Wilson, E-mail: wmerchan-merchan@ou.edu [School of Aerospace and Mechanical Engineering, University of Oklahoma, Norman, OK 73019 (United States); Farahani, Moien Farmahini [School of Aerospace and Mechanical Engineering, University of Oklahoma, Norman, OK 73019 (United States)

    2013-02-01

    Highlights: Black-Right-Pointing-Pointer We report a single-step flame method for the synthesis of Zn oxide nanocrystals. Black-Right-Pointing-Pointer Diverse flame positions lead to a variation of Zn oxide nanocrystal growth. Black-Right-Pointing-Pointer The synthesized crystals have polyhedral, pipet- and needle-like shape. Black-Right-Pointing-Pointer High length-to-diameter aspect-ratio crystals appear in a higher temperature flame. Black-Right-Pointing-Pointer The crystal growth mechanism corresponds to vapor-to-solid conversion. - Abstract: Distinctive zinc oxide (ZnO) nanocrystals were synthesized on the surface of Zn probes using a counter-flow flame medium formed by methane/acetylene and oxygen-enriched air streams. The source material, a zinc wire with a purity of {approx}99.99% and diameter of 1 mm, was introduced through a sleeve into the oxygen rich region of the flame. The position of the probe/sleeve was varied within the flame medium resulting in growth variation of ZnO nanocrystals on the surface of the probe. The shape and structural parameters of the grown crystals strongly depend on the flame position. Structural variations of the synthesized crystals include single-crystalline ZnO nanorods and microprisms (ZMPs) (the ZMPs have less than a few micrometers in length and several hundred nanometers in cross section) with a large number of facets and complex axial symmetry with a nanorod protruding from their tips. The protruding rods are less than 100 nm in diameter and lengths are less than 1 {mu}m. The protruding nanorods can be elongated several times by increasing the residence time of the probe/sleeve inside the oxygen-rich flame or by varying the flame position. At different flame heights, nanorods having higher length-to-diameter aspect-ratio can be synthesized. A lattice spacing of {approx}0.26 nm was measured for the synthesized nanorods, which can be closely correlated with the (0 0 2) interplanar spacing of hexagonal ZnO (Wurtzite) cells

  6. Structure and Magnetic Properties of Lanthanide Nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Dickerson, James Henry [Vanderbilt Univ., Nashville, TN (United States)

    2014-06-01

    We have had considerable success on this project, particularly in the understanding of the relationship between nanostructure and magnetic properties in lanthanide nanocrystals. We also have successfully facilitated the doctoral degrees of Dr. Suseela Somarajan, in the Department of Physics and Astronomy, and Dr. Melissa Harrison, in the Materials Science Program. The following passages summarize the various accomplishments that were featured in 9 publications that were generated based on support from this grant. We thank the Department of Energy for their generous support of our research efforts in this area of materials science, magnetism, and electron microscopy.

  7. Solvothermal crystallization of nanocrystals of metal oxides

    Science.gov (United States)

    Furukawa, S.; Amino, H.; Iwamoto, S.; Inoue, M.

    2008-07-01

    Solvothermal crystallization of the hydroxide gels obtained by hydrolysis of alkoxides (Zr, Ta, Nb, ln, Sn, Ti and Al) was examined. Nanocrystals having high surface areas (SBET > 170 m2 g-1) were obtained except for the product derived from indium isopropoxide. The effect of water in organic solvent upon the crystallinity of the product was investigated. The increase in the activity of water by using high concentration of alkoxide or intentional addition of water to the solvothermal medium led to crystal growth of the products. In contrast, decrease in activity of water by adding ethylene glycol before solvothermal treatment caused a decrease in crystallinity of the product.

  8. Charge transport in metal oxide nanocrystal-based materials

    Science.gov (United States)

    Runnerstrom, Evan Lars

    There is probably no class of materials more varied, more widely used, or more ubiquitous than metal oxides. Depending on their composition, metal oxides can exhibit almost any number of properties. Of particular interest are the ways in which charge is transported in metal oxides: devices such as displays, touch screens, and smart windows rely on the ability of certain metal oxides to conduct electricity while maintaining visible transparency. Smart windows, fuel cells, and other electrochemical devices additionally rely on efficient transport of ionic charge in and around metal oxides. Colloidal synthesis has enabled metal oxide nanocrystals to emerge as a relatively new but highly tunable class of materials. Certain metal oxide nanocrystals, particularly highly doped metal oxides, have been enjoying rapid development in the last decade. As in myriad other materials systems, structure dictates the properties of metal oxide nanocrystals, but a full understanding of how nanocrystal synthesis, the processing of nanocrystal-based materials, and the structure of nanocrystals relate to the resulting properties of nanocrystal-based materials is still nascent. Gaining a fundamental understanding of and control over these structure-property relationships is crucial to developing a holistic understanding of metal oxide nanocrystals. The unique ability to tune metal oxide nanocrystals by changing composition through the introduction of dopants or by changing size and shape affords a way to study the interplay between structure, processing, and properties. This overall goal of this work is to chemically synthesize colloidal metal oxide nanocrystals, process them into useful materials, characterize charge transport in materials based on colloidal metal oxide nanocrystals, and develop ways to manipulate charge transport. In particular, this dissertation characterizes how the charge transport properties of metal oxide nanocrystal-based materials depend on their processing and

  9. Surface and Core Electronic Structure of Oxidized Silicon Nanocrystals

    Directory of Open Access Journals (Sweden)

    Noor A. Nama

    2010-01-01

    Full Text Available Ab initio restricted Hartree-Fock method within the framework of large unit cell formalism is used to simulate silicon nanocrystals between 216 and 1000 atoms (1.6–2.65 nm in diameter that include Bravais and primitive cell multiples. The investigated properties include core and oxidized surface properties. Results revealed that electronic properties converge to some limit as the size of the nanocrystal increases. Increasing the size of the core of a nanocrystal resulted in an increase of the energy gap, valence band width, and cohesive energy. The lattice constant of the core and oxidized surface parts shows a decreasing trend as the nanocrystal increases in a size that converges to 5.28 Ǻ in a good agreement with the experiment. Surface and core convergence to the same lattice constant reflects good adherence of oxide layer at the surface. The core density of states shows highly degenerate states that split at the oxygenated (001-(1×1 surface due to symmetry breaking. The nanocrystal surface shows smaller gap and higher valence and conduction bands when compared to the core part, due to oxygen surface atoms and reduced structural symmetry. The smaller surface energy gap shows that energy gap of the nanocrystal is controlled by the surface part. Unlike the core part, the surface part shows a descending energy gap that proves its obedience to quantum confinement effects. Nanocrystal geometry proved to have some influence on all electronic properties including the energy gap.

  10. Growth of monodisperse mesoscopic metal-oxide colloids under constant monomer supply

    Science.gov (United States)

    Nozawa, Koh; Delville, Marie-Hélène; Ushiki, Hideharu; Panizza, Pascal; Delville, Jean-Pierre

    2005-07-01

    In closed systems, control over the size of monodisperse metal-oxide colloids is generally limited to submicrometric dimensions. To overcome this difficulty, we explore the formation and growth of silica particles under constant monomer supply. The monomer source is externally driven by the progressive addition into the system of one of the precursors. Monodisperse spherical particles are produced up to a mesoscopic size. We analyze their growth versus the monomer addition rate at different temperatures. Our results show that in the presence of a continuous monomer addition, growth is limited by diffusion over the investigated temporal window. Using the temperature variation of the growth rate, we prove that rescaling leads to a data reduction onto a single master curve. Contrary to the growth process, the final particle’s size reached after the end of the reagent supply strongly depends on the addition rate. The variation of the final particle size versus addition rate can be deduced from an analogy with crystal formation in jet precipitation. Within this framework, and using the temperature dependences of both the particle growth law and the final size, we determine the value of the molecular heat of dissolution associated to the silica solubility. These observations support the fact that classical theories of phase-ordering dynamics can be extended to the synthesis of inorganic particles. The emergence of a master behavior in the presence of continuous monomer addition also suggests the extension of these theories to open systems.

  11. Facile Synthesis of Mono-Dispersed Polystyrene (PS/Ag Composite Microspheres via Modified Chemical Reduction

    Directory of Open Access Journals (Sweden)

    Wen Zhu

    2013-12-01

    Full Text Available A modified method based on in situ chemical reduction was developed to prepare mono-dispersed polystyrene/silver (PS/Ag composite microspheres. In this approach; mono-dispersed PS microspheres were synthesized through dispersion polymerization using poly-vinylpyrrolidone (PVP as a dispersant at first. Then, poly-dopamine (PDA was fabricated to functionally modify the surfaces of PS microspheres. With the addition of [Ag(NH32]+ to the PS dispersion, [Ag(NH32]+ complex ions were absorbed and reduced to silver nanoparticles on the surfaces of PS-PDA microspheres to form PS/Ag composite microspheres. PVP acted both as a solvent of the metallic precursor and as a reducing agent. PDA also acted both as a chemical protocol to immobilize the silver nanoparticles at the PS surface and as a reducing agent. Therefore, no additional reducing agents were needed. The resulting composite microspheres were characterized by TEM, field emission scanning electron microscopy (FESEM, energy-dispersive X-ray spectroscopy (EDS, XRD, UV-Vis and surface-enhanced Raman spectroscopy (SERS. The results showed that Ag nanoparticles (NPs were homogeneously immobilized onto the PS microspheres’ surface in the presence of PDA and PVP. PS/Ag composite microspheres were well formed with a uniform and compact shell layer and were adjustable in terms of their optical property.

  12. Lock and Key Colloids through Polymerization-Induced Buckling of Monodispersed Silicon Oil Droplets

    Science.gov (United States)

    Sacanna, Stefano; Irvine, William T. M.; Chaikin, Paul M.; Pine, David J.

    2010-03-01

    Colloidal particles can spontaneously associate into larger structured aggregates when driven by selective and directional interactions. Colloidal organization can be programmed by engineering shapes and interactions of basic building blocks in a manner similar to molecular self-assembly. Examples of successful strategies that allow non-trivial assembly of particles include template-directed patterning, capillary forces and, most commonly, the functionalization of the particle surfaces with ``sticky patches'' of biological or synthetic molecules. The level of complexity of the realizable assemblies, increases when particles with well defined shape anisotropies are used. In particular depletion forces and specific surface treatments in combination with non spherical particles have proven to be powerful tools to self-assembly complex microstructures. We describe a simple, high yield, synthetic pathway to fabricate monodisperse hybrid silica spheres with well defined cavities. Because the particle morphologies are reproducible and tunable with precision, the resulting particles can be used as basic building blocks in the assembly of larger monodisperse clusters. This is demonstrated using depletion to drive the self-assembly.

  13. Linear theory on temporal instability of megahertz faraday waves for monodisperse microdroplet ejection.

    Science.gov (United States)

    Tsai, Shirley C; Tsai, Chen S

    2013-08-01

    A linear theory on temporal instability of megahertz Faraday waves for monodisperse microdroplet ejection based on mass conservation and linearized Navier-Stokes equations is presented using the most recently observed micrometer- sized droplet ejection from a millimeter-sized spherical water ball as a specific example. The theory is verified in the experiments utilizing silicon-based multiple-Fourier horn ultrasonic nozzles at megahertz frequency to facilitate temporal instability of the Faraday waves. Specifically, the linear theory not only correctly predicted the Faraday wave frequency and onset threshold of Faraday instability, the effect of viscosity, the dynamics of droplet ejection, but also established the first theoretical formula for the size of the ejected droplets, namely, the droplet diameter equals four-tenths of the Faraday wavelength involved. The high rate of increase in Faraday wave amplitude at megahertz drive frequency subsequent to onset threshold, together with enhanced excitation displacement on the nozzle end face, facilitated by the megahertz multiple Fourier horns in resonance, led to high-rate ejection of micrometer- sized monodisperse droplets (>10(7) droplets/s) at low electrical drive power (<;1 W) with short initiation time (<;0.05 s). This is in stark contrast to the Rayleigh-Plateau instability of a liquid jet, which ejects one droplet at a time. The measured diameters of the droplets ranging from 2.2 to 4.6 μm at 2 to 1 MHz drive frequency fall within the optimum particle size range for pulmonary drug delivery.

  14. In situ coating multiwalled carbon nanotubes with CdS nanoparticles

    International Nuclear Information System (INIS)

    Liu Yangqiao; Gao Lian

    2005-01-01

    CdS nanoparticles were homogeneously coated on multiwalled carbon nanotubes by an in situ method through introducing thiol groups onto the tube wall using a novel method. A cationic polyelectrolyte containing reactive imine groups, polyethyleneimine (PEI), was firstly adsorbed on the surface of nanotubes. 3-Mercaptopropionic acid (MPA) was then anchored by an amidation reaction between its carboxyl group and the imine group of the polyelectrolyte under the activation of carbodiimide reagents. These -SH terminated MWCNTs were coated with CdS nanoparticles by an in situ method. The phase composition, microstructure, and the UV-vis properties of the CdS coated MWCNTs were characterized. The addition of the carbodiimide reagents played an important role in linking the MPA with PEI covalently and subsequently coating the MWCNTs with CdS homogeneously. A blue shift in the absorption edge was observed for the MWCNTs-CdS hybrid material due to the quantum size effect

  15. Magnetodielectric effect in CdS nanosheets grown within Na-4 mica

    Science.gov (United States)

    Mandal, Amrita; Mitra, Sreemanta; Datta, Anindya; Banerjee, Sourish; Chakravorty, Dipankar

    2012-04-01

    CdS nanosheets of thickness 0.6 nm were grown within the interlayer spaces of Na-4 mica. Magnetization measurements carried out in the temperature range 2-300 K showed the composites to have weak ferromagnetic-like properties even at room temperature. The saturation magnetization (MS) at room temperature was found to be higher than that reported for CdS nanoparticles. The higher value of MS may be ascribed to the presence of a large number defects in the present CdS system, due to a large surface to volume ratio in the nanosheets as compared to that of CdS nanoparticles. The nanocomposites exhibited a magnetodielectric effect with a dielectric constant change of 5.3% for a magnetic field of 0.5 T. This occurred due to a combination of magnetoresistance and Maxwell-Wagner effect as delineated in the model developed by Catalan.

  16. Mixed-solvothermal synthesis of CdS micro/nanostructures and their optical properties

    International Nuclear Information System (INIS)

    Zhong Shengliang; Zhang Linfei; Huang Zhenzhong; Wang Shangping

    2011-01-01

    Several novel cadmium sulfide (CdS) micro/nanostructures, including cauliflower-like microspheres, football-like microspheres, tower-like microrods, and dendrites were controllably prepared via an oxalic acid-assisted solvothermal route using ethylene glycol (EG) and H 2 O as pure and mixed solvents with different S sources. The as-prepared products were characterized by X-ray powder diffraction (XRD), scanning electronic microscope (SEM) and UV-vis spectrophotometer (UV). It was found that CdS micro/nanostructures can be selectively obtained by varying the composition of solvent, concentration of oxalic acid, and sulfur sources. UV-vis absorption spectra reveal that their absorption properties are shape-dependent. The possible formation process of the CdS micro/nanostructures was briefly discussed. This route provides a facile way to tune the morphologies of CdS over a wide range.

