WorldWideScience

Sample records for monkeys callithrix jacchus

  1. Aggression and flight behaviour of the marmoset monkey Callithrix jacchus: an ethogram for brain stimulation studies.

    Science.gov (United States)

    Lipp, H P

    1978-01-01

    The aggressive and flight behaviour of the common marmoset monkey (Callithrix jacchus) is described and split into behavioural units, allowing analysis of agonistic behaviour evoked by electrical stimulation of the hypothalamus. The social context of the described units is also considered. C. jacchus shows clearly recognizable behavioural patterns. Free-born animals are very timid and show typical flight reactions. Within aggressive behaviour, two types of aggression can be distinguished: very violent attacks causing severe injuries, often accompanied by particular threat displays and observed during dominance and territorial encounters, and, on the other hand, relatively harmless short attacks, together with a noisy vocalization, for defensive purposes or keeping group members at a distance.

  2. The cortical motor system of the marmoset monkey (Callithrix jacchus).

    Science.gov (United States)

    Bakola, Sophia; Burman, Kathleen J; Rosa, Marcello G P

    2015-04-01

    Precise descriptions of the anatomical pathways that link different areas of the cerebral cortex are essential to the understanding of the sensorimotor and association processes that underlie human actions, and their impairment in pathological situations. Many years of research in macaque monkeys have critically shaped how we currently think about cortical motor function in humans. However, it is important to obtain additional understanding about the homologies between cortical areas in human and various non-human primates, and in particular how evolutionary changes in connectivity within specific neural circuits impact on the capacity for different behaviors. Current research has converged on the New World marmoset monkey as an important animal model for cortical function and dysfunction, emphasizing advantages unique to this species. However, the motor repertoire of the marmoset differs from that of the macaque in many ways, including the capacity for skilled use of the hands. Here, we review current knowledge about the cortical frontal areas in marmosets, which are key to the generation and control of motor behaviors, with focus on comparative analyses. We note significant parallels with the macaque monkey, as well as a few potentially important differences, which suggest future directions for work involving architectonic and functional analyses.

  3. Even simple forms of social learning rely on intention attribution in marmoset monkeys (Callithrix jacchus).

    Science.gov (United States)

    Burkart, Judith; Kupferberg, Aleksandra; Glasauer, Stefan; van Schaik, Carel

    2012-05-01

    Intention attribution guides the cognitively most demanding forms of social learning, such as imitation, thereby scaffolding cumulative cultural evolution. However, it is not thought to be necessary for more basic forms of social learning. Here we present evidence that in marmoset monkeys (Callithrix jacchus) even most basic forms of social learning such as enhancement depend on intention attribution. Marmosets perceived the behavior of a conspecific and a conspecific-like robot, but not that of a moving black box, as goal directed. Their subsequent choice behavior was shaped by social facilitation and stimulus enhancement, that is, by very simple forms of social learning, but only when exposed to the conspecific and robot, which they previously had perceived as intentional agents. We discuss the implications of this finding for contemporary debates about social learning, including emulation learning and ghost control studies, the necessity of goal-directed copying for cumulative cultural evolution, and the limits of current classification systems of social learning for the evolution of social and asocial learning.

  4. A combined histological and MRI brain atlas of the common marmoset monkey, Callithrix jacchus

    OpenAIRE

    Newman, John D.; Kenkel, William M.; Aronoff, Emily C.; Bock, Nicholas A.; Zametkin, Molly R.; Silva, Afonso C.

    2009-01-01

    The common marmoset, Callithrix jacchus, is of growing importance for research in neuroscience and related fields. In the present work, we describe a combined histological and magnetic resonance imaging (MRI) atlas constructed from the brains of two adult female marmosets. Histological sections were processed from Nissl staining and digitized to produce an atlas in a large format that facilitates visualization of structures with significant detail. Naming of identifiable brain structures was ...

  5. Germ cell dynamics in the testis of the postnatal common marmoset monkey (Callithrix jacchus).

    Science.gov (United States)

    Albert, S; Ehmcke, J; Wistuba, J; Eildermann, K; Behr, R; Schlatt, S; Gromoll, J

    2010-11-01

    The seminiferous epithelium in the nonhuman primate Callithrix jacchus is similarly organized to man. This monkey has therefore been used as a preclinical model for spermatogenesis and testicular stem cell physiology. However, little is known about the developmental dynamics of germ cells in the postnatal primate testis. In this study, we analyzed testes of newborn, 8-week-old, and adult marmosets employing immunohistochemistry using pluripotent stem cell and germ cell markers DDX4 (VASA), POU5F1 (OCT3/4), and TFAP2C (AP-2γ). Stereological and morphometric techniques were applied for quantitative analysis of germ cell populations and testicular histological changes. Quantitative RT-PCR (qRT-PCR) of testicular mRNA was applied using 16 marker genes establishing the corresponding profiles during postnatal testicular development. Testis size increased during the first 8 weeks of life with the main driver being longitudinal outgrowth of seminiferous cords. The number of DDX4-positive cells per testis doubled between birth and 8 weeks of age whereas TFAP2C- and POU5F1-positive cells remained unchanged. This increase in DDX4-expressing cells indicates dynamic growth of the differentiated A-spermatogonial population. The presence of cells expressing POU5F1 and TFAP2C after 8 weeks reveals the persistence of less differentiated germ cells. The mRNA and protein profiles determined by qRT-PCR and western blot in newborn, 8-week-old, and adult marmosets corroborated the immunohistochemical findings. In conclusion, we demonstrated the presence of distinct spermatogonial subpopulations in the primate testis exhibiting different dynamics during early testicular development. Our study demonstrates the suitability of the marmoset testis as a model for human testicular development.

  6. Differential renal glomerular changes induced by 5/6 nephrectomization between common marmoset monkeys (Callithrix jacchus) and rats.

    Science.gov (United States)

    Suzuki, Yui; Yamaguchi, Itaru; Onoda, Noriko; Saito, Takashi; Myojo, Kensuke; Imaizumi, Minami; Takada, Chie; Kimoto, Naoya; Takaba, Katsumi; Yamate, Jyoji

    2013-07-01

    We have been investigating the relevance and availability of 5/6 nephrectomized (Nx) common marmoset monkeys (Callithrix jacchus) as a chronic renal failure model. As a part of this investigation, renal glomerular changes in the Nx marmosets were histopathologically and immunohistochemically evaluated, and then compared with those in 5/6 Nx SD rats. In the Nx marmosets, the blood and urine parameters were elevated, excluding urine protein; histopathologically, enlargement of Bowman's capsule and atrophy of the glomeruli were observed in all animals, and other slight changes were also observed in 1 or 2 marmosets. There were no significant changes in the mesangial matrix injury score, vimentin and desmin positivity or the number of WT1 positive cells between the control and Nx marmoset groups. On the other hand, in the Nx rats, the blood and urine parameters were elevated; histopathologically, various changes were observed in the glomeruli, and the mesangial matrix injury score, vimentin and desmin positivity were increased, while the number of WT1 positive cells was decreased; these histopathological impacts on the renal glomerulus at 13 weeks after Nx in rats were more severe than that in the Nx marmosets. Because the glomerular basement membrane (GBM) was much thicker in the marmosets than in the rats in electron microscopy, the weaker pathological changes in the Nx marmosets might be due to the GBM thickness. This study showed for the first time glomerular lesions developed in the Nx marmosets, and the possible pathogenesis of the glomerular lesions was discussed.

  7. Comparative distribution of cocaine- and amphetamine-regulated transcript (CART) in the hypothalamus of the capuchin monkey (Cebus apella) and the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Cavalcante, Judney Cley; Cândido, Paulo Laino; Sita, Luciane Valéria; do Nascimento, Expedito Silva; Cavalcante, Jeferson de Souza; de Oliveira Costa, Miriam Stela Maris; Bittencourt, Jackson Cioni; Elias, Carol Fuzeti

    2011-11-24

    Cocaine- and amphetamine-regulated transcript (CART) is widely distributed in the brain of many species. In the hypothalamus, CART neurotransmission has been implicated in diverse functions including energy balance, stress response, and temperature and endocrine regulation. Although some studies have been performed in primates, very little is known about the distribution of CART neurons in New World monkeys. New World monkeys are good models for systems neuroscience, as some species have evolved several behavioral and anatomical characteristics shared with humans, including diurnal and social habits, intense maternal care, complex manipulative abilities and well-developed frontal cortices. In the present study, we assessed the distribution of CART mRNA and peptide in the hypothalamus of the capuchin monkey (Cebus apella) and the common marmoset (Callithrix jacchus). We found that the distribution of hypothalamic CART neurons in these monkeys is similar to what has been described for rodents and humans, but some relevant differences were noticed. Only in capuchin monkeys CART neurons were observed in the suprachiasmatic and the intercalatus nuclei, whereas only in marmoset CART neurons were observed in the dorsal anterior nucleus. We also found that the only in marmoset displayed CART neurons in the periventricular preoptic nucleus and in an area seemingly comprising the premammillary nucleus. These hypothalamic sites are both well defined in rodents but poorly defined in humans. Our findings indicate that CART expression in hypothalamic neurons is conserved across species but the identified differences suggest that CART is also involved in the control of species-specific related functions.

  8. Metabolic consequences of long-term rapamycin exposure on common marmoset monkeys (Callithrix jacchus).

    Science.gov (United States)

    Ross, Corinna; Salmon, Adam; Strong, Randy; Fernandez, Elizabeth; Javors, Marty; Richardson, Arlan; Tardif, Suzette

    2015-11-01

    Rapamycin has been shown to extend lifespan in rodent models, but the effects on metabolic health and function have been widely debated in both clinical and translational trials. Prior to rapamycin being used as a treatment to extend both lifespan and healthspan in the human population, it is vital to assess the side effects of the treatment on metabolic pathways in animal model systems, including a closely related non-human primate model. In this study, we found that long-term treatment of marmoset monkeys with orally-administered encapsulated rapamycin resulted in no overall effects on body weight and only a small decrease in fat mass over the first few months of treatment. Rapamycin treated subjects showed no overall changes in daily activity counts, blood lipids, or significant changes in glucose metabolism including oral glucose tolerance. Adipose tissue displayed no differences in gene expression of metabolic markers following treatment, while liver tissue exhibited suppressed G6Pase activity with increased PCK and GPI activity. Overall, the marmosets revealed only minor metabolic consequences of chronic treatment with rapamycin and this adds to the growing body of literature that suggests that chronic and/or intermittent rapamycin treatment results in improved health span and metabolic functioning. The marmosets offer an interesting alternative animal model for future intervention testing and translational modeling.

  9. Mediodorsal thalamic nucleus receives a direct retinal input in marmoset monkey (Callithrix jacchus): a subunit B cholera toxin study.

    Science.gov (United States)

    de Sousa, Twyla Barros; de Santana, Melquisedec Abiaré Dantas; Silva, Alane de Medeiros; Guzen, Fausto Pierdoná; Oliveira, Francisco Gilberto; Cavalcante, Judney Cley; Cavalcante, Jeferson de Souza; Costa, Miriam Stela Maris Oliveira; Nascimento, Expedito Silva do

    2013-01-01

    The mediodorsal thalamic nucleus is a prominent nucleus in the thalamus, positioned lateral to the midline nuclei and medial to the intralaminar thalamic complex in the dorsal thalamus. Several studies identify the mediodorsal thalamic nucleus as a key structure in learning and memory, as well as in emotional mechanisms and alertness due to reciprocal connections with the limbic system and prefrontal cortex. Fibers from the retina to the mediodorsal thalamic nucleus have recently been described for the first time in a crepuscular rodent, suggesting a possible regulation of the mediodorsal thalamic nucleus by visual activity. The present study shows retinal afferents in the mediodorsal thalamic nucleus of a new world primate, the marmoset (Callithrix jacchus), using B subunit of cholera toxin (CTb) as an anterograde tracer. A small population of labeled retinofugal axonal arborizations is consistently labeled in small domains of the medial and lateral periphery of the caudal half of the mediodorsal nucleus. Retinal projections in the mediodorsal thalamic nucleus are exclusively contralateral and the morphology of the afferent endings was examined. Although the functional significance of this projection remains unknown, this retina-mediodorsal thalamic nucleus pathway may be involved in a wide possibility of functional implications.

  10. Quantification of ZP1, ZP2 and ZP3 mRNA of marmoset monkey (Callithrix jacchus) oocytes from periantral and antral follicles.

    Science.gov (United States)

    Konrad, L; Kuhnert, S; Nayudu, P L; Einspanier, R; Hinsch, K D; Hinsch, E

    2012-05-01

    In mammals, the oocyte and preimplantation embryo are protected by the zona pellucida (ZP) consisting mainly of ZP glycoproteins, which are responsible for sperm binding, induction of the acrosome reaction and zona pellucida hardening to prevent polyspermia. The ZP proteins become increasingly important as possible predictors for in vitro cultured oocytes competence. As little is known about the stage-dependent expression of ZP1, ZP2 and ZP3 in marmoset monkey (Callithrix jacchus) oocytes, mRNA expression was investigated with real-time RT-PCR. Total-RNA was isolated from three different classes of marmoset oocytes; Class 1 oocytes from periantral follicles (1000 μm, n = 9). Compared with Class 1 oocytes mRNA expression of ZP1, ZP2 and ZP3 in Class 2 oocytes was significantly decreased. In Class 3 oocytes, the transcription of ZP1, ZP2 and ZP3 genes showed also a significant decrease compared with Class 1 oocytes. In this study a differently regulated expression of the ZP genes during late folliculogenesis with an obvious downregulation of ZP1, ZP2 and ZP3 could be demonstrated for the first time in the marmoset monkey.

  11. Histopathological characterization of renal tubular and interstitial changes in 5/6 nephrectomized marmoset monkeys (Callithrix jacchus).

    Science.gov (United States)

    Suzuki, Yui; Yamaguchi, Itaru; Myojo, Kensuke; Kimoto, Naoya; Imaizumi, Minami; Takada, Chie; Sanada, Hiroko; Takaba, Katsumi; Yamate, Jyoji

    2015-01-01

    Common marmosets (Callithrix jacchus) have become a useful animal model, particularly for development of biopharmaceuticals. While various renal failure models have been established in rodents, there is currently no acceptable model in marmosets. We analyzed the damaged renal tubules and tubulointerstitial changes (inflammation and fibrosis) of 5/6 nephrectomized (Nx) common marmosets by histopathological/immunohistochemical methods, and compared these findings to those in 5/6 Nx SD rats. In Nx marmosets and rats sacrificed at 5 and 13 weeks after Nx, variously dilated and atrophied renal tubules were seen in the cortex in common; however, the epithelial proliferating activity was much less in Nx marmosets. Furthermore, the degrees of inflammation and fibrosis seen in the affected cortex were more severe and massive in Nx marmosets with time-dependent increase. Interestingly, inflammation in Nx marmosets, of which degree was less in Nx rats, consisted of a large number of CD3-positive T cells and CD20-positive B cells (occasionally forming follicles), and a few CD68-positive macrophages. Based on these findings, lymphocytes might contribute to the progressive renal lesions in Nx marmosets. Fibrotic areas in Nx marmosets comprised myofibroblasts expressing vimentin and α-smooth muscle actin (α-SMA), whereas along with vimentin and α-SMA expressions, desmin was expressed in myofibroblasts in Nx rats. This study shows that there are some differences in renal lesions induced by Nx between marmosets and rats, which would provide useful, base-line information for pharmacology and toxicology studies using Nx marmosets.

  12. Fetal malformation in a marmoset (Callithrix jacchus: case report

    Directory of Open Access Journals (Sweden)

    M.C. Ferraz

    2014-10-01

    Full Text Available Callithrix jacchus is a neotropical primate adaptable in captivity. Colonies can be easily established in a short time and at low cost compared to other species of larger primates, which are normally used in laboratory. Because they are phylogenetically similar to humans in situations that induce anxiety, these small primates are increasingly being used in research involving the stress response. Wild animals in captivity are subjected to a series of stressful events that depending on the duration and intensity can modify the organic homeostasis. Observed in this study, serious problems occurred with the formation in fetal offspring of Callithrix jacchus kept in an environment with a high degree of stress.

  13. Effect of the size of zona pellucida opening on hatching in the common marmoset monkey (Callithrix jacchus) embryo.

    Science.gov (United States)

    Ishibashi, Hidetoshi; Motohashi, Hideyuki H; Kumon, Mami; Yamamoto, Kazuhiro; Okada, Hironori; Okada, Takashi; Seki, Kazuhiko

    2013-11-01

    The use of the common marmoset monkey in biomedical research has increased recently, and further attention has been devoted to this model after the successful production of transgenic marmosets. To extend genetic engineering approaches to widespread biomedical research fields, efficient prolonged in vitro culturing of embryo development is necessary. We aimed to evaluate the effects of the size of the zona pellucida opening on promoting the hatching process in the marmoset embryo. Piezo-microdrilling of a 6-μm opening in eight embryos resulted in four partially hatched embryos and one hatched embryo after 5 days of culture. Piezo-microdrilling a 20-μm opening in 11 embryos resulted in nine partial hatchings and no hatched embryos. Piezo-scraping an 80-μm opening in six embryos resulted in no partially hatched embryos and five hatched embryos. These results suggest that an 80-μm opening, rather than 6-μm or 20-μm openings, is suitable to complete the hatching process in the marmoset embryo.

  14. The relationship between the production and the anti-gonadotrophic action of prostaglandin F 2 alpha in luteal cells from the marmoset monkey (Callithrix jacchus) in the early and mid-luteal phase.

    Science.gov (United States)

    Webley, G E; Michael, A E; Abayasekara, D R E

    2010-04-01

    To address the potential luteolytic role for prostaglandin F(2 alpha) (PGF(2 alpha)) in the corpus luteum of the common marmoset monkey (Callithrix jacchus), the ability of marmoset luteal cells, maintained in monolayer culture, to produce PGF(2 alpha) was determined in vitro in the presence and absence of human chorionic gonadotrophin (hCG) and other established pharmacological modulators of PGF(2 alpha) synthesis. We also assessed the effects of the PGF(2 alpha) analogue, cloprostenol, on progesterone output from luteal cells isolated in the early luteal phase versus the mid-luteal phase (days 3 and 14 post ovulation, respectively). Cloprostenol had no effect on progesterone output from luteal cells isolated on day 3 of the luteal phase, whereas it significantly inhibited both basal and hCG-stimulated progesterone synthesis by day 14 luteal cells during the culture period 48-72 h (Pmarmoset monkey appears to involve changes in both the luteal cell response to and production of PGF(2 alpha).

  15. Placental insulin-like growth factor II (IGF-II) and its relation to litter size in the common marmoset monkey (Callithrix jacchus).

    Science.gov (United States)

    Rutherford, Julienne N; Eklund, Amy; Tardif, Suzette

    2009-12-01

    The primate placenta produces a wide variety of hormones throughout gestation that regulate placental function and fetal growth. One such hormone is insulin-like growth factor-II (IGF-II), a peptide implicated in cell division, differentiation, and amino acid transport. IGF-II concentrations were measured in 23 common marmoset (Callithrix jacchus) term placentas from twin and triplet litters in order to determine whether previously described differences in fetoplacental phenotype such as placental and litter mass and placental surface area were related to differences in endocrine function. IGF-II was extracted from frozen tissue samples and measured using an enzyme-linked immunosorbent assay kit designed for human tissue, which was validated for marmoset placenta. IGF-II concentrations were not related to placental or litter mass, and twin and triplet placentas did not differ in total concentration. However, per individual fetus, triplets were associated with a significant 42% reduction in IGF-II concentration (P = 0.03), and IGF-II concentration per gram of fetal mass was a third lower in triplet litters. The triplet placenta exhibits a global expansion of the surface area which was contrasted by a per unit area reduction in IGF-II concentration (r = -0.75, P = 0.01), a pattern that explains why twin and triplet placentas overall did not differ in concentration. Per fetus, triplet pregnancies are associated with relatively less maternal mass, placental mass and microscopic surface area suggesting that the intrauterine growth of triplets is supported by systems that increase the efficiency of nutrient transfer. The finding that individual triplet fetuses are also associated with significantly lower IGF-II concentrations is consistent with the view that the marmoset fetoplacental unit exhibits a flexible pattern of placental allocation and metabolism. Plasticity in placental endocrine and metabolic function is likely to play an important role in the ability of the

  16. Experimental schistosomiasis in the Common Marmoset Callithrix jacchus Esquistossomose experimental no Sagüi Callithrix jacchus

    Directory of Open Access Journals (Sweden)

    Ana Luna de Oliveira

    2004-06-01

    Full Text Available In order to evaluate Callithrix jacchus as an animal model for mansoni schistosomiasis, a group of 10 male animals were once percutaneously exposed to 250 cercariae of the Schistosoma mansoni SLM (São Lourenço da Mata strain. Animals were periodically bled for measuring serum level of enzymes and proteins and for blood cell counting. When comparing pre-infection to post-infection values, a significant increase was found for alkaline phosphatase at 15 to 120 days p.i., differential counts of eosinophil at 45 and 60 days, and total protein and global eosinophil counts at 120 days. No Schistosoma mansoni eggs were found in stools. Adult worms of small size were recovered from five animals. At day 120, the number of Schistosoma mansoni eggs/g of tissue was 0-289.7 (liver, 0-30.1 (large intestine and 0-171.4 (small intestine. These findings lead us to classify Callithrix jacchus as a non-permissive host to the SLM strain of Schistosoma mansoni.Com o objetivo de avaliar o Callithrix jacchus (sagüi como modelo experimental para a esquistossomose, um grupo de 10 animais, machos, adultos jovens, foram expostos a 250 cercárias da cepa SLM (São Lourenço da Mata do Schistosoma mansoni, pela via percutânea. A intervalos de 15 dias até 120 dias apos infecção foram dosados os níveis de proteínas totais e enzimas séricas, além de realizados exames parasitológico e hematológico. Aumento significativo foi observado para: fosfatase alcalina a partir do 150 dia; contagem global de eosinófilos aos 120 dias, e diferencial de eosinófilos aos 45 e 60 dias p.i. Nao se observou ovos de Schistosoma nas fezes. Á perfusão cinco animais apresentaram vermes adultos. Todos os vermes encontrados eram diminutos. O número de ovos foi 0-289,7 ovos/g de tecido no fígado, 0-30,1 no intestino grosso, 0-171,4 no intestino delgado. Esta observaçoes levam-nos a concluir que o Callithrix jacchus seja não-permissivo ao Schistosoma.

  17. Aging Phenotypes of Common Marmosets (Callithrix jacchus

    Directory of Open Access Journals (Sweden)

    Corinna N. Ross

    2012-01-01

    Full Text Available Characterizing the phenotypic changes associated with aging in a short-lived primate is necessary in order to develop better translational models for human health, aging, and disease research. A population of conventionally housed marmoset monkeys was assessed to determine if phenotypes of body composition, hematology, and morphometrical measures were associated with age or risk of death. We found that the cause of mortality in older marmosets was more likely to be due to cardiac and chronic kidney disease than in younger marmosets. Older marmosets have decreased fat mass, morphometric measures, and serum albumin. Older marmosets are more likely to show a modified posture while at rest and this modified posture was significantly associated with an increased risk of imminent death. These assessments provide an initial definition of aged health in marmosets and a base for future translational aging research with this species.

  18. Noninvasive genotyping of common marmoset (Callithrix jacchus) by fingernail PCR.

    Science.gov (United States)

    Takabayashi, Shuji; Katoh, Hideki

    2015-07-01

    The common marmoset (Callithrix jacchus) is a New World primate that is a useful model for medical studies. In this study, we report a convenient, reliable, and noninvasive procedure to genotype a living common marmoset by using fingernails. This method was used to successfully genotype DNA by restriction fragment length polymorphism (RFLP) PCR without prior purification, by using the KOD FX PCR enzyme kit. Additionally, there is no sample contamination from hematopoietic chimera derived from fused placenta in utero. We compared chimeric levels between various tissues in females with male littermates using quantitative fluorescent (QF)-PCR to prepare a reliable DNA source for genetic analyses, such as genotyping, gene mapping, or genomic sequencing. The chimerism detected appeared to be restricted to lymphatic tissues, such as bone marrow, thymus, spleen, lymph nodes and blood cells. As a result, DNA from fingernails with the quick is the best DNA source for genetic research in living marmosets.

  19. Development of metabolic function biomarkers in the common marmoset, Callithrix jacchus.

    Science.gov (United States)

    Ziegler, Toni E; Colman, Ricki J; Tardif, Suzette D; Sosa, Megan E; Wegner, Fredrick H; Wittwer, Daniel J; Shrestha, Hemanta

    2013-05-01

    Metabolic assessment of a non-human primate model of metabolic syndrome and obesity requires the necessary biomarkers specific to the species. While the rhesus monkey has a number of specific assays for assessing metabolic syndrome, the marmoset does not. Furthermore, the common marmoset (Callithrix jacchus) has a small blood volume that necessitates using a single blood volume for multiple analyses. The common marmoset holds a great potential as an alternative primate model for the study of human disease but assay methods need to be developed and validated for the biomarkers of metabolic syndrome. Here we report on the adaptation, development, and validation of commercially available immunoassays for common marmoset samples in small volumes. We have performed biological validations for insulin, adiponectin, leptin, and ghrelin to demonstrate the use of these biomarkers in examining metabolic syndrome and other related diseases in the common marmoset.

  20. Metabolic Characterization of the Common Marmoset (Callithrix jacchus).

    Science.gov (United States)

    Go, Young-Mi; Liang, Yongliang; Uppal, Karan; Soltow, Quinlyn A; Promislow, Daniel E L; Wachtman, Lynn M; Jones, Dean P

    2015-01-01

    High-resolution metabolomics has created opportunity to integrate nutrition and metabolism into genetic studies to improve understanding of the diverse radiation of primate species. At present, however, there is very little information to help guide experimental design for study of wild populations. In a previous non-targeted metabolomics study of common marmosets (Callithrix jacchus), Rhesus macaques, humans, and four non-primate mammalian species, we found that essential amino acids (AA) and other central metabolites had interspecies variation similar to intraspecies variation while non-essential AA, environmental chemicals and catabolic waste products had greater interspecies variation. The present study was designed to test whether 55 plasma metabolites, including both nutritionally essential and non-essential metabolites and catabolic products, differ in concentration in common marmosets and humans. Significant differences were present for more than half of the metabolites analyzed and included AA, vitamins and central lipid metabolites, as well as for catabolic products of AA, nucleotides, energy metabolism and heme. Three environmental chemicals were present at low nanomolar concentrations but did not differ between species. Sex and age differences in marmosets were present for AA and nucleotide metabolism and warrant additional study. Overall, the results suggest that quantitative, targeted metabolomics can provide a useful complement to non-targeted metabolomics for studies of diet and environment interactions in primate evolution.

  1. Frequency discrimination in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Osmanski, Michael S; Song, Xindong; Guo, Yueqi; Wang, Xiaoqin

    2016-11-01

    The common marmoset (Callithrix jacchus) is a highly vocal New World primate species that has emerged in recent years as a promising model system for studies of auditory and vocal processing. Our recent studies have examined perceptual mechanisms related to the pitch of harmonic complex tones in this species. However, no previous psychoacoustic work has measured marmosets' frequency discrimination abilities for pure tones across a broad frequency range. Here we systematically examined frequency difference limens (FDLs), which measure the minimum discriminable frequency difference between two pure tones, in marmosets across most of their hearing range. Results show that marmosets' FDLs are comparable to other New World primates, with lowest values in the frequency range of ∼3.5-14 kHz. This region of lowest FDLs corresponds with the region of lowest hearing thresholds in this species measured in our previous study and also with the greatest concentration of spectral energy in the major types of marmoset vocalizations. These data suggest that frequency discrimination in the common marmoset may have evolved to match the hearing sensitivity and spectral characteristics of this species' vocalizations.

  2. Mechanical output in jumps of marmosets (Callithrix jacchus).

    Science.gov (United States)

    Bobbert, Maarten F; Plas, Rogier L C; Weide, Guido; Clairbois, H E Bert; Hofman, Sam O; Jaspers, Richard T; Philippens, Ingrid H C H M

    2014-02-15

    In this study we determined the mechanical output of common marmosets (Callithrix jacchus) during jumping. Vertical ground reaction forces were measured in 18 animals while they jumped from an instrumented crossbar to a crossbar located 70 cm higher. From the vertical force time histories, we calculated the rate of change of mechanical energy of the centre of mass (dE/dt). The mean value of dE/dt during the push-off amounted to 51.8±6.2 W kg(-1) body mass, and the peak value to 116.4±17.6 W kg(-1) body mass. We used these values in combination with masses of leg muscles, determined in two specimens, to estimate mean and peak values of dE/dt of 430 and 970 W kg(-1) muscle, respectively. These values are higher than values reported in the literature for jumps of humans and bonobos, but smaller than those of jumps of bushbabies. Surprisingly, the mean value of dE/dt of 430 W kg(-1) muscle was close to the maximal power output of 516 W kg(-1) muscle reported in the literature for isokinetic contractions of rat medial gastrocnemius, one of the fastest mammalian muscles. Further study of the force-velocity relationship of muscle tissue of small primates is indicated.

  3. Descrição anatômica do plexo braquial de Callithrix jacchus e Callithrix penicillata

    Directory of Open Access Journals (Sweden)

    Paulo R.S. Santos

    Full Text Available Resumo: Callithrix jacchus e Callithrix penicillata são primatas de pequeno porte cuja utilização como modelo anatômico tem se mostrado cada vez mais frequente, não somente pela praticidade no manuseio como facilidade no trato em criatório e sua taxa de reprodução. Este estudo teve como objetivo descrever os componentes dos plexos braquial em Callithrix jacchus e penicillata. Para tanto, três espécimes com aproximadamente 8 anos e 240 g foram fixados em solução de formaldeído a 10%, e posteriormente dissecados e fotodocumentados. O plexo braquial do Callithrix jacchus e penicillata originou-se dos nervos espinhais C5 a T1 constituindo os troncos cranial, médio e caudal. A composição do plexo braquial destes animais se assemelha ao de outros primatas, bem como a outros mamíferos.