  17. Mixed-solvothermal synthesis of CdS micro/nanostructures and their optical properties

    Energy Technology Data Exchange (ETDEWEB)

    Zhong Shengliang, E-mail: zslxhx@yahoo.com.cn [College of Chemistry and Chemical Engineering, Jiangxi Normal University, Nanchang 330022 (China); Zhang Linfei; Huang Zhenzhong; Wang Shangping [College of Chemistry and Chemical Engineering, Jiangxi Normal University, Nanchang 330022 (China)

    2011-01-15

    Several novel cadmium sulfide (CdS) micro/nanostructures, including cauliflower-like microspheres, football-like microspheres, tower-like microrods, and dendrites were controllably prepared via an oxalic acid-assisted solvothermal route using ethylene glycol (EG) and H{sub 2}O as pure and mixed solvents with different S sources. The as-prepared products were characterized by X-ray powder diffraction (XRD), scanning electronic microscope (SEM) and UV-vis spectrophotometer (UV). It was found that CdS micro/nanostructures can be selectively obtained by varying the composition of solvent, concentration of oxalic acid, and sulfur sources. UV-vis absorption spectra reveal that their absorption properties are shape-dependent. The possible formation process of the CdS micro/nanostructures was briefly discussed. This route provides a facile way to tune the morphologies of CdS over a wide range.

  18. Enhanced photoelectrochemical properties of TiO2 nanorod arrays decorated with CdS nanoparticles

    International Nuclear Information System (INIS)

    Xie, Zheng; Wang, Weipeng; Liu, Can; Li, Zhengcao; Liu, Xiangxuan; Zhang, Zhengjun

    2014-01-01

    TiO 2 nanorod arrays (TiO 2 NRAs) sensitized with CdS nanoparticles were fabricated via successive ion layer adsorption and reaction (SILAR), and TiO 2 NRAs were obtained by oxidizing Ti NRAs obtained through oblique angle deposition. The TiO 2 NRAs decorated with CdS nanoparticles exhibited excellent photoelectrochemical and photocatalytic properties under visible light, and the one decorated with 20 SILAR cycles CdS nanoparticles shows the best performance. This can be attributed to the enhanced separation of electrons and holes by forming heterojunctions of CdS nanoparticles and TiO 2 NRAs. This provides a promising way to fabricate the material for solar energy conversion and wastewater degradation. (paper)

  19. Chemical bath deposition of CdS thin films doped with Zn and Cu

    Indian Academy of Sciences (India)

    Abstract. Zn- and Cu-doped CdS thin films were deposited onto glass substrates by the chemical bath technique. ... Cadmium sulfide; chemical bath deposition; doping; optical window. 1. ..... at low temperature (10 K), finding similar trends than.

  20. Synthesis of anisotropic CdS nanostructures via a single-source route

    CSIR Research Space (South Africa)

    Rajasekhar Pullabhotla, VSR

    2011-02-01

    Full Text Available A cadmium tetrahydroisoquinoline dithiocarbamate (DTC) complex has been used as single-source precursor for the synthesis of highly faceted hexadecylamine (HDA) capped CdS nanoparticles. Hexagonal and close to cubic shaped particles with distinct...

  1. Enhanced Performance of DSSCs Based on the Insertion Energy Level of CdS Quantum Dots

    Directory of Open Access Journals (Sweden)

    Xiaoping Zou

    2014-01-01

    Full Text Available Cadmium sulfide (CdS quantum dots (QDs are assembled onto the TiO2 films by chemical bath deposition method (CBD. And the QDs size is controlled by the times of CBD cycles. They are characterized by UV-visible absorption. To avoid the photo corrosion and electrolyte corrosion, CdS and N719 are sequentially assembled onto the nanocrystalline TiO2 films to prepare a CdS/N719 cosensitized photo electrode for the dye-sensitized solar cells. In the structure of TiO2/CdS/N719 electrode, the reorganization of energy levels between CdS and N719 forms a stepwise structure of band-edge levels which is advantageous to the electron injection and hole recovery of CdS and N719 QDs. The open circuit voltage (Voc, short circuit current density (Jsc, and efficiency are increased.

  2. Development of a Higher Fidelity Model for the Cascade Distillation Subsystem (CDS)

    Science.gov (United States)

    Perry, Bruce; Anderson, Molly

    2014-01-01

    Significant improvements have been made to the ACM model of the CDS, enabling accurate predictions of dynamic operations with fewer assumptions. The model has been utilized to predict how CDS performance would be impacted by changing operating parameters, revealing performance trade-offs and possibilities for improvement. CDS efficiency is driven by the THP coefficient of performance, which in turn is dependent on heat transfer within the system. Based on the remaining limitations of the simulation, priorities for further model development include: center dot Relaxing the assumption of total condensation center dot Incorporating dynamic simulation capability for the buildup of dissolved inert gasses in condensers center dot Examining CDS operation with more complex feeds center dot Extending heat transfer analysis to all surfaces

  3. Interfacial interactions between calcined hydroxyapatite nanocrystals and substrates.

    Science.gov (United States)

    Okada, Masahiro; Furukawa, Keiko; Serizawa, Takeshi; Yanagisawa, Yoshihiko; Tanaka, Hidekazu; Kawai, Tomoji; Furuzono, Tsutomu

    2009-06-02

    Interfacial interactions between calcined hydroxyapatite (HAp) nanocrystals and surface-modified substrates were investigated by measuring adsorption behavior and adhesion strength with a quartz crystal microbalance (QCM) and a contact-mode atomic force microscope (AFM), respectively. The goal was to develop better control of HAp-nanocrystal coatings on biomedical materials. HAp nanocrystals with rodlike or spherical morphology were prepared by a wet chemical process followed by calcination at 800 degrees C with an antisintering agent to prevent the formation of sintered polycrystals. The substrate surface was modified by chemical reaction with a low-molecular-weight compound, or graft polymerization with a functional monomer. QCM measurement showed that the rodlike HAp nanocrystals adsorbed preferentially onto anionic COOH-modified substrates compared to cationic NH2- or hydrophobic CH3-modified substrates. On the other hand, the spherical nanocrystals adsorbed onto NH2- and COOH-modified substrates, which indicates that the surface properties of the HAp nanocrystals determined their adsorption behavior. The adhesion strength, which was estimated from the force required to move the nanocrystal in contact-mode AFM, on a COOH-grafted substrate prepared by graft polymerization was almost 9 times larger than that on a COOH-modified substrate prepared by chemical reaction with a low-molecular-weight compound, indicating that the long-chain polymer grafted on the substrate mitigated the surface roughness mismatch between the nanocrystal and the substrate. The adhesion strength of the nanocrystal bonded covalently by the coupling reaction to a Si(OCH3)-grafted substrate prepared by graft polymerization was approximately 1.5 times larger than that when adsorbed on the COOH-grafted substrate.

  4. Photoelectrochemical properties of orthorhombic and metastable phase SnS nanocrystals synthesized by a facile colloidal method

    Energy Technology Data Exchange (ETDEWEB)

    Huang, Po-Chia [Department of Materials Science and Engineering, National Cheng Kung University, Tainan 701, Taiwan, ROC (China); Huang, Jow-Lay [Department of Materials Science and Engineering, National Cheng Kung University, Tainan 701, Taiwan, ROC (China); Department of Chemical and Materials Engineering, National University of Kaohsiung, Kaohsiung 81148, Taiwan, ROC (China); Center for Micro/Nano Science and Technology, National Cheng Kung University, Tainan 70101, Taiwan, ROC (China); Wang, Sheng-Chang; Shaikh, Muhammad Omar [Department of Mechanical Engineering, Southern Taiwan University of Science and Technology, Tainan 710, Taiwan, ROC (China); Lin, Chia-Yu [Department of Chemical Engineering, National Cheng Kung University, Tainan 701, Taiwan, ROC (China)

    2015-12-01

    SnS of orthorhombic (OR) and metastable (SnS) phases were synthesized by using a simple and facile colloidal method. The tin precursor was synthesized using tin oxide (SnO) and oleic acid (OA), while the sulfur precursor was prepared using sulfur powder (S) and oleyamine (OLA). The sulfur precursor was injected into the tin precursor and the prepared SnS nanocrystals were precipitated at a final reaction temperature of 180 °C. The results show that hexamethyldisilazane (HMDS) can be successfully used as a surfactant to synthesize monodisperse 20 nm metastable SnS nanoparticles, while OR phase SnS nanosheets were obtained without HMDS. The direct bandgap observed for the metastable SnS phase is higher (1.66 eV) as compared to the OR phase (1.46 eV). The large blueshift in the direct bandgap of metastable SnS is caused by the difference in crystal structure. The blueshift in the direct band gap value for OR-SnS could be explained by quantum confinement in two dimensions in the very thin nanosheets. SnS thin films used as a photo anode in a photoelectrochemical (PEC) cell were prepared by spin coating on the fluorine-doped tin oxide (FTO) substrates. The photocurrent density of the SnS (metastable SnS)/FTO and SnS (OR)/FTO are 191.8 μA/cm{sup 2} and 57.61 μA/cm{sup 2} at an applied voltage of − 1 V at 150 W, respectively. These narrow band gap and low cost nanocrystals can be used for applications in future optoelectronic devices. - Highlights: • A facile method to synthesize two different phases of SnS having different morphological and optical properties. • The phases and morphologies of SnS nanocrystal can be controlled by adding capping surfactant hexamethyldisilazane (HMDS). • As we know, this is the first metastable SnS photoanode for application in a photoelectrochemical cell.

  5. Optical characterization of CdS nanoparticles embedded into the comb-type amphiphilic graft copolymer

    Science.gov (United States)

    Kalaycı, Özlem A.; Duygulu, Özgür; Hazer, Baki

    2013-01-01

    This study refers to the synthesis and characterization of a novel organic/inorganic hybrid nanocomposite material containing cadmium sulfide (CdS) nanoparticles. For this purpose, a series of polypropylene (PP)-g-polyethylene glycol (PEG), PP-g-PEG comb-type amphiphilic graft copolymers were synthesized. PEGs with Mn = 400, 2000, 3350, and 8000 Da were used and the graft copolymers obtained were coded as PPEG400, PPEG2000, PPEG3350, and PPEG8000. CdS nanoparticles were formed in tetrahydrofuran solution of PP-g-PEG amphiphilic comb-type copolymer by the reaction between aqueous solutions of Na2S and Cd(CH3COO)2 simultaneously. Micelle formation of PPEG2000 comb-type amphiphilic graft copolymer in both solvent/non-solvent (petroleum ether-THF) by transmission electron microscopy (TEM). The optical characteristics, size morphology, phase analysis, and dispersion of CdS nanoparticles embedded in PPEG400, PPEG2000, PPEG3350, and PPEG8000 comb-type amphiphilic graft copolymer micelles were determined by high resolution TEM (HRTEM), energy dispersive spectroscopy, UV-vis spectroscopy, and fluorescence emission spectroscopy techniques. The aggregate size of PPEG2000-CdS is between 10 and 50 nm; however, in the case of PPEG400-CdS, PPEG3350-CdS, and PPEG8000-CdS samples, it is up to approximately 100 nm. The size of CdS quantum dots in the aggregates for PPEG2000 and PPEG8000 samples was observed as 5 nm by HRTEM analysis, and this result was also supported by UV-vis absorbance spectra and fluorescence emission spectra.

  6. Optical characterization of CdS nanoparticles embedded into the comb-type amphiphilic graft copolymer

    Energy Technology Data Exchange (ETDEWEB)

    Kalayc Latin-Small-Letter-Dotless-I , Oezlem A. [Bulent Ecevit University, Department of Physics (Turkey); Duygulu, Oezguer [TUBITAK Marmara Research Center, Materials Institute (Turkey); Hazer, Baki, E-mail: bkhazer@karaelmas.edu.tr [Bulent Ecevit University, Department of Chemistry (Turkey)

    2013-01-15

    This study refers to the synthesis and characterization of a novel organic/inorganic hybrid nanocomposite material containing cadmium sulfide (CdS) nanoparticles. For this purpose, a series of polypropylene (PP)-g-polyethylene glycol (PEG), PP-g-PEG comb-type amphiphilic graft copolymers were synthesized. PEGs with Mn = 400, 2000, 3350, and 8000 Da were used and the graft copolymers obtained were coded as PPEG400, PPEG2000, PPEG3350, and PPEG8000. CdS nanoparticles were formed in tetrahydrofuran solution of PP-g-PEG amphiphilic comb-type copolymer by the reaction between aqueous solutions of Na{sub 2}S and Cd(CH{sub 3}COO){sub 2} simultaneously. Micelle formation of PPEG2000 comb-type amphiphilic graft copolymer in both solvent/non-solvent (petroleum ether-THF) by transmission electron microscopy (TEM). The optical characteristics, size morphology, phase analysis, and dispersion of CdS nanoparticles embedded in PPEG400, PPEG2000, PPEG3350, and PPEG8000 comb-type amphiphilic graft copolymer micelles were determined by high resolution TEM (HRTEM), energy dispersive spectroscopy, UV-vis spectroscopy, and fluorescence emission spectroscopy techniques. The aggregate size of PPEG2000-CdS is between 10 and 50 nm; however, in the case of PPEG400-CdS, PPEG3350-CdS, and PPEG8000-CdS samples, it is up to approximately 100 nm. The size of CdS quantum dots in the aggregates for PPEG2000 and PPEG8000 samples was observed as 5 nm by HRTEM analysis, and this result was also supported by UV-vis absorbance spectra and fluorescence emission spectra.

  7. Optical characterization of CdS nanoparticles embedded into the comb-type amphiphilic graft copolymer

    International Nuclear Information System (INIS)

    Kalaycı, Özlem A.; Duygulu, Özgür; Hazer, Baki

    2013-01-01

    This study refers to the synthesis and characterization of a novel organic/inorganic hybrid nanocomposite material containing cadmium sulfide (CdS) nanoparticles. For this purpose, a series of polypropylene (PP)-g-polyethylene glycol (PEG), PP-g-PEG comb-type amphiphilic graft copolymers were synthesized. PEGs with Mn = 400, 2000, 3350, and 8000 Da were used and the graft copolymers obtained were coded as PPEG400, PPEG2000, PPEG3350, and PPEG8000. CdS nanoparticles were formed in tetrahydrofuran solution of PP-g-PEG amphiphilic comb-type copolymer by the reaction between aqueous solutions of Na 2 S and Cd(CH 3 COO) 2 simultaneously. Micelle formation of PPEG2000 comb-type amphiphilic graft copolymer in both solvent/non-solvent (petroleum ether–THF) by transmission electron microscopy (TEM). The optical characteristics, size morphology, phase analysis, and dispersion of CdS nanoparticles embedded in PPEG400, PPEG2000, PPEG3350, and PPEG8000 comb-type amphiphilic graft copolymer micelles were determined by high resolution TEM (HRTEM), energy dispersive spectroscopy, UV–vis spectroscopy, and fluorescence emission spectroscopy techniques. The aggregate size of PPEG2000-CdS is between 10 and 50 nm; however, in the case of PPEG400-CdS, PPEG3350-CdS, and PPEG8000-CdS samples, it is up to approximately 100 nm. The size of CdS quantum dots in the aggregates for PPEG2000 and PPEG8000 samples was observed as 5 nm by HRTEM analysis, and this result was also supported by UV–vis absorbance spectra and fluorescence emission spectra.

  8. Optical properties of CdS thin films by (SILAR) method

    International Nuclear Information System (INIS)

    Ates, A.; Gurbulak, B.; Yildirim, M.

    2004-01-01

    Full text: CdS thin film was grown by Successive ionic layer adsorption and reaction (SILAR) technique on quartz substrate. The film homogeneous of film is good and the film colour obtained as orange. Optical properties of CdS thin film has been investigated as a function of temperature in the temperature range 10-320 K with 10 K steps. The band gap energy decreased with increasing temperature

  9. Preparation of CdS semiconductor nanoarrays in the channels of nickel phosphate VSB-5 nanorods

    International Nuclear Information System (INIS)

    Jian Dunliang; Gao Qiuming; Gao Dongmei; Ruan Meiling; Shi Wei

    2006-01-01

    CdS nanoarrays with the particles' diameter of about 1 nm were assembled in the nanochannels of the host of VSB-5 nanorods. Obvious UV-vis absorption peaks with the onsets of about 350-400 nm were clearly observed. Compared with the band-gap absorption at about 515 nm of the large CdS particles at room temperature, about 115-165 nm of the blue-shifts occurred for the nanoarrays due to the quantum confinement effect

  10. White light emitting device based on single-phase CdS quantum dots

    Science.gov (United States)

    Li, Feng; Nie, Chao; You, Lai; Jin, Xiao; Zhang, Qin; Qin, Yuancheng; Zhao, Feng; Song, Yinglin; Chen, Zhongping; Li, Qinghua

    2018-05-01

    White light emitting diodes (WLEDs) based on quantum dots (QDs) are emerging as robust candidates for white light sources, however they are suffering from the problem of energy loss resulting from the re-absorption and self-absorption among the employed QDs of different peak wavelengths. It still remains a challenging task to construct WLEDs based on single-phase QD emitters. Here, CdS QDs with short synthesis times are introduced to the fabrication of WLEDs. With a short synthesis time, on one hand, CdS QDs with a small diameter with blue emission can be obtained. On the other hand, surface reconstruction barely has time to occur, and the surface is likely defect-ridden, which enables the existence of a broad emission covering the range of green, yellow and red regions. This is essential for the white light emission of CdS QDs, and is very important for WLED applications. The temporal evolution of the PL spectra for CdS QDs was obtained to investigate the influence of growth time on the luminescent properties. The CdS QDs with a growth time of 0.5 min exhibited a colour rendering index (CRI) of 79.5 and a correlated colour temperature (CCT) of 6238 K. With increasing reaction time, the colour coordinates of the CdS QDs will move away from the white light region in the CIE 1931 chromaticity diagram. By integrating the as prepared white light emission CdS QDs with a violet GaN chip, WLEDs were fabricated. The fabricated WLEDs exhibited a CRI of 87.9 and a CCT of 4619 K, which satisfy the demand of general illumination. The luminous flux and the luminous efficiency of the fabricated WLEDs, being less advanced than current commercial white light sources, can be further improved, meaning there is a need for much more in-depth studies on white light emission CdS QDs.

  11. Optical transitions and nature of Stokes shift in spherical CdS quantum dots

    OpenAIRE

    Demchenko, D. O.; Wang, Lin-Wang

    2006-01-01

    We study the structure of the energy spectra along with the character of the states participating in optical transitions in colloidal CdS quantum dots (QDs) using the {\\sl ab initio} accuracy charge patching method combined with the %pseudopotential based folded spectrum calculations of electronic structure of thousand-atom nanostructures. In particular, attention is paid to the nature of the large resonant Stokes shift observed in CdS quantum dots. We find that the top of the valence band st...

  12. Effect of silver doping on the elastic properties of CdS nanoparticles

    Science.gov (United States)

    Dey, P. C.; Das, R.

    2018-05-01

    CdS and Ag doped CdS (CdS/Ag) nanoparticles have been prepared via chemical method from a Cadmium acetate precursor and Thiourea. The synthesized CdS and CdS/Ag nanoparticles have been characterized by the X-ray Diffraction and High Resolution Transmission Electron Microscope. Here, these nanoparticles have been synthesized at room temperature and all the characterization have also been done at room temperature only. The XRD results reveal that the products are crystalline with cubic zinc blende structure. HRTEM images show that the prepared nanoparticles are nearly spherical in shape. Williamson-Hall method and Size-Strain Plot (SSP) have been used to study the individual contribution of crystalline sizes and lattice strain on the peak broadening of the CdS and CdS/Ag nanoparticles. The different modified model of Williamson-Hall method such as, uniform deformation model, uniform stress deformation model and uniform energy density deformation model and SSP method have been used to calculate the different physical parameter such as lattice strain, stress and energy density for all diffraction peaks of the XRD, corresponding to the CdS and silver doped CdS (CdS/Ag). The obtained results reveal that the average particle size of the prepared CdS and CdS/Ag nanoparticles estimated from the HRTEM images, Williamson-Hall analysis and SSP method are highly correlated with each other. Further, all these result confirms that doping of Ag significantly affects the elastic properties of CdS.

  13. Shape-Controlled Synthesis of High-Quality Cu7 S4 Nanocrystals for Efficient Light-Induced Water Evaporation.

    Science.gov (United States)

    Zhang, Changbo; Yan, Cong; Xue, Zhenjie; Yu, Wei; Xie, Yinde; Wang, Tie

    2016-10-01

    Copper sulfides (Cu 2-x S), are a novel kind of photothermal material exhibiting significant photothermal conversion efficiency, making them very attractive in various energy conversion related devices. Preparing high quality uniform Cu 2-x S nanocrystals (NCs) is a top priority for further energy-and sustainability relevant nanodevices. Here, a shape-controlled high quality Cu 7 S 4 NCs synthesis strategy is reported using sulfur in 1-octadecene as precursor by varying the heating temperature, as well as its forming mechanism. The performance of the Cu 7 S 4 NCs is further explored for light-driven water evaporation without the need of heating the bulk liquid to the boiling point, and the results suggest that as-synthesized highly monodisperse NCs perform higher evaporation rate than polydisperse NCs under the identical morphology. Furthermore, disk-like NCs exhibit higher water evaporation rate than spherical NCs. The water evaporation rate can be further enhanced by assembling the organic phase Cu 7 S 4 NCs into a dense film on the aqueous solution surface. The maximum photothermal conversion efficiency is as high as 77.1%. © 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Self organized formation of Ge nanocrystals in multilayers

    OpenAIRE

    Zschintzsch-Dias, Manuel

    2012-01-01

    The aim of this work is to create a process which allows the tailored growth of Ge nanocrystals for use in photovoltic applications. The multilayer systems used here provide a reliable method to control the Ge nanocrystal size after phase separation. In this thesis, the deposition of GeOx/SiO2 and Ge:SiOx~ 2/SiO2 multilayers via reactive dc magnetron sputtering and the self-ordered Ge nanocrystal formation within the GeOx and Ge:SiOx~ 2 sublayers during subsequent annealing is investigated...

  15. PPLA-cellulose nanocrystals nanocomposite prepared by in situ polymerization

    International Nuclear Information System (INIS)

    Paula, Everton L. de; Pereirea, Fabiano V.; Mano, Valdir

    2011-01-01

    This work reports the preparation and and characterization of a PLLA-cellulose nanocrystals nanocomposite obtained by in situ polymerization. The nanocomposite was prepared by ring opening polymerization of the lactide dimer in the presence of cellulose nanocrystals (CNCs) and the as-obtained materials was characterized using FTIR, DSC, XRD and TGA measurements. The incorporation of cellulose nanocrystals in PLLA using this method improved the thermal stability and increased the crystallinity of PLLA. These results indicate that the incorporation of CNCs by in situ polymerization improve thermal properties and has potential to improve also mechanical properties of this biodegradable polymer. (author)

  16. Lasing in ZnO and CdS nanowires

    Energy Technology Data Exchange (ETDEWEB)

    Thielmann, Andreas; Geburt, Sebastian; Kozlik, Michael; Kuehnel, Julian; Borschel, Christian; Ronning, Carsten [Institut fuer Festkoerperphysik, Friedrich-Schiller-Universitaet Jena, Max-Wien-Platz 1, 07743 Jena (Germany)

    2011-07-01

    The development of nanoscaled semiconductor lasers could be the key resolution to the still persistent size mismatch between integrated microelectronic devices and semiconductor optoelectronic devices. Semiconductor nanowires offer an elegant path to the development of nanoscaled lasers as their geometry with two planar end facets naturally combines a fiber-like waveguide with an optical resonator. The possible stimulation of the material's emission processes enables lasing of resonant optical modes. ZnO and CdS nanowires of different aspect ratios have been synthesized via the VLS mechanism and were characterized by SEM, EDX and ensemble PL measurements. Power dependent PL measurements on single nanowires excited with pulsed laser light at 355 nm have been performed between 10 K and room temperature and were set in correlation to the nanowires' respective morphology. Sharp emission lines which show characteristics of Fabry-Perot modes could be observed above a power threshold. The measured power dependencies reveal amplified stimulated emission and lasing at high excitation densities.

  17. Hybrid nanocrystal/polymer solar cells based on tetrapod-shaped CdSexTe1-x nanocrystals

    International Nuclear Information System (INIS)

    Zhou Yi; Li Yunchao; Zhong Haizheng; Hou Jianhui; Ding Yuqin; Yang Chunhe; Li Yongfang

    2006-01-01

    A series of ternary tetrapodal nanocrystals of CdSe x Te 1-x with x = 0 (CdTe), 0.23, 0.53, 0.78, 1 (CdSe) were synthesized and used to fabricate hybrid nanocrystal/polymer solar cells. Herein, the nanocrystals acted as electron acceptors, and poly(2-methoxy-5-(2'-ethyl-hexyloxy)-1,4-phenylene vinylene) (MEH-PPV) was used as an electron donor. It was found that the open circuit voltage (V oc ), short-circuit current (J sc ) and power conversion efficiency (η) of the devices all increased with increasing Se content in the CdSe x Te 1-x nanocrystals under identical experimental conditions. The solar cell based on the blend of tetrapodal CdSe nanocrystals and MEH-PPV (9:1 w/w) showed the highest power conversion efficiency of 1.13% under AM 1.5, 80 mW cm -2 , and the maximum incident photon to converted current efficiency (IPCE) of the device reached 47% at 510 nm. The influence of nanocrystal composition on the photovoltaic properties of the hybrid solar cells was explained by the difference of the band level positions between MEH-PPV and the nanocrystals

  18. Reusable hydroxyapatite nanocrystal sensors for protein adsorption

    International Nuclear Information System (INIS)

    Tagaya, Motohiro; Ikoma, Toshiyuki; Hanagata, Nobutaka; Chakarov, Dinko; Kasemo, Bengt; Tanaka, Junzo

    2010-01-01

    The repeatability of the adsorption and removal of fibrinogen and fetal bovine serum on hydroxyapatite (HAp) nanocrystal sensors was investigated by Fourier transform infrared (FTIR) spectroscopy and quartz crystal microbalance with dissipation (QCM-D) monitoring technique. The HAp nanocrystals were coated on a gold-coated quartz sensor by electrophoretic deposition. Proteins adsorbed on the HAp sensors were removed by (i) ammonia/hydrogen peroxide mixture (APM), (ii) ultraviolet light (UV), (iii) UV/APM, (iv) APM/UV and (v) sodium dodecyl sulfate (SDS) treatments. FTIR spectra of the reused surfaces revealed that the APM and SDS treatments left peptide fragments or the proteins adsorbed on the surfaces, whereas the other methods successfully removed the proteins. The QCM-D measurements indicated that in the removal treatments, fibrinogen was slowly adsorbed in the first cycle because of the change in surface wettability revealed by contact angle measurements. The SDS treatment was not effective in removing proteins. The APM or UV treatment decreased the frequency shifts for the reused HAp sensors. The UV/APM treatment did not induce the frequency shifts but decreased the dissipation shifts. Therefore, we conclude that the APM/UV treatment is the most useful method for reproducing protein adsorption behavior on HAp sensors.

  19. Reusable hydroxyapatite nanocrystal sensors for protein adsorption

    Directory of Open Access Journals (Sweden)

    Motohiro Tagaya, Toshiyuki Ikoma, Nobutaka Hanagata, Dinko Chakarov, Bengt Kasemo and Junzo Tanaka

    2010-01-01

    Full Text Available The repeatability of the adsorption and removal of fibrinogen and fetal bovine serum on hydroxyapatite (HAp nanocrystal sensors was investigated by Fourier transform infrared (FTIR spectroscopy and quartz crystal microbalance with dissipation (QCM-D monitoring technique. The HAp nanocrystals were coated on a gold-coated quartz sensor by electrophoretic deposition. Proteins adsorbed on the HAp sensors were removed by (i ammonia/hydrogen peroxide mixture (APM, (ii ultraviolet light (UV, (iii UV/APM, (iv APM/UV and (v sodium dodecyl sulfate (SDS treatments. FTIR spectra of the reused surfaces revealed that the APM and SDS treatments left peptide fragments or the proteins adsorbed on the surfaces, whereas the other methods successfully removed the proteins. The QCM-D measurements indicated that in the removal treatments, fibrinogen was slowly adsorbed in the first cycle because of the change in surface wettability revealed by contact angle measurements. The SDS treatment was not effective in removing proteins. The APM or UV treatment decreased the frequency shifts for the reused HAp sensors. The UV/APM treatment did not induce the frequency shifts but decreased the dissipation shifts. Therefore, we conclude that the APM/UV treatment is the most useful method for reproducing protein adsorption behavior on HAp sensors.

  20. The hydrodynamic size of polymer stabilized nanocrystals

    Energy Technology Data Exchange (ETDEWEB)

    Krueger, Karl M; Al-Somali, Ali M; Mejia, Michelle; Colvin, Vicki L [Department of Chemistry, Rice University, MS-60 6100 Main Street, Houston, TX 77005 (United States)

    2007-11-28

    For many emerging applications, nanocrystals are surface functionalized with polymers to control self-assembly, prevent aggregation, and promote incorporation into polymer matrices and biological systems. The hydrodynamic diameter of these nanoparticle-polymer complexes is a critical factor for many applications, and predicting this size is complicated by the fact that the structure of the grafted polymer at a nanocrystalline interface is not generally established. In this work we evaluate using size-exclusion chromatography the overall hydrodynamic diameter of nanocrystals (Au, CdSe, d<5 nm) surface coated with polystyrene of varying molecular weight. The polymer is tethered to the nanoparticles via a terminal thiol to provide strong attachment. Our data show that at full coverage the polymer assumes a brush conformation and is 44% longer than the unbound polymer in solution. The brush conformation is confirmed by comparison with models used to describe polymer brushes at flat interfaces. From this work, we suggest an empirical formula which predicts the hydrodynamic diameter of polymer coated nanoparticles based on the size of the nanoparticle core and the size of the randomly coiled unbound polymer in solution.