  4. Morphological analysis of cutaneous smell gland of Callithrix jacchus compared to Callithrix kuhlii (Callithrichidae, Primates

    Directory of Open Access Journals (Sweden)

    Ana Flávia de Carvalho

    2007-06-01

    Full Text Available The objective of this work was to be describe the morphological characteristics of the Callithrix jacchus and C. khulii cutaneous smells glands. Three animals of each species, previously fixed in formaldehyde 10%, were used. The glandular areas were analyzed macroscopically and microscopically between the two species. Macroscopically, the glands of the pubic and anal regions were more developed than they were in the esternal region. Microscopically, the epidermis was thin, constituted by one or two layers of squamous epithelium with a fine layer of keratin. The dermis was composed of a dense, irregular collagenous connective tissue with a pillous follicle. Sudoriparous and sebaceous glands were sometimes found associated with pillous follicles. In the pubic regions of both males and females, these sebaceous glands presented histological arrangements in “rose” format (multiacinar, very developed and in greater quantity than other areas. It was thus inferred that the thin epidermis could be related to the facilitation of the glandular secretion that can substitute the keratin in this region, beyond the substance production that assists in the recognition of each specimen.

  5. Homologies between human and marmoset (Callithrix jacchus) chromosomes revealed by comparative chromosome painting

    Energy Technology Data Exchange (ETDEWEB)

    Sherlock, J.K.; Griffin, D.K.; Delhanty, J.D.A.; Parrington, J.M. [Univ. College London (United Kingdom)

    1996-04-15

    Regions of DNA homology between human and marmoset (Callithrix jacchus) chromosomes have been demonstrated using fluorescence in situ hybridization. All 24 chromosome paints and two centromere repeat sequences from Homo sapiens (HSA) have been annealed to previously G-banded metaphase spreads of Callithrix jacchus. All human paint probes, except Y, successfully hybridized to marmoset chromosomes. Fifteen of them hybridized to one region only, seven to two regions, and paint 1 to three regions. Homologies proposed from previous banding comparisons have been confirmed for HSA 2, 4-6, 10-12, 18, 19, 21, and X and partially confirmed for HSA 1 and 3, but were not in agreement for HSA 14 and 17. Human centromere repeat sequences for X and 18 did not hybridize to marmoset chromosomes. Because, at present, there is the confusing situation of several different numbering systems for marmoset chromosomes, we propose a new simpler nomenclature based on descending order of chromosome size. 25 refs., 3 figs.

  6. X-ray-induced translocations in marmoset (Callithrix jacchus) stem-cell spermatogonia

    Energy Technology Data Exchange (ETDEWEB)

    Buul, P.P.W. van (Rijksuniversiteit Leiden (Netherlands). Lab. voor Stralengenetica en Chemische Mutagenese)

    1984-11-01

    The induction of reciprocal translocations in spermatogonial stem cells of marmosets (Callithrix jacchus) was studied after irradiation with different doses of X-rays (50, 100 and 200 rad) via spermatocyte analysis many cell generations later. The obtained results show a dose-effect relationship with clear saturation effects at 200 rad. The recorded frequencies of translocations were much lower than those reported for closely related marmosets (Saguinus fuscicollis and Saguinus oedipus). Possible reasons for this difference are discussed.

  7. Reporting social behaviours of mixed-species troops formed by Callithrix jacchus and Callithrix penicillata (Primate, Callitrichidae

    Directory of Open Access Journals (Sweden)

    G Valença-Silva

    Full Text Available In New World primates, mixed-species troops have been reported. Here, we analysed the performance of affiliative and agonistic behaviours of Callithrix jacchus and Callithrix penicillata living in mixed groups. For this purpose, we recorded the interaction of the individuals from two groups located in Bauru city, in the state of São Paulo (Brazil. Our data show that in both groups, affiliative behaviours appeared more frequently than agonistic ones. We concluded that there is cohesion inside the mixed-species troops observed. We suggest that a deeper knowledge about the social behaviour of mixed-species troop species certainly may be useful in projects linked with the management of the impact caused by them.

  8. Digestive efficiency mediated by serum calcium predicts bone mineral density in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Jarcho, Michael R; Power, Michael L; Layne-Colon, Donna G; Tardif, Suzette D

    2013-02-01

    Two health problems have plagued captive common marmoset (Callithrix jacchus) colonies for nearly as long as those colonies have existed: marmoset wasting syndrome and metabolic bone disease. While marmoset wasting syndrome is explicitly linked to nutrient malabsorption, we propose metabolic bone disease is also linked to nutrient malabsorption, although indirectly. If animals experience negative nutrient balance chronically, critical nutrients may be taken from mineral stores such as the skeleton, thus leaving those stores depleted. We indirectly tested this prediction through an initial investigation of digestive efficiency, as measured by apparent energy digestibility, and serum parameters known to play a part in metabolic bone mineral density of captive common marmoset monkeys. In our initial study on 12 clinically healthy animals, we found a wide range of digestive efficiencies, and subjects with lower digestive efficiency had lower serum vitamin D despite having higher food intakes. A second experiment on 23 subjects including several with suspected bone disease was undertaken to measure digestive and serum parameters, with the addition of a measure of bone mineral density by dual-energy X-ray absorptiometry (DEXA). Bone mineral density was positively associated with apparent digestibility of energy, vitamin D, and serum calcium. Further, digestive efficiency was found to predict bone mineral density when mediated by serum calcium. These data indicate that a poor ability to digest and absorb nutrients leads to calcium and vitamin D insufficiency. Vitamin D absorption may be particularly critical for indoor-housed animals, as opposed to animals in a more natural setting, because vitamin D that would otherwise be synthesized via exposure to sunlight must be absorbed from their diet. If malabsorption persists, metabolic bone disease is a possible consequence in common marmosets. These findings support our hypothesis that both wasting syndrome and metabolic bone

  9. Anatomical description and morphometry of the skeleton of the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Casteleyn, C; Bakker, J; Breugelmans, S; Kondova, I; Saunders, J; Langermans, J A M; Cornillie, P; Van den Broeck, W; Van Loo, D; Van Hoorebeke, L; Bosseler, L; Chiers, K; Decostere, A

    2012-04-01

    Callithrix jacchus (common marmoset) is regularly used in biomedical research, including for studies involving the skeleton. To support these studies, skeletons of healthy animals that had been euthanized for reasons not interfering with skeletal anatomy were prepared. The marmoset dental formula 2I-1C-3P-2M of each oral quadrant is atypical for New World monkeys which commonly possess a third molar. Seven cervical, 12-13 thoracic, 7-6 lumbar, 2-3 sacral and 26-29 caudal vertebrae are present, the thoracolumbar region always comprising 19 vertebrae. A sigmoid clavicle connects the scapula with the manubrium of the sternum. Depending on the number of thoracic vertebrae, 4-5 sternebrae are located between the manubrium and xiphoid process. Wide interosseous spaces separate the radius from the ulna, and the tibia from the fibula. A small sesamoid bone is inserted in the m. abductor digiti primi longus at the medial border of the carpus, a pair of ovoid sesamoid bones is located at the palmar/plantar sides of the trochleae of each metapodial bone, and round fabellae articulate with the proximal surfaces of the femoral condyles. Male marmosets possess a small penile bone. Both the front and hind feet have five digits. The hallux possesses a flat nail, whereas all other digits present curved claws. Interestingly, a central bone is present in both the carpus and tarsus. This study provides a description and detailed illustrations of the skeleton of the common marmoset as an anatomical guide for further biomedical research.

  10. Modeling Parkinson's disease in the common marmoset (Callithrix jacchus): overview of models, methods, and animal care.

    Science.gov (United States)

    Yun, Jun-Won; Ahn, Jae-Bum; Kang, Byeong-Cheol

    2015-12-01

    The common marmoset (Callithrix jacchus) is a small-bodied, popular New World monkey and is used widely in reproductive biology, neuroscience, and drug development, due to its comparative ease of handling, high reproductive efficiency, and its unique behavioral characters. In this review, we discuss the marmoset models in Parkinson's disease (PD), which is a neurological movement disorder primarily resulting from a degeneration of dopaminergic neurons with clinical features of tremor, rigidity, postural instability, and akinesia. The most common PD models involve the administration of 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP) or 6-hydroxydopamine to study the pathogenesis and to evaluate novel therapies. Following the systemic or local administration of these neurotoxins, the marmosets with very severe Parkinson's symptoms are recommended to be placed in an intensive care unit with artificial feeding to increase survival rate. All procedures with MPTP should be conducted in a special room with enclosed cages under negative-pressure by trained researchers with personal protection. Behavioral tests are conducted to provide an external measure of the brain pathology. Along with several biomarkers, including α-synuclein and DJ-1, non-invasive neuroimaging techniques such as positron emission tomography and magnetic resonance imaging are used to evaluate the functional changes associated with PD. With the recent growing interest in potential and novel therapies such as stem cell and gene therapy for PD in Korea, the marmoset can be considered as a suitable non-human primate model in PD research to bridge the gap between rodent studies and clinical applications.

  11. Hybridization effects and genetic diversity of the common and black-tufted marmoset (Callithrix jacchus and Callithrix penicillata) mitochondrial control region.

    Science.gov (United States)

    Malukiewicz, Joanna; Boere, Vanner; Fuzessy, Lisieux F; Grativol, Adriana D; French, Jeffrey A; de Oliveira e Silva, Ita; Pereira, Luiz C M; Ruiz-Miranda, Carlos R; Valença, Yuri M; Stone, Anne C

    2014-12-01

    Hybridization is continually documented in primates, but effects of natural and anthropogenic hybridization on biodiversity are still unclear and differentiating between these contexts remains challenging in regards to primate evolution and conservation. Here, we examine hybridization effects on the mitochondrial DNA (mtDNA) control region of Callithrix marmosets, which provide a unique glimpse into interspecific mating under distinct anthropogenic and natural conditions. DNA was sampled from 40 marmosets along a 50-km transect from a previously uncharacterized hybrid zone in NE Brazil between the ranges of Callithrix jacchus and Callithrix penicillata. DNA was also collected from 46 marmosets along a 30-km transect in a hybrid zone in Rio de Janeiro state, Brazil, where exotic marmosets appeared in the 1980s. Combining Callithrix DNA sampled inside and outside of these hybrid zones, phylogenetic and network analyses show C. jacchus and C. penicillata being parental species to sampled hybrids. We expand limited Callithrix population genetics work by describing mtDNA diversity and demographic history of these parental species. We show ancient population expansion in C. jacchus and historically constant population size in C. penicillata, with the latter being more genetically diverse than the former. The natural hybrid zone contained higher genetic diversity relative to the anthropogenic zone. While our data suggest hybrid swarm formation within the anthropogenic zone due to removed physical reproductive barriers, this pattern is not seen in the natural hybrid zone. These results suggest different genetic dynamics within natural and anthropogenic hybridization contexts that carry important implications for primate evolution and conservation.

  12. Exchanging grooming, but not tolerance and aggression in common marmosets (Callithrix jacchus).

    Science.gov (United States)

    Campennì, Marco; Manciocco, Arianna; Vitale, Augusto; Schino, Gabriele

    2015-02-01

    In this study, we investigated the reciprocal exchanges of grooming, tolerance and reduced aggression in common marmosets (Callithrix jacchus), a cooperatively breeding primate whose groups are typically characterized by uniformly high genetic relatedness and high interdependency between group members. Both partner control and partner choice processes played a role in the reciprocal exchanges of grooming. In contrast, we did not find any evidence of reciprocity between grooming and tolerance over a preferred food source or between grooming and reduced aggression. Thus, reciprocity seems to play a variable role in the exchange of cooperative behaviors in marmosets.

  13. Congenital malformation of the vaginal orifice, imperforate vagina, in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Niimi, Kimie; Oguchi, Ayaka; Nishio, Kenji; Okano, Yasushi; Takahashi, Eiki

    2015-03-01

    The following is a report on a congenital vaginal malformation, imperforate vagina, in the common marmoset (Callithrix jacchus). This anomaly was observed for the first time in an adult female in our research colony. There was no uterine and vaginal aplasia or atresia in her grossly normal genital tract. The plasma progesterone concentration suggested that the ovarian cycle had ceased. However, this may not be related to a functional anomaly, but rather to suppressed ovulation resulting from subordination to cagemates considering the various stages of follicular development observed.

  14. Web-accessible digital brain atlas of the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Tokuno, Hironobu; Tanaka, Ikuko; Umitsu, Yoshitomo; Akazawa, Toshikazu; Nakamura, Yasuhisa

    2009-05-01

    Here we describe a web-accessible digital brain atlas of the common marmoset (Callithrix jacchus) at http://marmoset-brain.org:2008. We prepared the histological sections of the marmoset brain using various staining techniques. For virtual microscopy, high-resolution digital images of sections were obtained with Aperio Scanscope. The digital images were then converted to Zoomify files (zoomable multiresolution image files). Thereby, we could provide the multiresolution images of the marmoset brains for fast interactive viewing on the web via the Internet. In addition, we describe an automated method to obtain drawings of Nissl-stained sections.

  15. An overview of models, methods, and reagents developed for translational autoimmunity research in the common marmoset (Callithrix jacchus)

    NARCIS (Netherlands)

    S.A. Jagessar (Anwar); M.P.M. Vierboom (Michel); E. Blezer (Erwin); J. Bauer; B.A. 't Hart (Bert); Y.S. Kap (Yolanda)

    2013-01-01

    textabstractThe common marmoset (Callithrix jacchus) is a small-bodied Neotropical primate and a useful preclinical animal model for translational research into autoimmune-mediated inflammatory diseases (AIMID), such as rheumatoid arthritis (RA) and multiple sclerosis (MS). The animal model for MS e

  16. An Overview of Models, Methods, and Reagents Developed for Translational Autoimmunity Research in the Common Marmoset (Callithrix jacchus)

    NARCIS (Netherlands)

    Jagessar, S. Anwar; Vierboom, Michel; Blezer, Erwin L. A.; Bauer, Jan; 't Hart, Bert A.; Kap, Yolanda S.

    2013-01-01

    The common marmoset (Callithrix jacchus) is a small-bodied Neotropical primate and a useful preclinical animal model for translational research into autoimmune-mediated inflammatory diseases (AIMID), such as rheumatoid arthritis (RA) and multiple sclerosis (MS). The animal model for MS established i

  17. Behavioral Adjustments by a Small Neotropical Primate (Callithrix jacchus in a Semiarid Caatinga Environment

    Directory of Open Access Journals (Sweden)

    María Fernanda Castellón De la Fuente

    2014-01-01

    Full Text Available We provide the first information on the behavior of a small primate (Callithrix jacchus inhabiting a semiarid Caatinga environment in northeastern Brazil. We observed behavioral variations in response to temperature fluctuation throughout the day. Due to the high temperatures, low precipitation, and resource scarcity in the Caatinga, as well as the lack of physiological adaptations (e.g., a highly concentrated urine and a carotid rete to cool down the brain of these primates, we expected that the common marmosets would exhibit behavioral adjustments, such as a prolonged resting period or the use of a large home range. During the six-month period, we collected 246 hours of behavioral data of two groups (10 individuals of Callithrix jacchus. Most of the observed behavioral patterns were influenced by temperature fluctuation. Animals rested longer and reduced other activities, such as foraging, when temperatures were higher. Both study groups exploited home ranges of 2.21–3.26 ha, which is within the range described for common marmosets inhabiting the Atlantic Forest. Our findings confirm that common marmosets inhabiting the Caatinga adjust their behavioral patterns to cope with the high temperatures that characterize this environment and highlight their ability to survive across a wide range of different environmental conditions.

  18. TOPOGRAFIA VÉRTEBRO-MEDULAR EM SAGUI-DE-TUFO-BRANCO (Callithrix jacchus, LINNAEUS 1758

    Directory of Open Access Journals (Sweden)

    Luana Célia Stunitz da Silva

    2013-12-01

    Full Text Available Due to the importance of spinal cord morphological studies, their applicability in clinical veterinary during cerebrospinal fluid punction, location of nervous injuries in spinal levels, and epidural anesthesia, this study aimed at analyzing and describing the spinal cord and vertebral-medullary topography in the primate Callithrix jacchus (common marmoset. Ten adult specimens, 5 females and 5 males, with 170g-300g were used. The animals came from a wildlife breeding center and died of natural causes. After fixation in 10% formaldehyde solution, the animals were incised at the dorsal midline, from foramen magnum to the tail base, with removal of epaxial muscles and vertebral arches to expose the spinal cord. Total length measurements from the spinal cord, medullary cone and cervical and lumbar intumescences were performed, as well as skeletopie of all structures. Based on the analyzed material and the technique apllied we concluded that the spine of the common marmoset (Callithrix jacchus presents standard morphometric and morphological characteristic, and through the medullary cone morphological description, between L2-L5, we suggest that epidural anesthesia in this species should be performed at lumbosacral region.

  19. Behavioral adjustments by a small neotropical primate (Callithrix jacchus) in a semiarid Caatinga environment.

    Science.gov (United States)

    De la Fuente, María Fernanda Castellón; Souto, Antonio; Sampaio, Marilian Boachá; Schiel, Nicola

    2014-01-01

    We provide the first information on the behavior of a small primate (Callithrix jacchus) inhabiting a semiarid Caatinga environment in northeastern Brazil. We observed behavioral variations in response to temperature fluctuation throughout the day. Due to the high temperatures, low precipitation, and resource scarcity in the Caatinga, as well as the lack of physiological adaptations (e.g., a highly concentrated urine and a carotid rete to cool down the brain) of these primates, we expected that the common marmosets would exhibit behavioral adjustments, such as a prolonged resting period or the use of a large home range. During the six-month period, we collected 246 hours of behavioral data of two groups (10 individuals) of Callithrix jacchus. Most of the observed behavioral patterns were influenced by temperature fluctuation. Animals rested longer and reduced other activities, such as foraging, when temperatures were higher. Both study groups exploited home ranges of 2.21-3.26 ha, which is within the range described for common marmosets inhabiting the Atlantic Forest. Our findings confirm that common marmosets inhabiting the Caatinga adjust their behavioral patterns to cope with the high temperatures that characterize this environment and highlight their ability to survive across a wide range of different environmental conditions.

  20. Genomic sequence analysis of the MHC class I G/F segment in common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Kono, Azumi; Brameier, Markus; Roos, Christian; Suzuki, Shingo; Shigenari, Atsuko; Kametani, Yoshie; Kitaura, Kazutaka; Matsutani, Takaji; Suzuki, Ryuji; Inoko, Hidetoshi; Walter, Lutz; Shiina, Takashi

    2014-04-01

    The common marmoset (Callithrix jacchus) is a New World monkey that is used frequently as a model for various human diseases. However, detailed knowledge about the MHC is still lacking. In this study, we sequenced and annotated a total of 854 kb of the common marmoset MHC region that corresponds to the HLA-A/G/F segment (Caja-G/F) between the Caja-G1 and RNF39 genes. The sequenced region contains 19 MHC class I genes, of which 14 are of the MHC-G (Caja-G) type, and 5 are of the MHC-F (Caja-F) type. Six putatively functional Caja-G and Caja-F genes (Caja-G1, Caja-G3, Caja-G7, Caja-G12, Caja-G13, and Caja-F4), 13 pseudogenes related either to Caja-G or Caja-F, three non-MHC genes (ZNRD1, PPPIR11, and RNF39), two miscRNA genes (ZNRD1-AS1 and HCG8), and one non-MHC pseudogene (ETF1P1) were identified. Phylogenetic analysis suggests segmental duplications of units consisting of basically five (four Caja-G and one Caja-F) MHC class I genes, with subsequent expansion/deletion of genes. A similar genomic organization of the Caja-G/F segment has not been observed in catarrhine primates, indicating that this genomic segment was formed in New World monkeys after the split of New World and Old World monkeys.

  1. Multipotent stromal cells derived from common marmoset Callithrix jacchus within alginate 3D environment: Effect of cryopreservation procedures.

    Science.gov (United States)

    Gryshkov, Oleksandr; Hofmann, Nicola; Lauterboeck, Lothar; Pogozhykh, Denys; Mueller, Thomas; Glasmacher, Birgit

    2015-08-01

    Multipotent stromal cells derived from the common marmoset monkey Callithrix jacchus (cjMSCs) possess high phylogenetic similarity to humans, with a great potential for preclinical studies in the field of regenerative medicine. Safe and effective long-term storage of cells is of great significance to clinical and research applications. Encapsulation of such cell types within alginate beads that can mimic an extra-cellular matrix and provide a supportive environment for cells during cryopreservation, has several advantages over freezing of cells in suspension. In this study we have analysed the effect of dimethyl sulfoxide (Me2SO, 2.5-10%, v/v) and pre-freeze loading time of alginate encapsulated cjMSCs in Me2SO (0-45 min) on the viability and metabolic activity of the cells after freezing using a slow cooling rate (-1°C/min). It was found that these parameters affect the stability and homogeneity of alginate beads after thawing. Moreover, the cjMSCs can be frozen in alginate beads with lower Me2SO concentration of 7.5% after 30 min of loading, while retaining high cryopreservation outcome. We demonstrated the maximum viability, membrane integrity and metabolic activity of the cells under optimized, less cytotoxic conditions. The results of this study are another step forward towards the application of cryopreservation for the long-term storage and subsequent applications of transplants in cell-based therapies.

  2. Salmonella Yoruba infection in white-tufted-ear marmoset (Callithrix jacchus

    Directory of Open Access Journals (Sweden)

    Terezinha Knöbl

    2011-08-01

    Full Text Available The aim of this study was to describe a fatal salmonellosis case in a non-human female primate (Callithrix jacchus, found in the illegal pet trade in Brazil. The marmoset was sent to the quarantine section of the Guarulhos City Zoo and died in the sequence of an episode of profuse diarrhea. Necropsy findings included mucous enteritis, and liver enlargement and necrosis. Feces and liver fragments were collected for bacteriological tests, which indicated the presence of Salmonella sp.; it was subsequently characterized as pertaining to the Yoruba serotype. The susceptibility profile demonstrated resistance to tetracycline only. The strain was positive for genes that encoded the virulence factors investigated (invA, sefC, pefA and spvC. The results indicated the risk of introduction of Salmonella pathogenic serotypes in primates in captivity.

  3. Thyroid follicular adenoma with accumulation of collagen type IV in a common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Kawasako, K; Doi, T; Kanno, T; Wako, Y; Hamamura, M; Tsuchitani, M

    2014-01-01

    A thyroid tumour was identified in a 10-year-old male common marmoset (Callithrix jacchus). The tumour was encapsulated by fibrous connective tissue and compressed the adjacent normal thyroid. The tumour was composed of variably sized and irregularly shaped thyroid follicles lined by a single layer of columnar epithelial cells. Eosinophilic material at the base of the neoplastic cells stained black with periodic acid-methenamine silver and red with periodic acid-Schiff. Immunohistochemistry confirmed that this eosinophilic material was collagen type IV. Ultrastructurally, highly dense and amorphous material was observed at the base of the neoplastic cells. Small vesicles in the basolateral cytoplasm of the neoplastic cells contained similar material to that at the base of the cells. The tumour was diagnosed as a thyroid follicular adenoma with accumulation of collagen type IV. This is the first description of an endocrine tumour with accumulation of collagen type IV in animals.

  4. Life span of common marmoset (Callithrix jacchus) at CLEA Japan breeding colony.

    Science.gov (United States)

    Nishijima, Kazutoshi; Saitoh, Ryoichi; Tanaka, Shin; Ohsato-Suzuki, Motoko; Ohno, Tamio; Kitajima, Shuji

    2012-08-01

    The life span and survival parameters of the common marmoset (Callithrix jacchus) in a breeding colony at CLEA Japan, Inc. were investigated. The average life span of male marmosets was 148.5 ± 6.1 (mean ± SE) months of age (M), which was significantly longer (P marmosets show a slight decline in survival during the first 7-9 years and then a dramatic decrease and another slight decline after 14-16 year of age in survival, i.e., a lifespan curve similar to what is observed in colonies of aging rodents and humans. The sex-associated difference in life span was caused by reproductive burden on the females. The present study reported a longer than expected life span of the marmoset, and a long-lived animal can be a powerful model for senescence and longevity sciences.

  5. An alternative method of endotracheal intubation of common marmosets (Callithrix jacchus).

    Science.gov (United States)

    Thomas, A A; Leach, M C; Flecknell, P A

    2012-01-01

    Endotracheal intubation was carried out in 11 common marmosets (Callithrix jacchus). A commercially available tilting stand and a Miller laryngoscope blade were used to visualize the larynx. Anaesthesia was induced with alphaxalone (10.6 ± 1.6 mg/kg intramuscularly, followed by 3.2 ± 1.2 mg/kg intravenously). The diameter of the proximal trachea easily fitted an endotracheal tube made from readily available material (a 12 G 'over the needle' catheter). Once the tip of the endotracheal tube was at the level of the vocal folds, the tube had to be gently rotated through a 180° angle in order to pass through the larynx into the trachea. Assessment of the dimensions of the larynx and trachea, and comparison with external anatomical features of the animals (n = 10) showed that the length of the trachea could be predicted by multiplying the craniosacral length of the marmoset by a factor of 0.42.

  6. The spinal cord of the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Watson, Charles; Sengul, Gulgun; Tanaka, Ikuko; Rusznak, Zoltan; Tokuno, Hironobu

    2015-04-01

    The marmoset spinal cord possesses all the characteristic features of a typical mammalian spinal cord, but with some interesting variation in the levels of origin of the limb nerves. In our study Nissl and ChAT sections of the each segment of the spinal cord in two marmosets (Ma5 and Ma8), we found that the spinal cord can be functionally and anatomically divided into six regions: the prebrachial region (C1 to C3); the brachial region (C4 to C8) - segments supplying the upper limb; the post-brachial region (T1 to L1) - containing the sympathetic outflow, and supplying the hypaxial muscles of the body wall; the crural region (L2 to L5) - segments supplying the lower limb; the postcrural region (L6) - containing the parasympathetic outflow; and the caudal region (L7 to Co4) - supplying the tail. In the rat, mouse, and rhesus monkey, the prebrachial region consists of segments C1 to C4 (with the phrenic nucleus located at the C4 segment), and the brachial region extends from C5 to T1 inclusive. The prefixing of the upper limb outflow in these two marmosets mirrors the finding in the literature that a large C4 contribution to the brachial plexus is common in humans.

  7. Congenitally caused fused labia in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Isachenko, E F; Nayudu, P L; Isachenko, V V; Nawroth, F; Michelmann, H W

    2002-12-01

    In this paper, the occurrence of an external genital abnormality in female marmoset monkeys (fused labia) is discussed. This malformation was detected, for the first time, in a group of animals at the German Primate Center (GPC), Goettingen. The malformed vulva was completely sealed except for an opening of 1.5-2.5 mm around the urethra sufficient for urination. Because of this defect the animals were not able to copulate. As a consequence, the affected females were functionally infertile although they had a normal genital tract and a regular cycle. This vulvar abnormality was found in 12 females, offspring of 10 pairs in which either one or both came to the German Primate Center from two genetically related colonies in Munich, Germany, and one colony in Basel, Switzerland. The abnormality appeared to be recessive and inheritable from either parent. In pairs in which both animals were from one of the mentioned colonies, 45% of the female offspring were affected. In pairs where only one partner came from these colonies, 26% of female offspring had the malformation. These results indicate that avoidance of inbreeding, which is frequently performed in primate colonies, may reduce, but not eliminate the expression of abnormalities of genetic origin. Therefore selective breeding is required, and, in colonies where these recessive mutations are widespread, the development of genetic screening tests would be advantageous.

  8. Distinct Neural Activities in Premotor Cortex during Natural Vocal Behaviors in a New World Primate, the Common Marmoset (Callithrix jacchus).

    Science.gov (United States)

    Roy, Sabyasachi; Zhao, Lingyun; Wang, Xiaoqin

    2016-11-30

    Although evidence from human studies has long indicated the crucial role of the frontal cortex in speech production, it has remained uncertain whether the frontal cortex in nonhuman primates plays a similar role in vocal communication. Previous studies of prefrontal and premotor cortices of macaque monkeys have found neural signals associated with cue- and reward-conditioned vocal production, but not with self-initiated or spontaneous vocalizations (Coudé et al., 2011; Hage and Nieder, 2013), which casts doubt on the role of the frontal cortex of the Old World monkeys in vocal communication. A recent study of marmoset frontal cortex observed modulated neural activities associated with self-initiated vocal production (Miller et al., 2015), but it did not delineate whether these neural activities were specifically attributed to vocal production or if they may result from other nonvocal motor activity such as orofacial motor movement. In the present study, we attempted to resolve these issues and examined single neuron activities in premotor cortex during natural vocal exchanges in the common marmoset (Callithrix jacchus), a highly vocal New World primate. Neural activation and suppression were observed both before and during self-initiated vocal production. Furthermore, by comparing neural activities between self-initiated vocal production and nonvocal orofacial motor movement, we identified a subpopulation of neurons in marmoset premotor cortex that was activated or suppressed by vocal production, but not by orofacial movement. These findings provide clear evidence of the premotor cortex's involvement in self-initiated vocal production in natural vocal behaviors of a New World primate.

  9. Natural and Anthropogenic Hybridization in Two Species of Eastern Brazilian Marmosets (Callithrix jacchus and C. penicillata)

    Science.gov (United States)

    Malukiewicz, Joanna; Boere, Vanner; Fuzessy, Lisieux F.; Grativol, Adriana D.; de Oliveira e Silva, Ita; Pereira, Luiz C. M.; Ruiz-Miranda, Carlos R.; Valença, Yuri M.; Stone, Anne C.