  1. CdS thin films prepared by laser assisted chemical bath deposition

    International Nuclear Information System (INIS)

    Garcia, L.V.; Mendivil, M.I.; Garcia Guillen, G.; Aguilar Martinez, J.A.; Krishnan, B.; Avellaneda, D.; Castillo, G.A.; Das Roy, T.K.; Shaji, S.

    2015-01-01

    Highlights: • CdS thin films by conventional CBD and laser assisted CBD. • Characterized these films using XRD, XPS, AFM, optical and electrical measurements. • Accelerated growth was observed in the laser assisted CBD process. • Improved dark conductivity and good photocurrent response for the LACBD CdS. - Abstract: In this work, we report the preparation and characterization of CdS thin films by laser assisted chemical bath deposition (LACBD). CdS thin films were prepared from a chemical bath containing cadmium chloride, triethanolamine, ammonium hydroxide and thiourea under various deposition conditions. The thin films were deposited by in situ irradiation of the bath using a continuous laser of wavelength 532 nm, varying the power density. The thin films obtained during deposition of 10, 20 and 30 min were analyzed. The changes in morphology, structure, composition, optical and electrical properties of the CdS thin films due to in situ irradiation of the bath were analyzed by atomic force microscopy (AFM), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and UV–vis spectroscopy. The thin films obtained by LACBD were nanocrystalline, photoconductive and presented interesting morphologies. The results showed that LACBD is an effective synthesis technique to obtain nanocrystalline CdS thin films having good optoelectronic properties

  2. Synthesis of uniform CdS nanowires in high yield and its single nanowire electrical property

    International Nuclear Information System (INIS)

    Yan Shancheng; Sun Litao; Qu Peng; Huang Ninping; Song Yinchen; Xiao Zhongdang

    2009-01-01

    Large-scale high quality CdS nanowires with uniform diameter were synthesized by using a rapid and simple solvothermal route. Field emission scan electron microscopy (FESEM) and transmission electron microscopy (TEM) images show that the CdS nanowires have diameter of about 26 nm and length up to several micrometres. High resolution TEM (HRTEM) study indicates the single-crystalline nature of CdS nanowires with an oriented growth along the c-axis direction. The optical properties of the products were characterized by UV-vis absorption spectra, photoluminescence spectra and Raman spectra. The resistivity, electron concentration and electron mobility of single NW are calculated by fitting the symmetric I-V curves measured on single NW by the metal-semiconductor-metal model based on thermionic field emission theory. - Graphical abstract: Large-scale high quality CdS nanowires (NWs) with uniform diameter were synthesized by using a rapid and simple solvothermal route. The reaction time is reduced to 2 h, comparing to other synthesis which needed long reaction time up to 12 h. In addition, the as-prepared CdS nanowires have more uniform diameter and high yield. More importantly, the I-V curve of present single CdS nanowire has a good symmetric characteristic as expected by the theory.

  3. The effect of different pH modifier on formation of CdS nanoparticles

    Energy Technology Data Exchange (ETDEWEB)

    Xiaoxiao, Ren [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China); Zhao Gaoling [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China)], E-mail: glzhao@zju.edu.cn; Hong, Li; Wei, Wu; Gaorong, Han [State Key Laboratory of Silicon Materials, Department of Materials Science and Engineering, Zhejiang University, Hangzhou 310027 (China)

    2008-10-06

    CdS nanoparticles were prepared by hydrothermal method. The effects of pH modifier on the properties of CdS particles were studied. NaOH and NH{sub 4}OH were chosen as the pH modifier. The morphology and optical properties of CdS particles were characterized by transmitted electron microscope (TEM) and optical absorption spectra analysis, respectively. The particle size of the samples whose pH modifier is NaOH was smaller than that of the CdS samples with NH{sub 4}OH at the same pH value. Optical absorption edge of CdS shifted to longer wavelength with increasing pH value. Optical absorption edge of the samples with NH{sub 4}OH as pH modifier shifted to the longer wavelength more significantly than that of those samples with NaOH as pH modifier. When CdS particles were adsorbed to the TiO{sub 2} electrodes, the photoelectrochemical property of CdS-sensitized TiO{sub 2} electrode showed that the samples with NH{sub 4}OH as pH modifier had higher photocurrent than those samples with NaOH.

  4. The effect of different pH modifier on formation of CdS nanoparticles

    International Nuclear Information System (INIS)

    Ren Xiaoxiao; Zhao Gaoling; Li Hong; Wu Wei; Han Gaorong

    2008-01-01

    CdS nanoparticles were prepared by hydrothermal method. The effects of pH modifier on the properties of CdS particles were studied. NaOH and NH 4 OH were chosen as the pH modifier. The morphology and optical properties of CdS particles were characterized by transmitted electron microscope (TEM) and optical absorption spectra analysis, respectively. The particle size of the samples whose pH modifier is NaOH was smaller than that of the CdS samples with NH 4 OH at the same pH value. Optical absorption edge of CdS shifted to longer wavelength with increasing pH value. Optical absorption edge of the samples with NH 4 OH as pH modifier shifted to the longer wavelength more significantly than that of those samples with NaOH as pH modifier. When CdS particles were adsorbed to the TiO 2 electrodes, the photoelectrochemical property of CdS-sensitized TiO 2 electrode showed that the samples with NH 4 OH as pH modifier had higher photocurrent than those samples with NaOH

  5. CdS thin films prepared by laser assisted chemical bath deposition

    Energy Technology Data Exchange (ETDEWEB)

    Garcia, L.V.; Mendivil, M.I.; Garcia Guillen, G.; Aguilar Martinez, J.A. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); Krishnan, B. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); CIIDIT – Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico); Avellaneda, D.; Castillo, G.A.; Das Roy, T.K. [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); Shaji, S., E-mail: sshajis@yahoo.com [Facultad de Ingenieria Mecanica y Electrica, Universidad Autonoma de Nuevo Leon, Av. Pedro de Alba s/n, Ciudad Universitaria, San Nicolas de los Garza, Nuevo Leon 66450 (Mexico); CIIDIT – Universidad Autonoma de Nuevo Leon, Apodaca, Nuevo Leon (Mexico)

    2015-05-01

    Highlights: • CdS thin films by conventional CBD and laser assisted CBD. • Characterized these films using XRD, XPS, AFM, optical and electrical measurements. • Accelerated growth was observed in the laser assisted CBD process. • Improved dark conductivity and good photocurrent response for the LACBD CdS. - Abstract: In this work, we report the preparation and characterization of CdS thin films by laser assisted chemical bath deposition (LACBD). CdS thin films were prepared from a chemical bath containing cadmium chloride, triethanolamine, ammonium hydroxide and thiourea under various deposition conditions. The thin films were deposited by in situ irradiation of the bath using a continuous laser of wavelength 532 nm, varying the power density. The thin films obtained during deposition of 10, 20 and 30 min were analyzed. The changes in morphology, structure, composition, optical and electrical properties of the CdS thin films due to in situ irradiation of the bath were analyzed by atomic force microscopy (AFM), X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and UV–vis spectroscopy. The thin films obtained by LACBD were nanocrystalline, photoconductive and presented interesting morphologies. The results showed that LACBD is an effective synthesis technique to obtain nanocrystalline CdS thin films having good optoelectronic properties.

  6. Morphology, structure and optical properties of hydrothermally synthesized CeO2/CdS nanocomposites

    Science.gov (United States)

    Mohanty, Biswajyoti; Nayak, J.

    2018-04-01

    CeO2/CdS nanocomposites were synthesized using a two-step hydrothermal technique. The effects of precursor concentration on the optical and structural properties of the CeO2/CdS nanoparticles were systematically studied. The morphology, composition and the structure of the CeO2/CdS nanocomposite powder were studied by scanning electron microscopy (SEM), energy dispersive X-ray spectrum analysis (EDXA) and X-ray diffraction (XRD), respectively. The optical properties of CeO2/CdS nanocomposites were studied by UV-vis absorption and photoluminescence (PL) spectroscopy. The optical band gaps of the CeO2/CdS nanopowders ranged from 2.34 eV to 2.39 eV as estimated from the UV-vis absorption. In the room temperature photoluminescence spectrum of CeO2/CdS nanopowder, a strong blue emission band was observed at 400 nm. Since the powder shows strong visible luminescence, it may be used as a blue phosphor in future. The original article published with this DOI was submitted in error. The correct article was inadvertently left out of the original submission. This has been rectified and the correct article was published online on 16 April 2018.

  7. Photosensitization of TiO2 P25 with CdS Nanoparticles for Photocatalytic Applications

    Directory of Open Access Journals (Sweden)

    Trenczek-Zając A.

    2017-06-01

    Full Text Available A TiO2/CdS coupled system was prepared by mixing the TiO2 P25 with CdS synthesized by means of the precipitation method. It was found that the specific surface area (SSA of both components is extremely different and equals 49.5 for TiO2 and 145.4 m2·g−1 for CdS. The comparison of particle size distribution and images obtained by means of transmission electron microscopy (TEM showed agglomeration of nanocomposites. X-ray diffraction (XRD patterns suggest that CdS crystallizes in a mixture of cubic and hexagonal phases. Optical reflectance spectra revealed a gradual shift of the fundamental absorption edge towards longer wavelengths with increasing CdS molar fraction, which indicates an extension of the absorption spectrum of TiO2. The photocatalytic activity in UV and UV-vis was tested with the use of methyl orange (MO. The Langmuir–Hinshelwood model described well the photodegradation process of MO. The results showed that the photocatalytic behaviour of the TiO2/CdS mixture is significantly better than that of pure nanopowders.

  8. Simulation of sovereign CDS market based on interaction between market participant

    Science.gov (United States)

    Ko, Bonggyun; Kim, Kyungwon

    2017-08-01

    A research for distributional property of financial asset is the subject of intense interest not only for financial theory but also for practitioner. Such respect is no exception to CDS market. The CDS market, which began to receive attention since the global financial debacle, is not well researched despite of the importance of research necessity. This research introduces creation of CDS market and use Ising system utilizing occurrence characteristics (to shift risk) as an important factor. Therefore the results of this paper would be of great assistance to both financial theory and practice. From this study, not only distributional property of the CDS market but also various statistics like multifractal characteristics could promote understanding about the market. A salient point in this study is that countries are mainly clustering into 2 groups and it might be because of market situation and geographical characteristics of each country. This paper suggested 2 simulation parameters representing this market based on understanding such CDS market situation. The estimated parameters are suitable for high and low risk event of CDS market respectively and these two parameters are complementary and can cover not only basic statistics but also multifractal properties of most countries. Therefore these estimated parameters can be used in researches preparing for a certain event (high or low risk). Finally this research will serve as a momentum double-checking indirectly the performance of Ising system based on these results.

  9. Synthesis, optical, structural, and electrical properties of single-crystalline CdS nanobelts

    Energy Technology Data Exchange (ETDEWEB)

    Alqahtani, Mohammed S. [King Saud University, Department of Physics and Astronomy, Riyadh (Saudi Arabia); Hadia, N.M.A.; Mohamed, S.H. [Sohag University, Physics Department, Faculty of Science, Sohag (Egypt)

    2017-04-15

    CdS nanobelts (NBs) were synthesized by vapor transport of CdS powders. The growth was carried out without any catalyst on quartz and Si (100) substrates. The synthesized CdS NBs were examined by transmission electron microscopy (TEM), field emission scanning electron microscopy (FE-SEM) and selected area electron diffraction (SAED), high-resolution transmission electron microscopy (HR-TEM), X-ray powder diffraction (XRD), energy dispersion analysis of X-ray (EDAX), spectrophotometer, and photoluminescence spectroscopy. CdS NBs were indexed as hexagonal wurtzite structure. The growth was via vapor-solid growth mechanism and along the [100] direction. The refractive index was evaluated in the transparent region, as suggested by Swanepoel, using the envelope method. The refractive index values and the extinction coefficient were decreased by increasing the wavelength. The calculated optical band gap was 2.50 eV. The photoluminescence (PL) spectrum of the synthesized CdS NBs exhibited a green emission peak at 510 nm and a broad red emission peak at 696 nm. The conductivity measurements were achieved, in the temperature range from 300 to 600 K, using the conventional two-probe technique. Two different slopes with different activation energies of 0.618 and 0.215 eV were obtained. The CdS NBs are likely being novel functional materials. Thus, they can be used in the manufacture of innovative optoelectronic nanodevices. (orig.)

  10. Fluorescent cellulose nanocrystals via supramolecular assembly of terpyridine-modified cellulose nanocrystals and terpyridine-modified perylene

    International Nuclear Information System (INIS)

    Hassan, Mohammad L.; Moorefield, Charles M.; Elbatal, Hany S.; Newkome, George R.; Modarelli, David A.; Romano, Natalie C.

    2012-01-01

    Highlights: ► Surfaces of cellulose nanocrystals were modified with terpyridine ligands. ► Fluorescent nanocrystals could be obtained via self-assembly of terpyridine-modified perylene dye onto the terpyridine-modified cellulose nanocrystals. ► Further self-assembly of azide-functionalized terpyridine onto the fluorescent cellulose nanocrystals was possible to obtain nanocellulosic material with expected use in bioimaging. - Abstract: Due to their natural origin, biocompatibility, and non-toxicity, cellulose nanocrystals are promising candidates for applications in nanomedicine. Highly fluorescent nanocellulosic material was prepared via surface modification of cellulose nanocrystals with 2,2′:6′,2″-terpyridine side chains followed by supramolecular assembly of terpyridine-modified perylene dye onto the terpyridine-modified cellulose nanocrystals (CTP) via Ru III /Ru II reduction. The prepared terpyridine-modified cellulose-Ru II -terpyridine-modified perylene (CTP-Ru II -PeryTP) fluorescent nanocrystals were characterized using cross-polarized/magic angle spin 13 C nuclear magnetic resonance (CP/MAS 13 C NMR), Fourier transform infrared (FTIR), UV–visible, and fluorescence spectroscopy. In addition, further self-assembly of terpyridine units with azide functional groups onto CTP-Ru II -PeryTP was possible via repeating the Ru III /Ru II reduction protocol to prepare supramolecular fluorescent nanocrystals with azide functionality (CTP-Ru II -PeryTP-Ru II -AZTP). The prepared derivative may have potential application in bio-imaging since the terminal azide groups can be easily reacted with antigens via “Click” chemistry reaction.

  11. Hybrid composites of monodisperse pi-conjugated rodlike organic compounds and semiconductor quantum particles

    DEFF Research Database (Denmark)

    Hensel, V.; Godt, A.; Popovitz-Biro, R.

    2002-01-01

    Composite materials of quantum particles (Q-particles) arranged in layers within crystalline powders of pi-conjugated, rodlike dicarboxylic acids are reported. The synthesis of the composites, either as three-dimensional crystals or as thin films at the air-water interface, comprises a two...... analysis of the solids and grazing incidence X-ray diffraction analysis of the films on water. 2) Topotactic solid/gas reaction of these salts with H2S to convert the metal ions into Q-particles of CdS or PbS embedded in the organic matrix that consists of the acids 6(H) and 8(H). These hybrid materials...

  12. Memory characteristics of an MOS capacitor structure with double-layer semiconductor and metal heterogeneous nanocrystals

    International Nuclear Information System (INIS)

    Ni Henan; Wu Liangcai; Song Zhitang; Hui Chun

    2009-01-01

    An MOS (metal oxide semiconductor) capacitor structure with double-layer heterogeneous nanocrystals consisting of semiconductor and metal embedded in a gate oxide for nonvolatile memory applications has been fabricated and characterized. By combining vacuum electron-beam co-evaporated Si nanocrystals and self-assembled Ni nanocrystals in a SiO 2 matrix, an MOS capacitor with double-layer heterogeneous nanocrystals can have larger charge storage capacity and improved retention characteristics compared to one with single-layer nanocrystals. The upper metal nanocrystals as an additional charge trap layer enable the direct tunneling mechanism to enhance the flat voltage shift and prolong the retention time. (semiconductor devices)

  13. Processing of ZnO nanocrystals by solochemical technique

    International Nuclear Information System (INIS)

    Gusatti, M.; Speckhahn, R.; Silva, L.A.; Rosario, J.A.; Lima, R.B.; Kuhnen, N.C.; Riella, H.G.; Campos, C.E.M.

    2009-01-01

    In the present work, we report the synthesis of high quality ZnO nanocrystals by solochemical technique. This synthetic strategy has been shown to have advantages over other methods of producing nanostructures in terms of low cost, efficiency, simplicity and uniformity of crystal structure. Zinc chloride solution at room temperature was mixed with sodium hydroxide solution at 50°C to produce ZnO nanocrystals. Transmission electronic microscopy (TEM) and X-ray powder diffraction (XRD) were used to characterize the ZnO nanocrystals obtained. The structure of ZnO was refined by the Rietveld Method from X-ray diffraction data. These methods showed that the product consisted of pure ZnO nanocrystals and has, predominantly, a rod-like morphology. (author)

  14. Magneto-optical transitions in multilayer semiconductor nanocrystals

    CERN Document Server

    Climente, J; Jaskolski, W; Aliaga, J I

    2003-01-01

    Absorption spectra of chemically synthesized uniform and multilayer semiconductor nanocrystals in a magnetic field are investigated theoretically. The nanocrystals are modelled by spherical barrier/well potentials. The electron states are calculated within the effective mass model. A four-band k centre dot p Hamiltonian, accounting for the valence subband mixing, is used to obtain the hole states. The magneto-optical transition spectrum depends strongly on the size and composition of the nanocrystals. In the case of small uniform quantum dots, only the linear Zeeman splitting of the electron and hole energy levels is observed even for very strong magnetic fields. In larger nanocrystals, the quadratic magnetic interaction turns out to be important and the transition spectrum becomes complicated. The most complicated influence of the magnetic field is found in quantum dot-quantum well systems in which the lowest electron and hole states are localized in a thin spherical layer. It is shown that transitions that ...

  15. Hydroxyapatite nanocrystals: Simple preparation, characterization and formation mechanism

    International Nuclear Information System (INIS)

    Mohandes, Fatemeh; Salavati-Niasari, Masoud; Fathi, Mohammadhossein; Fereshteh, Zeinab

    2014-01-01

    Crystalline hydroxyapatite (HAP) nanoparticles and nanorods have been successfully synthesized via a simple precipitation method. To control the shape and particle size of HAP nanocrystals, coordination ligands derived from 2-hydroxy-1-naphthaldehyde were first prepared, characterized by Fourier transform infrared (FT-IR) and proton nuclear magnetic resonance ( 1 H-NMR) spectroscopies, and finally applied in the synthesis process of HAP. On the other hand, the HAP nanocrystals were also characterized by several techniques including powder X-ray diffraction (XRD), field-emission scanning electron microscopy (FE-SEM) and transmission electron microscopy (TEM). According to the FE-SEM and TEM micrographs, it was found that the morphology and crystallinity of the HAP powders depended on the coordination mode of the ligands. - Highlights: • HAP nanobundles and nanoparticles have been prepared by a precipitation method. • Morphologies of HAP nanocrystals were controlled by different coordination ligands. • The formation mechanism of hydroxyapatite nanocrystals was also considered

  16. Hydroxyapatite nanocrystals: Simple preparation, characterization and formation mechanism

    Energy Technology Data Exchange (ETDEWEB)

    Mohandes, Fatemeh [Department of Inorganic Chemistry, Faculty of Chemistry, University of Kashan, Kashan, P. O. Box. 87317-51167, Islamic Republic of Iran (Iran, Islamic Republic of); Salavati-Niasari, Masoud, E-mail: salavati@kashanu.ac.ir [Department of Inorganic Chemistry, Faculty of Chemistry, University of Kashan, Kashan, P. O. Box. 87317-51167, Islamic Republic of Iran (Iran, Islamic Republic of); Institute of Nano Science and Nano Technology, University of Kashan, Kashan, P. O. Box 87317-51167, Islamic Republic of Iran (Iran, Islamic Republic of); Fathi, Mohammadhossein [Biomaterials Research Group, Department of Materials Engineering, Isfahan University of Technology, Isfahan 8415683111, Islamic Republic of Iran (Iran, Islamic Republic of); Dental Materials Research Center, Isfahan University of Medical Sciences, Isfahan, Islamic Republic of Iran (Iran, Islamic Republic of); Fereshteh, Zeinab [Biomaterials Research Group, Department of Materials Engineering, Isfahan University of Technology, Isfahan 8415683111, Islamic Republic of Iran (Iran, Islamic Republic of)

    2014-12-01

    Crystalline hydroxyapatite (HAP) nanoparticles and nanorods have been successfully synthesized via a simple precipitation method. To control the shape and particle size of HAP nanocrystals, coordination ligands derived from 2-hydroxy-1-naphthaldehyde were first prepared, characterized by Fourier transform infrared (FT-IR) and proton nuclear magnetic resonance ({sup 1}H-NMR) spectroscopies, and finally applied in the synthesis process of HAP. On the other hand, the HAP nanocrystals were also characterized by several techniques including powder X-ray diffraction (XRD), field-emission scanning electron microscopy (FE-SEM) and transmission electron microscopy (TEM). According to the FE-SEM and TEM micrographs, it was found that the morphology and crystallinity of the HAP powders depended on the coordination mode of the ligands. - Highlights: • HAP nanobundles and nanoparticles have been prepared by a precipitation method. • Morphologies of HAP nanocrystals were controlled by different coordination ligands. • The formation mechanism of hydroxyapatite nanocrystals was also considered.

  17. Chemically Addressable Perovskite Nanocrystals for Light-Emitting Applications

    KAUST Repository

    Sun, Haizhu; Yang, Zhenyu; Wei, Mingyang; Sun, Wei; Li, Xiyan; Ye, Shuyang; Zhao, Yongbiao; Tan, Hairen; Kynaston, Emily L.; Schon, Tyler B.; Yan, Han; Lu, Zheng-Hong; Ozin, Geoffrey A.; Sargent, Edward H.; Seferos, Dwight S.

    2017-01-01

    Whereas organic–inorganic hybrid perovskite nanocrystals (PNCs) have remarkable potential in the development of optoelectronic materials, their relatively poor chemical and colloidal stability undermines their performance in optoelectronic devices

  18. Pyridine-induced Dimensionality Change in Hybrid Perovskite Nanocrystals

    KAUST Repository

    Ahmed, Ghada H.; Yin, Jun; Bose, Riya; Sinatra, Lutfan; Alarousu, Erkki; Yengel, Emre; AlYami, Noktan; Saidaminov, Makhsud I.; Zhang, Yuhai; Hedhili, Mohamed N.; Bakr, Osman; Bredas, Jean-Luc; Mohammed, Omar F.

    2017-01-01

    of pyridine during the synthesis of methylammonium lead bromide (MAPbBr) perovskite nanocrystals can transform three-dimensional (3D) cubes into two-dimensional (2D) nanostructures. Density functional theory (DFT) calculations show that pyridine preferentially

  19. Rapid thermal synthesis of GaN nanocrystals and nanodisks

    Czech Academy of Sciences Publication Activity Database

    Sofer, Z.; Sedmidubský, D.; Huber, Š.; Šimek, P.; Šaněk, F.; Jankovský, O.; Gregorová, E.; Fiala, R.; Matějková, Stanislava; Mikulics, M.

    2013-01-01

    Roč. 15, č. 1 (2013), 1411/1-1411/7 ISSN 1388-0764 Institutional support: RVO:61388963 Keywords : gallium nitride * thermal ammonolysis * nanodisks * nanocrystals Subject RIV: CF - Physical ; Theoretical Chemistry Impact factor: 2.278, year: 2013

  20. A single molecule switch based on two Pd nanocrystals linked

    Indian Academy of Sciences (India)

    Conducting molecule; nanocrystals; scanning tunneling microscopy; negative differential resistance. Abstract. Tunneling spectroscopy measurements have been carried out on a single molecule device formed by two Pd ... Current Issue : Vol.

  1. Nonvolatile memory effect of tungsten nanocrystals under oxygen plasma treatments

    International Nuclear Information System (INIS)

    Chen, Shih-Cheng; Chang, Ting-Chang; Chen, Wei-Ren; Lo, Yuan-Chun; Wu, Kai-Ting; Sze, S.M.; Chen, Jason; Liao, I.H.; Yeh, Fon-Shan

    2010-01-01

    In this work, an oxygen plasma treatment was used to improve the memory effect of nonvolatile W nanocrystal memory, including memory window, retention and endurance. To investigate the role of the oxygen plasma treatment in charge storage characteristics, the X-ray photon-emission spectra (XPS) were performed to analyze the variation of chemical composition for W nanocrystal embedded oxide both with and without the oxygen plasma treatment. In addition, the transmission electron microscopy (TEM) analyses were also used to identify the microstructure in the thin film and the size and density of W nanocrystals. The device with the oxygen plasma treatment shows a significant improvement of charge storage effect, because the oxygen plasma treatment enhanced the quality of silicon oxide surrounding the W nanocrystals. Therefore, the data retention and endurance characteristics were also improved by the passivation.

  2. Self-aggregation of magnetic semiconductor EuS nanocrystals

    International Nuclear Information System (INIS)

    Tanaka, Atsushi; Hasegawa, Yasuchika; Kamikubo, Hironari; Kataoka, Mikio; Kawai, Tsuyoshi

    2009-01-01

    Controlled formation of aggregates having organized structure of cube-shaped EuS nanocrystals is reported. The EuS aggregates in liquid media (methanol) were obtained by means of van der Waals interaction between EuS nanocrystals. The packing structure of the EuS aggregates is characterized with transmission electron microscopy (TEM) and small angle X-ray scattering measurements (SAXS). TEM image indicates the EuS nanocrystals form self-aggregated 2D orthogonal lattice structure. The diffraction peak of (111) of SAXS profile shows that the cube-shaped EuS form 3D cubic superlattice. We successfully demonstrated that the aggregates of cube-shaped EuS nanocrystals formed cubic stacking structure.

  3. Dynamics of polyelectrolyte adsorption and colloidal flocculation upon mixing studied using mono-dispersed polystyrene latex particles

    NARCIS (Netherlands)

    Feng, Lili; Cohen Stuart, Martien; Adachi, Yasuhisa

    2015-01-01

    The dynamic behavior of polyelectrolytes just after their encounter with the surface of bare colloidal particles is analyzed, using the flocculation properties of mono-dispersed polystyrene latex (PSL) particles. Applying a Standardized Colloid Mixing (SCM) approach, effects of ionic strength and

  4. Rapid Synthesis of Highly Monodisperse Au x Ag 1− x Alloy Nanoparticles via a Half-Seeding Approach

    KAUST Repository

    Chng, Ting Ting; Polavarapu, Lakshminarayana; Xu, Qing Hua; Ji, Wei; Zeng, Hua Chun

    2011-01-01

    Gold-silver alloy AuxAg1-x is an important class of functional materials promising new applications across a wide array of technological fields. In this paper, we report a fast and facile synthetic protocol for preparation of highly monodisperse Aux

  5. Plasma-assisted synthesis of monodispersed and robust Ruthenium ultrafine nanocatalysts for organosilane oxidation and oxygen evolution reactions

    NARCIS (Netherlands)

    Gnanakumar, E.S.; Ng, W.; Filiz, B.C.; Rothenberg, G.; Wang, S.; Xu, H.; Pastor-Pérez, L.; Pastor-Blas, M.M.; Sepúlveda-Escribano, A.; Yan, N.; Shiju, N.R.

    2017-01-01

    We report a facile and general approach for preparing ultrafine ruthenium nanocatalysts by using a plasma-assisted synthesis at <100 °C. The resulting Ru nanoparticles are monodispersed (typical size 2 nm) and remain that way upon loading onto carbon and TiO2 supports. This gives robust catalysts

  6. Ultrasonic-assisted synthesis of monodisperse single-crystalline silver nanoplates and gold nanorings.

    Science.gov (United States)

    Jiang, Li-Ping; Xu, Shu; Zhu, Jian-Min; Zhang, Jian-Rong; Zhu, Jun-Jie; Chen, Hong-Yuan

    2004-09-20

    A simple sonochemical route was developed for the crystal growth of uniform silver nanoplates and ringlike gold nanocrystals in a N,N-dimethylformamide solution. The platelike structures were generated from the selective growth on different crystal planes in the presence of poly(vinylpyrrolidone) and the ultrasonic-assisted Ostwald ripening processes. The silver nanoplates in solution served as the templates for the synthesis of ringlike gold crystals via a displacement reaction. Both the silver nanoplates and gold nanorings were highly oriented single crystals with (111) planes as the basal planes. Copyright 2004 American Chemical Society

  7. Formation of colloidal semiconductor nanocrystals. The aspect of nucleation

    Energy Technology Data Exchange (ETDEWEB)

    Kudera, S.

    2007-08-17

    The present work describes different techniques to control some major parameters of colloidal nanocrystals. The individual techniques rely on the manipulation of the nucleation event. The sensitive control of the nanocrystals' size and shape is discussed. Furthermore the formation of hybrid nanocrystals composed of different materials is presented. The synthesis technique for the production of the different samples involves organic solvents and surfactants and reactions at elevated temperatures. The presence of magic size clusters offers a possibility to control the size of the nanocrystals even at very small dimensions. The clusters produced comprise ca. 100 atoms. In the case of CdSe, nanocrystals of this size emit a blue fluorescence and therefore extend the routinely accessible spectrum for this material over the whole visible range. Samples fluorescing in the spectral range from green to red are produced with standard recipes. In this work a reaction scheme for magic size clusters is presented and a theoretical model to explain the particular behaviour of their growth dynamics is discussed. The samples are investigated by optical spectroscopy, transmission electron microscopy, X-ray diffraction and elemental analysis. A method to form branched nanocrystals is discussed. The branching point is analysed by high resolution transmission electron microscopy and proves for the occurrence of a multiple twinned structure are strengthened by simulation of the observed patterns. Two different techniques to generate nanocrystals of this type are presented. The first relies on a seeded growth approach in which the nucleation of the second material is allowed only on de ned sites of the seeds. The second technique uses the tips of pre-formed nano-dumbbells as sacrificial domains. The material on the tips is replaced by gold. Hybrid materials are formed by a seeded-growth mechanism. Pre-formed nanocrystals provide the nucleation sites for the second material. (orig.)