    2015-01-01

    Animal hybridization is well documented, but evolutionary outcomes and conservation priorities often differ for natural and anthropogenic hybrids. Among primates, an order with many endangered species, the two contexts can be hard to disentangle from one another, which carries important conservation implications. Callithrix marmosets give us a unique glimpse of genetic hybridization effects under distinct natural and human-induced contexts. Here, we use a 44 autosomal microsatellite marker panel to examine genome-wide admixture levels and introgression at a natural C. jacchus and C. penicillata species border along the São Francisco River in NE Brazil and in an area of Rio de Janeiro state where humans introduced these species exotically. Additionally, we describe for the first time autosomal genetic diversity in wild C. penicillata and expand previous C. jacchus genetic data. We characterize admixture within the natural zone as bimodal where hybrid ancestry is biased toward one parental species or the other. We also show evidence that São Francisco River islands are gateways for bidirectional gene flow across the species border. In the anthropogenic zone, marmosets essentially form a hybrid swarm with intermediate levels of admixture, likely from the absence of strong physical barriers to interspecific breeding. Our data show that while hybridization can occur naturally, the presence of physical, even if leaky, barriers to hybridization is important for maintaining species genetic integrity. Thus, we suggest further study of hybridization under different contexts to set well informed conservation guidelines for hybrid populations that often fit somewhere between “natural” and “man-made.” PMID:26061111

  10. Behavioral and trait rating assessments of personality in common marmosets (Callithrix jacchus).

    Science.gov (United States)

    Iwanicki, Suzanne; Lehmann, Julia

    2015-08-01

    The study of personality in animals is a rapidly growing scientific field and numerous species have been reported to show consistent personality profiles. Much animal personality research has focused on nonhuman primates, with the main emphasis being placed on Old World primates, particularly rhesus macaques and chimpanzees. So far, little work has been done on cooperatively breeding nonhuman primates and New World species. Here, we study personality in the cooperatively breeding common marmosets (Callithrix jacchus) to broaden the taxonomic range of such research and to widen the perspective of comparative personality research. We use behavioral data collection and observer trait ratings to assess marmoset personality dimensions. The resulting behavioral and rating-derived personality dimensions, when viewed in tandem, resemble the human five-factor model and include extraversion, agreeableness, neuroticism, openness, and conscientiousness. Correlations between the behavioral data and the observer trait-rated personality components suggest that the personality construct of common marmosets exhibits both convergent and discriminant validity. The finding of a distinct Conscientiousness component in this species extends previous knowledge in comparative personality psychology and warrants reconsideration of proposed taxonomic trait distributions. (c) 2015 APA, all rights reserved).

  11. Visual responses in the lateral geniculate nucleus of dichromatic and trichromatic marmosets (Callithrix jacchus).

    Science.gov (United States)

    Yeh, T; Lee, B B; Kremers, J; Cowing, J A; Hunt, D M; Martin, P R; Troy, J B

    1995-12-01

    New-world primates such as the marmoset (Callithrix jacchus) show polymorphism for the middle- to long-wavelength sensitive cone pigments. Each X-chromosome carries a gene for only one of three possible pigments. All males are thus dichromats, but some females will be trichromats. We have investigated the responses of cells of the parvocellular (PC) and magnocellular (MC) systems within animals from a single marmoset family. The middle- to long-wavelength pigment of dichromats was identified physiologically. Trichromats could readily be distinguished from dichromats by the presence of a high proportion of red-green opponent PC-cells. The physiological classification of phenotypes was confirmed with genetic analysis. The pattern of inheritance was consistent with current genetic models. In trichromatic females, the properties of cells resembled in detail those of cells from the PC- and MC-pathways of the macaque. In dichromats, cell responses resembled those of trichromats (except for the lack of opponency in PC-cells); PC-cells showed sustained and MC-cells transient responses, with a lower contrast gain for the former type. One difference was that a proportion of PC-cells in dichromats showed strong rod input even at high levels of retinal illuminance. Thus, in trichromatic marmosets the presence of two middle- to long-wave pigments appears to permit the elaboration of all the physiological properties associated with trichromacy.

  12. The influence of gluten on clinical and immunological status of common marmosets (Callithrix jacchus).

    Science.gov (United States)

    Kuehnel, Friederike; Mietsch, Matthias; Buettner, Thomas; Vervuert, Ingrid; Ababneh, Rayan; Einspanier, Almuth

    2013-12-01

    Common marmosets (Callithrix jacchus) are susceptible to gastrointestinal diseases. Sensitivity to nutritional elements, for example gluten, has been suggested, but a serological screening has not been performed yet. A gluten-containing diet was offered to 24 animals, followed by a gluten-free diet. During these diets, serum IgA antibodies to gliadin (AGA), tissue transglutaminase (tTG), deamidated gliadin (ADGA), and glycoprotein 2 (AGP2A) were determined. Body weight, diarrhea, and other clinical symptoms were recorded. Gluten increased AGA, tTG, and AGP2A concentrations in 13 of 24 animals. A significant decline of AGA and AGP2A was seen on gluten withdrawal. Positive (AGA, tTG) animals presented diarrhea more frequently on gluten-containing diet and showed significantly increased body weight on gluten-free diet compared to negative animals. Gluten ingestion caused gastrointestinal symptoms in common marmosets, which disappeared on gluten withdrawal. Considering the immunological response to both diets, gluten sensitivity seems to be most likely. © 2013 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  13. The complete mitochondrial genome of white-tufted-ear marmoset, Callithrix jacchus (Primates: Callitrichinae).

    Science.gov (United States)

    Wang, Wei; Liu, Jing-Yu; Wang, Hai-Feng; Yang, Ming-Ying; Liu, Qi-Ying; Ding, Ming-Xia

    2016-05-01

    The white-tufted-ear marmoset (Callithrix jacchus) is a New World primate that inhabits the coastal rainforests of eastern Brazil. In the present work, we report the complete mitochondrial genome sequence of white-tufted-ear marmoset for the first time. The total length of this mitogenome is 16,499 bp long, containing 13 protein-coding genes, 22 transfer RNA genes, 2 ribosomal RNA genes, and 1 non-coding region (D-loop region). The gene organization and arrangement is identical to typical vertebrates. The overall base composition is 32.75% of A, 26.95% of T, 26.91% C, and 13.39% G, with a slight A + T bias of 59.7%. All the genes are encoded on H-strand, except for the ND6 subunit gene and 8 tRNA genes. The complete mitochondrial genome sequence reported here will be useful for comparative genomics studies in primates.

  14. Population-averaged standard template brain atlas for the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Hikishima, K; Quallo, M M; Komaki, Y; Yamada, M; Kawai, K; Momoshima, S; Okano, H J; Sasaki, E; Tamaoki, N; Lemon, R N; Iriki, A; Okano, H

    2011-02-14

    Advanced magnetic resonance (MR) neuroimaging analysis techniques based on voxel-wise statistics, such as voxel-based morphometry (VBM) and functional MRI, are widely applied to cognitive brain research in both human subjects and in non-human primates. Recent developments in imaging have enabled the evaluation of smaller animal models with sufficient spatial resolution. The common marmoset (Callithrix jacchus), a small New World primate species, has been widely used in neuroscience research, to which voxel-wise statistics could be extended with a species-specific brain template. Here, we report, for the first time, a tissue-segmented, population-averaged standard template of the common marmoset brain. This template was created by using anatomical T(1)-weighted images from 22 adult marmosets with a high-resolution isotropic voxel size of (0.2 mm)(3) at 7-Tesla and DARTEL algorithm in SPM8. Whole brain templates are available at International Neuroinformatics Japan Node website, http://brainatlas.brain.riken.jp/marmoset/.

  15. Development of an acute model of inhalational melioidosis in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Nelson, Michelle; Dean, Rachel E; Salguero, Francisco J; Taylor, Christopher; Pearce, Peter C; Simpson, Andrew J H; Lever, Mark S

    2011-12-01

    Studies of inhalational melioidosis were undertaken in the common marmoset (Callithrix jacchus). Following exposure to an inhaled challenge with aerosolized Burkholderia pseudomallei, lethal infection was observed in marmosets challenged with doses below 10 cfu; a precise LD(50) determination was not possible. The model was further characterized using a target challenge dose of approximately 10(2) cfu. A separate pathogenesis time-course experiment was also conducted. All animals succumbed, between 27 and 78 h postchallenge. The challenge dose received and the time to the humane endpoint (1 °C below normal body temperature postfever) were correlated. The first indicator of disease was an increased core body temperature (T(c) ), at 22 h postchallenge. This coincided with bacteraemia and bacterial dissemination. Overt clinical signs were first observed 3-5 h later. A sharp decrease (typically within 3-6 h) in the T(c) was observed prior to humanely culling the animals in the lethality study. Pathology was noted in the lung, liver and spleen. Disease progression in the common marmoset appears to be consistent with human infection in terms of bacterial spread, pathology and physiology. The common marmoset can therefore be considered a suitable animal model for further studies of inhalational melioidosis.

  16. Vocalizations associated with anxiety and fear in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Kato, Yoko; Gokan, Hayato; Oh-Nishi, Arata; Suhara, Tetsuya; Watanabe, Shigeru; Minamimoto, Takafumi

    2014-12-15

    Vocalizations of common marmoset (Callithrix jacchus) were examined under experimental situations related to fear or anxiety. When marmosets were isolated in an unfamiliar environment, they frequently vocalized "tsik-egg" calls, which were the combination calls of 'tsik' followed by several 'egg'. Tsik-egg calls were also observed after treatment with the anxiogenic drug FG-7142 (20mg/kg, sc). In contrast, when marmosets were exposed to predatory stimuli as fear-evoking situations, they frequently vocalized tsik solo calls as well as tsik-egg calls. These results suggest that marmosets dissociate the vocalization of tsik-egg and tsik calls under conditions related to fear/anxiety; tsik-egg solo vocalizations were emitted under anxiety-related conditions (e.g., isolation and anxiogenic drug treatment), whereas a mixed vocalization of tsik-egg and tsik was emitted when confronted with fear-provoking stimuli (i.e., threatening predatory stimuli). Tsik-egg call with/without tsik can be used as a specific vocal index of fear/anxiety in marmosets, which allows us to understand the neural mechanism of negative emotions in primate.

  17. Retinal projections and neurochemical characterization of the pregeniculate nucleus of the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Lima, Ruthnaldo R M; Pinato, Luciana; Nascimento, Rayane B S; Engelberth, Rovena Clara G J; Nascimento, Expedito S Junior; Cavalcante, Judney C; Britto, Luiz R G; Costa, Miriam S M O; Cavalcante, Jeferson S

    2012-05-01

    In mammals, the suprachiasmatic nucleus (SCN) and the intergeniculate leaflet (IGL) are the main components of the circadian timing system. The SCN is the site of the endogenous biological clock that generates rhythms and synchronizes them to environmental cues. The IGL is a key structure that modulates SCN activity and is responsible for the transmission of non-photic information to the SCN, thus participating in the integration between photic and non-photic stimuli. Both the SCN and IGL receive projections of retinal ganglion cells and the IGL is connected to the SCN through the geniculohypothalamic tract. Little is known about these structures in the primate brain and the pregeniculate nucleus (PGN) has been suggested to be the primate equivalent of the rodent IGL. The aim of this study was to characterize the PGN of a primate, the common marmoset (Callithrix jacchus), and to analyze its retinal afferents. Here, the marmoset PGN was found to be organized into three subsectors based on neuronal size, pattern of retinal projections, and the distribution of neuropeptide Y-, GAD-, serotonin-, enkephalin- and substance P-labeled terminals. This pattern indicates that the marmoset PGN is equivalent to the IGL. This detailed description contributes to the understanding of the circadian timing system in this primate species considering the importance of the IGL within the context of circadian regulation.

  18. Experimental respiratory Marburg virus haemorrhagic fever infection in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Smither, Sophie J; Nelson, Michelle; Eastaugh, Lin; Laws, Thomas R; Taylor, Christopher; Smith, Simon A; Salguero, Francisco J; Lever, Mark S

    2013-04-01

    Marburg virus causes a highly infectious and lethal haemorrhagic fever in primates and may be exploited as a potential biothreat pathogen. To combat the infection and threat of Marburg haemorrhagic fever, there is a need to develop and license appropriate medical countermeasures. To determine whether the common marmoset (Callithrix jacchus) would be an appropriate model to assess therapies against Marburg haemorrhagic fever, initial susceptibility, lethality and pathogenesis studies were performed. Low doses of virus, between 4 and 28 TCID50 , were sufficient to cause a lethal, reproducible infection. Animals became febrile between days 5 and 6, maintaining a high fever before succumbing to disease between 8 and 11 days postchallenge. Typical signs of Marburg virus infection were observed including haemorrhaging and a transient rash. In pathogenesis studies, virus was isolated from the animals' lungs from day 3 postchallenge and from the liver, spleen and blood from day 5 postchallenge. Early signs of histopathology were apparent in the kidney and liver from day 3. The most striking features were observed in animals exhibiting severe clinical signs, which included high viral titres in all organs, with the highest levels in the blood, increased levels in liver function enzymes and blood clotting times, decreased levels in platelets, multifocal moderate-to-severe hepatitis and perivascular oedema.

  19. Bioavailability and efficacy of levofloxacin against Francisella tularensis in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Nelson, Michelle; Lever, Mark S; Dean, Rachel E; Pearce, Peter C; Stevens, Daniel J; Simpson, Andrew J H

    2010-09-01

    Pharmacokinetic and efficacy studies with levofloxacin were performed in the common marmoset (Callithrix jacchus) model of inhalational tularemia. Plasma levofloxacin pharmacokinetics were determined in six animals in separate single-dose and multidose studies. Plasma drug concentrations were analyzed using liquid chromatography-tandem mass spectrometry-electrospray ionization. On day 7 of a twice-daily dosing regimen of 40 mg/kg, the levofloxacin half-life, maximum concentration, and area under the curve in marmoset plasma were 2.3 h, 20.9 microg/ml, and 81.4 microg/liter/h, respectively. An efficacy study was undertaken using eight treated and two untreated control animals. Marmosets were challenged with a mean of 1.5 x 10(2) CFU of Francisella tularensis by the airborne route. Treated animals were administered 16.5 mg/kg levofloxacin by mouth twice daily, based on the pharmacokinetic parameters, beginning 24 h after challenge. Control animals had a raised core body temperature by 57 h postchallenge and died from infection by day 5. All of the other animals survived, remained afebrile, and lacked overt clinical signs. No bacteria were recovered from the organs of these animals at postmortem after culling at day 24 postchallenge. In conclusion, postexposure prophylaxis with orally administered levofloxacin was efficacious against acute inhalational tularemia in the common marmoset. The marmoset appears to be an appropriate animal model for the evaluation of postexposure therapies.

  20. The olfactory bulb and the number of its glomeruli in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Moriya-Ito, Keiko; Tanaka, Ikuko; Umitsu, Yoshitomo; Ichikawa, Masumi; Tokuno, Hironobu

    2015-04-01

    The olfactory system has been well studied in mammals such as mice and rats. However, few studies have focused on characterizing this system in diurnal primates that rely on their sense of smell to a lesser extent due to their ecological environment. In the present study, we determined the histological organization of the olfactory bulb in the common marmoset (Callithrix jacchus). We then constructed 3-dimensional models of the glomeruli of the olfactory bulb, and estimated the number of glomeruli. Olfactory glomeruli are the functional units of olfactory processing, and have been investigated in detail using mice. There are approximately 1800 glomeruli in a mouse hemibulb, and olfactory sensory neurons expressing one selected olfactory receptor converge onto one or two glomeruli. Because mice have about 1000 olfactory receptor genes, it is proposed that the number of glomeruli in mammals is nearly double that of olfactory receptor genes. The common marmoset carries only about 400 intact olfactory receptor genes. The present study revealed that the number of glomeruli in a marmoset hemibulb was approximately 1500-1800. This result suggests that the number of glomeruli is not positively correlated with the number of intact olfactory receptor genes in mammals.

  1. Morphology and staining behavior of neutrophilic and eosinophilic granulocytes of the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Bleyer, Martina; Curths, Christoph; Dahlmann, Franziska; Wichmann, Judy; Bauer, Natali; Moritz, Andreas; Braun, Armin; Knauf, Sascha; Kaup, Franz-Josef; Gruber-Dujardin, Eva

    2016-06-01

    Common marmosets (Callithrix jacchus) are frequently used as translational animal models for human diseases. However, a comparative study of cytological and histochemical detection methods as well as morphometric and ultrastructural characterization of neutrophils and eosinophils in this species is lacking. Blood samples of house dust mite sensitized and allergen challenged as well as lipopolysaccharide (LPS) challenged marmosets were analyzed with different cytological and histological staining methods. Furthermore, cell size and number of nuclear segments were compared between neutrophils and eosinophils. Electron microscopy was performed to characterize the ultrastructure of granulocytes. Of all applied cytological stains, three allowed differentiation of eosinophils and neutrophils and, thus, reliable quantification in blood smears: May-Grünwald-Giemsa stain, Congo Red and Naphthol AS-D Chloroacetate-Esterase. For histology, Hematoxylin-Eosin (H&E) could not demonstrate clear differences, whereas Sirius Red, Congo Red, and Naphthol AS-D Chloroacetate Esterase showed capable results for identification of eosinophils or neutrophils in lung tissue. Morphometry revealed that marmoset neutrophils have more nuclear segments and are slightly larger than eosinophils. Ultrastructurally, eosinophils presented with large homogeneous electron-dense granules without crystalloid cores, while neutrophils were characterized by heterogeneous granules of different size and density. Additionally, sombrero-like vesicles were detected in tissue eosinophils of atopic marmosets, indicative for hypersensitivity-related piecemeal degranulation. In conclusion, we provide a detailed overview of marmoset eosinophils and neutrophils, important for phenotypic characterization of marmoset models for human airway diseases.

  2. Novel monoclonal antibodies recognizing different subsets of lymphocytes from the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Ito, Ryoji; Maekawa, Shin-ichiro; Kawai, Kenji; Suemizu, Hiroshi; Suzuki, Shuzo; Ishii, Hajime; Tanioka, Yoshikuni; Satake, Masanobu; Yagita, Hideo; Habu, Sonoko; Ito, Mamoru

    2008-12-22

    Callithrix jacchus, the common marmoset, is a small new world primate that is considered effective as an experimental animal model for various human diseases. In this study, we generated monoclonal antibodies (mAbs) against common marmoset lymphocytes for immunological studies on the common marmoset. We established five hybridoma clones, 6C9, 10D7, 6F10, 7A4 and 5A1, producing anti-marmoset mAbs against cell surface antigens on marmoset T and/or B lymphocytes. We confirmed that 6C9 and 10D7 antibodies recognized CD45 antigen, and 6F10 antibody recognized CD8 antigen by flow cytometry using marmoset cDNA transfectants. We also tested them for application of immunoprecipitation, Western blot analysis and immunohistochemistry. We found that immunohistochemistry using marmoset spleen sections could be applied with all established mAbs but immunoprecipitation and the Western blot analysis could be applied with 6F10 and 10D7 antibodies but not with the other three mAbs. These results show that these monoclonal antibodies are useful for advancing immunological research on the common marmoset.

  3. Comparative experimental subcutaneous glanders and melioidosis in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Nelson, Michelle; Salguero, Francisco J; Dean, Rachel E; Ngugi, Sarah A; Smither, Sophie J; Atkins, Timothy P; Lever, Mark S

    2014-12-01

    Glanders and melioidosis are caused by two distinct Burkholderia species and have generally been considered to have similar disease progression. While both of these pathogens are HHS/CDC Tier 1 agents, natural infection with both these pathogens is primarily through skin inoculation. The common marmoset (Callithrix jacchus) was used to compare disease following experimental subcutaneous challenge. Acute, lethal disease was observed in marmosets following challenge with between 26 and 1.2 × 10(8) cfu Burkholderia pseudomallei within 22-85 h. The reproducibility and progression of the disease were assessed following a challenge of 1 × 10(2) cfu of B. pseudomallei. Melioidosis was characterised by high levels of bacteraemia, focal microgranuloma progressing to non-necrotic multifocal solid lesions in the livers and spleens and multi-organ failure. Lethal disease was observed in 93% of animals challenged with Burkholderia mallei, occurring between 5 and 10.6 days. Following challenge with 1 × 10(2) cfu of B. mallei, glanders was characterised with lymphatic spread of the bacteria and non-necrotic, multifocal solid lesions progressing to a multifocal lesion with severe necrosis and pneumonia. The experimental results confirmed that the disease pathology and presentation is strikingly different between the two pathogens. The marmoset provides a model of the human syndrome for both diseases facilitating the development of medical countermeasures.

  4. Characterization of common marmoset (Callithrix jacchus) bone marrow-derived mesenchymal stem cells.

    Science.gov (United States)

    Kanda, Akifumi; Sotomaru, Yusuke; Nobukiyo, Asako; Yamaoka, Emi; Hiyama, Eiso

    2013-01-01

    Mesenchymal stem cells (MSCs) could be useful for regenerative medicine because they can beharvested easily from the bone marrow of living donors and the cells can be differentiated into adipogenic, osteogenic, and chondrogenic lineages in vitro. To apply MSCs for the medical treatment of human diseases as regenerative medicine, detailed experimental characterization of the cells is required. Recently, a New World primate, the common marmoset (Callithrix jacchus), has been widely used as a new human disease model because of its ease of handling and breeding. Although common marmoset MSCs have been established and will be used in preclinical studies of regenerative medicine, the characteristics of these cells remain unclear. Aiming to characterize common marmoset MSCs further, we harvested common marmoset bone marrow-derived cells (cmBMDCs) from the femurs of newborn males. We revealed that the morphology of the cells was similar to common marmoset fibroblasts, and extracellular matrix components, such as gelatin and fibronectin, were effective for their proliferation and formation of colony-forming unit fibroblasts. Furthermore, we were able to differentiate cmBMDCs into adipocytes, osteocytes, and chondrocytes in vitro, and they expressed the MSCmarkers CD44, CD73, CD90, and CD105, but their expression decreased with increasing passage number. The data demonstrate that cmBMDCs exhibit characteristics of MSCs and thus it would be beneficial to use these cells in preclinical studies.

  5. Differential endocrine responses to infant odors in common marmoset (Callithrix jacchus) fathers.

    Science.gov (United States)

    Ziegler, Toni E; Peterson, Laura J; Sosa, Megan E; Barnard, Allison M

    2011-02-01

    Olfactory cues can exert priming effects on many mammalian species. Paternally experienced marmosets, Callithrix jacchus, exposed to direct isolated olfactory contact with their own infant's scent show rapid decreases in testosterone levels within 20 min, whereas paternally inexperienced males do not. The following study tests whether there is a differential steroid response to exposure of infant scent from dependent infants (own and novel) and independent infants (own and novel). We examined the serum levels of estradiol, estrone, testosterone, dihydrotestosterone (DHT), and combined estrogens and androgens in eight male marmosets 20 min after exposure to isolated infant scent. Testosterone and androgen levels combined were significantly lower with exposure to own infant scent than a novel infant scent when the infants were at a dependent age but not at an independent age. Estrogen levels elevated significantly in response to own infant scent when the infants were at a dependent age but not at an independent age. These results suggest that marmoset fathers are more responsive to priming cues from related infants and hormonal responses from fathers are greatest when the infant is at a dependent age.

  6. Experimental Respiratory Infection of Marmosets (Callithrix jacchus) With Ebola Virus Kikwit.

    Science.gov (United States)

    Smither, Sophie J; Nelson, Michelle; Eastaugh, Lin; Nunez, Alejandro; Salguero, Francisco J; Lever, Mark S

    2015-10-01

    Ebola virus (EBOV) causes a highly infectious and lethal hemorrhagic fever in primates with high fatality rates during outbreaks and EBOV may be exploited as a potential biothreat pathogen. There is therefore a need to develop and license appropriate medical countermeasures against this virus. To determine whether the common marmoset (Callithrix jacchus) would be an appropriate model to assess vaccines or therapies against EBOV disease (EVD), initial susceptibility, lethality and pathogenesis studies were performed. Low doses of EBOV-Kikwit, between 4 and 27 times the 50% tissue culture infectious dose, were sufficient to cause a lethal, reproducible infection. Animals became febrile between days 5 and 6, maintaining a high fever before succumbing to EVD between 6 and 8 days after challenge. Typical signs of EVD were observed. Pathogenesis studies revealed that virus was isolated from the lungs of animals beginning on day 3 after challenge and from the liver, spleen and blood beginning on day 5. The most striking features were observed in animals that succumbed to infection, including high viral titers in all organs, increased levels of liver function enzymes and blood clotting times, decreased levels of platelets, multifocal moderate to severe hepatitis, and perivascular edema.

  7. Differences in social and vocal behavior between left- and right-handed common marmosets (Callithrix jacchus).

    Science.gov (United States)

    Gordon, Dianne J; Rogers, Lesley J

    2010-11-01

    Common marmosets (Callithrix jacchus) show either a left- or right-hand preference for reaching to pick up food and they retain the same preference throughout adult life. We compared the behavior of 10 right-handed and 10 left-handed marmosets, matched for age and sex. They were presented with live crickets both when alone and when in their social group. The marmosets captured more crickets and the latency to capture the first cricket was shorter when they were in a group than when they were alone. This effect of social facilitation was significantly greater for right- than left-handed individuals. The number of vocalizations (tsik, crackle, very brief whistle, cough, and phee) produced by the left- and right-handed marmosets differed significantly: right-handed marmosets produced an increased number of all of these calls when the crickets were presented, whereas left-handed marmosets did not show a change from pretesting levels. The right-handed marmosets also produced more tsik (mobbing) calls than left-handed marmosets when they were presented with a fear-inducing stimulus and performed more head cocking and parallax movements than the left-handed marmosets. Hence, hand preference is associated with differences in exploratory and social behavior, the latter including vocal communication.

  8. Diagnosis and Treatment of Trichospirura leptostoma Infection in Common Marmosets (Callithrix jacchus).

    Science.gov (United States)

    Hawkins, James V.; Clapp, Neal K.; Carson, Robert L.; Henke, Marsha A.; McCracken, Malcolm D.; Faulkner, Charles T.; Patton, Sharon

    1997-01-01

    Trichospirura leptostoma is a spirurid nematode that inhabits the pancreatic ducts of the common marmoset, Callithrix jacchus, and other New World primates. This parasite was diagnosed in members of this species at the Marmoset Research Center in Oak Ridge, Tennessee colony after their importation from multiple colonies outside the United States. Animals with few parasites in the pancreas had few tissue changes, whereas those with many parasites had moderate to severe fibrosis replacing exocrine tissue. Trichospirura leptostoma can cause chronic pancreatitis, resulting in subclinical to clinical pancreatic insufficiency and secondary malnutrition. Clinical signs of pancreatic insufficiency in affected marmosets included weight loss (despite good appetite) and increased fecal volume. Because earlier reports did not mention treatments, experimental therapeutic regimens were attempted to eliminate infections from the marmosets. In the clinical studies, different doses and treatment periods with ivermectin and fenbendazole were evaluated for therapeutic efficacy. Fenbendazole given daily at a dosage of 50 mg/kg of body weight by gavage for 14 days was the most effective treatment (PI 0.052). Control of the cockroach vector, as well as treatment of infected animals, is needed to prevent Trichospirura leptostoma-induced disease.

  9. Social mobbing calls in common marmosets (Callithrix jacchus): effects of experience and associated cortisol levels.

    Science.gov (United States)

    Clara, Elena; Tommasi, Luca; Rogers, Lesley J

    2008-04-01

    We compared the mobbing response to model snakes of two groups of captive-born common marmosets (Callithrix jacchus) differing in genetic relatedness, age and past experience. Mobbing vocalisations (tsik calls), other mobbing behaviour and attention to the stimulus were recorded for 2 min. intervals pre-exposure, during exposure to various stimuli and post-exposure. Marmosets in one group were vocally reactive to all stimuli, although more so to one particular stimulus resembling rearing snakes and modified images of it, whereas the marmosets in a younger and genetically unrelated group attended to the stimuli but made very few mobbing calls. The parent stock of the first group had suffered stress in early life and had developed a phobic response to a specific stimulus, which they had transmitted to their offspring. A third group, matching the older group in age range but genetically unrelated, was also found to be unresponsive to the stimulus that elicited the strongest response in the first group. Cortisol levels in samples of hair were assayed and a significant negative correlation was found between the number of tsik calls made during presentation of the stimuli and the cortisol level, showing that mobbing behaviour/behavioural reactivity is associated with low levels of physiological stress.

  10. COLLECTION AND ANALYSIS OF SEMEN FROM THE COMMON MARMOSET (Callithrix jacchus COLHEITA E AVALIAÇÃO DO SÊMEN DE SAGUI-DE-TUFO-BRANCO (Callithrix jacchus

    Directory of Open Access Journals (Sweden)

    César Roberto Esper

    2009-07-01

    Full Text Available y of different extenders on the semen from common marmoset to improve the quality of physical and morphological characteristics. Three adult specimens were used and nine ejaculates were collected from each one, using electroejaculation. To break up the seminal clot, nine variations of three different extenders were tested. TALP, Ca+2 free, with 0.5% tripsin, during 45 minutes at 37ºC, was the best extender, dissolving partially the semen clot. The electroejaculation is a viable semen collection method for common marmoset, obtaining success in all animals, but the semen quality was relatively poor.

    KEY WORDS: Callithrix jacchus, electroejaculation, primates, semen.
    método de eletroejaculação na colheita de sêmen de saguis-de-tufo-branco (Callithrix jacchus e realizar uma avaliação descritiva dos aspectos físicos e morfológicos do ejaculado. Foram utilizados três espécimes adultos e colhidas nove amostras de sêmen de cada animal, pela eletroejaculação. Para os testes de dissolução dos coágulos seminais, utilizaram-se nove variações de três tipos de meios. De todas as variações estudadas, o meio TALP, livre de íons Ca+2, acrescido de tripsina a 0,5%, durante 45 minutos, a 37º C, mostrou-se o mais eficiente na dissolução do coágulo, porém não foi capaz de dissolvê-lo completamente. O método de eletroejaculação para colheita de sêmen em C. jacchus mostrou-se viável, apresentando sucesso em todas as colheitas, porém a qualidade do sêmen apresentou-se baixa.

    PALAVRAS-CHAVES: Callithrix jacchus, eletroejaculação, primata, sêmen.