  8. Formation of colloidal semiconductor nanocrystals. The aspect of nucleation

    Energy Technology Data Exchange (ETDEWEB)

    Kudera, S

    2007-08-17

    The present work describes different techniques to control some major parameters of colloidal nanocrystals. The individual techniques rely on the manipulation of the nucleation event. The sensitive control of the nanocrystals' size and shape is discussed. Furthermore the formation of hybrid nanocrystals composed of different materials is presented. The synthesis technique for the production of the different samples involves organic solvents and surfactants and reactions at elevated temperatures. The presence of magic size clusters offers a possibility to control the size of the nanocrystals even at very small dimensions. The clusters produced comprise ca. 100 atoms. In the case of CdSe, nanocrystals of this size emit a blue fluorescence and therefore extend the routinely accessible spectrum for this material over the whole visible range. Samples fluorescing in the spectral range from green to red are produced with standard recipes. In this work a reaction scheme for magic size clusters is presented and a theoretical model to explain the particular behaviour of their growth dynamics is discussed. The samples are investigated by optical spectroscopy, transmission electron microscopy, X-ray diffraction and elemental analysis. A method to form branched nanocrystals is discussed. The branching point is analysed by high resolution transmission electron microscopy and proves for the occurrence of a multiple twinned structure are strengthened by simulation of the observed patterns. Two different techniques to generate nanocrystals of this type are presented. The first relies on a seeded growth approach in which the nucleation of the second material is allowed only on de ned sites of the seeds. The second technique uses the tips of pre-formed nano-dumbbells as sacrificial domains. The material on the tips is replaced by gold. Hybrid materials are formed by a seeded-growth mechanism. Pre-formed nanocrystals provide the nucleation sites for the second material. (orig.)

  9. DNA-imprinted polymer nanoparticles with monodispersity and prescribed DNA-strand patterns

    Science.gov (United States)

    Trinh, Tuan; Liao, Chenyi; Toader, Violeta; Barłóg, Maciej; Bazzi, Hassan S.; Li, Jianing; Sleiman, Hanadi F.

    2018-02-01

    As colloidal self-assembly increasingly approaches the complexity of natural systems, an ongoing challenge is to generate non-centrosymmetric structures. For example, patchy, Janus or living crystallization particles have significantly advanced the area of polymer assembly. It has remained difficult, however, to devise polymer particles that associate in a directional manner, with controlled valency and recognition motifs. Here, we present a method to transfer DNA patterns from a DNA cage to a polymeric nanoparticle encapsulated inside the cage in three dimensions. The resulting DNA-imprinted particles (DIPs), which are 'moulded' on the inside of the DNA cage, consist of a monodisperse crosslinked polymer core with a predetermined pattern of different DNA strands covalently 'printed' on their exterior, and further assemble with programmability and directionality. The number, orientation and sequence of DNA strands grafted onto the polymeric core can be controlled during the process, and the strands are addressable independently of each other.

  10. Monodisperse, submicrometer-scale platinum colloidal spheres with high electrocatalytic activity

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Lixue; Wang, Liang; Guo, Shaojun; Zhai, Junfeng; Dong, Shaojun; Wang, Erkang [State Key Laboratory of Electroanalytical Chemistry, Changchun Institute of Applied Chemistry, Chinese Academy of Sciences, Graduate School of the Chinese Academy of Sciences, 130022 Jilin, Changchun (China)

    2009-02-15

    Monodisperse, submicrometer-scale platinum (Pt) colloidal spheres were prepared through a simple direct chemical reduction of p-phenylenediamine (PPD)-chloroplatinic acid (H{sub 2}PtCl{sub 6}) coordination polymer colloids. It was found that the prepared Pt colloids had the similar size and morphology with their coordination polymer precursors, and the prepared Pt colloids with rough surfaces were three-dimensional (3D) structured assemblies of high-density small Pt nanoparticles. The electrochemical experiments confirmed that the prepared Pt colloids possessed a high electrocatalytic activity towards mainly four-electron reduction of dioxygen to water, making the prepared Pt colloids potential candidates for the efficient cathode material in fuel cells. (author)

  11. Synthesis of Monodisperse Walnut-Like SnO2 Spheres and Their Photocatalytic Performances

    Directory of Open Access Journals (Sweden)

    Jing Wang

    2015-01-01

    Full Text Available Novel walnut-like SnO2 spheres have been synthesized using a one-step hydrothermal reaction with SnCl2·2H2O and KOH as raw materials. The morphology, microstructure, and optical properties of the products were characterized by X-ray powder diffraction (XRD, Raman spectrum, scanning electron microscopy (SEM, transmission electron microscopy (TEM, selected area electron diffraction (SAED, and ultraviolet-visible (UV-Vis absorption spectroscopy. The detailed studies revealed that these synthesized spheres are highly monodisperse and have a uniform size of approximately 250 nm. Photocatalytic activity of the prepared SnO2 spheres was evaluated by the degradation of methylene orange. The synthesized SnO2 spheres exhibited excellent photocatalytic degradation. In addition, a possible formation mechanism of the walnut-like nanostructures was proposed based on reaction time-dependent experiments.

  12. Synthesis of monodispersed silver nanoparticles using Hibiscus cannabinus leaf extract and its antimicrobial activity

    Science.gov (United States)

    Bindhu, M. R.; Umadevi, M.

    2013-01-01

    Synthesis of silver nanoparticles using leaf extract of Hibiscus cannabinus has been investigated. The influences of different concentration of H. cannabinus leaf extract, different metal ion concentration and different reaction time on the above cases on the synthesis of nanoparticles were evaluated. The synthesized nanoparticles were characterized using UV-vis spectroscopy, Fourier transform infrared spectroscopy (FTIR), X-ray diffraction (XRD) and Transmission Electron Microscopy (TEM). The prepared silver nanoparticles were monodispersed, spherical in shape with the average particle size of 9 nm and shows surface plasmon peak at 446 nm. The study also reveals that the ascorbic acid present in H. cannabinus leaf extract has been used as reducing agent. The prepared silver nanoparticle shows good antimicrobial activity against Escherichia coli, Proteus mirabilis and Shigella flexneri.

  13. Monodispersed ZIF-8 particles with enhanced performance for CO2 adsorption and heterogeneous catalysis

    Science.gov (United States)

    Guan, Yebin; Shi, Juanjuan; Xia, Ming; Zhang, Jun; Pang, Zhenfeng; Marchetti, Alessandro; Wang, Xiaohong; Cai, Jingsong; Kong, Xueqian

    2017-11-01

    Monodispersed zeolitic imidazolate frameworks (ZIFs) were prepared with a simple method using dimethylsulfoxide (DMSO) as solvent. This method yields ZIF-8 nanoparticles with a narrow particle size distribution of 90-110 nm and the dispersion is highly stable against agglomeration. These particles have larger nanosized porosity and enhanced CO2 adsorption capability compared to ZIF-8 prepared with different solvents such as methanol or N, N-dimethyl formamide. Their uniform size and surface chemistry also lead to superior performance in the Knoevenagel condensation reactions. The ZIF-8 nanoparticles possess high thermal stability up to 550 °C and the preparation steps are easy for scaling up which are favorable for industrial applications.

  14. Microscopy evidence of the face-centered cubic arrangement of monodisperse polystyrene nanospheres

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Hui [School of Science, Beijing Jiaotong University, Beijing 100044 (China)]. E-mail: zhanghui14305@sohu.com; Duan Renguan [Los Alamos National Laboratory, Los Alamos, NM 87545 (United States); Li Fan [Department of Physical Chemistry, University of Science and Technology Beijing, Beijing 100083 (China); Tang Qing [Institute of Process Engineering, Chinese Academy of Sciences, Beijing 100080 (China); Li Wenchao [Department of Physical Chemistry, University of Science and Technology Beijing, Beijing 100083 (China)

    2007-07-01

    This paper reports a scanning electron microscopy (SEM) investigation of polystyrene artificial opal achieved through self-assembly of monodisperse polystyrene nanospheres with a diameter of 250 nm from colloidal suspension after being ambient dried. A detailed analysis of the SEM images verifies that the face-centered cubic (fcc) phase is the most stable one for the polystyrene opal prepared. This finding provides a strong support for, by using polystyrene opal as template, fabricating a photonic crystal with inverse fcc structure of full band gap if the refractive index contrast is higher than 2.8 and the filling fraction of the high index materials is between 0.2 and 0.3.

  15. Microscopy evidence of the face-centered cubic arrangement of monodisperse polystyrene nanospheres

    International Nuclear Information System (INIS)

    Zhang Hui; Duan Renguan; Li Fan; Tang Qing; Li Wenchao

    2007-01-01

    This paper reports a scanning electron microscopy (SEM) investigation of polystyrene artificial opal achieved through self-assembly of monodisperse polystyrene nanospheres with a diameter of 250 nm from colloidal suspension after being ambient dried. A detailed analysis of the SEM images verifies that the face-centered cubic (fcc) phase is the most stable one for the polystyrene opal prepared. This finding provides a strong support for, by using polystyrene opal as template, fabricating a photonic crystal with inverse fcc structure of full band gap if the refractive index contrast is higher than 2.8 and the filling fraction of the high index materials is between 0.2 and 0.3

  16. A novel approach for preparation of micrometer-sized, monodisperse dimple and hemispherical polystyrene particles.

    Science.gov (United States)

    Tanaka, Takuya; Komatsu, Yoshifumi; Fujibayashi, Teruhisa; Minami, Hideto; Okubo, Masayoshi

    2010-03-16

    Micrometer-sized, monodisperse dimple and hemispherical polystyrene (PS) particles were successfully prepared by heating (55-70 degrees C) of spherical PS particles dispersed in methanol/water media (40/60 to 80/20, w/w) in the presence of decane droplets, and subsequent cooling down to room temperature. Decane was absorbed by the PS particles during the heating process. Decane-absorbed PS particles phase-separated into PS and decane phases in the inside during the cooling process, and eventually dimple and/or hemispherical particles were formed by removal of the decane phase from phase-separated PS/decane particles by evaporation. The size of the dimple, which is determined by the volume of decane phase-separated from decane-absorbed PS particles during the cooling process, increased with increases in the heating temperature and the methanol content.

  17. Measurement and interpretation of growth and evaporation of monodispersed droplets in a shock tube

    Science.gov (United States)

    Peters, F.; Paikert, B.

    1994-01-01

    A special gasdynamic shock tube process in combination with a Mie light scattering method is used to study growth and subsequent evaporation of monodispersed droplets carried in argon or air. The droplets are generated by homogeneous nucleation and observed in the micrometer range (0.15-6 micrometer radius). Droplet concentrations range from 10-1000/cu mm. Four different substances, i.e. water, n-propanol, methanol and n-hexane are tested for a wide range of properties. A model covering the entire range between large (Kn much greater than 1) and small Knudsen numbers (K much less than 1) is applied to interpret the experimental data. Excellent agreement is found.

  18. Extracellular biosynthesis of monodispersed gold nanoparticles by a SAM capping route

    Science.gov (United States)

    Wen, Li; Lin, Zhonghua; Gu, Pingying; Zhou, Jianzhang; Yao, Bingxing; Chen, Guoliang; Fu, Jinkun

    2009-02-01

    Monodispersed gold nanoparticles capped with a self-assembled monolayer of dodecanethiol were biosynthesized extracellularly by an efficient, simple, and environmental friendly procedure, which involved the use of Bacillus megatherium D01 as the reducing agent and the use of dodecanethiol as the capping ligand at 26 °C. The kinetics of gold nanoparticle formation was followed by transmission electron microscope (TEM) and UV-vis spectroscopy. It was shown that reaction time was an important parameter in controlling the morphology of gold nanoparticles. The effect of thiol on the shape, size, and dispersity of gold nanoparticles was also studied. The results showed that the presence of thiol during the biosynthesis could induce the formation of small size gold nanoparticles (gold nanoparticles capped with thiol of 1.9 ± 0.8 nm size were formed by using Bacillus megatherium D01.

  19. Synthesis of monodispersed silver nanoparticles using Hibiscus cannabinus leaf extract and its antimicrobial activity.

    Science.gov (United States)

    Bindhu, M R; Umadevi, M

    2013-01-15

    Synthesis of silver nanoparticles using leaf extract of Hibiscus cannabinus has been investigated. The influences of different concentration of H. cannabinus leaf extract, different metal ion concentration and different reaction time on the above cases on the synthesis of nanoparticles were evaluated. The synthesized nanoparticles were characterized using UV-vis spectroscopy, Fourier transform infrared spectroscopy (FTIR), X-ray diffraction (XRD) and Transmission Electron Microscopy (TEM). The prepared silver nanoparticles were monodispersed, spherical in shape with the average particle size of 9 nm and shows surface plasmon peak at 446 nm. The study also reveals that the ascorbic acid present in H. cannabinus leaf extract has been used as reducing agent. The prepared silver nanoparticle shows good antimicrobial activity against Escherichia coli, Proteus mirabilis and Shigella flexneri. Copyright © 2012 Elsevier B.V. All rights reserved.

  20. Production and characterization of monodisperse uranium particles for nuclear safeguards applications

    International Nuclear Information System (INIS)

    Knott, Alexander

    2016-01-01

    Environmental sampling is a very effective measure to detect undeclared nuclear activities. Generally, samples are taken as swipe samples on cotton. These swipes contain minute quantities of particulates which have an inherent signature of their production and release scenario. These inspection samples are assessed for their morphology, elemental composition and their isotopic vectors. Mass spectrometry plays a crucial role in determining the isotopic ratios of uranium. Method validation and instrument calibration with well-characterized quality control (QC)-materials, reference materials (RMs) and certified reference materials (CRMs) ensures reliable data output. Currently, the availability of suitable well defined microparticles containing uranium and plutonium reference materials is very limited. Primarily, metals, oxides and various uranium and plutonium containing solutions are commercially available. Therefore, the IAEA's Safeguards Analytical Services (SGAS) cooperates with the Institute of Nuclear Waste Management and Reactor Safety (IEK-6) at the Forschungszentrum Juelich GmbH in a joint task entitled ''Production of Particle Reference Materials''. The work presented in this thesis has been partially funded by the IAEA, Forschungszentrum Juelich GmbH and the Federal Ministry of Economic Affairs and Energy (BMWi) through the ''Joint Program on the Technical Development and Further Improvement of IAEA Safeguards between the Government of the Federal Republic of Germany and the IAEA''. The first step towards monodisperse microparticles was the development of pure uranium oxide particles made from certified reference materials. The focus of the dissertation is (1) the implementation of a working setup to produce monodisperse uranium oxide particles and (2) the characterization of these particles towards the application as QC-material. Monodisperse uranium oxide particles were produced by spray pyrolysis. It was demonstrated that the particle size can be

  1. One-pot template-free synthesis of monodisperse hollow hydrogel microspheres and their resulting properties.

    Science.gov (United States)

    Lim, Hyung-Seok; Kwon, Eunji; Lee, Moonjoo; Moo Lee, Young; Suh, Kyung-Do

    2013-08-01

    Monodisperse poly(methacrylic acid/ethyleneglycoldimethacrylate) (MAA/EGDMA) hollow microcapsules, which exhibit pH-responsive behavior, are prepared by diffusion of cationic surfactants and hydrophobic interaction. During the association of the negatively charged hydrogel microspheres and an oppositely charged surfactant (cetyltrimethylammonium bromide, CTA(+)B), the hydrophobic polymer-surfactant complexes that form are separated from the internal water; consequently, a hollow structure can be formed. Confocal laser scanning microscopy, UV spectro-scopy and zeta potential are employed to study the formation of the hollow structure during the diffusion of the cationic surfactant. The controlled release behavior of methylene blue as a model drug from the as-prepared poly(MAA/EGDMA) microcapsules with a hollow structure is investigated under different pH conditions. The hollow structure can be retained, even during repetitive pH changes. © 2013 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  2. A Convenient and Templated Method for the Fabrication of Monodisperse Micrometer Hollow Titania Spheres

    Directory of Open Access Journals (Sweden)

    Haibo Yao

    2013-01-01

    Full Text Available A simple and widely applicable methodology was presented to synthesize monodisperse micrometer hollow titania spheres (HTS based on the templating method. It was performed by using the preformed poly(styrene-acrylic acid (PSA as template spheres which was mixed with tetrabutyltitanate (TBOT in an ethanol solvent under steam treatment. The HTS which were obtained by the calcination of PSA/TiO2 composite core-shell spheres had a narrow particle size distribution and commendable surface topography characterized by SEM. The calcined HTS at 500°C displayed crystalline reflection peaks that were characteristic to the anatase phase by XRD. Moreover, some key influencing factors including TBOT concentration and reaction time were analyzed. As expected, the diameter of HTS could be readily controlled by altering the size of PSA template spheres. In addition, the approach was also applied to fabricate hollow zirconia spheres and other inorganic spheres.

  3. Parameterizing the competition between homogeneous and heterogeneous freezing in cirrus cloud formation – monodisperse ice nuclei

    Directory of Open Access Journals (Sweden)

    D. Barahona

    2009-01-01

    Full Text Available We present a parameterization of cirrus cloud formation that computes the ice crystal number and size distribution under the presence of homogeneous and heterogeneous freezing. The parameterization is very simple to apply and is derived from the analytical solution of the cloud parcel equations, assuming that the ice nuclei population is monodisperse and chemically homogeneous. In addition to the ice distribution, an analytical expression is provided for the limiting ice nuclei number concentration that suppresses ice formation from homogeneous freezing. The parameterization is evaluated against a detailed numerical parcel model, and reproduces numerical simulations over a wide range of conditions with an average error of 6±33%. The parameterization also compares favorably against other formulations that require some form of numerical integration.

  4. XAFS studies of monodisperse Au nanoclusters formation in the etching process

    International Nuclear Information System (INIS)

    Yang, Lina; Huang, Ting; Liu, Wei; Bao, Jie; Huang, Yuanyuan; Cao, Yuanjie; Yao, Tao; Sun, Zhihu; Wei, Shiqiang

    2016-01-01

    Understanding the formation mechanism of gold nanoclusters is essential to the development of their synthetic chemistry. Here, by using x-ray absorption fine-structure (XAFS) spectroscopy, UV-Vis and MS spectra, the formation process of monodisperse Au 13 nanoclusters is investigated. We find that a critical step involving the formation of smaller Au 8 -Au 11 metastable intermediate clusters induced by the HCl + HSR etching of the polydisperse Au n precursor clusters occurs firstly. Then these intermediate species undergo a size-growth to Au 13 cores, followed by a slow structure rearrangement to reach the final stable structure. This work enriches the understanding of cluster formation chemistry and may guide the way towards the design and the controllable synthesis of nanoclusters. (paper)

  5. Straightforward and robust synthesis of monodisperse surface-functionalized gold nanoclusters

    Directory of Open Access Journals (Sweden)

    Silvia Varela-Aramburu

    2016-09-01

    Full Text Available Gold nanoclusters are small (1–3 nm nanoparticles with a high surface area that are useful for biomedical studies and drug delivery. The synthesis of small, surface-functionalized gold nanoclusters is greatly dependent on the reaction conditions. Here, we describe a straightforward, efficient and robust room temperature one-pot synthesis of 2 nm gold nanoclusters using thioglucose as a reducing and stabilizing agent, which was discovered by serendipity. The resultant monodisperse gold nanoclusters are more stable than those generated using some other common methods. The carboxylic acid contained in the stabilizing agent on the cluster surface serves as anchor for nanocluster functionalization. Alternatively, the addition of thiols serves to functionalize the nanoclusters. The resulting non-cytotoxic nanoclusters are taken up by cells and constitute a tuneable platform for biomedical applications including drug delivery.

  6. Experimental mixture design as a tool for the synthesis of antimicrobial selective molecularly imprinted monodisperse microbeads.

    Science.gov (United States)

    Benito-Peña, Elena; Navarro-Villoslada, Fernando; Carrasco, Sergio; Jockusch, Steffen; Ottaviani, M Francesca; Moreno-Bondi, Maria C

    2015-05-27

    The effect of the cross-linker on the shape and size of molecular imprinted polymer (MIP) beads prepared by precipitation polymerization has been evaluated using a chemometric approach. Molecularly imprinted microspheres for the selective recognition of fluoroquinolone antimicrobials were prepared in a one-step precipitation polymerization procedure using enrofloxacin (ENR) as the template molecule, methacrylic acid as functional monomer, 2-hydroxyethyl methacrylate as hydrophilic comonomer, and acetonitrile as the porogen. The type and amount of cross-linker, namely ethylene glycol dimethacrylate, divinylbenzene or trimethylolpropane trimethacrylate, to obtain monodispersed MIP spherical beads in the micrometer range was optimized using a simplex lattice design. Particle size and morphology were assessed by scanning electron microscopy, dynamic light scattering, and nitrogen adsorption measurements. Electron paramagnetic resonance spectroscopy in conjunction with a nitroxide as spin probe revealed information about the microviscosity and polarity of the binding sites in imprinted and nonimprinted polymer beads.

  7. Inhibition of palm oil oxidation by zeolite nanocrystals.

    Science.gov (United States)

    Tan, Kok-Hou; Awala, Hussein; Mukti, Rino R; Wong, Ka-Lun; Rigaud, Baptiste; Ling, Tau Chuan; Aleksandrov, Hristiyan A; Koleva, Iskra Z; Vayssilov, Georgi N; Mintova, Svetlana; Ng, Eng-Poh

    2015-05-13

    The efficiency of zeolite X nanocrystals (FAU-type framework structure) containing different extra-framework cations (Li(+), Na(+), K(+), and Ca(2+)) in slowing the thermal oxidation of palm oil is reported. The oxidation study of palm oil is conducted in the presence of zeolite nanocrystals (0.5 wt %) at 150 °C. Several characterization techniques such as visual analysis, colorimetry, rheometry, total acid number (TAN), FT-IR spectroscopy, (1)H NMR spectroscopy, and Karl Fischer analyses are applied to follow the oxidative evolution of the oil. It was found that zeolite nanocrystals decelerate the oxidation of palm oil through stabilization of hydroperoxides, which are the primary oxidation product, and concurrently via adsorption of the secondary oxidation products (alcohols, aldehydes, ketones, carboxylic acids, and esters). In addition to the experimental results, periodic density functional theory (DFT) calculations are performed to elucidate further the oxidation process of the palm oil in the presence of zeolite nanocrystals. The DFT calculations show that the metal complexes formed with peroxides are more stable than the complexes with alkenes with the same ions. The peroxides captured in the zeolite X nanocrystals consequently decelerate further oxidation toward formation of acids. Unlike the monovalent alkali metal cations in the zeolite X nanocrystals (K(+), Na(+), and Li(+)), Ca(2+) reduced the acidity of the oil by neutralizing the acidic carboxylate compounds to COO(-)(Ca(2+))1/2 species.

  8. Size- and shape-dependent surface thermodynamic properties of nanocrystals

    Science.gov (United States)

    Fu, Qingshan; Xue, Yongqiang; Cui, Zixiang

    2018-05-01

    As the fundamental properties, the surface thermodynamic properties of nanocrystals play a key role in the physical and chemical changes. However, it remains ambiguous about the quantitative influence regularities of size and shape on the surface thermodynamic properties of nanocrystals. Thus by introducing interface variables into the Gibbs energy and combining Young-Laplace equation, relations between the surface thermodynamic properties (surface Gibbs energy, surface enthalpy, surface entropy, surface energy and surface heat capacity), respectively, and size of nanocrystals with different shapes were derived. Theoretical estimations of the orders of the surface thermodynamic properties of nanocrystals agree with available experimental values. Calculated results of the surface thermodynamic properties of Au, Bi and Al nanocrystals suggest that when r > 10 nm, the surface thermodynamic properties linearly vary with the reciprocal of particle size, and when r < 10 nm, the effect of particle size on the surface thermodynamic properties becomes greater and deviates from linear variation. For nanocrystals with identical equivalent diameter, the more the shape deviates from sphere, the larger the surface thermodynamic properties (absolute value) are.

  9. Cellulose nanocrystals from acacia bark-Influence of solvent extraction.

    Science.gov (United States)

    Taflick, Ticiane; Schwendler, Luana A; Rosa, Simone M L; Bica, Clara I D; Nachtigall, Sônia M B

    2017-08-01

    The isolation of cellulose nanocrystals from different lignocellulosic materials has shown increased interest in academic and technological research. These materials have excellent mechanical properties and can be used as nanofillers for polymer composites as well as transparent films for various applications. In this work, cellulose isolation was performed following an environmental friendly procedure without chlorine. Cellulose nanocrystals were isolated from the exhausted acacia bark (after the industrial process of extracting tannin) with the objective of evaluating the effect of the solvent extraction steps on the characteristics of cellulose and cellulose nanocrystals. It was also assessed the effect of acid hydrolysis time on the thermal stability, morphology and size of the nanocrystals, through TGA, TEM and light scattering analyses. It was concluded that the extraction step with solvents was important in the isolation of cellulose, but irrelevant in the isolation of cellulose nanocrystals. Light scattering experiments indicated that 30min of hydrolysis was long enough for the isolation of cellulose nanocrystals. Copyright © 2017 Elsevier B.V. All rights reserved.

  10. Effect of protic solvents on CdS thin films prepared by chemical bath deposition

    Energy Technology Data Exchange (ETDEWEB)

    Yao, Pin-Chuan, E-mail: pcyao@mail.dyu.edu.tw; Chen, Chun-Yu

    2015-03-31

    In this study, cadmium sulfide (CdS) thin films are grown on glass substrates by chemical bath deposition (CBD) in an aqueous bath containing 10–20 vol.% alcohol. The roles of ethanol as a protic solvent that substantially improves the quality of films are explored extensively. The deposited films in an alcohol bath are found to be more compact and smoother with smaller CdS grains. The X-ray diffractograms of the samples confirm that all films were polycrystalline with mixed wurtzite (hexagonal) and zinkblende (cubic) phases. Raman spectra indicate that, for a film deposited in an alcohol bath, the position of 1LO is closer to the value for single crystal CdS, indicating that these films have a high degree of crystallinity. The as-deposited CdS thin films in a 10 vol.% alcohol bath were found to have the highest visible transmittance of 81.9%. XPS analysis reveals a stronger signal of C1s for samples deposited in the alcohol baths, indicating that there are more carbonaceous residues on the films with protic solvent than on the films with water. A higher XPS S/Cd atomic ratio for films deposited in an alcohol bath indicates that undesirable surface reactions (leading to sulfur containing compounds other than CdS) occur less frequently over the substrates. - Highlights: • Study of CBD-CdS films grown in an alcohol-containing aqueous bath is reported. • The deposited films in an alcohol bath are more compact with smaller CdS grains. • Raman spectra show that in an alcohol bath, the CdS film has a better crystallinity. • XPS reveals more carbon residues remain on the films deposited using alcohol bath. • In an alcohol bath, the undesirable surface reactions with Cd ions were hindered.

  11. Solution precursor plasma deposition of nanostructured CdS thin films

    International Nuclear Information System (INIS)

    Tummala, Raghavender; Guduru, Ramesh K.; Mohanty, Pravansu S.

    2012-01-01

    Highlights: ► Inexpensive process with capability to produce large scale nanostructured coatings. ► Technique can be employed to spray the coatings on any kind of substrates including polymers. ► The CdS coatings developed have good electrical conductivity and optical properties. ► Coatings possess large amount of particulate boundaries and nanostructured grains. -- Abstract: Cadmium sulfide (CdS) films are used in solar cells, sensors and microelectronics. A variety of techniques, such as vapor based techniques, wet chemical methods and spray pyrolysis are frequently employed to develop adherent CdS films. In the present study, rapid deposition of CdS thin films via plasma spray route using a solution precursor was investigated, for the first time. Solution precursor comprising cadmium chloride, thiourea and distilled water was fed into a DC plasma jet via an axial atomizer to create ultrafine droplets for instantaneous and accelerated thermal decomposition in the plasma plume. The resulting molten/semi-molten ultrafine/nanoparticles of CdS eventually propel toward the substrate to form continuous CdS films. The chemistry of the solution precursor was found to be critical in plasma pyrolysis to control the stoichiometry and composition of the films. X-ray diffraction studies confirmed hexagonal α-CdS structure. Surface morphology and microstructures were investigated to compare with other synthesis techniques in terms of process mechanism and structural features. Transmission electron microscopy studies revealed nanostructures in the atomized particulates. Optical measurements indicated a decreasing transmittance in the visible light with increasing the film thickness and band gap was calculated to be ∼2.5 eV. The electrical resistivity of the films (0.243 ± 0.188 × 10 5 Ω cm) was comparable with the literature values. These nanostructured polycrystalline CdS films could be useful in sensing and solar applications.