  11. Long-term fidelity of foraging techniques in common marmosets (Callithrix jacchus).

    Science.gov (United States)

    Gunhold, Tina; Range, Friederike; Huber, Ludwig; Bugnyar, Thomas

    2015-03-01

    The formation of behavioral traditions has been considered as one of the main building blocks of culture. Numerous studies on social learning in different animal species provide evidence for their capability of successful transmission of information. However, questions concerning the memory and maintenance of this information have received comparably little attention. After the innovation and initial spread of a novel behavior, the behavior should stabilize and be maintained over time. Otherwise, the behavioral pattern might collapse and no tradition formation would be possible. The aim of this study was to investigate long-term preferences in a two-action manipulation task in common marmosets (Callithrix jacchus). Three captive family groups (23 individuals in total) were trained on one of two possible techniques to open a wooden box and gain access to a food reward, by either pulling or pushing a flap door. The training phase took place in a family group setting, while the test phase was conducted individually. Although the subjects could experience the alternative technique during the test sessions, the majority preferentially used the technique learned in the group setting. Moreover, the subjects were re-tested six times over a period of more than four years, in order to examine the fidelity of their preferences. The longest break without exposure the task lasted for 3.5 years. In all tests, the marmosets showed a similar preference as in the first test block shortly after the training. To our knowledge, this is the first lab study that experimentally demonstrates memory and fidelity of experimentally seeded information in a manipulation task over a time period of several years, supporting the assumption that socially learned foraging techniques can lead to relatively stable behavioral traditions. © 2014 Wiley Periodicals, Inc.

  12. Differential virulence and disease progression following Mycobacterium tuberculosis complex infection of the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Via, Laura E; Weiner, Danielle M; Schimel, Daniel; Lin, Philana Ling; Dayao, Emmanuel; Tankersley, Sarah L; Cai, Ying; Coleman, M Teresa; Tomko, Jaime; Paripati, Praveen; Orandle, Marlene; Kastenmayer, Robin J; Tartakovsky, Michael; Rosenthal, Alexander; Portevin, Damien; Eum, Seok Yong; Lahouar, Saher; Gagneux, Sebastien; Young, Douglas B; Flynn, Joanne L; Barry, Clifton E

    2013-08-01

    Existing small-animal models of tuberculosis (TB) rarely develop cavitary disease, limiting their value for assessing the biology and dynamics of this highly important feature of human disease. To develop a smaller primate model with pathology similar to that seen in humans, we experimentally infected the common marmoset (Callithrix jacchus) with diverse strains of Mycobacterium tuberculosis of various pathogenic potentials. These included recent isolates of the modern Beijing lineage, the Euro-American X lineage, and M. africanum. All three strains produced fulminant disease in this animal with a spectrum of progression rates and clinical sequelae that could be monitored in real time using 2-deoxy-2-[(18)F]fluoro-d-glucose (FDG) positron emission tomography (PET)/computed tomography (CT). Lesion pathology at sacrifice revealed the entire spectrum of lesions observed in human TB patients. The three strains produced different rates of progression to disease, various extents of extrapulmonary dissemination, and various degrees of cavitation. The majority of live births in this species are twins, and comparison of results from siblings with different infecting strains allowed us to establish that the infection was highly reproducible and that the differential virulence of strains was not simply host variation. Quantitative assessment of disease burden by FDG-PET/CT provided an accurate reflection of the pathology findings at necropsy. These results suggest that the marmoset offers an attractive small-animal model of human disease that recapitulates both the complex pathology and spectrum of disease observed in humans infected with various M. tuberculosis strain clades.

  13. Non-invasive blood pressure measurement: values, problems and applicability in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Mietsch, M; Einspanier, A

    2015-07-01

    The common marmoset (Callithrix jacchus, C. j.) is an established primate model in biomedical research and for human-related diseases. Monitoring of cardiovascular parameters including blood pressure (BP) is important for the health surveillance of these experimental animals and the quantification of diseases or pharmaceutical substances influencing BP. Measurement guidelines for C. j. do not exist yet; therefore, the present study was carried out to establish a practicable protocol based on recommendations of the American College of Veterinary Internal Medicine (ACVIM). Furthermore, BP data of 49 marmosets (13.8-202.4 months of age) were obtained via high-definition oscillometry to further knowledge of physiological parameters and gender-related differences in this primate. The thighs proved to be the most suitable measurement localization, since systolic values were less variable (left 4.03 ± 2.90%, right 5.96 ± 2.77%) compared with the tail (12.7 ± 6.96%). BP values were similar in the morning and in the afternoon (P > 0.05). Data were highly reproducible within and between several sessions on three consecutive days (P > 0.05) as well as over the course of 20 months (P > 0.05). Furthermore, the measurement time for females was significantly shorter than for males (5:14 ± 1:59 min versus 6:50 ± 1:58 min, P = 0.007). Measurement recommendations for the common marmoset were successfully established. Standardized values enabled a reliable comparison of BP parameters, e.g. for cardiovascular, toxicological or metabolic research.

  14. Temporal bone characterization and cochlear implant feasibility in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Johnson, Luke A; Della Santina, Charles C; Wang, Xiaoqin

    2012-08-01

    The marmoset (Callithrix jacchus) is a valuable non-human primate model for studying behavioral and neural mechanisms related to vocal communication. It is also well suited for investigating neural mechanisms related to cochlear implants. The purpose of this study was to characterize marmoset temporal bone anatomy and investigate the feasibility of implanting a multi-channel intracochlear electrode into the marmoset scala tympani. Micro computed tomography (microCT) was used to create high-resolution images of marmoset temporal bones. Cochlear fluid spaces, middle ear ossicles, semicircular canals and the surrounding temporal bone were reconstructed in three-dimensional space. Our results show that the marmoset cochlea is ∼16.5 mm in length and has ∼2.8 turns. The cross-sectional area of the scala tympani is greatest (∼0.8 mm(2)) at ∼1.75 mm from the base of the scala, reduces to ∼0.4 mm(2) at 5 mm from the base, and decreases at a constant rate for the remaining length. Interestingly, this length-area profile, when scaled 2.5 times, is similar to the scala tympani of the human cochlea. Given these dimensions, a compatible multi-channel implant electrode was identified. In a cadaveric specimen, this electrode was inserted ¾ turn into the scala tympani through a cochleostomy at ∼1 mm apical to the round window. The depth of the most apical electrode band was ∼8 mm. Our study provides detailed structural anatomy data for the middle and inner ear of the marmoset, and suggests the potential of the marmoset as a new non-human primate model for cochlear implant research.

  15. Ocular wavefront aberrations in the common marmoset Callithrix jacchus: effects of age and refractive error.

    Science.gov (United States)

    Coletta, Nancy J; Marcos, Susana; Troilo, David

    2010-11-23

    The common marmoset, Callithrix jacchus, is a primate model for emmetropization studies. The refractive development of the marmoset eye depends on visual experience, so knowledge of the optical quality of the eye is valuable. We report on the wavefront aberrations of the marmoset eye, measured with a clinical Hartmann-Shack aberrometer (COAS, AMO Wavefront Sciences). Aberrations were measured on both eyes of 23 marmosets whose ages ranged from 18 to 452 days. Twenty-one of the subjects were members of studies of emmetropization and accommodation, and two were untreated normal subjects. Eleven of the 21 experimental subjects had worn monocular diffusers and 10 had worn binocular spectacle lenses of equal power. Monocular deprivation or lens rearing began at about 45 days of age and ended at about 108 days of age. All refractions and aberration measures were performed while the eyes were cyclopleged; most aberration measures were made while subjects were awake, but some control measurements were performed under anesthesia. Wavefront error was expressed as a seventh-order Zernike polynomial expansion, using the Optical Society of America's naming convention. Aberrations in young marmosets decreased up to about 100 days of age, after which the higher-order RMS aberration leveled off to about 0.10 μm over a 3 mm diameter pupil. Higher-order aberrations were 1.8 times greater when the subjects were under general anesthesia than when they were awake. Young marmoset eyes were characterized by negative spherical aberration. Form-deprived eyes of the monocular deprivation animals had greater wavefront aberrations than their fellow untreated eyes, particularly for asymmetric aberrations in the odd-numbered Zernike orders. Both lens-treated and form-deprived eyes showed similar significant increases in Z3(-3) trefoil aberration, suggesting the increase in trefoil may be related to factors that do not involve visual feedback.

  16. Body weight-associated differences in ovarian morphology in captive common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Scheerer-Bernhard, J U; Tkachenko, O Y; Heistermann, M; Gründker, C; Nayudu, P L

    2015-06-01

    In captivity, Callithrix jacchus (common marmoset) is on average heavier than their wild-living counterparts, and has a tendency to produce triplet litters rather than the normal twins. To provide initial basic information about possible weight-related differences among the ovaries, a morphometric study of follicular phase ovaries from 48 young adult marmosets has been carried out. Nearly 90% of these ovaries were found to contain some degree of luteal tissue composed of large and/or small cells. The luteal structures, follicles of all stages, and stroma were subjected to morphometric analysis, and these results were compared with body weight, circulating triglyceride, androstenedione, and total estrogens. Where only large luteal cells were present, the median body weight was the highest (only this group included animals over 500 g) compared with mixed, or only small luteal cells, or absence of luteal cells. Furthermore, in this group plasma triglycerides were significantly higher compared to other groups, suggesting possible role of triglycerides in promoting luteinisation. Plasma androstenedione was also a critical discriminating factor, and was elevated where large luteal cells were present even as a mixture with small cells suggesting the large luteal cells to be the likely major ovarian source of this hormone and its metabolites. Additionally, the ovaries with large luteal cells compared to those containing only small or no luteal cells, had lower primordial follicle reserve associated with high levels of atresia and luteinisation among growing non-ovulatory follicles, indicating an accelerated activation, but at the same time a suboptimal environment for follicular growth.

  17. Molecular signatures to define spermatogenic cells in common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Lin, Zachary Yu-Ching; Imamura, Masanori; Sano, Chiaki; Nakajima, Ryusuke; Suzuki, Tomoko; Yamadera, Rie; Takehara, Yuji; Okano, Hirotaka James; Sasaki, Erika; Okano, Hideyuki

    2012-05-01

    Germ cell development is a fundamental process required to produce offspring. The developmental program of spermatogenesis has been assumed to be similar among mammals. However, recent studies have revealed differences in the molecular properties of primate germ cells compared with the well-characterized mouse germ cells. This may prevent simple application of rodent insights into higher primates. Therefore, thorough investigation of primate germ cells is necessary, as this may lead to the development of more appropriate animal models. The aim of this study is to define molecular signatures of spermatogenic cells in the common marmoset, Callithrix jacchus. Interestingly, NANOG, PRDM1, DPPA3 (STELLA), IFITM3, and ZP1 transcripts, but no POU5F1 (OCT4), were detected in adult marmoset testis. Conversely, mouse testis expressed Pou5f1 but not Nanog, Prdm1, Dppa3, Ifitm3, and Zp1. Other previously described mouse germ cell markers were conserved in marmoset and mouse testes. Intriguingly, marmoset spermatogenic cells underwent dynamic protein expression in a developmental stage-specific manner; DDX4 (VASA) protein was present in gonocytes, diminished in spermatogonial cells, and reexpressed in spermatocytes. To investigate epigenetic differences between adult marmoset and mice, DNA methylation analyses identified unique epigenetic profiles to marmoset and mice. Marmoset NANOG and POU5F1 promoters in spermatogenic cells exhibited a methylation status opposite to that in mice, while the DDX4 and LEFTY1 loci, as well as imprinted genes, displayed an evolutionarily conserved methylation pattern. Marmosets have great advantages as models for human reproductive biology and are also valuable as experimental nonhuman primates; thus, the current study provides an important platform for primate reproductive biology, including possible applications to humans.

  18. The distribution of presumptive thoracic paraganglionic tissue in the common marmoset (Callithrix jacchus

    Directory of Open Access Journals (Sweden)

    Clarke J.A.

    2002-01-01

    Full Text Available The aortic-pulmonary regions (APR of seven adult marmosets (Callithrix jacchus and the region of the right subclavian artery of a further three marmosets were diffusion-fixed with 10% buffered formol-saline solution. In both regions serial 5-µm sections were cut and stained by the Martius yellow, brilliant crystal scarlet and soluble blue method. Presumptive thoracic paraganglionic (PTP tissue was only observed in the APR. PTP tissue was composed of small groups of cells that varied in size and number. The distribution of the groups of cells was extremely variable, so much so that it would be misleading to attempt to classify their position; they were not circumscribed by a connective tissue capsule, but were always related to the thoracic branches of the left vagus nerve. The cells lay in loose areolar tissue characteristic of this part of the mediastinum and received their blood supply from small adjacent connective tissue arterioles. Unlike the paraganglionic tissue found in the carotid body the cells in the thorax did not appear to have a profuse capillary blood supply. There was, however, a close cellular-neural relationship. The cells, 10-15 µm in diameter, were oval or rounded in appearance and possessed a central nucleus and clear cytoplasm. No evidence was found that these cells possessed a 'companion' cell reminiscent of the arrangement of type 1 and type 2 cells in the carotid body. In conclusion, we found evidence of presumed paraganglionic tissue in the APR of the marmoset which, however, did not show the characteristic histological features of the aortic body chemoreceptors that have been described in some non-primate mammals. A survey of the mediastina of other non-human primates is required to establish whether this finding is atypical for these animals.

  19. The influence of sex and relatedness on stress response in common marmosets (Callithrix jacchus).

    Science.gov (United States)

    Galvão-Coelho, Nicole L; Silva, Hélderes Peregrino A; De Sousa, Maria Bernardete Cordeiro

    2012-09-01

    Research in stress physiology has demonstrated the benefits of receiving social support during stressful conditions. However, recent data have shown that the efficacy of social support in buffering physiological and behavioral responses to stressor agents depends on species, sex, and relatedness among animals. This study investigated whether different kinds of social support (presence of same sex related or nonrelated conspecifics) have the same effect on hormonal (fecal cortisol levels) and behavioral responses (agonistic: scent-marking and individual piloerection; anxiety: locomotion; tension-reducing: autogrooming, allogrooming, and body contact). We used adult male and female isosexual dyads of Callithrix jacchus, a small Neotropical primate from the Callitrichidae family, widely used in the study of stress and related diseases. Following a 28-day baseline phase, dyads faced three challenging situations (phase 1: dyads were moved together from the baseline cage to a similar new cage; phase 2: each dyad member was moved alone to a new cage; and phase 3: dyad members were reunited in the same baseline cage). Type of social support was found to influence the response to stressors differently for each sex. Related male dyads did not change their hormonal or behavioral profile over the three experimental phases, when compared to the baseline phase. For nonrelated male dyads, social support buffered hormonal but not behavioral response. For females, the social support offered by a related and nonrelated animal, does not seem to buffer the stress response, as shown by correlations between agonistic behaviors versus cortisol and locomotion during all three experimental phases and a significant increase in fecal cortisol levels during phases 2 and 3, when compared with baseline levels. The results only partially support the buffering model theory and corroborate other studies reporting that the benefits of social support during a period of crisis arise only when it is

  20. Differential Virulence and Disease Progression following Mycobacterium tuberculosis Complex Infection of the Common Marmoset (Callithrix jacchus)

    Science.gov (United States)

    Via, Laura E.; Weiner, Danielle M.; Schimel, Daniel; Lin, Philana Ling; Dayao, Emmanuel; Tankersley, Sarah L.; Cai, Ying; Coleman, M. Teresa; Tomko, Jaime; Paripati, Praveen; Orandle, Marlene; Kastenmayer, Robin J.; Tartakovsky, Michael; Rosenthal, Alexander; Portevin, Damien; Eum, Seok Yong; Lahouar, Saher; Gagneux, Sebastien; Young, Douglas B.; Flynn, JoAnne L.

    2013-01-01

    Existing small-animal models of tuberculosis (TB) rarely develop cavitary disease, limiting their value for assessing the biology and dynamics of this highly important feature of human disease. To develop a smaller primate model with pathology similar to that seen in humans, we experimentally infected the common marmoset (Callithrix jacchus) with diverse strains of Mycobacterium tuberculosis of various pathogenic potentials. These included recent isolates of the modern Beijing lineage, the Euro-American X lineage, and M. africanum. All three strains produced fulminant disease in this animal with a spectrum of progression rates and clinical sequelae that could be monitored in real time using 2-deoxy-2-[18F]fluoro-d-glucose (FDG) positron emission tomography (PET)/computed tomography (CT). Lesion pathology at sacrifice revealed the entire spectrum of lesions observed in human TB patients. The three strains produced different rates of progression to disease, various extents of extrapulmonary dissemination, and various degrees of cavitation. The majority of live births in this species are twins, and comparison of results from siblings with different infecting strains allowed us to establish that the infection was highly reproducible and that the differential virulence of strains was not simply host variation. Quantitative assessment of disease burden by FDG-PET/CT provided an accurate reflection of the pathology findings at necropsy. These results suggest that the marmoset offers an attractive small-animal model of human disease that recapitulates both the complex pathology and spectrum of disease observed in humans infected with various M. tuberculosis strain clades. PMID:23716617

  1. Validation of non-fluorescent methods to reliably detect acrosomal and plasma membrane integrity of common marmoset (Callithrix jacchus) sperm.

    Science.gov (United States)

    Valle, R R; Valle, C M R; Nichi, M; Muniz, J A P C; Nayudu, P L; Guimarães, M A B V

    2008-07-01

    Simple, rapid and stable sperm evaluation methods which have been optimized for common marmoset (Callithrix jacchus) are critical for studies involving collection and evaluation of sperm in the field. This is particularly important for new species groups such as Callitrichidae where the sperm have been little studied. Of this family, C. jacchus is the best known, and has been chosen as a model species for other members of the genus Callithrix. The fundamental evaluation parameters for sperm of any species are viability and acrosomal status. Semen samples were collected by penile vibratory stimulation. To evaluate sperm plasma membrane integrity, Eosin-Nigrosin was tested here for the common marmoset sperm to be used under field conditions. Further, a non-fluorescent stain for acrosome, the "Simple" stain, developed for domestic and wild cats, was tested on common marmoset sperm. This was compared with a fluorescent staining, Fluorescein isothiocyanate-Pisum sativum agglutinin (FITC-PSA), routinely used and validated for common marmoset at the German Primate Centre to evaluate acrosomal integrity. Results obtained with the "Simple" stain showed a marked differentiation between sperm with intact and non-intact acrosome both with and without ionophore treatment and closely correlated with results obtained with FITC-PSA. Temperature had no effect on the results with the "Simple" stain and the complete processing is simple enough to be carried out under field conditions. These findings indicated that the "Simple" stain and Eosin-Nigrosin provide rapid and accurate results for C. jacchus sperm and that those methods can be reliably used as field tools for sperm evaluation for this species.

  2. Fatal Human herpesvirus 1 (HHV-1 infection in captive marmosets (Callithrix jacchus and Callithrix penicillata in Brazil: clinical and pathological characterization

    Directory of Open Access Journals (Sweden)

    Renata A. Casagrande

    2014-11-01

    Full Text Available Fatal Human herpesvirus 1 (HHV-1 was diagnosed in 12 captive marmosets (Callithrix jacchus and Callithrix penicillata from metropolitan region of São Paulo, São Paulo State. Clinical signs were variable among the cases, but most affected marmosets presented signs associated with viral epithelial replication: oral, lingual and facial skin ulcers and hypersalivation, and viral replication in the central nervous system: prostration, seizure and aggressive behavior. Consistent microscopic findings were diffuse mild to severe nonsuppurative necrotizing meningoencephalitis with gliosis, vasculitis and neuronal necrosis. Additionally, in the brain, oral cavity, skin, adrenal gland and myoenteric plexus intranuclear inclusion bodies were present. Immunohistochemistry confirmed the presence of the HHV-1 antigen in association with lesions in the brain, oral and lingual mucosa, facial skin, adrenal gland and myoenteric plexus. HHV-1-specific polymerase chain reaction (PCR analysis of the brain was carried out and the virus was detected in 7/8 infected marmosets. It is concluded that HHV-1 causes widespread fatal infection in marmosets.

  3. Bifidobacterium aesculapii sp. nov., from the faeces of the baby common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Modesto, M; Michelini, S; Stefanini, I; Ferrara, A; Tacconi, S; Biavati, B; Mattarelli, P

    2014-08-01

    Six Gram-positive-staining, microaerophilic, non-spore-forming, fructose-6-phosphate phosphoketolase-positive bacterial strains with a peculiar morphology were isolated from faecal samples of baby common marmosets (Callithrix jacchus). Cells of these strains showed a morphology not reported previously for a bifidobacterial species, which resembled a coiled snake, always coiled or ring shaped or forming a 'Y' shape. Strains MRM 3/1(T) and MRM 4/2 were chosen as representative strains and characterized further. The bacteria utilized a wide range of carbohydrates and produced urease. Glucose was fermented to acetate and lactate. Strain MRM 3/1(T) showed a peptidoglycan type unique among members of the genus Bifidobacterium. The DNA base composition was 64.7 mol% G+C. Almost-complete 16S rRNA, hsp60, clpC and rpoB gene sequences were obtained and phylogenetic relationships were determined. Comparative analysis of 16S rRNA gene sequences showed that strains MRM 3/1(T) and MRM 4/2 had the highest similarities to Bifidobacterium scardovii DSM 13734(T) (94.6%) and Bifidobacterium stellenboschense DSM 23968(T) (94.5%). Analysis of hsp60 showed that both strains were closely related to B. stellenboschense DSM 23968(T) (97.5% similarity); however, despite this high degree of similarity, our isolates could be distinguished from B. stellenboschense DSM 23968(T) by low levels of DNA-DNA relatedness (30.4% with MRM 3/1(T)). Strains MRM 3/1(T) and MRM 4/2 were located in an actinobacterial cluster and were more closely related to the genus Bifidobacterium than to other genera in the family Bifidobacteriaceae. On the basis of these results, strains MRM 3/1(T) and MRM 4/2 represent a novel species within the genus Bifidobacterium, for which the name Bifidobacterium aesculapii sp. nov. is proposed; the type strain is MRM 3/1(T) ( = DSM 26737(T) = JCM 18761(T)).

  4. Overview of models, methods, and reagents developed for translational autoimmunity research in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Jagessar, S Anwar; Vierboom, Michel; Blezer, Erwin L A; Bauer, Jan; Hart, Bert A 't; Kap, Yolanda S

    2013-01-01

    The common marmoset (Callithrix jacchus) is a small-bodied Neotropical primate and a useful preclinical animal model for translational research into autoimmune-mediated inflammatory diseases (AIMID), such as rheumatoid arthritis (RA) and multiple sclerosis (MS). The animal model for MS established in marmosets has proven their value for exploratory research into (etio) pathogenic mechanisms and for the evaluation of new therapies that cannot be tested in lower species because of their specificity for humans. Effective usage of the marmoset in preclinical immunological research has been hampered by the limited availability of blood for immunological studies and of reagents for profiling of cellular and humoral immune reactions. In this paper, we give a concise overview of the procedures and reagents that were developed over the years in our laboratory in marmoset models of the above-mentioned diseases.

  5. Toxoplasmosis in a colony of New World monkeys

    DEFF Research Database (Denmark)

    Dietz, H.H.; Henriksen, P.; Bille-Hansen, Vivi

    1997-01-01

    In a colony of New World monkeys five tamarins (Saguinus oedipus, Saguinus labiatus and Leontopithecus rosal. rosal.), three marmosets (Callithrix jacchus and Callithrix pygmaea) and one saki (Pithecia pithecia) died suddenly. The colony comprised 16 marmosets, 10 tamarins and three sakis. The ma...

  6. Molecular Cloning of Ghrelin and Characteristics of Ghrelin-Producing Cells in the Gastrointestinal Tract of the Common Marmoset (Callithrix jacchus).

    Science.gov (United States)

    Takemi, Shota; Sakata, Ichiro; Apu, Auvijit Saha; Tsukahara, Shinji; Yahashi, Satowa; Katsuura, Goro; Iwashige, Fumihiro; Akune, Atsushi; Inui, Akio; Sakai, Takafumi

    2016-10-01

    Ghrelin was first isolated from human and rat as an endogenous ligand for the growth hormone secretagogue receptor (GHS-R). In the present study, we determined the ghrelin cDNA sequence of the common marmoset (Callithrix jacchus), a small-bodied New World monkey, and investigated the distribution of ghrelin-producing cells in the gastrointestinal tract and localization profiles with somatostatin-producing cells. The marmoset ghrelin cDNA coding region was 354 base pairs, and showed high homology to that in human, rhesus monkey, and mouse. Marmoset ghrelin consists of 28 amino acids, and the N-terminal region is highly conserved as found in other mammalian species. Marmoset preproghrelin and mature ghrelin have 86.3% and 92.9% homology, respectively, to their human counterparts. Quantitative RT-PCR analysis showed that marmoset ghrelin mRNA is highly expressed in the stomach, but it is not detected in other tissues of the gastrointestinal tract. In addition, a large number of ghrelin mRNA-expressing cells and ghrelin-immunopositive cells were detected in the mucosal layer of the stomach, but not in the myenteric plexus. Moreover, all the ghrelin cells examined in the stomach were observed to be closed-type. Double staining showed that somatostatin-immunopositive cells were not co-localized with ghrelin-producing cells; however, a subset of somatostatin-immunopositive cells is directly adjacent to ghrelin-immunopositive cells. These findings suggest that the distribution of ghrelin cells in marmoset differs from that in rodents, and thus the marmoset may be a more useful model for the translational study of ghrelin in primates. In conclusion, we have clarified the expression and cell distribution of ghrelin in marmoset, which may represent a useful model in translational study.

  7. Comparative genome analysis of the major histocompatibility complex (MHC) class I B/C segments in primates elucidated by genomic sequencing in common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Shiina, Takashi; Kono, Azumi; Westphal, Nico; Suzuki, Shingo; Hosomichi, Kazuyoshi; Kita, Yuki F; Roos, Christian; Inoko, Hidetoshi; Walter, Lutz

    2011-08-01

    Common marmoset monkeys (Callithrix jacchus) have emerged as important animal models for biomedical research, necessitating a more extensive characterization of their major histocompatibility complex (MHC) region. However, the genomic information of the marmoset MHC (Caja) is still lacking. The MHC-B/C segment represents the most diverse MHC region among primates. Therefore, in this paper, to elucidate the detailed gene organization and evolutionary processes of the Caja class I B (Caja-B) segment, we determined two parts of the Caja-B sequences with 1,079 kb in total, ranging from H6orf15 to BAT1 and compared the structure and phylogeny with that of other primates. This segment contains 54 genes in total, nine Caja-B genes (Caja-B1 to Caja-B9), two MIC genes (MIC1 and MIC2), eight non-MHC genes, two non-coding genes, and 33 non-MHC pseudogenes that have not been observed in other primate MHC-B/C segments. Caja-B3, Caja-B4, and Caja-B7 encode proper MHC class I proteins according to amino acid structural characteristics. Phylogenetic relationships based on 48 MHC-I nucleotide sequences in primates suggested (1) species-specific divergence for Caja, Mamu, and HLA/Patr/Gogo lineages, (2) independent generation of the "seven coding exon" type MHC-B genes in Mamu and HLA/Patr/Gogo lineages from an ancestral "eight coding exon" type MHC-I gene, (3) parallel correlation with the long and short segmental duplication unit length in Caja and Mamu lineages. These findings indicate that the MHC-B/C segment has been under permanent selective pressure in the evolution of primates.

  8. Low doses of 2,3,7,8-tetrachlorodibenzo-p-dioxin increase transforming growth factor {beta} and cause myocardial fibrosis in marmosets (Callithrix jacchus)

    Energy Technology Data Exchange (ETDEWEB)

    Riecke, K.; Grimm, D.; Kossmehl, P.; Paul, M.; Stahlmann, R. [Inst. of Clinical Pharmacology and Toxicology, Benjamin Franklin Medical Center, Freie Univ. Berlin, Berlin (Germany); Shakibaei, M.; Schulze-Tanzil, G. [Inst. of Anatomy, Benjamin Franklin Medical Center, Freie Univ. Berlin, Berlin (Germany)

    2002-06-01

    Epidemiological studies have suggested an association between exposure to dioxins and cardiovascular morbidity and mortality. However, cardiotoxic effects of low doses of 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) in animals have not been reported so far. We studied the hearts of male marmosets (Callithrix jacchus) after treatment with single subcutaneous doses of 1, 10 or 100 ng TCDD/kg body weight or vehicle (toluene/DMSO 1+2 v/v, 100 {mu}l/kg body weight). The animals were killed 2 or 4 weeks after treatment. Tissue samples of left ventricular myocardium were stained with picrosirius red and examined histologically along with quantitative image analysis. Extracellular matrix proteins were additionally analysed by western blotting. Monkeys showed no overt signs of toxicity nor did their relative heart weights differ significantly depending on treatment. Histology revealed an increase of picrosirius red-positive area above control values in 2 of 4 (1 ng TCDD/kg body weight), 6 of 12 (10 ng/kg) and 6 of 10 (100 ng/kg) marmosets. Western blotting confirmed these histological findings showing an increase of collagen, fibronectin and laminin in the hearts of TCDD-treated animals. Western blotting additionally showed an increased concentration of transforming growth factor {beta}1 (TGF-{beta}1) as well as TGF-{beta} receptor type I which could be a functional link to the effects on extracellular matrix. Our findings might explain the association of TCDD exposure with increased cardiovascular mortality observed in epidemiological studies and should stimulate further research on the role of changes in the extracellular matrix in the toxic effects of dioxins and related substances on other organs. (orig.)