  12. Solution precursor plasma deposition of nanostructured CdS thin films

    Energy Technology Data Exchange (ETDEWEB)

    Tummala, Raghavender [Department of Mechanical Engineering, University of Michigan, Dearborn, MI 48128 (United States); Guduru, Ramesh K., E-mail: rkguduru@umich.edu [Department of Mechanical Engineering, University of Michigan, Dearborn, MI 48128 (United States); Mohanty, Pravansu S. [Department of Mechanical Engineering, University of Michigan, Dearborn, MI 48128 (United States)

    2012-03-15

    Highlights: Black-Right-Pointing-Pointer Inexpensive process with capability to produce large scale nanostructured coatings. Black-Right-Pointing-Pointer Technique can be employed to spray the coatings on any kind of substrates including polymers. Black-Right-Pointing-Pointer The CdS coatings developed have good electrical conductivity and optical properties. Black-Right-Pointing-Pointer Coatings possess large amount of particulate boundaries and nanostructured grains. -- Abstract: Cadmium sulfide (CdS) films are used in solar cells, sensors and microelectronics. A variety of techniques, such as vapor based techniques, wet chemical methods and spray pyrolysis are frequently employed to develop adherent CdS films. In the present study, rapid deposition of CdS thin films via plasma spray route using a solution precursor was investigated, for the first time. Solution precursor comprising cadmium chloride, thiourea and distilled water was fed into a DC plasma jet via an axial atomizer to create ultrafine droplets for instantaneous and accelerated thermal decomposition in the plasma plume. The resulting molten/semi-molten ultrafine/nanoparticles of CdS eventually propel toward the substrate to form continuous CdS films. The chemistry of the solution precursor was found to be critical in plasma pyrolysis to control the stoichiometry and composition of the films. X-ray diffraction studies confirmed hexagonal {alpha}-CdS structure. Surface morphology and microstructures were investigated to compare with other synthesis techniques in terms of process mechanism and structural features. Transmission electron microscopy studies revealed nanostructures in the atomized particulates. Optical measurements indicated a decreasing transmittance in the visible light with increasing the film thickness and band gap was calculated to be {approx}2.5 eV. The electrical resistivity of the films (0.243 {+-} 0.188 Multiplication-Sign 10{sup 5} {Omega} cm) was comparable with the literature

  13. Nano-architecture based photoelectrochemical water oxidation efficiency enhancement by CdS photoanodes

    Science.gov (United States)

    Pareek, Alka; Kim, Hyun Gyu; Paik, Pradip; Joardar, Joydip; Borse, Pramod H.

    2017-02-01

    In the present work, 2D nanostructuring has been utilized to impart an efficiency improvement to the hexagonal phase CdS films for the photoelectrochemical (PEC) cells those were deposited by spray pyrolysis technique. By controlling the aerosol droplet- size, population and impingement time during the spray pyrolysis deposition, various nano-features viz. randomly aligned nanorods, nanotubes and nanowires of CdS has been demonstrated for the first time. A growth mechanism has been proposed to predict the temporal evolution of the nanostructures. The prominent nanoscale structures show improved optical properties in the visible range of solar spectrum. The structural studies validate the morphological differences of nanostructures in terms of the texture coefficient analysis as well as 2D micro x-ray diffraction imaging. Electrochemical characterization is carried out to understand the effect of nanostructuring on the PEC performance of the CdS photoanodes in the sulphide (0.1 M Na2S  +  0.02 M Na2SO3) electrolyte at applied bias of 0.2 V (versus SCE). The evolution of morphology from randomly aligned rods to nanowire is responsible for improved photocurrent (3.5 times). CdS film morphology can be tuned to nanotubes, nano- rose buds and nanorod bunches even by doping Zn2+ ions in CdS lattice. Nano-structuring of doped CdS has shown enhanced performance of the photoanodes. The nanotubes structures yielded highest photocurrent density of 1.6 mA cm-2. Whereas modifying the 2D-nanostructured CdS film by simple MoO3 spray coating yields the photocurrent enhancement to 2.1 mA cm-2.

  14. Photoelectrochemical performance of DSSC with monodisperse and polydisperse ZnO SPs

    Energy Technology Data Exchange (ETDEWEB)

    Wahyuono, Ruri Agung, E-mail: r-agung-w@ep.its.ac.id; Risanti, Doty D., E-mail: r-agung-w@ep.its.ac.id [Department of Engineering Physics, Institut Teknologi Sepuluh Nopember (Indonesia); Shirosaki, Tomohiro; Nagaoka, Shoji [Kumamoto Industrial Research Institute (Japan); Takafuji, Makoto; Ihara, Hirotaka [Department of Applied Chemistry and Biochemistry, Kumamoto University (Japan)

    2014-02-24

    Zinc oxide, ZnO, is one of oxide semiconductors being used in DSSC. ZnO is promising material for having fairly higher energy band gap and much higher bulk electron mobility than that of anatase TiO{sub 2}, the most widely used semiconductor for DSSC photoelectrode. This study introduces the synthesis of ZnO by precipitation method. The synthesis involves ZnAc dihydrate and diethylene glycol (DEG) for the chemicals. Various size of ZnO spherical particles (SPs) are obtained in polydisperse and monodisperse particles. Monolayer and bilayer DSSCs are fabricated in sandwich structure and sensitized with N719 dye for 3 and 5 hours. Monolayer DSSC using monodisperse particles (422 nm) is able to generate highest conversion efficiency of 0.569% (V{sub oc} = 541.3 mV, J{sub sc} = 1.92 mA/cm{sup 2}, and fill factor of 54.78%). Bilayer DSSC, i.e. combined 422 - 185 nm ZnO layer, can optimize the photocurrent action spectra in UV regime leading to high conversion efficiency of 0.568 (V{sub oc} = 568.2 mV, J{sub sc} = 2.22 mA/cm{sup 2}, and fill factor of 47.25%). The longer sensitizing time does not always produce better conversion efficiency since it can induce the dissolution of Zn atoms and formation of Zn{sup 2+} - dye resisting the electron transport from dye to ZnO photoelectrode.

  15. Highly sensitive glucose sensor based on monodisperse palladium nickel/activated carbon nanocomposites.

    Science.gov (United States)

    Koskun, Yağmur; Şavk, Aysun; Şen, Betül; Şen, Fatih

    2018-06-20

    Glucose enzyme biosensors have been used for a variety of applications such as medical diagnosis, bioprocess engineering, beverage industry and environmental scanning etc. and there is still a growing interest in glucose sensors. For this purpose, addressed herein, as a novel glucose sensor, highly sensitive activated carbon (AC) decorated monodisperse nickel and palladium alloy nanocomposites modified glassy carbon electrode (Ni-Pd@AC/GCE NCs) have been synthesized by in-situ reduction technique. Raman Spectroscopy (RS), X-ray Photoelectron Spectroscopy (XPS), X-ray Diffraction (XRD), Transmission Electron Microscopy (TEM), cyclic voltammetry (CV) and chronoamperometry (CA) were used for the characterization of the prepared non-enzymatic glucose sensor. The characteristic sensor properties of the Ni-Pd@AC/GCE electrode were compared with Ni-Pd NCs/GCE, Ni@AC/GCE and Pd@AC/GCE and the results demonstrate that the AC is very effective in the enhancement of the electrocatalytic properties of sensor. In addition, the Ni-Pd@AC/GCE nanocomposites showed a very low detection limit of 0.014 μM, a wide linear range of 0.01 mM-1 mM and a very high sensitivity of 90 mA mM -1  cm -2 . Furthermore, the recommended sensor offer the various advantageous such as facile preparation, fast response time, high selectivity and sensitivity. Lastly, monodisperse Ni-Pd@AC/GCE was utilized to detect glucose in real sample species. Copyright © 2018 Elsevier B.V. All rights reserved.

  16. Production of monodispersed Oil-in Water Emulsion Using Crossflow-Type Silicon Microchannel Plate

    Energy Technology Data Exchange (ETDEWEB)

    Kawakatsu, Takahiro.; Komori, Hideaki.; Yonemoto, Toshikuni. [Tohoku University, Miyagi (Japan). Chemical Engineering Department; Nakajima, Mitsutoshi.; Kikuchi, Yuji. [National Food Research Institute, Ibaraki (Japan)

    1999-04-01

    A novel method for continuous productin of monodispersed oil-in-water (O/W) emulsion is developed using acrossflow-type silicaon microchannel plate. On the single crystal silicon plate, a liquid flow path for continuous phase was made, and at each side of th wall of the path an array of regular-sized slits was precisely fabricated. A flat glass plate was tightly attached on the microchannel plate to cover the top of the slits to form the array of microchannels. Regular-sized oil (triolein) droplets were generated by squeezing the oil through the microchannels into the continuous-phase water (0.3 wt% sodium lauryl sulfate solutin) flowing in the liquid path. Oil droplet size is significantly dependent on the microchannel structure, which is identified with the microchannel width, height, and the length of the terrace (a flat area at the microchannel outlet). Three types of microchannel plates having different microchannel structures generate monodispersed emulsions of different average droplet sizes, 16,20, and 48 {mu}m at the watr flow rate of 1.4x10{sup -2}mL{center_dot}min{sup -1}. For the microchannel plate which generates large droplets of 48 {mu}m, increasing the flow rate causes decreasing droplet size. However, for the microchannel plate which generates small droplets of 16 or 20 {mu}m, the size is not affected by the flow rate within the range from 1.4x10{sup -2}to 2.4 mL{center_dot}min{sup -1}. In every case, the droplet size distribution is narrow, and the geometric standard deviation is 1.03 or less. (author)

  17. Controlled synthesis of monodisperse gold nanorods with different aspect ratios in the presence of aromatic additives

    Energy Technology Data Exchange (ETDEWEB)

    Wang, Yun; Wang, Feihu [Shanghai Jiao Tong University, School of Pharmacy (China); Guo, Yuan [University of Leeds, School of Chemistry and Astbury Centre for Structural Molecular Biology (United Kingdom); Chen, Rongjun, E-mail: rongjun.chen@imperial.ac.uk [Imperial College London, Department of Chemical Engineering (United Kingdom); Shen, Yuanyuan; Guo, Aijie; Liu, Jieying; Zhang, Xiao [Shanghai Jiao Tong University, School of Pharmacy (China); Zhou, Dejian, E-mail: d.zhou@leeds.ac.uk [University of Leeds, School of Chemistry and Astbury Centre for Structural Molecular Biology (United Kingdom); Guo, Shengrong, E-mail: srguo@sjtu.edu.cn [Shanghai Jiao Tong University, School of Pharmacy (China)

    2014-12-15

    This paper reports the synthesis of monodisperse gold nanorods (GNRs) via a simple seeded growth approach in the presence of different aromatic additives, such as 7-bromo-3-hydroxy-2-naphthoic acid (7-BrHNA), 3-hydroxy-2-naphthoic acid (HNA), 5-bromosalicylic acid (5-BrSA), salicylic acid (SA), or phenol (PhOH). Effects of the aromatic additives and hydrochloric acid (HCl) on the structure and optical properties of the synthesized GNRs were investigated. The longitudinal surface plasmon resonance (LSPR) peak wavelength of the resulting GNRs was found to be dependent on the aromatic additive in the following sequence: 5-BrSA (778 nm) > 7-BrHNA (706 nm) > SA (688 nm) > HNA (676 nm) > PhOH (638 nm) without the addition of HCl, but this was changed to 7-BrHNA (920 nm) > SA (890 nm) > HNA (872 nm) > PhOH (858 nm) > 5-BrSA (816 nm) or 7-BrHNA (1,005 nm) > PhOH (995 nm) > SA (990 nm) > HNA (980 nm) > 5-BrSA (815 nm) with the addition of HCl or HNO{sub 3}, respectively. The LSPR peak wavelength was increased with the increasing concentration of 7-BrHNA without HCl addition; however, there was a maximum LSPR peak wavelength when HCl was added. Interestingly, the LSPR peak wavelength was also increased with the amount of HCl added. The results presented here thus established a simple approach to synthesize monodisperse GNRs of different LSPR wavelengths.

  18. Cellulose nanocrystals reinforced foamed nitrile rubber nanocomposites.

    Science.gov (United States)

    Chen, Yukun; Zhang, Yuanbing; Xu, Chuanhui; Cao, Xiaodong

    2015-10-05

    Research on foamed nitrile rubber (NBR)/cellulose nanocrystals (CNs) nanocomposites is rarely found in the literatures. In this paper, CNs suspension and NBR latex was mixed to prepared the foamed NBR/CNs nanocomposites. We found that the CNs mainly located in the cell walls, effectively reinforcing the foamed NBR. The strong interaction between the CNs and NBR matrix restricted the mobility of NBR chains surrounding the CNs, hence increasing the crosslink density of the NBR matrix. CNs exhibited excellent reinforcement on the foamed NBR: a remarkable increase nearly 76% in the tensile strength of the foamed nanocomposites was achieved with a load of only 15 phr CNs. Enhanced mechanical properties make the foamed NBR/CNs nanocomposites a promising damping material for industrial applications with a potential to reduce the petroleum consumption. Copyright © 2015 Elsevier Ltd. All rights reserved.

  19. Making sense of nanocrystal lattice fringes

    International Nuclear Information System (INIS)

    Fraundorf, P.; Qin Wentao; Moeck, Peter; Mandell, Eric

    2005-01-01

    The orientation dependence of thin-crystal lattice fringes can be gracefully quantified using fringe-visibility maps, a direct-space analog of Kikuchi maps [Nishikawa and Kikuchi, Nature (London) 121, 1019 (1928)]. As in navigation of reciprocal space with the aid of Kikuchi lines, fringe-visibility maps facilitate acquisition of crystallographic information from lattice images. In particular, these maps can help researchers to determine the three-dimensional lattice of individual nanocrystals, to 'fringe-fingerprint' collections of randomly oriented particles, and to measure local specimen thickness with only a modest tilt. Since the number of fringes in an image increases with maximum spatial-frequency squared, these strategies (with help from more precise goniometers) will be more useful as aberration correction moves resolutions into the subangstrom range

  20. Flexible and fragmentable tandem photosensitive nanocrystal skins

    Science.gov (United States)

    Akhavan, S.; Uran, C.; Bozok, B.; Gungor, K.; Kelestemur, Y.; Lesnyak, V.; Gaponik, N.; Eychmüller, A.; Demir, H. V.

    2016-02-01

    We proposed and demonstrated the first account of large-area, semi-transparent, tandem photosensitive nanocrystal skins (PNSs) constructed on flexible substrates operating on the principle of photogenerated potential buildup, which avoid the need for applying an external bias and circumvent the current-matching limitation between junctions. We successfully fabricated and operated the tandem PNSs composed of single monolayers of colloidal water-soluble CdTe and CdHgTe nanocrystals (NCs) in adjacent junctions on a Kapton polymer tape. Owing to the usage of a single NC layer in each junction, noise generation was significantly reduced while keeping the resulting PNS films considerably transparent. In each junction, photogenerated excitons are dissociated at the interface of the semi-transparent Al electrode and the NC layer, with holes migrating to the contact electrode and electrons trapped in the NCs. As a result, the tandem PNSs lead to an open-circuit photovoltage buildup equal to the sum of those of the two single junctions, exhibiting a total voltage buildup of 128.4 mV at an excitation intensity of 75.8 μW cm-2 at 350 nm. Furthermore, we showed that these flexible PNSs could be bent over 3.5 mm radius of curvature and cut out in arbitrary shapes without damaging the operation of individual parts and without introducing any significant loss in the total sensitivity. These findings indicate that the NC skins are promising as building blocks to make low-cost, flexible, large-area UV/visible sensing platforms with highly efficient full-spectrum conversion.We proposed and demonstrated the first account of large-area, semi-transparent, tandem photosensitive nanocrystal skins (PNSs) constructed on flexible substrates operating on the principle of photogenerated potential buildup, which avoid the need for applying an external bias and circumvent the current-matching limitation between junctions. We successfully fabricated and operated the tandem PNSs composed of