  9. Colonization with nontuberculous mycobacteria is associated with positive tuberculin skin test reactions in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Wachtman, Lynn M; Miller, Andrew D; Xia, DongLing; Curran, Elizabeth H; Mansfield, Keith G

    2011-06-01

    Mycobacterium tuberculosis infections can result in significant morbidity and mortality in nonhuman primate colonies. Preventative health programs designed to detect infection routinely include tuberculin skin testing (TST). Because Mammalian Old Tuberculin used for TST contains antigens common to a variety of mycobacterial species, false-positive results can occur in animals sensitized to nontuberculous mycobacteria (NTM). Over 11 mo, a large colony of common marmosets (Callithrix jacchus) demonstrated a 3.6% prevalence of equivocal or positive TST reactions (termed 'suspect reactions'). Culture of gastric aspirates, bronchoalveolar lavage fluid, and feces revealed a single animal with a positive fecal culture for Mycobacterium gordonae. PCR amplification of M. gordonae DNA in feces collected from animals with suspect TST reactions (demonstrating a 66.7% colonization rate) and colony controls (demonstrating a 14.3% colonization rate) revealed a significant association between suspect TST reactions and intestinal colonization. Gross and histopathologic evaluation revealed a multifocal lymphadenopathy and granulomatous lymphadenitis in 2 of 4 TST-positive marmosets examined. Counter to expectations, granulomatous lymphoid tissue was culture-positive for M. kansasii rather than M. gordonae. Detection of M. gordonae in the feces of TST-suspect animals likely represents an apathogenic intestinal colonization that may serve as an indicator of NTM exposure, whereas evidence of histopathologic disease is associated with the more pathogenic M. kansasii. Although a high index of suspicion for M. tuberculosis should always be maintained, colonization with NTM organisms represents a cause of suspect TST reactions in common marmosets.

  10. Using Snacks High in Fat and Protein to Improve Glucoregulatory Function in Adolescent Male Marmosets (Callithrix jacchus)

    Science.gov (United States)

    Ziegler, Toni E; Sosa, Megan E; Peterson, Laura J; Colman, Ricki J

    2013-01-01

    The common marmoset (Callithrix jacchus), a laboratory nonhuman primate, is a well-known model of several human diseases and conditions, but the nutritional needs of these animals are not fully understood. Here we describe a 4-mo controlled study in which we increased the dietary fat and protein of subadult male common marmosets by using healthy snacks. Six male marmosets received their normal diet (control), and an additional 6 were given their normal diet supplemented daily with a 14-kcal snack. Cashews and waxworms were used as the snack, given their high-fat content. Although body weight did not differ between the 2 groups, only control male marmosets showed increased chest circumferences over the course of the study. Glucoregulatory function remained consistent in the snack-fed marmosets, whereas control animals had progressed toward higher insulin. Other indices of glucoregulation indicated significant differences in adiponectin and the cortisol:cortisone ratio between the 2 groups, but no differences in lipid concentration were detected. Therefore, the most notable difference attributable to the snack feeding was improved glucoregulation. Because the snacks we used had a high proportion of unsaturated compared with saturated fat, we suggest that these healthy high-fat–high-protein snacks provide an important contribution to the nutrition of this laboratory species. This study also demonstrates the utility of marmosets as a model for understanding the implications of dietary fats in humans. PMID:24351764

  11. Novel marmoset (Callithrix jacchus model of human Herpesvirus 6A and 6B infections: immunologic, virologic and radiologic characterization.

    Directory of Open Access Journals (Sweden)

    Emily Leibovitch

    2013-01-01

    Full Text Available Human Herpesvirus 6 (HHV-6 is a ubiquitous virus with an estimated seroprevalence of 95% in the adult population. HHV-6 is associated with several neurologic disorders, including multiple sclerosis, an inflammatory demyelinating disease affecting the CNS. Animal models of HHV-6 infection would help clarify its role in human disease but have been slow to develop because rodents lack CD46, the receptor for cellular entry. Therefore, we investigated the effects of HHV-6 infections in a non-human primate, the common marmoset Callithrix jacchus. We inoculated a total of 12 marmosets with HHV-6A and HHV-6B intravenously and HHV-6A intranasally. Animals were monitored for 25 weeks post-inoculation clinically, immunologically and by MRI. Marmosets inoculated with HHV-6A intravenously exhibited neurologic symptoms and generated virus-specific antibody responses, while those inoculated intravenously with HHV-6B were asymptomatic and generated comparatively lower antibody responses. Viral DNA was detected at a low frequency in paraffin-embedded CNS tissue of a subset of marmosets inoculated with HHV-6A and HHV-6B intravenously. When different routes of HHV-6A inoculation were compared, intravenous inoculation resulted in virus-specific antibody responses and infrequent detection of viral DNA in the periphery, while intranasal inoculation resulted in negligible virus-specific antibody responses and frequent detection of viral DNA in the periphery. Moreover, marmosets inoculated with HHV-6A intravenously exhibited neurologic symptoms, while marmosets inoculated with HHV-6A intranasally were asymptomatic. We demonstrate that a marmoset model of HHV-6 infection can serve to further define the contribution of this ubiquitous virus to human neurologic disorders.

  12. A longitudinal analysis of the effects of age on the blood plasma metabolome in the common marmoset, Callithrix jacchus.

    Science.gov (United States)

    Hoffman, Jessica M; Tran, ViLinh; Wachtman, Lynn M; Green, Cara L; Jones, Dean P; Promislow, Daniel E L

    2016-04-01

    Primates tend to be long-lived for their size with humans being the longest lived of all primates. There are compelling reasons to understand the underlying age-related processes that shape human lifespan. But the very fact of our long lifespan that makes it so compelling, also makes it especially difficult to study. Thus, in studies of aging, researchers have turned to non-human primate models, including chimpanzees, baboons, and rhesus macaques. More recently, the common marmoset, Callithrix jacchus, has been recognized as a particularly valuable model in studies of aging, given its small size, ease of housing in captivity, and relatively short lifespan. However, little is known about the physiological changes that occur as marmosets age. To begin to fill in this gap, we utilized high sensitivity metabolomics to define the longitudinal biochemical changes associated with age in the common marmoset. We measured 2104 metabolites from blood plasma at three separate time points over a 17-month period, and we completed both a cross-sectional and longitudinal analysis of the metabolome. We discovered hundreds of metabolites associated with age and body weight in both male and female animals. Our longitudinal analysis identified age-associated metabolic pathways that were not found in our cross-sectional analysis. Pathways enriched for age-associated metabolites included tryptophan, nucleotide, and xenobiotic metabolism, suggesting these biochemical pathways might play an important role in the basic mechanisms of aging in primates. Moreover, we found that many metabolic pathways associated with age were sex specific. Our work illustrates the power of longitudinal approaches, even in a short time frame, to discover novel biochemical changes that occur with age.

  13. Novel marmoset (Callithrix jacchus) model of human Herpesvirus 6A and 6B infections: immunologic, virologic and radiologic characterization.

    Science.gov (United States)

    Leibovitch, Emily; Wohler, Jillian E; Cummings Macri, Sheila M; Motanic, Kelsey; Harberts, Erin; Gaitán, María I; Maggi, Pietro; Ellis, Mary; Westmoreland, Susan; Silva, Afonso; Reich, Daniel S; Jacobson, Steven

    2013-01-01

    Human Herpesvirus 6 (HHV-6) is a ubiquitous virus with an estimated seroprevalence of 95% in the adult population. HHV-6 is associated with several neurologic disorders, including multiple sclerosis, an inflammatory demyelinating disease affecting the CNS. Animal models of HHV-6 infection would help clarify its role in human disease but have been slow to develop because rodents lack CD46, the receptor for cellular entry. Therefore, we investigated the effects of HHV-6 infections in a non-human primate, the common marmoset Callithrix jacchus. We inoculated a total of 12 marmosets with HHV-6A and HHV-6B intravenously and HHV-6A intranasally. Animals were monitored for 25 weeks post-inoculation clinically, immunologically and by MRI. Marmosets inoculated with HHV-6A intravenously exhibited neurologic symptoms and generated virus-specific antibody responses, while those inoculated intravenously with HHV-6B were asymptomatic and generated comparatively lower antibody responses. Viral DNA was detected at a low frequency in paraffin-embedded CNS tissue of a subset of marmosets inoculated with HHV-6A and HHV-6B intravenously. When different routes of HHV-6A inoculation were compared, intravenous inoculation resulted in virus-specific antibody responses and infrequent detection of viral DNA in the periphery, while intranasal inoculation resulted in negligible virus-specific antibody responses and frequent detection of viral DNA in the periphery. Moreover, marmosets inoculated with HHV-6A intravenously exhibited neurologic symptoms, while marmosets inoculated with HHV-6A intranasally were asymptomatic. We demonstrate that a marmoset model of HHV-6 infection can serve to further define the contribution of this ubiquitous virus to human neurologic disorders.

  14. Septo-temporal distribution and lineage progression of hippocampal neurogenesis in a primate (Callithrix jacchus in comparison to mice

    Directory of Open Access Journals (Sweden)

    Irmgard eAmrein

    2015-06-01

    Full Text Available Adult born neurons in the hippocampus show species-specific differences in their numbers, the pace of their maturation and their spatial distribution. Here, we present quantitative data on adult hippocampal neurogenesis in a New World primate, the common marmoset (Callithrix jacchus that demonstrate parts of the lineage progression and age-related changes. Proliferation was largely (~70% restricted to stem cells or early progenitor cells, whilst the remainder of the cycling pool could be assigned almost exclusively to Tbr2+, intermediate precursor cells in both neonate and adult animals (20-122 months. Proliferating DCX+ neuroblasts were virtually absent in adults, although rare MCM2+/DCX+ co-expression reveals a small, persisting proliferative potential. Co-expression of DCX with calretinin was very limited in marmosets, suggesting that these markers label distinct maturational stages. In adult marmosets, numbers of MCM2+, Ki67+, and significantly Tbr2+, DCX+ and CR+ cells declined with age. The distributions of granule cells, proliferating cells and DCX+ young neurons along the hippocampal longitudinal axis were equal in marmosets and mice. In both species, a gradient along the hippocampal septo-temporal axis was apparent for DCX+ and resident granule cells. Both cell numbers are higher septally than temporally, whilst proliferating cells were evenly distributed along this axis. Relative to resident granule cells however, the ratio of proliferating cells and DCX+ neurons remained constant in the septal, middle and temporal hippocampus. In marmosets, the extended phase of the maturation of young neurons that characterizes primate hippocampal neurogenesis was due to the extension in a large CR+/DCX- cell population. This clear dissociation between DCX+ and CR+ young neurons has not been reported for other species and may therefore represent a key primate specific feature of adult hippocampal neurogenesis.

  15. Cortical connections of auditory cortex in marmoset monkeys: lateral belt and parabelt regions

    OpenAIRE

    de la Mothe, Lisa A.; Blumell, Suzanne; Kajikawa, Yoshinao; Hackett, Troy A.

    2012-01-01

    The current working model of primate auditory cortex is constructed from a number of studies of both New and Old World monkeys. It includes three levels of processing. A primary level, the core region, is surrounded both medially and laterally by a secondary belt region. A third level of processing, the parabelt region, is located lateral to the belt. The marmoset monkey (Callithrix jacchus jacchus) has become an important model system to study auditory processing, but its anatomical organiza...

  16. Purification and partial characterization of α1-proteinase inhibitor in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Parambeth, Joseph Cyrus; Suchodolski, Jan S; Steiner, Jörg M

    2015-04-01

    Fecal alpha1-proteinase inhibitor (α1-PI) concentration has been to diagnose enteric protein loss in dogs and cats. Chronic lymphocytic enteritis is commonly seen in the marmoset (Callithrix jaccus) and is characterized by hypoalbuminemia. As a prelude to immunoassay development for detecting enteric protein loss, marmoset serum α1-PI was purified using immunoaffinity chromatography and ceramic hydroxyapatite chromatography. Partial characterization was performed by reducing gel electrophoresis and enzyme inhibitory assays. Protein identity was confirmed with peptide mass fingerprinting and N-terminal amino acid sequencing. Molecular mass, relative molecular mass, and isoelectric point for marmoset α1-PI were 54 kDa, 51,677, and 4.8-5.4, respectively. Trypsin, chymotrypsin, and elastase inhibitory activity were observed. N-terminal amino acid sequence for marmoset α1-PI was EDPQGDAAQKMDTSHH. In conclusion, marmoset α1-PI was successfully purified from serum with an overall yield of 12% using a rapid and efficient method. Purified marmoset α1-PI has characteristics similar to those of α1-PI reported for other species.

  17. Characterising trait anxiety in the common marmoset (Callithrix jacchus): investigations into behavioural, psychophysiological and cognitive phenotypes

    OpenAIRE

    Shiba, Yoshiro

    2013-01-01

    The major aim of my thesis project has been to develop a non-human primate model of trait anxiety, using a new world monkey, the common marmoset. The first step was to identify animals high or low in trait anxiety. Based on the findings that high trait-anxious individuals display over-generalization of fear responses, a pathogenic marker of elevated trait anxiety in humans, a new aversive discriminative conditioning paradigm was designed. Testing a normal cohort of marmosets revealed that 26%...

  18. Measurement of absolute auditory thresholds in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Osmanski, Michael S; Wang, Xiaoqin

    2011-07-01

    The common marmoset is a small, arboreal, New World primate that has emerged as a promising non-human model system in auditory neuroscience. A complete understanding of the neuroethology of auditory processing in marmosets will include behavioral work examining how sounds are perceived by these animals. However, there have been few studies of the marmoset's hearing and perceptual abilities and the audiogram of this species has not been measured using modern psychophysical methods. The present experiment pairs psychophysics with an operant conditioning technique to examine perception of pure tone stimuli by marmosets using an active behavioral paradigm. Subjects were trained to lick at a feeding tube when they detected a sound. Correct responses provided access to a food reward. Pure tones of varying intensities were presented to subjects using the method of constant stimuli. Behavioral thresholds were calculated for each animal based on hit rate--threshold was defined by the tone intensity that the animal correctly identified 50% of the time. Results show that marmoset hearing is comparable to that of other New World monkeys, with a hearing range extending from about 125 Hz up to 36 kHz and a sensitivity peak around 7 kHz.

  19. Touchscreen assays of learning, response inhibition, and motivation in the marmoset (Callithrix jacchus).

    Science.gov (United States)

    Kangas, Brian D; Bergman, Jack; Coyle, Joseph T

    2016-05-01

    Recent developments in precision gene editing have led to the emergence of the marmoset as an experimental subject of considerable interest and translational value. A better understanding of behavioral phenotypes of the common marmoset will inform the extent to which forthcoming transgenic mutants are cognitively intact. Therefore, additional information regarding their learning, inhibitory control, and motivational abilities is needed. The present studies used touchscreen-based repeated acquisition and discrimination reversal tasks to examine basic dimensions of learning and response inhibition. Marmosets were trained daily to respond to one of the two simultaneously presented novel stimuli. Subjects learned to discriminate the two stimuli (acquisition) and, subsequently, with the contingencies switched (reversal). In addition, progressive ratio performance was used to measure the effort expended to obtain a highly palatable reinforcer varying in magnitude and, thereby, provide an index of relative motivational value. Results indicate that rates of both acquisition and reversal of novel discriminations increased across successive sessions, but that rate of reversal learning remained slower than acquisition learning, i.e., more trials were needed for mastery. A positive correlation was observed between progressive ratio break point and reinforcement magnitude. These results closely replicate previous findings with squirrel monkeys, thus providing evidence of similarity in learning processes across nonhuman primate species. Moreover, these data provide key information about the normative phenotype of wild-type marmosets using three relevant behavioral endpoints.

  20. Use of alternative plant resources by common marmosets (Callithrix jacchus) in the semi-arid caatinga scrub forests of northeastern Brazil.

    Science.gov (United States)

    Amora, Tacyana Duarte; Beltrão-Mendes, Raone; Ferrari, Stephen F

    2013-04-01

    The common marmoset (Callithrix jacchus) is amply distributed in the Brazilian Northeast, but little is known of its ecology in the semi-arid Caatinga scrublands. The present study provides the first detailed data on the composition of the diet of C. jacchus in Caatinga ecosystems, derived from observations at four sites in the state of Sergipe. While exudate sources were gouged at all four sites in a manner typical of the species, fruit was the principal component of the diet at the main study site during most months, and a number of unusual items were eaten, including leaves, and the reproductive parts of cacti and bromeliads. These plants are rarely recorded in marmoset diets, but are common in caatinga habitats. Leaves were ingested during 5 of the 8 months monitored at the main study site, reaching 39.74% of the diet in 1 month, and appeared to be an alternative fallback food to plant exudates during periods when fruit was scarce. Three species of cactus provided both flowers and fruits, while the terrestrial bromeliad, Encholirium spectabile, provided nectar (30.81% of the diet in November). Approximately half of the plant species (and three families) identified in this study had not been recorded previously in the diet of Callithrix. Overall, the data suggest that, while the marmosets exploit the same types of plant foods in the Caatinga, the resource base is quite distinct from that of the Atlantic Forest. Other differences, such as relatively small groups and large home ranges, may contribute to divergent ecological patterns, which require more systematic investigation. Am. J. Primatol. 75:333-341, 2013. © 2012 Wiley Periodicals, Inc. © 2012 Wiley Periodicals, Inc.

  1. Comportamento e composição de um grupo de Callithrix jacchus Erxleben (Primates, Callitrichidae na mata de Dois Irmãos, Recife, Pernambuco, Brasil Behavior and composition of a group of Callithrix jacchus Erxleben (Primates, Callitrichidae in Dois Irmãos forest, Recife, Pernambuco, Brazil

    Directory of Open Access Journals (Sweden)

    Goretti Sônia da Silva

    1993-01-01

    Full Text Available The objective of this study was to determine the size and composition of a group of wild Callithrix jacchus Erxleben, 1777, a small neotropical primate from the North East Brazil. The study was carried out in Dois Irmãos Forest, Recife, Pernambuco, Brazil, in an area of 6ha where this social group of marmosets had its home range. A graded transects system was cut to provide the access and moving during the observation period. To provide an individual identification for the members of the marmosets group and to achieve the objective of this study, two captures were made, with a six month interval between them in a 50x50m² area at the nuclear range of the group's area. The animals were realeased after a maximum period of 24h after traping. We made, during the whole study period, direct observations of the social group which wasn't limited only to count and identification of the marmosets, but expanded in consideration on the ecology and behavior of the Callithrix jacchus group. The results show us that the size and composition of the study group was similar to others descriptions for the Callitrichidae. The group composition suffered a 30% "turnover" in a six month interval, and the adults particulary, had a big frequency of change. One pair of infants was seen in December 1986 - in the middle of the dry season - and another infant appeared in the study group in 1987, just after the end of the wet season. Some dietary items were fruits, leaf buds and also exudate from the trunks and branchs of some tree's species. Intergroup agonistic interactions were recorded during February 1987.

  2. Effectivness of the GnRH analogue deslorelin as a reversible contraceptive in a neotropical primate, the Common Marmoset Callithrix Jacchus (Mammalia: Primates: Callitrichidae

    Directory of Open Access Journals (Sweden)

    Derek A. Rosenfield

    2016-04-01

    Full Text Available Deslorelin is a synthetic GnRH analogue, which is being used as a contraceptive in animals by acting as a gonadal suppressant.  The product Suprelorin (Virbac, Australia contains deslorelin as a biocompatible, slow release subcutaneous implant. The continuous release of deslorelin provokes a down-regulation of GnRH receptors, and subsequently, inhibition of the synthesis and release of the gonadotropins FSH and LH, necessary for gonadal activities.  The intention of this study was to investigate the effectiveness of a subcutaneous deslorelin acetate implant (2,35mg in suppressing ovarian cyclic activity and inhibiting ovulation in captive Common Marmoset Callithrix jacchus, and investigate the reversibility of the treatment.  Two experimental groups were formed, group deslorelin (D with three couples and control group (C with two couples.  To monitor the effect of the implants, hormones indicating ovarian cyclic activity were monitored non-invasively by enzyme immunoassay (fecal monoclonal antibody anti-progesterone CL 425.  Fecal samples were collected three times a week from all females during three trial phases (phase I: month 1,2,3 and 4; phase II: month: 5,6 and 7 and phase III: month 8,9 and 10.  In contrast to expectations the results of this trial indicated that there was no suppression of the ovarian cyclic activity, nor inhibition of the ovulation after the application of the implants.  The outcome of our trial can possibly be explained by the fact that the dosage of 2.35mg of deslorelin is not effective in C. jacchus.  We confirmed significant changes (p<0.05 of P4 metabolites from phase I to phase II due to the treatment after the implantation of the GnRH analogue Deslorelin.  The employed non-invasive fecal progesterone monitoring could be biologically validated and proved to be efficient in the detection of ovarian cyclic activity in this neotropical primate species, C. jacchus

  3. Abundant Occurrence of Basal Radial Glia in the Subventricular Zone of Embryonic Neocortex of a Lissencephalic Primate, the Common Marmoset Callithrix jacchus

    Science.gov (United States)

    Kelava, Iva; Reillo, Isabel; Murayama, Ayako Y.; Kalinka, Alex T.; Stenzel, Denise; Tomancak, Pavel; Matsuzaki, Fumio; Lebrand, Cécile; Sasaki, Erika; Schwamborn, Jens C.; Okano, Hideyuki; Borrell, Víctor

    2012-01-01

    Subventricular zone (SVZ) progenitors are a hallmark of the developing neocortex. Recent studies described a novel type of SVZ progenitor that retains a basal process at mitosis, sustains expression of radial glial markers, and is capable of self-renewal. These progenitors, referred to here as basal radial glia (bRG), occur at high relative abundance in the SVZ of gyrencephalic primates (human) and nonprimates (ferret) but not lissencephalic rodents (mouse). Here, we analyzed the occurrence of bRG cells in the embryonic neocortex of the common marmoset Callithrix jacchus, a near-lissencephalic primate. bRG cells, expressing Pax6, Sox2 (but not Tbr2), glutamate aspartate transporter, and glial fibrillary acidic protein and retaining a basal process at mitosis, occur at similar relative abundance in the marmoset SVZ as in human and ferret. The proportion of progenitors in M-phase was lower in embryonic marmoset than developing ferret neocortex, raising the possibility of a longer cell cycle. Fitting the gyrification indices of 26 anthropoid species to an evolutionary model suggested that the marmoset evolved from a gyrencephalic ancestor. Our results suggest that a high relative abundance of bRG cells may be necessary, but is not sufficient, for gyrencephaly and that the marmoset's lissencephaly evolved secondarily by changing progenitor parameters other than progenitor type. PMID:22114084

  4. Presence of Viral Genome in Urine and Development of Hematuria and Pathological Changes in Kidneys in Common Marmoset (Callithrix jacchus after Inoculation with Dengue Virus

    Directory of Open Access Journals (Sweden)

    Hirofumi Akari

    2013-05-01

    Full Text Available Common marmosets (Callithrix jacchus developed high levels of viremia, clinical signs including fever, weight loss, a decrease in activity and hematuria upon inoculation with dengue virus (DENV. Presence of DENV genome in urine samples and pathological changes in kidneys were examined in the present study. Levels of DENV genome were determined in 228 urine samples from 20 primary DENV-inoculated marmosets and in 56 urine samples from four secondary DENV-inoculated marmosets. DENV genome was detected in 75% (15/20 of marmosets after primary DENV infection. No DENV genome was detected in urine samples from the marmosets with secondary infection with homologous DENV (0%, 0/4. Two marmosets demonstrated hematuria. Pathological analysis of the kidneys demonstrated non-suppressive interstitial nephritis with renal tubular regeneration. DENV antigen-positive cells were detected in kidneys. In human dengue virus infections, some patients present renal symptoms. The results indicate that marmosets recapitulate some aspects of the involvement of kidneys in human DENV infection, and suggest that marmosets are potentially useful for the studies of the pathogenesis of DENV infection, including kidneys.

  5. Double expression of CD34 and CD117 on bone marrow progenitors is a hallmark of the development of functional mast cell of Callithrix jacchus (common marmoset).

    Science.gov (United States)

    Nunomura, Satoshi; Shimada, Shin; Kametani, Yoshie; Yamada, Yuko; Yoshioka, Mino; Suemizu, Hiroshi; Ozawa, Manabu; Itoh, Toshio; Kono, Azumi; Suzuki, Ryuji; Tani, Kenzaburo; Ando, Kiyoshi; Yagita, Hideo; Ra, Chisei; Habu, Sonoko; Satake, Masanobu; Sasaki, Erika

    2012-09-01

    Mast cells (MCs) are developed from hematopoietic progenitor cells and play an important role in inflammation. Study of the kinetics of development and accumulation of primate MC in vivo is crucial for the control of human inflammatory diseases, as evolution of the immune system is quite rapid and inflammation including MC response is considered to be different between mouse and human. In the present study, we examined the development of MC from hematopoietic progenitors of Callithrix jacchus (common marmoset), an experimental animal of nonhuman primates. Bone marrow cells were fractionated for the expression of CD34 and CD117 by cell sorting. MCs were developed in vitro or by transplanting the cells to NOD/SCID/IL-2γc knockout (NOG) mice. In vitro culture of CD34(+)CD117(+) (double positive, DP) cells with stem cell factor could generate high-affinity Fc epsilon receptor (FcεR)-expressing CD117(+) cells with typical granules. The developed MC released β-hexosaminidase and produced leukotriene C(4) after the stimulation of FcεRI. Transplantation of DP cells gave rise to a marked expansion of CD34(-)CD45(+)CD117(+)FcεR(+) cells in NOG mice. They expressed transcripts encoding chymase 1 and tryptase β. Differentiation of CD34(-)CD117(+) cells to MCs was relatively limited compared with the DP cells, similarly to human MCs. These results suggest that this marmoset system provides a good model for human MC development.

  6. Abundant occurrence of basal radial glia in the subventricular zone of embryonic neocortex of a lissencephalic primate, the common marmoset Callithrix jacchus.

    Science.gov (United States)

    Kelava, Iva; Reillo, Isabel; Murayama, Ayako Y; Kalinka, Alex T; Stenzel, Denise; Tomancak, Pavel; Matsuzaki, Fumio; Lebrand, Cécile; Sasaki, Erika; Schwamborn, Jens C; Okano, Hideyuki; Huttner, Wieland B; Borrell, Víctor

    2012-02-01

    Subventricular zone (SVZ) progenitors are a hallmark of the developing neocortex. Recent studies described a novel type of SVZ progenitor that retains a basal process at mitosis, sustains expression of radial glial markers, and is capable of self-renewal. These progenitors, referred to here as basal radial glia (bRG), occur at high relative abundance in the SVZ of gyrencephalic primates (human) and nonprimates (ferret) but not lissencephalic rodents (mouse). Here, we analyzed the occurrence of bRG cells in the embryonic neocortex of the common marmoset Callithrix jacchus, a near-lissencephalic primate. bRG cells, expressing Pax6, Sox2 (but not Tbr2), glutamate aspartate transporter, and glial fibrillary acidic protein and retaining a basal process at mitosis, occur at similar relative abundance in the marmoset SVZ as in human and ferret. The proportion of progenitors in M-phase was lower in embryonic marmoset than developing ferret neocortex, raising the possibility of a longer cell cycle. Fitting the gyrification indices of 26 anthropoid species to an evolutionary model suggested that the marmoset evolved from a gyrencephalic ancestor. Our results suggest that a high relative abundance of bRG cells may be necessary, but is not sufficient, for gyrencephaly and that the marmoset's lissencephaly evolved secondarily by changing progenitor parameters other than progenitor type.

  7. Caracterização farmacológica de artéria pulmonar de Callithrix jacchus : importância do sistema nervoso parassimpático?

    OpenAIRE

    Paulo Gabriel Gonzalez

    2014-01-01

    É bem estabelecido que a acetilcolina (ACh) produz relaxamento da musculatura lisa vascular através da liberação endotelial do óxido nítrico (NO) e, portanto, é uma das ferramentas farmacológicas mais utilizadas para avaliar a integridade do endotélio. Experimentos preliminares feito pelo nosso grupo mostraram que a ACh não relaxou a aorta e nem artéria pulmonar de sagui (Callithrix jacchus), além de induzir contração neste último leito em vaso com endotélio íntegro. Assim, o presente estudo ...

  8. Do snakes represent the principal predatory threat to callitrichids? Fatal attack of a viper (Bothrops leucurus) on a common marmoset (Callithrix jacchus) in the Atlantic Forest of the Brazilian Northeast.

    Science.gov (United States)

    Ferrari, Stephen F; Beltrão-Mendes, Raone

    2011-07-01

    A juvenile common marmoset (Callithrix jacchus) was attacked by a whitetail lancehead viper (Bothrops leucurus) while playing with other group members close to the ground at a site in northeastern Brazil. The attack was almost immediately fatal, but the viper was unable to ingest the body of the marmoset. After approximately 10 min, during which it attempted to swallow the marmoset a number of times, the viper moved away, abandoning the body. While raptors are the principal predators of callitrichids, this record reinforces the relative vulnerability of these primates to snakes in comparison with other platyrrhines, although the small number of recorded events precludes a more definitive analysis of the phenomenon.

  9. Remote long-term registrations of sleep-wake rhythms, core body temperature and activity in marmoset monkeys

    NARCIS (Netherlands)

    Hoffmann, Kerstin; Coolen, Alex; Schlumbohm, Christina; Meerlo, Peter; Fuchs, Eberhard

    2012-01-01

    Initial studies in the day active marmoset monkey (Callithrix jacchus) indicate that the sleep-wake cycle of these non-human primates resembles that of humans and therefore conceivably represent an appropriate model for human sleep. The methods currently employed for sleep studies in marmosets are

  10. Remote long-term registrations of sleep-wake rhythms, core body temperature and activity in marmoset monkeys

    NARCIS (Netherlands)

    Hoffmann, Kerstin; Coolen, Alex; Schlumbohm, Christina; Meerlo, Peter; Fuchs, Eberhard

    2012-01-01

    Initial studies in the day active marmoset monkey (Callithrix jacchus) indicate that the sleep-wake cycle of these non-human primates resembles that of humans and therefore conceivably represent an appropriate model for human sleep. The methods currently employed for sleep studies in marmosets are l

  11. Remote long-term registrations of sleep-wake rhythms, core body temperature and activity in marmoset monkeys

    NARCIS (Netherlands)

    Hoffmann, Kerstin; Coolen, Alex; Schlumbohm, Christina; Meerlo, Peter; Fuchs, Eberhard

    2012-01-01

    Initial studies in the day active marmoset monkey (Callithrix jacchus) indicate that the sleep-wake cycle of these non-human primates resembles that of humans and therefore conceivably represent an appropriate model for human sleep. The methods currently employed for sleep studies in marmosets are l

  12. Expression of accessory molecules and cytokines in acute EAE in marmoset monkeys (Callithrix jacchus)

    NARCIS (Netherlands)

    Laman, J.D.; Meurs, M. van; Schellekens, M.M.; Boer, M. de; Melchers, B.; Massacesi, L.; Lassmann, H.; Claassen, E.; Hart, B.A. 't

    1998-01-01

    Accessory molecules and cytokines are involved in the immunopathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE) in rodent models, and are potential targets for immunotherapy. Evaluation of such experimental therapies requires appropriate animal models. Therefo

  13. Minimally invasive transabdominal collection of preimplantation embryos from the common marmoset monkey (Callithrix jacchus).

    Science.gov (United States)

    Hanazawa, K; Mueller, T; Becker, T; Heistermann, M; Behr, R; Sasaki, E

    2012-09-01

    A novel, minimally invasive, transabdominal embryo collection method (transabdominal method) was developed as an alternative to a standard abdominal incision for embryo collection in the common marmoset. The abdominal incision method was used for 304 flushes using 36 female animals, whereas the transabdominal method was used for 488 flushes using 48 females; successful embryo collection rates were 48.0% and 48.4% (P > 0.05), respectively. These techniques were successfully duplicated at another institute (German Primate Center, DPZ). At that institution, successful embryo collection rates were 88.9% and 77.8% for the abdominal incision and transabdominal methods, respectively (P > 0.05), whereas the average numbers of preimplantation embryos obtained per flush were (mean ± SD) 1.91 ± 0.35 and 1.71 ± 0.14 (P > 0.05). The transabdominal method reduced animal stress, did not require incisional wound healing, and enabled successive embryo recoveries to be done much sooner. More embryos in early developmental stages (zygotes/morulae) were recovered using the transabdominal method (76.1%) than the abdominal incision method (52.6%, P marmoset developmental biology and embryology.

  14. Ensaio terapêutico com glucantime em sagüis (Callithrix jacchus infectados com uma cepa de Leishmania donovani aparentemente resistente ao tratamento

    Directory of Open Access Journals (Sweden)

    R. Dietze

    1985-03-01

    Full Text Available Os autores relatam o resultado de um ensaio terapêutico em sagüis com uma cepa de Leishmania donovani isolada de um caso humano fatal de calazar, clinicamente resistente aos antimoniais (Glucantime e Pentostam, Anfotericina B ePentamidina. Os testes cutâneos realizados no paciente para avaliação da imunidade celular foram negativos à exceção do DNCB a 2%. Quatro sangüis adultos (Callithrix jacchus foram inoculados por via intraperitoneal com uma suspensão deformas amastigotas de L. donovani. Duzentos e dez dias após, todos os animais mostravam formas amastigotas do protozoário, evidenciadas através de punção hepática por aspiração. Iniciou-se então um esquema terapêutico com glucantime (28 mgSb v/kg/dia em três séries de 10 dias com cinco dias de intervalo entre elas em três dosprimatas,ficando o quarto animal como controle. Nos três animais tratados houve curaparasitológica da doença, o mesmo não ocorrehdo com o controle. O fato de a amostra de L. donovani ter sido, no paciente, resistente aos vários tratamentos e ter sido sensível em modelo experimental à terapêutica com glucantime, sugere a possibilidade de que fatores imunológicos do paciente possam ter contribuído para a evolução fatal da doença.The authors describe a therapeutic study in marmosets (Callithrix jacchus of a strain of Leishmania donovani isolated from a fatal human case of Kala-azar. The patient failed to respond to antimoniais (Glucantime and Pentostam, Amphotericin B and pentamidine therapy. Skin tests for the evaluation of cellular immunity were negative with the exception of 2% dinitrochlobenzene. Four adult marmosets were inoculated intraperitoneally with a suspension of amastigotes of L. donovani isolated from the hamster liver and spleen. Two hundred and ten days later all the animals had amastigotes in aspirates obtained by liver puncture. Glucantime treatment 28 mg/kilogram body weightper day for 3 series of 10 days was begun in

  15. In vivo manipulation of γ9(+ T cells in the common marmoset (Callithrix Jacchus with phosphoantigen and effect on the progression of respiratory melioidosis.

    Directory of Open Access Journals (Sweden)

    Thomas R Laws

    Full Text Available Burkholderia pseudomallei is a dangerous human pathogen. Phosphoantigens specifically the target primate specific γ9(+δ2(+ T cells subset and some have been developed as potential immunotherapeutics. Previously, we demonstrated that, when stimulated with the phosphoantigen CHDMAPP, γ9(+δ2(+ T cells aid in the killing of intracellular B. pseudomallei bacteria. Moreover, we found that common marmoset (Callithrix Jacchus γ9(+ T cells increase in frequency and respond to the phosphoantigen CHDMAPP and/or B. pseudomallei, in combination with IL-2, in a similar manner to human γ9(+δ2(+ T cells. Here we evaluate the efficacy of the phosphoantigen CHDMAPP, in combination with IL-2, as a therapy against B. pseudomallei infection, in vivo. We found that the previous studies predicted the in vivo responsiveness of γ9(+ T cells to the CHDMAPP+IL-2 treatment and significant expansion of the numbers of peripheral and splenic γ9(+ T cells were observed. This effect was similar to those reported in other primate species treated with phosphoantigen. Furthermore, splenocytes were retrieved 7 days post onset of treatment, restimulated with CHDMAPP or heat-killed B. pseudomallei and the cultured γ9(+ T cells demonstrated no reduction in IFN-γ response when CHDMAPP+IL-2 animals were compared to IL-2 only treated animals. Using an established model of B. pseudomallei infection in the marmoset, we assessed the potential for using phosphoantigen as a novel immunotherapy. The CHDMAPP treatment regime had no effect on the progression of respiratory melioidosis and this was despite the presence of elevated numbers of γ9(+ T cells in the spleen, liver and lung and an increased proportion of IFN-γ(+ cells in response to infection. We therefore report that the common marmoset has proven a good model for studying the effect in vivo of γ9(+ T cell stimulation; however, γ9(+ T cells have little or no effect on the progression of lethal, respiratory B

  16. In vivo manipulation of γ9(+) T cells in the common marmoset (Callithrix Jacchus) with phosphoantigen and effect on the progression of respiratory melioidosis.

    Science.gov (United States)

    Laws, Thomas R; Nelson, Michelle; Bonnafous, Cecile; Sicard, Helene; Taylor, Christopher; Salguero, Francisco Javier; Atkins, Timothy P; Oyston, Petra C F; Rowland, Caroline A

    2013-01-01

    Burkholderia pseudomallei is a dangerous human pathogen. Phosphoantigens specifically the target primate specific γ9(+)δ2(+) T cells subset and some have been developed as potential immunotherapeutics. Previously, we demonstrated that, when stimulated with the phosphoantigen CHDMAPP, γ9(+)δ2(+) T cells aid in the killing of intracellular B. pseudomallei bacteria. Moreover, we found that common marmoset (Callithrix Jacchus) γ9(+) T cells increase in frequency and respond to the phosphoantigen CHDMAPP and/or B. pseudomallei, in combination with IL-2, in a similar manner to human γ9(+)δ2(+) T cells. Here we evaluate the efficacy of the phosphoantigen CHDMAPP, in combination with IL-2, as a therapy against B. pseudomallei infection, in vivo. We found that the previous studies predicted the in vivo responsiveness of γ9(+) T cells to the CHDMAPP+IL-2 treatment and significant expansion of the numbers of peripheral and splenic γ9(+) T cells were observed. This effect was similar to those reported in other primate species treated with phosphoantigen. Furthermore, splenocytes were retrieved 7 days post onset of treatment, restimulated with CHDMAPP or heat-killed B. pseudomallei and the cultured γ9(+) T cells demonstrated no reduction in IFN-γ response when CHDMAPP+IL-2 animals were compared to IL-2 only treated animals. Using an established model of B. pseudomallei infection in the marmoset, we assessed the potential for using phosphoantigen as a novel immunotherapy. The CHDMAPP treatment regime had no effect on the progression of respiratory melioidosis and this was despite the presence of elevated numbers of γ9(+) T cells in the spleen, liver and lung and an increased proportion of IFN-γ(+) cells in response to infection. We therefore report that the common marmoset has proven a good model for studying the effect in vivo of γ9(+) T cell stimulation; however, γ9(+) T cells have little or no effect on the progression of lethal, respiratory B. pseudomallei

  17. Polyhalogenated dibenzo-p-dioxins and dibenzofurans and the immune system. In vitro effects of 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) on lymphocytes of venous blood from man and a non-human primate (Callithrix jacchus)

    Energy Technology Data Exchange (ETDEWEB)

    Neubert, R.; Helge, H. (Freie Univ. Berlin (Germany, F.R.). Kinderklinik und Poliklinik); Jacob-Mueller, U.; Stahlmann, R.; Neubert, D. (Freie Univ. Berlin (Germany, F.R.). Inst. fuer Toxikologie und Embryonalpharmakologie)

    1991-04-01

    The effect of 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) on poke weed mitogen-stimulated proliferation and differentiation of peripheral lymphocytes was studied in vitro with cells from a non-human primate (marmoset monkey, Callithrix jacchus) and from man. Monoclonal antibodies and flow cytometry (FACScan) were used for analysis. The extent of the overall mitogen-stimulated proliferation of isolated lymphocytes in vitro from marmoset blood was only slightly reduced in the presence of TCDD compared to the solvent control (0.01% DMSO). However, incubation with TCDD in the culture medium together with the mitogen led to a pronounced decrease in the percentage of the lymphocyte subset with the surface marker CD4, and a concomitant increase in the percentage of CD8{sup +} cells. The lowest concentration found to be effective in vitro was 1x10{sup -13} M TCDD (25 fg TCDD/ml). When culturing lymphocytes from human blood of different donors under indentical conditions in the presence of TCDD and the mitogen, corresponding effects were observed to those seen with marmoset cells. A closer analysis of the T lymphocyte subsets affected revealed the CD4{sup +}CDw29{sup +} (helper-inducer cells) to be the main target for the action of TCDD. A clear-cut change in the percentage of this subpopulation was induced at concentrations as low as 1x10{sup -13} M TCDD. The development of the IL-2-marker in culture was only slightly affected by TCDD, and concentrations of 1x10{sup -12} M were required to slightly reduce the number of CD2{sup +}CD25{sup +} cells. Special B cells, namely CD20{sup +} (i.e. B{sub 1}) cells, were found to be especially susceptible to the action of TCDD, and clear-cut effects were seen in several experimental series at 1x10{sup -14} M TCDD. The formation of B cells with IgG lambda or kappa chains was also depressed in culture in the presence of TCDD. (orig./MG).

  18. Tamanho da área de vida e padrão de uso do espaço em grupos de sagüis, Callithrix jacchus (Linnaeus (Primates, Callitrichidae Home range size and pattern of range use in common marmoset groups, Callithrix jacchus (Linnaeus (Primates, Callitrichidae

    Directory of Open Access Journals (Sweden)

    Carla Soraia Soares de Castro

    2003-03-01

    Full Text Available The influence of abundance and distribution of fruits and gums resources in home range size and pattern of range use were investigated in Callithrix jacchus. From October 1996 to January 1998 two groups (QT and PB that lived in a National Forest/IBAMA-RN in northeastern Brazil (6º5'S, 35º12'W, were observed once a week by instantaneous scan sampling. The frequency of quadrant's visit in the home range was recorded at five minute intervals. Trees used for feeding on fruits and/or gum by the study groups were marked with flagging tape and numbered. Samples of the food items were collected for identification. Data on the temporal variation in fruits abundance was based on the monthly phenological observations of the marked trees. Study groups showed small home range size (QT: 2.4 ha and PB: 0.7 ha. No significant differences in home range size between dry and wet months were found, but groups showed a tendency to broadened the range use in the wet months. This revealed a behavioral strategy which marmosets exploited more gums face to decreased in fruits abundance. The abundance and distribution in clusters of fruits and gums resources influenced the pattern of range use and home range size.

  19. Simultaneous pharmacokinetics evaluation of human cytochrome P450 probes, caffeine, warfarin, omeprazole, metoprolol and midazolam, in common marmosets (Callithrix jacchus).

    Science.gov (United States)

    Uehara, Shotaro; Inoue, Takashi; Utoh, Masahiro; Toda, Akiko; Shimizu, Makiko; Uno, Yasuhiro; Sasaki, Erika; Yamazaki, Hiroshi

    2016-01-01

    1. Pharmacokinetics of human cytochrome P450 probes (caffeine, racemic warfarin, omeprazole, metoprolol and midazolam) composite, after single intravenous and oral administrations at doses of 0.20 and 1.0 mg kg(-1), respectively, to four male common marmosets were investigated. 2. The plasma concentrations of caffeine and warfarin decreased slowly in a monophasic manner but those of omeprazole, metoprolol and midazolam decreased extensively after intravenous and oral administrations, in a manner that approximated those as reported for pharmacokinetics in humans. 3. Bioavailabilities were ∼100% for caffeine and warfarin, but midazolam was 4% in marmosets, presumably because of contribution of marmoset P450 3A4 expressed in small intestine and liver, with a high catalytic efficiency for midazolam 1'-hydroxylation as evident in the recombinant system. 4. These results suggest that common marmosets, despite their rapid clearance of some human P450 probe substrates, could be an experimental model for humans and that marmoset P450s have functional characteristics that differ from those of human and/or cynomolgus monkey P450s in some aspects, indicating their importance in modeling in P450-dependent drug metabolism studies in marmosets and of further studies.

  20. An observational investigation of behavioural contagion in common marmosets (Callithrix jacchus: indications for contagious scent-marking.

    Directory of Open Access Journals (Sweden)

    Jorg J.M. Massen

    2016-08-01

    Full Text Available Behavioural contagion is suggested to promote group coordination that may facilitate activity transitions, increased vigilance and state matching. Apart from contagious yawning, however, very little attention has been given to this phenomenon, and studies on contagious yawning in primates have so far only focused on Old World monkeys and apes. Here we studied behavioural contagion in common marmosets, a species for which group coordination and vigilance are paramount. In particular, we investigated the contagiousness of yawning, stretching, scratching, tongue protrusion, gnawing and scent-marking. We coded these behaviours from 14 adult marmosets, from two different social groups. During testing sessions, animals were separated into groups of four individuals for 20-minute observation periods, across three distinct diurnal time points (morning, midday and afternoon to test for circadian patterns. We observed almost no yawning (0.12 yawns / hour and very little stretching behaviour. For all other behaviours, which were more common, we found several temporal and inter-individual differences (i.e., sex, age, dominance status predictive of these responses. Moreover, we found that gnawing and scent-marking, that almost always co-occurred as a fixed-action pattern, were highly temporally clustered within observation sessions. We discuss the relative absence of yawning in marmosets as well as the possible function of contagious scent-marking, and provide suggestions for future research into the proximate and ultimate functions of these behaviours in marmosets.

  1. An ethogram of the common marmoset (Calithrix jacchus jacchus): general behavioural repertoire.

    Science.gov (United States)

    Stevenson, M F; Poole, T B

    1976-05-01

    The behavioural repertoire of four captive breeding pairs of Callithrix jacchus jacchus is described. Social communication took the form of postures, facial expressions, vocalizations and piloerection displays. Detailed analyses were made of piloerection displays, adult play, copulatory, aggressive, and prey-catching behaviour. Aggressive behaviour was uncommon in adult mated pairs. Play between adults showed a degree of temporal of temporal organization. Vocalizations were the main methods of intragroup communication whilst piloerection displays were directed towards members of other groups and also to unfamiliar objects. The behavioural repertoire of C. jacchus jacchus is compared with that of other Primates.

  2. Bifidobacterium reuteri sp. nov., Bifidobacterium callitrichos sp. nov., Bifidobacterium saguini sp. nov., Bifidobacterium stellenboschense sp. nov. and Bifidobacterium biavatii sp. nov. isolated from faeces of common marmoset (Callithrix jacchus) and red-handed tamarin (Saguinus midas).

    Science.gov (United States)

    Endo, Akihito; Futagawa-Endo, Yuka; Schumann, Peter; Pukall, Rüdiger; Dicks, Leon M T

    2012-03-01

    Five strains of bifidobacteria were isolated from faeces of a common marmoset (Callithrix jacchus) and a red-handed tamarin (Saguinus midas). The five isolates clustered inside the phylogenetic group of the genus Bifidobacterium but did not show high sequence similarities between the isolates and to known species in the genus by phylogenetic analysis based on 16S rRNA gene sequences. Sequence analyses of dnaJ1 and hsp60 also indicated their independent phylogenetic positions to each other in the Bifidobacterium cluster. DNA G+C contents of the species ranged from 57.3 to 66.3 mol%, which is within the values recorded for Bifidobacterium species. All isolates showed fructose-6-phosphate phosphoketolase activity. Based on the data provided, the five isolates represent five novel species, for which the names Bifidobacterium reuteri sp. nov. (type strain: AFB22-1(T) = JCM 17295(T) = DSM 23975(T)), Bifidobacterium callitrichos sp. nov. (type strain: AFB22-5(T) = JCM 17296(T) = DSM 23973(T)), Bifidobacterium saguini sp. nov. (type strain: AFB23-1(T) = JCM 17297(T) = DSM 23967(T)), Bifidobacterium stellenboschense sp. nov. (type strain: AFB23-3(T) = JCM 17298(T) = DSM 23968(T)) and Bifidobacterium biavatii sp. nov. (type strain: AFB23-4(T) = JCM 17299(T) = DSM 23969(T)) are proposed.

  3. Natural variation in gestational cortisol is associated with patterns of growth in marmoset monkeys (Callithrix geoffroyi).

    Science.gov (United States)

    Mustoe, Aaryn C; Birnie, Andrew K; Korgan, Austin C; Santo, Jonathan B; French, Jeffrey A

    2012-02-01

    High levels of prenatal cortisol have been previously reported to retard fetal growth. Although cortisol plays a pivotal role in prenatal maturation, heightened exposure to cortisol can result in lower body weights at birth, which have been shown to be associated with adult diseases like hypertension and cardiovascular disease. This study examines the relationship between natural variation in gestational cortisol and fetal and postnatal growth in marmoset monkeys. Urinary samples obtained during the mother's gestation were analyzed for cortisol. Marmoset body mass index (BMI) was measured from birth through 540 days in 30- or 60-day intervals. Multi-level modeling was used to test if marmoset growth over time was predicted by changes in gestational cortisol controlling for time, sex, litter, and litter size. The results show that offspring exposed to intra-uterine environments with elevated levels of cortisol had lower linear BMI rates of change shortly after birth than did offspring exposed to lower levels of cortisol, but exhibited a higher curvilinear growth rate during adolescence. Average daily change in gestational cortisol during the first trimester had a stronger relationship with postnatal growth than change during the third trimester. Higher exposure to cortisol during gestation does alter developmental trajectories, however there appears to be a catch-up period during later post-natal growth. These observations contribute to a larger discussion about the relationship of maternal glucocorticoids on offspring development and the possibility of an earlier vulnerable developmental window.

  4. Qualitative de novo analysis of full length cDNA and quantitative analysis of gene expression for common marmoset (Callithrix jacchus) transcriptomes using parallel long-read technology and short-read sequencing.

    Science.gov (United States)

    Shimizu, Makiko; Iwano, Shunsuke; Uno, Yasuhiro; Uehara, Shotaro; Inoue, Takashi; Murayama, Norie; Onodera, Jun; Sasaki, Erika; Yamazaki, Hiroshi

    2014-01-01

    The common marmoset (Callithrix jacchus) is a non-human primate that could prove useful as human pharmacokinetic and biomedical research models. The cytochromes P450 (P450s) are a superfamily of enzymes that have critical roles in drug metabolism and disposition via monooxygenation of a broad range of xenobiotics; however, information on some marmoset P450s is currently limited. Therefore, identification and quantitative analysis of tissue-specific mRNA transcripts, including those of P450s and flavin-containing monooxygenases (FMO, another monooxygenase family), need to be carried out in detail before the marmoset can be used as an animal model in drug development. De novo assembly and expression analysis of marmoset transcripts were conducted with pooled liver, intestine, kidney, and brain samples from three male and three female marmosets. After unique sequences were automatically aligned by assembling software, the mean contig length was 718 bp (with a standard deviation of 457 bp) among a total of 47,883 transcripts. Approximately 30% of the total transcripts were matched to known marmoset sequences. Gene expression in 18 marmoset P450- and 4 FMO-like genes displayed some tissue-specific patterns. Of these, the three most highly expressed in marmoset liver were P450 2D-, 2E-, and 3A-like genes. In extrahepatic tissues, including brain, gene expressions of these monooxygenases were lower than those in liver, although P450 3A4 (previously P450 3A21) in intestine and P450 4A11- and FMO1-like genes in kidney were relatively highly expressed. By means of massive parallel long-read sequencing and short-read technology applied to marmoset liver, intestine, kidney, and brain, the combined next-generation sequencing analyses reported here were able to identify novel marmoset drug-metabolizing P450 transcripts that have until now been little reported. These results provide a foundation for mechanistic studies and pave the way for the use of marmosets as model animals

  5. Trypanosoma cruzi: avirulence of the PF strain to Callithrix marmosets

    Directory of Open Access Journals (Sweden)

    Humberto Menezes

    1981-06-01

    Full Text Available Callithrix jacchus geoffroy marmosets (HumBol. 1812 were injected once subcutaneously with 10.000 parasites/g body weight and followed for a period of six months. The PF strain of Trypanosoma cruzi was used. Follow-up was done through blood cultures, xenodiagnosis, serological tests, and ECG. A small number of normaI animais served as control.

  6. More effective induction of anesthesia using midazolam-butorphanol-ketamine-sevoflurane compared with ketamine-sevoflurane in the common marmoset monkey (Callithrix jacchus).

    Science.gov (United States)

    Ishibashi, Hidetoshi

    2016-02-01

    The common marmoset has been increasingly used for research in the biomedical field; however, there is little information available regarding effective methods of anesthesia in this species. This study retrospectively analyzed 2 regimens of anesthesia induction: intramuscular injection of ketamine followed by inhalation of 5% sevoflurane, and intramuscular injection of midazolam, butorphanol and ketamine followed by inhalation of 5% sevoflurane. Anesthetic depth did not reach the surgical anesthesia stage in 7 out of 99 animals receiving the former regimen, whereas there were only 2 such animals out of 273 receiving the latter regimen. The latter regimen, when followed by maintenance anesthesia with 3% sevoflurane inhalation, was successfully used in various nociceptive procedures. These results indicate that the injection of a combination of midazolam, butorphanol and ketamine followed by inhalation of a high concentration of sevoflurane is effective for anesthesia induction in marmosets.

  7. Efficient embryo transfer in the common marmoset monkey (Callithrix jacchus) with a reduced transfer volume: a non-surgical approach with cryopreserved late-stage embryos.

    Science.gov (United States)

    Ishibashi, Hidetoshi; Motohashi, Hideyuki H; Kumon, Mami; Yamamoto, Kazuhiro; Okada, Hironori; Okada, Takashi; Seki, Kazuhiko

    2013-05-01

    Among primates, the common marmoset is suitable for primate embryology research. Its small body size, however, has delayed the technical development of efficient embryo transfer. Furthermore, three factors have been determined to adversely affect the performance of marmoset embryo transfer: nonsurgical approaches, the use of cryopreserved embryos, and the use of late-stage embryos. Here we performed embryo transfer under conditions that included the above three factors and using either a small (1 μl or less) or a large volume (2-3 μl) of medium. The pregnancy and birth rates were 50% (5/10) and 27% (3/11), respectively, when using the large volume, and 80% (8/10) and 75% (9/12), respectively, when using the small volume. The latter scores exceed those of previous reports using comparable conditions. Thus, it appears that these three previously considered factors could be overcome, and we propose that reducing the transfer volume to 1 μl or less is essential for successful marmoset embryo transfer.

  8. Strategies in Landmark Use by Children, Adults, and Marmoset Monkeys

    Science.gov (United States)

    MacDonald, Suzanne E.; Spetch, Marcia L.; Kelly, Debbie M.; Cheng, Ken

    2004-01-01

    Common marmosets ("Callithrix jacchus jacchus"), human children, and human adults learned to find a goal that was located in the center of a square array of four identical landmarks. The location of the landmark array and corresponding goal varied across trials, so the task could not be solved without using the landmark array. In Experiment 1, a…

  9. The 14/15 association as a paradigmatic example of tracing karyotype evolution in New World monkeys.

    Science.gov (United States)

    Capozzi, Oronzo; Archidiacono, Nicoletta; Lorusso, Nicola; Stanyon, Roscoe; Rocchi, Mariano

    2016-09-01

    Fluorescence in situ hybridization (FISH), especially chromosome painting, has been extensively exploited in the phylogenetic reconstruction of primate evolution. Although chromosome painting is a key method to map translocations, it is not effective in detecting chromosome inversions, which may be up to four times more frequent than other chromosomal rearrangements. BAC-FISH instead can economically delineate marker order and reveal intrachromosomal rearrangements. However, up to now, BAC-FISH was rarely used to study the chromosomes of New World monkeys partly due to technical difficulties. In this paper, we used BAC-FISH to disentangle the complex evolutionary history of the ancestral 14/15 association in NWMs, beginning from the squirrel monkey (Saimiri boliviensis). To improve the hybridization efficiency of BAC-FISH in NWMs, we "translated" the human BACs into Callithrix jacchus (CJA) BACs, which yielded much higher hybridization efficiencies on other NWM species than human BACs. Our results disclosed 14 synteny blocks in squirrel monkeys, 7 more than with chromosome painting. We then applied a subset of CJA BACs on six other NWM species. The comparison of the hybridization pattern of these species contained phylogenetic information to discriminate evolutionary relationships. Notably Aotus was found to share an inversion with Callithrix, thus definitely assigning the genus Aotus to Cebidae. The present study can be seen as a paradigmatic approach to investigate the phylogenetics of NWMs by molecular cytogenetics.

  10. Dissecting the mechanisms of squirrel monkey (Saimiri boliviensis) social learning.

    Science.gov (United States)

    Hopper, Lm; Holmes, An; Williams, LE; Brosnan, Sf

    2013-01-01

    Although the social learning abilities of monkeys have been well documented, this research has only focused on a few species. Furthermore, of those that also incorporated dissections of social learning mechanisms, the majority studied either capuchins (Cebus apella) or marmosets (Callithrix jacchus). To gain a broader understanding of how monkeys gain new skills, we tested squirrel monkeys (Saimiri boliviensis) which have never been studied in tests of social learning mechanisms. To determine whether S. boliviensis can socially learn, we ran "open diffusion" tests with monkeys housed in two social groups (N = 23). Over the course of 10 20-min sessions, the monkeys in each group observed a trained group member retrieving a mealworm from a bidirectional task (the "Slide-box"). Two thirds (67%) of these monkeys both learned how to operate the Slide-box and they also moved the door significantly more times in the direction modeled by the trained demonstrator than the alternative direction. To tease apart the underlying social learning mechanisms we ran a series of three control conditions with 35 squirrel monkeys that had no previous experience with the Slide-box. The first replicated the experimental open diffusion sessions but without the inclusion of a trained model, the second was a no-information control with dyads of monkeys, and the third was a 'ghost' display shown to individual monkeys. The first two controls tested for the importance of social support (mere presence effect) and the ghost display showed the affordances of the task to the monkeys. The monkeys showed a certain level of success in the group control (54% of subjects solved the task on one or more occasions) and paired controls (28% were successful) but none were successful in the ghost control. We propose that the squirrel monkeys' learning, observed in the experimental open diffusion tests, can be best described by a combination of social learning mechanisms in concert; in this case, those

  11. Dissecting the mechanisms of squirrel monkey (Saimiri boliviensis social learning

    Directory of Open Access Journals (Sweden)

    LM Hopper

    2013-02-01

    Full Text Available Although the social learning abilities of monkeys have been well documented, this research has only focused on a few species. Furthermore, of those that also incorporated dissections of social learning mechanisms, the majority studied either capuchins (Cebus apella or marmosets (Callithrix jacchus. To gain a broader understanding of how monkeys gain new skills, we tested squirrel monkeys (Saimiri boliviensis which have never been studied in tests of social learning mechanisms. To determine whether S. boliviensis can socially learn, we ran “open diffusion” tests with monkeys housed in two social groups (N = 23. Over the course of 10 20-min sessions, the monkeys in each group observed a trained group member retrieving a mealworm from a bidirectional task (the “Slide-box”. Two thirds (67% of these monkeys both learned how to operate the Slide-box and they also moved the door significantly more times in the direction modeled by the trained demonstrator than the alternative direction. To tease apart the underlying social learning mechanisms we ran a series of three control conditions with 35 squirrel monkeys that had no previous experience with the Slide-box. The first replicated the experimental open diffusion sessions but without the inclusion of a trained model, the second was a no-information control with dyads of monkeys, and the third was a ‘ghost’ display shown to individual monkeys. The first two controls tested for the importance of social support (mere presence effect and the ghost display showed the affordances of the task to the monkeys. The monkeys showed a certain level of success in the group control (54% of subjects solved the task on one or more occasions and paired controls (28% were successful but none were successful in the ghost control. We propose that the squirrel monkeys’ learning, observed in the experimental open diffusion tests, can be best described by a combination of social learning mechanisms in concert

  12. Mirror Neurons in a New World Monkey, Common Marmoset.

    Science.gov (United States)

    Suzuki, Wataru; Banno, Taku; Miyakawa, Naohisa; Abe, Hiroshi; Goda, Naokazu; Ichinohe, Noritaka

    2015-01-01

    Mirror neurons respond when executing a motor act and when observing others' similar act. So far, mirror neurons have been found only in macaques, humans, and songbirds. To investigate the degree of phylogenetic specialization of mirror neurons during the course of their evolution, we determined whether mirror neurons with similar properties to macaques occur in a New World monkey, the common marmoset (Callithrix jacchus). The ventral premotor cortex (PMv), where mirror neurons have been reported in macaques, is difficult to identify in marmosets, since no sulcal landmarks exist in the frontal cortex. We addressed this problem using "in vivo" connection imaging methods. That is, we first identified cells responsive to others' grasping action in a clear landmark, the superior temporal sulcus (STS), under anesthesia, and injected fluorescent tracers into the region. By fluorescence stereomicroscopy, we identified clusters of labeled cells in the ventrolateral frontal cortex, which were confirmed to be within the ventrolateral frontal cortex including PMv after sacrifice. We next implanted electrodes into the ventrolateral frontal cortex and STS and recorded single/multi-units under an awake condition. As a result, we found neurons in the ventrolateral frontal cortex with characteristic "mirror" properties quite similar to those in macaques. This finding suggests that mirror neurons occur in a common ancestor of New and Old World monkeys and its common properties are preserved during the course of primate evolution.

  13. Long-Term Oocyte-Like Cell Development in Cultures Derived from Neonatal Marmoset Monkey Ovary

    Directory of Open Access Journals (Sweden)

    Bentolhoda Fereydouni

    2016-01-01

    Full Text Available We use the common marmoset monkey (Callithrix jacchus as a preclinical nonhuman primate model to study reproductive and stem cell biology. The neonatal marmoset monkey ovary contains numerous primitive premeiotic germ cells (oogonia expressing pluripotent stem cell markers including OCT4A (POU5F1. This is a peculiarity compared to neonatal human and rodent ovaries. Here, we aimed at culturing marmoset oogonia from neonatal ovaries. We established a culture system being stable for more than 20 passages and 5 months. Importantly, comparative transcriptome analysis of the cultured cells with neonatal ovary, embryonic stem cells, and fibroblasts revealed a lack of germ cell and pluripotency genes indicating the complete loss of oogonia upon initiation of the culture. From passage 4 onwards, however, the cultured cells produced large spherical, free-floating cells resembling oocyte-like cells (OLCs. OLCs strongly expressed several germ cell genes and may derive from the ovarian surface epithelium. In summary, our novel primate ovarian cell culture initially lacked detectable germ cells but then produced OLCs over a long period of time. This culture system may allow a deeper analysis of early phases of female primate germ cell development and—after significant refinement—possibly also the production of monkey oocytes.

  14. Density, proportion, and dendritic coverage of retinal ganglion cells of the common marmoset (Callithrix jacchus jacchus

    Directory of Open Access Journals (Sweden)

    F.L. Gomes

    2005-06-01

    Full Text Available We performed a quantitative analysis of M and P cell mosaics of the common-marmoset retina. Ganglion cells were labeled retrogradely from optic nerve deposits of Biocytin. The labeling was visualized using horseradish peroxidase (HRP histochemistry and 3-3'diaminobenzidine as chromogen. M and P cells were morphologically similar to those found in Old- and New-World primates. Measurements were performed on well-stained cells from 4 retinas of different animals. We analyzed separate mosaics for inner and outer M and P cells at increasing distances from the fovea (2.5-9 mm of eccentricity to estimate cell density, proportion, and dendritic coverage. M cell density decreased towards the retinal periphery in all quadrants. M cell density was higher in the nasal quadrant than in other retinal regions at similar eccentricities, reaching about 740 cells/mm² at 2.5 mm of temporal eccentricity, and representing 8-14% of all ganglion cells. P cell density increased from peripheral to more central regions, reaching about 5540 cells/mm² at 2.5 mm of temporal eccentricity. P cells represented a smaller proportion of all ganglion cells in the nasal quadrant than in other quadrants, and their numbers increased towards central retinal regions. The M cell coverage factor ranged from 5 to 12 and the P cell coverage factor ranged from 1 to 3 in the nasal quadrant and from 5 to 12 in the other quadrants. These results show that central and peripheral retinal regions differ in terms of cell class proportions and dendritic coverage, and their properties do not result from simply scaling down cell density. Therefore, differences in functional properties between central and peripheral vision should take these distinct regional retinal characteristics into account.

  15. Cortical connections of auditory cortex in marmoset monkeys: lateral belt and parabelt regions.

    Science.gov (United States)

    de la Mothe, Lisa A; Blumell, Suzanne; Kajikawa, Yoshinao; Hackett, Troy A

    2012-05-01

    The current working model of primate auditory cortex is constructed from a number of studies of both new and old world monkeys. It includes three levels of processing. A primary level, the core region, is surrounded both medially and laterally by a secondary belt region. A third level of processing, the parabelt region, is located lateral to the belt. The marmoset monkey (Callithrix jacchus jacchus) has become an important model system to study auditory processing, but its anatomical organization has not been fully established. In previous studies, we focused on the architecture and connections of the core and medial belt areas (de la Mothe et al., 2006a, J Comp Neurol 496:27-71; de la Mothe et al., 2006b, J Comp Neurol 496:72-96). In this study, the corticocortical connections of the lateral belt and parabelt were examined in the marmoset. Tracers were injected into both rostral and caudal portions of the lateral belt and parabelt. Both regions revealed topographic connections along the rostrocaudal axis, where caudal areas of injection had stronger connections with caudal areas, and rostral areas of injection with rostral areas. The lateral belt had strong connections with the core, belt, and parabelt, whereas the parabelt had strong connections with the belt but not the core. Label in the core from injections in the parabelt was significantly reduced or absent, consistent with the idea that the parabelt relies mainly on the belt for its cortical input. In addition, the present and previous studies indicate hierarchical principles of anatomical organization in the marmoset that are consistent with those observed in other primates.

  16. Antibodies against human BLyS and APRIL attenuate EAE development in marmoset monkeys.

    Science.gov (United States)

    Jagessar, S Anwar; Heijmans, Nicole; Oh, Luke; Bauer, Jan; Blezer, Erwin L A; Laman, Jon D; Migone, Thi-Sau; Devalaraja, Matt N; 't Hart, Bert A

    2012-09-01

    B lymphocyte stimulator (BLyS, also indicated as BAFF (B-cell activating factor) and CD257), and A Proliferation Inducing Ligand (APRIL, CD256) are two members of the TNF superfamily with a central role in B cell survival. Antibodies against these factors have potential therapeutic relevance in autoimmune inflammatory disorders with a proven pathogenic contribution of B cells, such as multiple sclerosis (MS). In the current study we performed a multi-parameter efficacy comparison of monoclonal antibodies against human anti-BLyS and anti-APRIL in a common marmoset (Callithrix jacchus) model of experimental autoimmune encephalomyelitis (EAE). A MS-like disease was induced by immunization with recombinant human myelin/oligodendrocyte glycoprotein (rhMOG) in complete Freund's adjuvant. The results show that the anti-BLyS and anti-APRIL antibody cause significant depletion of circulating CD20+ B cells, but a small subset of CD20 + CD40(high) B cells was not depleted. Induction of CD20+ B cell depletion from lymph nodes was only observed in the anti-BLyS treated monkeys. Both antibodies had a significant inhibitory effect on disease development, but all monkeys developed clinically evident EAE. Anti-BLyS treated monkeys were sacrificed with the same clinical signs as saline-treated monkeys, but nevertheless displayed significantly reduced spinal cord demyelination. This effect was not observed in the anti-APRIL treated monkeys. The two antibodies had a different effect on T cell subset activation and the profiles of ex vivo released cytokines. In conclusion, treatment with anti-BLyS and anti-APRIL delays the development of neurological disease in a relevant preclinical model of MS. The two mAbs achieve this effect via different mechanisms.

  17. Non-viral generation of marmoset monkey iPS cells by a six-factor-in-one-vector approach.

    Directory of Open Access Journals (Sweden)

    Katharina Debowski

    Full Text Available Groundbreaking studies showed that differentiated somatic cells of mouse and human origin could be reverted to a stable pluripotent state by the ectopic expression of only four proteins. The resulting pluripotent cells, called induced pluripotent stem (iPS cells, could be an alternative to embryonic stem cells, which are under continuous ethical debate. Hence, iPS cell-derived functional cells such as neurons may become the key for an effective treatment of currently incurable degenerative diseases. However, besides the requirement of efficacy testing of the therapy also its long-term safety needs to be carefully evaluated in settings mirroring the clinical situation in an optimal way. In this context, we chose the long-lived common marmoset monkey (Callithrix jacchus as a non-human primate species to generate iPS cells. The marmoset monkey is frequently used in biomedical research and is gaining more and more preclinical relevance due to the increasing number of disease models. Here, we describe, to our knowledge, the first-time generation of marmoset monkey iPS cells from postnatal skin fibroblasts by non-viral means. We used the transposon-based, fully reversible piggyback system. We cloned the marmoset monkey reprogramming factors and established robust and reproducible reprogramming protocols with a six-factor-in-one-construct approach. We generated six individual iPS cell lines and characterized them in comparison with marmoset monkey embryonic stem cells. The generated iPS cells are morphologically indistinguishable from marmoset ES cells. The iPS cells are fully reprogrammed as demonstrated by differentiation assays, pluripotency marker expression and transcriptome analysis. They are stable for numerous passages (more than 80 and exhibit euploidy. In summary, we have established efficient non-viral reprogramming protocols for the derivation of stable marmoset monkey iPS cells, which can be used to develop and test cell replacement

  18. Non-viral generation of marmoset monkey iPS cells by a six-factor-in-one-vector approach.

    Science.gov (United States)

    Debowski, Katharina; Warthemann, Rita; Lentes, Jana; Salinas-Riester, Gabriela; Dressel, Ralf; Langenstroth, Daniel; Gromoll, Jörg; Sasaki, Erika; Behr, Rüdiger

    2015-01-01

    Groundbreaking studies showed that differentiated somatic cells of mouse and human origin could be reverted to a stable pluripotent state by the ectopic expression of only four proteins. The resulting pluripotent cells, called induced pluripotent stem (iPS) cells, could be an alternative to embryonic stem cells, which are under continuous ethical debate. Hence, iPS cell-derived functional cells such as neurons may become the key for an effective treatment of currently incurable degenerative diseases. However, besides the requirement of efficacy testing of the therapy also its long-term safety needs to be carefully evaluated in settings mirroring the clinical situation in an optimal way. In this context, we chose the long-lived common marmoset monkey (Callithrix jacchus) as a non-human primate species to generate iPS cells. The marmoset monkey is frequently used in biomedical research and is gaining more and more preclinical relevance due to the increasing number of disease models. Here, we describe, to our knowledge, the first-time generation of marmoset monkey iPS cells from postnatal skin fibroblasts by non-viral means. We used the transposon-based, fully reversible piggyback system. We cloned the marmoset monkey reprogramming factors and established robust and reproducible reprogramming protocols with a six-factor-in-one-construct approach. We generated six individual iPS cell lines and characterized them in comparison with marmoset monkey embryonic stem cells. The generated iPS cells are morphologically indistinguishable from marmoset ES cells. The iPS cells are fully reprogrammed as demonstrated by differentiation assays, pluripotency marker expression and transcriptome analysis. They are stable for numerous passages (more than 80) and exhibit euploidy. In summary, we have established efficient non-viral reprogramming protocols for the derivation of stable marmoset monkey iPS cells, which can be used to develop and test cell replacement therapies in

  19. Increased positive selection pressure within the complementarity determining regions of the T-cell receptor β gene in New World monkeys.

    Science.gov (United States)

    Matsutani, Takaji; Fujii, Yoshiki; Kitaura, Kazutaka; Suzuki, Satsuki; Tsuruta, Yuji; Takasaki, Tomohiko; Ogasawara, Kouetsu; Nishimoto, Norihiro; Kurane, Ichiro; Suzuki, Ryuji

    2011-10-01

    Because of the long-term co-evolution of TCR and MHC molecules, numerous nucleotide substitutions have accumulated within the domains of TCRβ genes. We previously found that nonsynonymous nucleotide substitutions occurred more frequently in complementarity determining region (CDR)β than in CDRα, even though only a limited number of common marmoset (Callithrix jacchus) and human T-cell receptor β variable (TRBV) sequences were compared. This interesting finding raised the question of whether the increased selective pressure within CDRβ was species-specific. In this study, we identified 21 TRBV region sequences from the common marmoset and performed comparative sequence analyses of the T-cell receptor α variable (TRAV) and TRBV regions from human, chimpanzee, rhesus monkey, cotton-top tamarin, Ma's night monkey, and common marmoset. The ratios of the number of nonsynonymous nucleotide substitutions per site (d(N) ) to the d(S) values (d(N) /d(S) ) were less than 1 within the framework regions (FRs) of TRAV and TRBV region sequences, suggesting that purifying selection is largely dominant within the FRs. In contrast, the d(N) values were statistically significantly greater for CDRβ than for CDRα only in New World monkeys. Also, increased d(N) /d(S) ratios (d(N) /d(S) >1) were observed within CDRβ between humans and New World monkeys and, interestingly, between New World monkeys, which share a relatively recent common ancestor. Moreover, phylogenetic analysis by maximum likelihood analysis provided firm evidence to support that positive selection occurred within CDRβ along New World monkey lineages. These results suggest that increased positive selection pressure within CDRβ is common in New World monkeys rather than being species-specific. This study provides an intriguing insight into the co-evolution of TCR and MHC molecules within primates. © 2011 Wiley-Liss, Inc.

  20. The zoonotic importance of Mycobacterium tuberculosis : transmission from human to monkey : case report

    Directory of Open Access Journals (Sweden)

    A.L. Michel

    1998-07-01

    Full Text Available A case of zoonotic Mycobacterium tuberculosis infection in a marmoset (Callithrix jacchus is reported. Genomic typing of the relevant M. tuberculosis isolates strongly suggests that the marmoset, which was kept as companion animal, acquired the disease from an infected member in the household who had been treated for pulmonary tuberculosis 8 years prior to this case.

  1. Experimental cross-species infection of common marmosets by titi monkey adenovirus.

    Directory of Open Access Journals (Sweden)

    Guixia Yu

    Full Text Available Adenoviruses are DNA viruses that infect a number of vertebrate hosts and are associated with both sporadic and epidemic disease in humans. We previously identified a novel adenovirus, titi monkey adenovirus (TMAdV, as the cause of a fulminant pneumonia outbreak in a colony of titi monkeys (Callicebus cupreus at a national primate center in 2009. Serological evidence of infection by TMAdV was also found in a human researcher at the facility and household family member, raising concerns for potential cross-species transmission of the virus. Here we present experimental evidence of cross-species TMAdV infection in common marmosets (Callithrix jacchus. Nasal inoculation of a cell cultured-adapted TMAdV strain into three marmosets produced an acute, mild respiratory illness characterized by low-grade fever, reduced activity, anorexia, and sneezing. An increase in virus-specific neutralization antibody titers accompanied the development of clinical signs. Although serially collected nasal swabs were positive for TMAdV for at least 8 days, all 3 infected marmosets spontaneously recovered by day 12 post-inoculation, and persistence of the virus in tissues could not be established. Thus, the pathogenesis of experimental inoculation of TMAdV in common marmosets resembled the mild, self-limiting respiratory infection typically seen in immunocompetent human hosts rather than the rapidly progressive, fatal pneumonia observed in 19 of 23 titi monkeys during the prior 2009 outbreak. These findings further establish the potential for adenovirus cross-species transmission and provide the basis for development of a monkey model useful for assessing the zoonotic potential of adenoviruses.

  2. Comprehensive characterization of evolutionary conserved breakpoints in four New World Monkey karyotypes compared to Chlorocebus aethiops and Homo sapiens.

    Science.gov (United States)

    Fan, Xiaobo; Supiwong, Weerayuth; Weise, Anja; Mrasek, Kristin; Kosyakova, Nadezda; Tanomtong, Alongkoad; Pinthong, Krit; Trifonov, Vladimir A; Cioffi, Marcelo de Bello; Grothmann, Pierre; Liehr, Thomas; Oliveira, Edivaldo H C de

    2015-11-01

    Comparative cytogenetic analysis in New World Monkeys (NWMs) using human multicolor banding (MCB) probe sets were not previously done. Here we report on an MCB based FISH-banding study complemented with selected locus-specific and heterochromatin specific probes in four NWMs and one Old World Monkey (OWM) species, i.e. in Alouatta caraya (ACA), Callithrix jacchus (CJA), Cebus apella (CAP), Saimiri sciureus (SSC), and Chlorocebus aethiops (CAE), respectively. 107 individual evolutionary conserved breakpoints (ECBs) among those species were identified and compared with those of other species in previous reports. Especially for chromosomal regions being syntenic to human chromosomes 6, 8, 9, 10, 11, 12 and 16 previously cryptic rearrangements could be observed. 50.4% (54/107) NWM-ECBs were colocalized with those of OWMs, 62.6% (62/99) NWM-ECBs were related with those of Hylobates lar (HLA) and 66.3% (71/107) NWM-ECBs corresponded with those known from other mammalians. Furthermore, human fragile sites were aligned with the ECBs found in the five studied species and interestingly 66.3% ECBs colocalized with those fragile sites (FS). Overall, this study presents detailed chromosomal maps of one OWM and four NWM species. This data will be helpful to further investigation on chromosome evolution in NWM and hominoids in general and is prerequisite for correct interpretation of future sequencing based genomic studies in those species.

  3. Colonization of collagen scaffolds by adipocytes derived from mesenchymal stem cells of the common marmoset monkey

    Energy Technology Data Exchange (ETDEWEB)

    Bernemann, Inga, E-mail: bernemann@imp.uni-hannover.de [Institute for Multiphase Processes, Leibniz Universitaet Hannover, Hannover (Germany); Mueller, Thomas; Blasczyk, Rainer [Institute for Transfusion Medicine, Hannover Medical School, Hannover (Germany); Glasmacher, Birgit; Hofmann, Nicola [Institute for Multiphase Processes, Leibniz Universitaet Hannover, Hannover (Germany)

    2011-07-29

    Highlights: {yields} Marmoset bone marrow-derived MSCs differentiate in suspension into adipogenic, osteogenic and chondrogenic lineages. {yields} Marmoset MSCs integrate in collagen type I scaffolds and differentiate excellently into adipogenic cells. {yields} Common marmoset monkey is a suitable model for soft tissue engineering in human regenerative medicine. -- Abstract: In regenerative medicine, human cell replacement therapy offers great potential, especially by cell types differentiated from immunologically and ethically unproblematic mesenchymal stem cells (MSCs). In terms of an appropriate carrier material, collagen scaffolds with homogeneous pore size of 65 {mu}m were optimal for cell seeding and cultivating. However, before clinical application and transplantation of MSC-derived cells in scaffolds, the safety and efficiency, but also possible interference in differentiation due to the material must be preclinically tested. The common marmoset monkey (Callithrix jacchus) is a preferable non-human primate animal model for this aim due to its genetic and physiological similarities to the human. Marmoset bone marrow-derived MSCs were successfully isolated, cultured and differentiated in suspension into adipogenic, osteogenic and chondrogenic lineages by defined factors. The differentiation capability could be determined by FACS. Specific marker genes for all three cell types could be detected by RT-PCR. Furthermore, MSCs seeded on collagen I scaffolds differentiated in adipogenic lineage showed after 28 days of differentiation high cell viability and homogenous distribution on the material which was validated by calcein AM and EthD staining. As proof of adipogenic cells, the intracellular lipid vesicles in the cells were stained with Oil Red O. The generation of fat vacuoles was visibly extensive distinguishable and furthermore determined on the molecular level by expression of specific marker genes. The results of the study proved both the differential

  4. Initial investigation of three selective and potent small molecule oxytocin receptor PET ligands in New World monkeys.

    Science.gov (United States)

    Smith, Aaron L; Freeman, Sara M; Barnhart, Todd E; Abbott, David H; Ahlers, Elizabeth O; Kukis, David L; Bales, Karen L; Goodman, Mark M; Young, Larry J

    2016-07-15

    The neuropeptide oxytocin is part of a neuroendocrine system that has physiological effects ranging from ensuring uterine myometrial contractions at parturition and post-partum mammary gland milk ejection to the modulation of neural control of social relationships. This initial study was performed to investigate the potential use of positron emission tomography (PET) for localizing oxytocin receptors in two New World primates. Three biomarkers for PET (1-3) that are known to have high affinity and selectivity for the human oxytocin receptor were investigated in the common marmoset (Callithrix jacchus) via PET imaging. Brain penetration, and uptake in the salivary gland area were both observed with biomarkers 2 and 3. No brain penetration was observed with 1, but uptake was observed more specifically in several peripheral endocrine glands compared to 2 or 3. Biomarker 2, which displayed the best brain penetration of the three biomarkers in the marmoset, was then investigated in the monogamous coppery titi monkey (Callicebus cupreus) in a brain scan and a limited full body scan. No significant brain penetration of 2 was observed in the titi monkey, but significant uptake was observed in various locations throughout the periphery. Metabolism of 2 was suspected to have been significant based upon HPLC analysis of blood draws, but parent compound was still present near the end of the scan. Follow-up investigations will focus on next generation biomarkers bearing improved binding characteristics and brain penetrability as well as investigating tissue in regions where biomarker uptake was observed. Copyright © 2016 Elsevier Ltd. All rights reserved.

  5. Activity-dependent regulation of MHC class I expression in the developing primary visual cortex of the common marmoset monkey

    Directory of Open Access Journals (Sweden)

    Schlumbohm Christina

    2011-01-01

    Full Text Available Abstract Background Several recent studies have highlighted the important role of immunity-related molecules in synaptic plasticity processes in the developing and adult mammalian brains. It has been suggested that neuronal MHCI (major histocompatibility complex class I genes play a role in the refinement and pruning of synapses in the developing visual system. As a fast evolutionary rate may generate distinct properties of molecules in different mammalian species, we studied the expression of MHCI molecules in a nonhuman primate, the common marmoset monkey (Callithrix jacchus. Methods and results Analysis of expression levels of MHCI molecules in the developing visual cortex of the common marmoset monkeys revealed a distinct spatio-temporal pattern. High levels of expression were detected very early in postnatal development, at a stage when synaptogenesis takes place and ocular dominance columns are formed. To determine whether the expression of MHCI molecules is regulated by retinal activity, animals were subjected to monocular enucleation. Levels of MHCI heavy chain subunit transcripts in the visual cortex were found to be elevated in response to monocular enucleation. Furthermore, MHCI heavy chain immunoreactivity revealed a banded pattern in layer IV of the visual cortex in enucleated animals, which was not observed in control animals. This pattern of immunoreactivity indicated that higher expression levels were associated with retinal activity coming from the intact eye. Conclusions These data demonstrate that, in the nonhuman primate brain, expression of MHCI molecules is regulated by neuronal activity. Moreover, this study extends previous findings by suggesting a role for neuronal MHCI molecules during synaptogenesis in the visual cortex.

  6. LPS-induced lung inflammation in marmoset monkeys - an acute model for anti-inflammatory drug testing.

    Directory of Open Access Journals (Sweden)

    Sophie Seehase

    Full Text Available Increasing incidence and substantial morbidity and mortality of respiratory diseases requires the development of new human-specific anti-inflammatory and disease-modifying therapeutics. Therefore, new predictive animal models that closely reflect human lung pathology are needed. In the current study, a tiered acute lipopolysaccharide (LPS-induced inflammation model was established in marmoset monkeys (Callithrix jacchus to reflect crucial features of inflammatory lung diseases. Firstly, in an ex vivo approach marmoset and, for the purposes of comparison, human precision-cut lung slices (PCLS were stimulated with LPS in the presence or absence of the phosphodiesterase-4 (PDE4 inhibitor roflumilast. Pro-inflammatory cytokines including tumor necrosis factor-alpha (TNF-α and macrophage inflammatory protein-1 beta (MIP-1β were measured. The corticosteroid dexamethasone was used as treatment control. Secondly, in an in vivo approach marmosets were pre-treated with roflumilast or dexamethasone and unilaterally challenged with LPS. Ipsilateral bronchoalveolar lavage (BAL was conducted 18 hours after LPS challenge. BAL fluid was processed and analyzed for neutrophils, TNF-α, and MIP-1β. TNF-α release in marmoset PCLS correlated significantly with human PCLS. Roflumilast treatment significantly reduced TNF-α secretion ex vivo in both species, with comparable half maximal inhibitory concentration (IC(50. LPS instillation into marmoset lungs caused a profound inflammation as shown by neutrophilic influx and increased TNF-α and MIP-1β levels in BAL fluid. This inflammatory response was significantly suppressed by roflumilast and dexamethasone. The close similarity of marmoset and human lungs regarding LPS-induced inflammation and the significant anti-inflammatory effect of approved pharmaceuticals assess the suitability of marmoset monkeys to serve as a promising model for studying anti-inflammatory drugs.

  7. The pluripotency factor LIN28 in monkey and human testes: a marker for spermatogonial stem cells?

    Science.gov (United States)

    Aeckerle, N; Eildermann, K; Drummer, C; Ehmcke, J; Schweyer, S; Lerchl, A; Bergmann, M; Kliesch, S; Gromoll, J; Schlatt, S; Behr, R

    2012-10-01

    Mammalian spermatogenesis is maintained by spermatogonial stem cells (SSCs). However, since evidentiary assays and unequivocal markers are still missing in non-human primates (NHPs) and man, the identity of primate SSCs is unknown. In contrast, in mice, germ cell transplantation studies have functionally demonstrated the presence of SSCs. LIN28 is an RNA-binding pluripotent stem cell factor, which is also strongly expressed in undifferentiated mouse spermatogonia. By contrast, two recent reports indicated that LIN28 is completely absent from adult human testes. Here, we analyzed LIN28 expression in marmoset monkey (Callithrix jacchus) and human testes during development and adulthood and compared it with that in mice. In the marmoset, LIN28 was strongly expressed in migratory primordial germ cells and gonocytes. Strikingly, we found a rare LIN28-positive subpopulation of spermatogonia also in adult marmoset testis. This was corroborated by western blotting and quantitative RT-PCR. Importantly, in contrast to previous publications, we found LIN28-positive spermatogonia also in normal adult human and additional adult NHP testes. Some seasonal breeders exhibit a degenerated (involuted) germinal epithelium consisting only of Sertoli cells and SSCs during their non-breeding season. The latter re-initiate spermatogenesis prior to the next breeding-season. Fully involuted testes from a seasonal hamster and NHP (Lemur catta) exhibited numerous LIN28-positive spermatogonia, indicating an SSC identity of the labeled cells. We conclude that LIN28 is differentially expressed in mouse and NHP spermatogonia and might be a marker for a rare SSC population in NHPs and man. Further characterization of the LIN28-positive population is required.

  8. Inhibition of maternal behaviour by central infusion of corticotrophin-releasing hormone in marmoset monkeys.

    Science.gov (United States)

    Saltzman, W; Boettcher, C A; Post, J L; Abbott, D H

    2011-11-01

    Stress can inhibit maternal behaviour and increase rates of child abuse in humans and other animals; however, the neuroendocrine mechanisms are not known. To determine whether corticotrophin-releasing hormone (CRH) plays a role in stress-induced disruption of maternal behaviour in primates, we characterised the effects of acute i.c.v. infusions of CRH on maternal and abusive behaviour in common marmoset monkeys (Callithrix jacchus). Nulliparous females were implanted with indwelling i.c.v. guide cannulae before conception. Between 18 and 58 days after the birth of her first infants, each female underwent a series of i.c.v. infusions of human CRH (0, 2, 8 and 25 μg) in 8 μl of artificial cerebrospinal fluid. In the 70 min after infusion, marmosets were tested with one of their infants, first in their home cage and, subsequently, in an unfamiliar cage in which the infant was confined in a transparent box on the cage floor. In the home cage, the highest dose of CRH significantly reduced the amount of time that mothers spent carrying their infants, as compared to vehicle alone, although it did not reliably affect aggression toward the infant or other behaviours. In the confined-infant test, the highest dose of CRH significantly reduced the amount of time that mothers spent on the cage floor, increased mothers' vocalisation rates, and tended to reduce their activity levels and time spent in proximity to their infant. Twenty-five micrograms of CRH also elicited significant elevations in plasma adrenocorticotrophic hormone and cortisol concentrations compared to vehicle. These results indicate that i.c.v.-administered CRH reduces maternal behaviour in marmoset mothers, in both familiar and unfamiliar environments, but does not increase infant abuse.

  9. Postnatal development of quantitative morphological parameters in the lateral geniculate nucleus of the marmoset monkey.

    Science.gov (United States)

    Fritschy, J M; Garey, L J

    1986-12-01

    Quantitative morphological parameters were studied in the lateral geniculate nucleus (LGN) of the marmoset monkey (Callithrix jacchus) during development, using a series of 14 animals, at ages from birth to adulthood. They include the volume of the LGN and of its layers and interlaminar zones, their neuronal content expressed as numerical density and total number, and the density and number of glial cells in the nucleus as a whole. The volume of the LGN increases rapidly after birth, reaches a maximum at 6 months of age, and then decreases to its adult value of about 11 mm3. Neuronal density follows a reciprocal curve, reaching an adult value of about 41,000 neurons/mm3, so that the total number of about 440,000 neurons per LGN remains constant throughout life although large interindividual variations, especially in juveniles, do not allow unequivocal statements about total neuronal number to be made. Parvocellular layers occupy most of the geniculate volume, and contain about 74% of its neurons in the adult. We found no difference in their development pattern compared with the magnocellular component. The 'superficial' layers and interlaminar zones contain more than 15% of the geniculate neurons, and they could therefore play an important functional role in the primary visual pathway of New World primates. The number of glial cells nearly triples during the first 6 weeks and stabilizes around 800,000 in the LGN of one hemisphere. As the same brains were used as in a previous study on the area 17 of the marmoset (Dev. Brain Res., 29 (1986) 173-188) direct comparisons of the development of cortex and thalamus can be made. Their development is parallel in time, and in both cases the adult values for volume, neuronal density and glial numbers are reached several months postnatally.

  10. Imitation as faithful copying of a novel technique in marmoset monkeys.

    Directory of Open Access Journals (Sweden)

    Bernhard Voelkl

    Full Text Available Imitative learning has received great attention due to its supposed role in the development of culture and the cognitive demands it poses on the individual. Evidence for imitation in non-human primate species, therefore, could shed light on the early origins of proto-cultural traits in the primate order. Imitation has been defined as the learning of an act by seeing it done or, more specifically, as the copying of a novel or otherwise improbable act. But despite a century of research and the detection of mirror neurons the empirical basis for this most advanced form of observational learning is weak. Few, if any, studies have shown that the observer has learned the response topography, i.e., the specific action by which the response is made. In an experimental set-up we confronted marmoset monkeys (Callithrix jacchus with a conspecific model that was previously trained to open a plastic box in a peculiar way. Employing detailed motion analyses we show that the observers precisely copied the movement patterns of the novel action demonstrated by the model. A discriminant analysis classified 13 out of 14 observer movements (92.86% as model movements and only one as non-observer movement. This evidence of imitation in non-human primates questions the dominant opinion that imitation is a human-specific ability. Furthermore, the high matching degree suggests that marmosets possess the neuronal mechanism to code the actions of others and to map them onto their own motor repertoire, rather than priming existing motor-templates.

  11. Representation of the visual field in the primary visual area of the marmoset monkey: magnification factors, point-image size, and proportionality to retinal ganglion cell density.

    Science.gov (United States)

    Chaplin, Tristan A; Yu, Hsin-Hao; Rosa, Marcello G P

    2013-04-01

    The primary visual area (V1) forms a systematic map of the visual field, in which adjacent cell clusters represent adjacent points of visual space. A precise quantification of this map is key to understanding the anatomical relationships between neurons located in different stations of the visual pathway, as well as the neural bases of visual performance in different regions of the visual field. We used computational methods to quantify the visual topography of V1 in the marmoset (Callithrix jacchus), a small diurnal monkey. The receptive fields of neurons throughout V1 were mapped in two anesthetized animals using electrophysiological recordings. Following histological reconstruction, precise 3D reconstructions of the V1 surface and recording sites were generated. We found that the areal magnification factor (M(A) ) decreases with eccentricity following a function that has the same slope as that observed in larger diurnal primates, including macaque, squirrel, and capuchin monkeys, and humans. However, there was no systematic relationship between M(A) and polar angle. Despite individual variation in the shape of V1, the relationship between M(A) and eccentricity was preserved across cases. Comparison between V1 and the retinal ganglion cell density demonstrated preferential magnification of central space in the cortex. The size of the cortical compartment activated by a punctiform stimulus decreased from the foveal representation towards the peripheral representation. Nonetheless, the relationship between the receptive field sizes of V1 cells and the density of ganglion cells suggested that each V1 cell receives information from a similar number of retinal neurons, throughout the visual field.

  12. Proteome profiling reveals regional protein alteration in cerebrum of common marmoset (Callithrix jacchus) exposed to methylmercury.

    Science.gov (United States)

    Shao, Yueting; Yamamoto, Megumi; Figeys, Daniel; Ning, Zhibin; Chan, Hing Man

    2016-03-10

    Methylmercury (MeHg) is known to selectively damage the calcarine and precentral cortices along deep sulci and fissures in adult cases, but the detailed mechanism is still unclear. This study aims to identify and analyze the differential proteome expression in two regions of the cerebrum (the frontal lobe and the occipital lobe including the calcarine sulcus) of the common marmoset exposed to MeHg using a shot-gun proteomic approach. A total of 1045 and 1062 proteins were identified in the frontal lobe (FL) and occipital lobe (OL), of which, 62 and 89 proteins were found significantly changed with MeHg exposure. Functional enrichment/depletion analysis showed that the lipid metabolic process and proteolysis were affected in both two lobes. Functional changes in FL were characterized in cell cycle and cell division, sulfur compound metabolic process, microtubule-based process and glycerolipid metabolic process. In comparison, proteins were enriched in the functions of transport, carbohydrate metabolic process, chemical caused homeostasis and regulation of body fluid levels in OL. Pathway analysis predicted that vasopressin-regulated water reabsorption was disturbed in MeHg-treated FL. Our results showed that MeHg induced regional specific protein changes in FL and OL but with similar endpoint effects such as energy diminish and disruption of water transport. APOE and GPX1 were shown to be possible key proteins targeted by MeHg leading to multiple functional changes in OL. This is the first report of the whole proteome changes of primate cerebrum for MeHg neurotoxicity, and the results will contribute to the understanding of molecular basis of MeHg intoxication in humans. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  13. Birth of healthy offspring following ICSI in in vitro-matured common marmoset (Callithrix jacchus) oocytes.

    Science.gov (United States)

    Takahashi, Tsukasa; Hanazawa, Kisaburo; Inoue, Takashi; Sato, Kenya; Sedohara, Ayako; Okahara, Junko; Suemizu, Hiroshi; Yagihashi, Chie; Yamamoto, Masafumi; Eto, Tomoo; Konno, Yusuke; Okano, Hideyuki; Suematsu, Makoto; Sasaki, Erika

    2014-01-01

    Intracytoplasmic sperm injection (ICSI), an important method used to treat male subfertility, is applied in the transgenic technology of sperm-mediated gene transfer. However, no study has described successful generation of offspring using ICSI in the common marmoset, a small non-human primate used as a model for biomedical translational research. In this study, we investigated blastocyst development and the subsequent live offspring stages of marmoset oocytes matured in vitro and fertilized by ICSI. To investigate the optimal timing of performing ICSI, corrected immature oocytes were matured in vitro and ICSI was performed at various time points (1-2 h, 2-4 h, 4-6 h, 6-8 h, and 8-10 h after extrusion of the first polar body (PB)). Matured oocytes were then divided randomly into two groups: one was used for in vitro fertilization (IVF) and the other for ICSI. To investigate in vivo development of embryos followed by ICSI, 6-cell- to 8-cell-stage embryos and blastocysts were nonsurgically transferred into recipient marmosets. Although no significant differences were observed in the fertilization rate of blastocysts among ICSI timing after the first PB extrusion, the blastocyst rate at 1-2 h was lowest among groups at 2-4 h, 4-6 h, 6-8 h, and 8-10 h. Comparing ICSI to IVF, the fertilization rates obtained in ICSI were higher than in IVF (p>0.05). No significant difference was noted in the cleaved blastocyst rate between ICSI and IVF. Following the transfer of 37 ICSI blastocysts, 4 of 20 recipients became pregnant, while with the transfer of 21 6-cell- to 8-cell-stage ICSI embryos, 3 of 8 recipients became pregnant. Four healthy offspring were produced and grew normally. These are the first marmoset offspring produced by ICSI, making it an effective fertilization method for marmosets.

  14. Use of human methylation arrays for epigenome research in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Ueda, Junko; Murata, Yui; Bundo, Miki; Oh-Nishi, Arata; Kassai, Hidetoshi; Ikegame, Tempei; Zhao, Zhilei; Jinde, Seiichiro; Aiba, Atsu; Suhara, Tetsuya; Kasai, Kiyoto; Kato, Tadafumi; Iwamoto, Kazuya

    2017-02-17

    We examined the usefulness of commercially available DNA methylation arrays designed for the human genome (Illumina HumanMethylation450 and MethylationEPIC) for high-throughput epigenome analysis of the common marmoset, a nonhuman primate suitable for research on neuropsychiatric disorders. From among the probes on the methylation arrays, we selected those available for the common marmoset. DNA methylation data were obtained from genomic DNA extracted from the frontal cortex and blood samples of adult common marmosets as well as the frontal cortex of neonatal marmosets. About 10% of the probes on the arrays were estimated to be useful for DNA methylation assay in the common marmoset. Strong correlations existed between human and marmoset DNA methylation data. Illumina methylation arrays are useful for epigenome research using the common marmoset.

  15. A case of nontraumatic gas gangrene in a common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Yasuda, Masahiko; Inoue, Takashi; Ueno, Masami; Morita, Hanako; Hayashimoto, Nobuhito; Kawai, Kenji; Itoh, Toshio

    2016-01-01

    The common marmoset is widely used in neuroscience and regenerative medicine research. However, information concerning common marmoset disorders, particularly infectious diseases, is scarce. Here, we report a case of a female common marmoset that died suddenly due to gas gangrene. The animal presented with gaseous abdominal distention at postmortem, and Clostridium perfringens type A was isolated from several tissues. Vacuoles, a Gram-positive bacteremia and intravascular hemolysis were observed microscopically in the muscles, liver and lungs. On the basis of these findings, we diagnosed nontraumatic gas gangrene caused by Clostridium perfringens type A in this common marmoset.

  16. Experimental endocrine manipulation by contraceptive regimen in the male marmoset (Callithrix jacchus).

    Science.gov (United States)

    Wistuba, Joachim; Luetjens, C Marc; Ehmcke, Jens; Redmann, Klaus; Damm, Oliver S; Steinhoff, Antje; Sandhowe-Klaverkamp, Reinhild; Nieschlag, Eberhard; Simoni, Manuela; Schlatt, Stefan

    2013-04-01

    Marmosets are used as preclinical model in reproductive research. In contrast to other primates, they display short gestation times rendering this species valid for exploration of effects on fertility. However, their peculiar endocrine regulation differs from a those of macaques and humans. We subjected male marmosets to previously clinically tested hormonal regimens that are known to effectively suppress spermatogenesis. Beside a control group, seven groups (each n=6) were investigated for different periods of up to 42 months: regimen I, (four groups) received testosterone undecanoate (TU) and norethisterone enanthate (NETE); regimen II, (two groups) received TU and NETE followed by NETE only; and regimen III, (one group) received NETE only. Testicular volume, cell ploidy and histology, endocrine changes and fertility were monitored weekly. TU and NETE and initial TU and NETE treatment followed by NETE failed to suppress spermatogenesis and fertility. Testicular volumes dropped, although spermatogenesis was only mildly affected; however, testicular cellular composition remained stable. Serum testosterone dropped when NETE was given alone but the animals remained fertile. Compared with controls, no significant changes were observed in sperm motility and fertility. Administration of TU and NETE affected testicular function only mildly, indicating that the regulatory role of chorionic gonadotrophin and testosterone on spermatogenesis is obviously limited and testicular function is maintained, although the endocrine axis is affected by the treatment. In conclusion, marmosets showed a different response to regimens of male contraception from macaques or men and have to be considered as a problematic model for preclinical trials of male hormonal contraception.

  17. An animal model that reflects human disease: the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Carrion, Ricardo; Patterson, Jean L

    2012-06-01

    The common marmoset is a new world primate belonging to the Callitrichidae family weighing between 350 and 400 g. The marmoset has been shown to be an outstanding model for studying aging, reproduction, neuroscience, toxicology, and infectious disease. With regard to their susceptibility to infectious agents, they are exquisite NHP models for viral, protozoan and bacterial agents, as well as prions. The marmoset provides the advantages of a small animal model in high containment coupled with the immunological repertoire of a nonhuman primate and susceptibility to wild type, non-adapted viruses.

  18. Inflammatory fibroid polyp in the duodenum of a common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Yokouchi, Yusuke; Imaoka, Masako; Sayama, Ayako; Jindo, Toshimasa; Sanbuissho, Atsushi

    2013-01-01

    A 32-month-old male common marmoset had a firm and white-colored mass in the duodenal wall. The cut surface was smooth and grayish white in color. Histologically, the mass consisted of a proliferation of spindle cells with an oval to spindle-shaped nucleus and scant eosinophilic cytoplasm in a loose myxoid or fibrotic background. Most of the lesion displayed no specific growth pattern whereas some of the cells concentrated around the vessels and created an onion-bulb structure. Additionally, marked inflammatory cellular infiltration, mainly eosinophils, was observed throughout the lesion. Immunohistochemically, the spindle cells were positive for vimentin, α-smooth muscle actin, fascin, and cyclin D1, and negative for S-100, factor VIII-related antigen, and c-kit. These histological and immunohistochemical features did not meet any differential diagnoses such as gastrointestinal stromal tumor, inflammatory myofibroblastic tumor, solitary fibrous tumor/hemangiopericytoma, smooth muscle tumor, schwannoma, and hemangiosarcoma. Collectively, the authors diagnosed the mass as a lesion that corresponded to an inflammatory fibroid polyp (IFP) in humans. IFP is defined as a mesenchymal proliferation composed of spindle stromal cells, small blood vessels, and inflammatory cells, particularly eosinophils, and is currently classified as a nonneoplastic lesion. To the best of our knowledge, this is the first case of spontaneous IFP in nonhuman primates.

  19. The common marmoset (Callithrix jacchus) as a model for neuroleptic-induced acute dystonia.

    Science.gov (United States)

    Fukuoka, T; Nakano, M; Kohda, A; Okuno, Y; Matsuo, M

    1997-12-01

    To examine whether acute dystonia is induced by neuroleptic treatment, common marmosets were treated with haloperidol orally twice a week over 25 weeks until dystonic behavior was elicited. Movement disorders such as acute dystonia were observed 6 weeks after the initial treatment, and had appeared in all treated animals by 25 weeks. Once these movement disorders were induced, they consistently reappeared after further treatment with haloperidol, and once haloperidol dosing was discontinued, the episodes vanished. Then, various neuroleptic drugs (bromperidol, chlorpromazine, risperidone thioridazine, sulpiride, tiapride, and clozapine) or a nonneuroleptic drug (diazepam) were administered orally instead of haloperidol in the above animals. All the neuroleptic drugs except for clozapine elicited similar abnormal behavior, while diazepam failed to induce any dystonia. An anticholinergic drug, trihexyphenidyl, which is known to reduce acute dystonia in patients, was also given orally to the above haloperidol-sensitized animals, followed by further treatment with haloperidol 30 min later. This clearly suppressed the induction of dystonia by haloperidol. The similarity between these findings for haloperidol-pretreated common marmosets and clinical findings suggests that the present model is useful for predicting the potential of antipsychotics to induce acute dystonia in humans.

  20. Differential contribution of dietary fat and monosaccharide to metabolic syndrome in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Wachtman, Lynn M; Kramer, Joshua A; Miller, Andrew D; Hachey, Audra M; Curran, Elizabeth H; Mansfield, Keith G

    2011-06-01

    There is a critical need for animal models to study aspects type 2 diabetes (T2D) pathogenesis and prevention. While the rhesus macaque is such an established model, the common marmoset has added benefits including reduced zoonotic risks, shorter life span, and a predisposition to birth twins demonstrating chimerism. The marmoset as a model organism for the study of metabolic syndrome has not been fully evaluated. Marmosets fed high-fat or glucose-enriched diets were followed longitudinally to observe effects on morphometric and metabolic measures. Effects on pancreatic histomorphometry and vascular pathology were examined terminally. The glucose-enriched diet group developed an obese phenotype and a prolonged hyperglycemic state evidenced by a rapid and persistent increase in mean glycosylated hemoglobin (HgbA1c) observed as early as week 16. In contrast, marmosets fed a high-fat diet did not maintain an obese phenotype and demonstrated a delayed increase in HgbA1) that did not reach statistical significance until week 40. Consumption of either diet resulted in profound pancreatic islet hyperplasia suggesting a compensation for increased insulin requirements. Although the high-fat diet group developed atherosclerosis of increased severity, the presence of lesions correlated with glucose intolerance only in the glucose-enriched diet group. The altered timing of glucose dysregulation, differential contribution to obesity, and variation in vascular pathology suggests mechanisms of effect specific to dietary nutrient content. Feeding nutritionally modified diets to common marmosets recapitulates aspects of metabolic disease and represents a model that may prove instrumental to elucidating the contribution of nutrient excess to disease development.

  1. Differential contribution of dietary fat and monosaccharide to metabolic syndrome in the common marmoset (Callithrix jacchus)

    OpenAIRE

    2010-01-01

    There is a critical need for animal models to study aspects type 2 diabetes mellitus pathogenesis and prevention. While the rhesus macaque is such an established model, the common marmoset has added benefits including reduced zoonotic risks, shorter life span, and a predisposition to birth twins demonstrating chimerism. The marmoset as a model organism for the study of metabolic syndrome has not been fully evaluated. Marmosets fed high-fat or glucose-enriched diets were followed longitudinall...

  2. Characterization and Pathogenesis of Aerosolized Eastern Equine Encephalitis in the Common Marmoset (Callithrix jacchus)

    Science.gov (United States)

    2016-08-10

    conventional environmental enrichment. Animals were surgically implanted with 101 subcutaneous Data Sciences International (DSI) TA-F40 telemetry implants to...Guyton’s formula; and Q, the flow rate of the 141 AGI sampler (ml/min). 142 Telemetry Analysis 143 Prior to aerosol challenge, all marmosets were...using the following primers and probe, 196 respectively: EEEV Forward 5’-TGCAAAgATGCTTTCC-3’, EEEV Reverse 5’-197 TCACCTGGTCTGTATCCA-3’, and the dual

  3. Predation on artificial nests by marmosets of the genus Callithrix (Primates, Platyrrhini in a Cerrado fragment in Southeastern Brazil

    Directory of Open Access Journals (Sweden)

    Marcos Vinícius de Almeida

    2013-03-01

    Full Text Available Although the causes of decline in bird populations in forest fragments are not well known, nest predation seems to play a major role in these events. A way to estimate the relative importance of predation for the reproduction of native birds is the use of artificial nests. Here, there is a report on the high rates of predation on artificial nests by two marmoset species from the genus Callithrix, C. pennicillata and C. jacchus, as well as their hybrid derivatives, in a Cerrado fragment in the state of Sao Paulo, Brazil. By means of artificial nests and quail eggs filled with paraffin, it was possible to identify the marmosets as predators through the bite pattern left on the paraffin. The results suggest a possible occurrence of predation on natural nests. Further studies involving the monitoring of natural nests will be able to confirm the role of marmosets in the decline of bird populations in the study area.

  4. Taxonomy Icon Data: white-tufted-ear marmoset [Taxonomy Icon

    Lifescience Database Archive (English)

    Full Text Available white-tufted-ear marmoset Callithrix jacchus Chordata/Vertebrata/Mammalia/Theria/Eutheria/Primate Call...ithrix_jacchus_L.png Callithrix_jacchus_NL.png Callithrix_jacchus_S.png Callithrix_jacchu...s_NS.png http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Callithrix+jacchus&t=L http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Cal...lithrix+jacchus&t=NL http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Call...ithrix+jacchus&t=S http://biosciencedbc.jp/taxonomy_icon/icon.cgi?i=Callithrix+jacchus&t=NS ...

  5. Transfer of various polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDDs and PCDFs) via placenta and through milk in a marmoset monkey

    Energy Technology Data Exchange (ETDEWEB)

    Hagenmaier, H.; Wiesmueller, T. (Tuebingen Univ. (Germany, F.R.). Inst. fuer Organische Chemie); Golor, G.; Krowke, R.; Neubert, D. (Freie Univ. Berlin (Germany, F.R.). Inst. fuer Toxikologie und Embryonalpharmakologie); Helge, H. (Freie Univ. Berlin (Germany, F.R.). Kinderklinik und Poliklinik)

    1990-11-01

    A mixture of PCDDs and PCDFs was subcutaneously administered to a pregnant marmoset monkey (Callithrix jacchus) 11 weeks prior to delivery. Transfer of PCDDs and PCDFs via placenta and mother's milk was investigated by measurement of concentrations in a newborn 1 day after birth and in an infant of the same litter after a lactation period of 33 days. Furthermore, comparative measurements were performed in different tissues of the mother at the end of the lactation period, and in addition, in two groups of four adult monkeys each 1 and 6 weeks after treatment. Deposition of the PCDDs and PCDFs into fetal liver was very low for most of the 2,3,7,8-substituted congeners. Highest deposition was observed for 2,3,7,8-T4CDD and 1,2,3,7,8-P5CDD. For all other compounds concentrations in the hepatic tissue of newborn shortly after birth were lower than one tenth of corresponding concentrations in adults. Fetal liver is apparently largely unable to accumulate PCDDs/PCDFs. In contrast to liver, concentrations of 2,3,7,8-substituted PCDDs/PCDFs in adipose tissue of the newborn were at least one third of the levels in adults. However, concentrations of OCDD and OCDF were about three times higher in the newborn than in adult adipose tissue. Transfer of some of the 2,3,7,8-substituted PCDDs and PCDFs to the offspring via mother's milk was considerable, leading to hepatic concentrations in the suckled infant at the end of the 33-day nursing period well above corresponding concentrations in the dam. When hepatic concentrations in the infant and dam were compared 2- to 4-fold higher concentrations were found in the infant's liver for 2,3,7,8-T4CDD/F and for 1,2,3,7,8-P5CDD. In the case of the 2,3,7,8-substituted H6CDDs, P5CDFs, and most of the H6CDFs, hepatic concentrations in the infant and dam were in the same range at the end of the suckling period. (orig./MG).

  6. Comportamentos interespecíficos entre Callithrix jacchus (Linnaeus (Primates, Callitrichidae e algumas aves de Mata Atlântica, Pernambuco, Brasil Interspecific behaviour between Callithrix jacchus (Linnaeus (Callitrichidae, Primates and some birds of the Atlantic forest, Pernanbuco State, Brazil

    Directory of Open Access Journals (Sweden)

    Rachel M. de Lyra-Neves

    2007-01-01

    Full Text Available As observações ocorreram no período de dois anos, monitorando grupos marcados de sagüis durante oito horas por dia. Foram registrados seis tipos de eventos: predação de sagüis; predação de aves, disputa de área de forrageio e recurso alimentar; compartilhamento de área de forrageio e recurso alimentar; perseguição branda e utilização de ninho de ave como local de pernoite dos sagüis. Os eventos agrupados obtiveram diferenças significativas entre as estações do ano e os estratos ocupados.The observations cover a period of two years, monitoring groups of marked common marmosets in eight hour/day periods. Six types of events were recorded: marmoset predation; bird predation; foraging competition; food sharing; use of avian nest for nocturnal marmoset rest and mutual pursuit. All pooled events showed highly significant differences between season and vegetation strata.

  7. Endocrine and cognitive adaptations to cope with stress in immature male and female common marmosets (Callithrix jacchus

    Directory of Open Access Journals (Sweden)

    Maria Bernardete Cordeiro de Sousa

    2015-11-01

    Full Text Available Phenotypic sex differences in primates are associated with body differentiation during the early stages of life, expressed in both physiological and behavioral features. Hormones seem to play a pivotal role in creating a range of responses to meet environmental and social demands, resulting in better reactions to cope with challenges to survival and reproduction. Our studies on brain plasticity combine hormonal and behavioral approaches to investigate stress-coping mechanisms in nonhuman primates. Steroid hormones actively participate in neuroplasticity and steroids from both gonads and neurons seem to be involved in behavioral modulation in primates. Indirect evidence suggests the participation of sexual steroids in dimorphism of the stress response in common marmosets. This is an important experimental model in Psychiatry, since we found a dual profile for cortisol in the transition from infancy to puberty, with females showing higher levels that extend to adulthood. Immature males and females at 6, 9 and 12 months of age moved alone from the family group to a new cage, over a 21-day period, expressed distinct patterns of cortisol variation, depending on age, but similar in terms of range of variation between sexes. Additional evidence showed that during juvenile to sub-adult transition males buffered the HPA axis during chronic stress. However, animals under both acute and chronic stress performed poorly on spatial cognitive tests and evidence from the literature that they respond better to social tasks indicates that new approaches are necessary to take advantage of this experimental model. These findings increase the potential of also using this experimental model during development, such as in adolescence, and strengthen the importance of sex as a part of experimental protocols that study neuropsychiatric illnesses such as anxiety and mood disorders as well as associated therapeutics.

  8. Interaction between rod and cone signals in responses of lateral geniculate neurons in dichromatic marmosets (Callithrix jacchus).

    Science.gov (United States)

    Weiss, S; Kremers, J; Maurer, J

    1998-01-01

    Parvocellular (P-) and magnocellular (M-) cells in the marmoset LGN can receive prominent rod input up to relatively high illuminance levels (Kremers et al., 1997b). In the present paper, we quantify rod and cone input strengths under different retinal illuminance levels. The stimulus was based on the so-called "silent substitution" method. The activities of P- and M-cells of dichromatic animals were recorded extracellularly. We were able to adequately describe the response amplitudes and phases by a vector summation of rod and cone signals. At low retinal illuminance levels, the cells' responses were determined by rod and cone inputs. With increasing illuminances the strength of the cone input increased relative to the rod strength. But, we often found significant rod inputs up to illuminances equivalent to 700 td in the human eye or more. Rod input strength was more pronounced in cells with receptive fields at large retinal eccentricities. The phase differences between rod and cone inputs suggest that the rod signals lag about 45 ms behind the cone signals.

  9. Birth of common marmoset (Callithrix jacchus) offspring derived from in vitro-matured oocytes in chemically defined medium.

    Science.gov (United States)

    Tomioka, I; Takahashi, T; Shimada, A; Yoshioka, K; Sasaki, E

    2012-10-15

    Optimization of oocyte culture conditions is a crucial aspect of reproductive biology and technology. In the present study, maturation of germinal vesicle-stage marmoset oocytes were evaluated in the following media: Waymouth medium, Waymouth medium containing porcine follicular fluid (pFF) (Waymouth-pFF medium), and porcine oocyte medium (POM). Oocytes cultured in Waymouth-pFF medium had higher maturation rates to the metaphase II stage than those cultured in Waymouth medium (36.1% vs. 24.8%, respectively, P marmoset oocytes. Hence, maturation of marmoset oocytes cultured in POM was subsequently evaluated. The rate of maturation to the metaphase I stage was significantly higher and degradation rates were significantly lower in oocytes cultured in POM than those cultured in Waymouth medium. In addition, three offspring were successfully obtained after transfer of embryos matured in chemically defined medium. Therefore, we concluded that POM was suitable for marmoset oocyte culture. Furthermore, this was apparently the first report of marmoset offspring derived from oocytes cultured in chemically defined medium.

  10. Generating induced pluripotent stem cells from common marmoset (Callithrix jacchus) fetal liver cells using defined factors, including Lin28.

    Science.gov (United States)

    Tomioka, Ikuo; Maeda, Takuji; Shimada, Hiroko; Kawai, Kenji; Okada, Yohei; Igarashi, Hiroshi; Oiwa, Ryo; Iwasaki, Tsuyoshi; Aoki, Mikio; Kimura, Toru; Shiozawa, Seiji; Shinohara, Haruka; Suemizu, Hiroshi; Sasaki, Erika; Okano, Hideyuki

    2010-09-01

    Although embryonic stem (ES) cell-like induced pluripotent stem (iPS) cells have potential therapeutic applications in humans, they are also useful for creating genetically modified human disease models in nonhuman primates. In this study, we generated common marmoset iPS cells from fetal liver cells via the retrovirus-mediated introduction of six human transcription factors: Oct-3/4, Sox2, Klf4, c-Myc, Nanog, and Lin28. Four to five weeks after introduction, several colonies resembling marmoset ES cells were observed and picked for further expansion in ES cell medium. Eight cell lines were established, and validation analyses of the marmoset iPS cells followed. We detected the expression of ES cell-specific surface markers. Reverse transcription-PCR showed that these iPS cells expressed endogenous Oct-3/4, Sox2, Klf4, c-Myc, Nanog and Lin28 genes, whereas all of the transgenes were silenced. Karyotype analysis showed that two of three iPS cell lines retained a normal karyotype after a 2-month culture. Both embryoid body and teratoma formation showed that marmoset iPS cells had the developmental potential to give rise to differentiated derivatives of all three primary germ layers. In summary, we generated marmoset iPS cells via the transduction of six transcription factors; this provides a powerful preclinical model for studies in regenerative medicine.

  11. NKG2D functions as an activating receptor on natural killer cells in the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Watanabe, Masamichi; Kudo, Yohei; Kawano, Mitsuko; Nakayama, Masafumi; Nakamura, Kyohei; Kameda, Mai; Ebara, Masamune; Sato, Takeki; Nakamura, Marina; Omine, Kaito; Kametani, Yoshie; Suzuki, Ryuji; Ogasawara, Kouetsu

    2014-11-01

    The natural killer group 2 membrane D (NKG2D) receptor is an NK-activating receptor that plays an important role in host defense against tumors and viral infections. Although the marmoset is an important and reliable animal model, especially for the study of human-specific viral infections, functional characterization of NKG2D on marmoset NK cells has not previously been conducted. In the present study, we investigated a subpopulation of marmoset NK cells that express NKG2D and exhibit cytolytic potential. On the basis of their CD16 and CD56 expression patterns, marmoset NK cells can be classified into three subpopulations: CD16(+) CD56(-), CD16(-) CD56(+) and CD16(-) CD56(-) cells. NKG2D expression on marmoset CD16(+) CD56(-) and CD16(-) CD56(+) splenocytes was confirmed using an NKG2D ligand composed of an MHC class I chain-related molecule A (MICA)-Fc fusion protein. When marmoset splenocytes were cultured with IL-2 for 4 days, NKG2D expression was retained on CD16(+) CD56(-) and CD16(-) CD56(+). In addition, CD16(+) CD56(+) cells within the marmoset NK population appeared which expressed NKG2D after IL-2 stimulation. IL-2-activated marmoset NK cells showed strong cytolytic activity against K562 target cells and target cells stably expressing MICA. Further, the cytolytic activity of marmoset splenocytes was significantly reduced after addition of MICA-Fc fusion protein. Thus, NKG2D functions as an activating receptor on marmoset NK cells that possesses cytotoxic potential, and phenotypic profiles of marmoset NK cell subpopulations are similar to those seen in humans.

  12. An assessment of common marmoset (Callithrix jacchus) γ9(+) T cells and their response to phosphoantigen in vitro.

    Science.gov (United States)

    Rowland, Caroline A; Laws, Thomas R; Oyston, Petra C F

    2012-12-01

    γ9δ2 T cells are a primate-specific γδ T cell subtype that expand and become activated during infection, responding directly to phosphoantigens which are by-products of essential metabolic pathways in both bacteria and mammals. Analogues of natural phosphoantigens have been developed as potential immunotherapeutics for treatment of tumours and infectious diseases. Several non-human primate models have been used in preclinical studies, however, little is known about marmoset γ9δ2 T cell responses. We identified γ9(+) T cells in various tissues in the marmoset and determined that these cells respond to phosphoantigen in a similar manner to human γ9δ2 T cells in vitro. Both human γ9δ2 T cells and marmoset γ9(+) T cells were able to reduce growth of the intracellular bacterium Burkholderia pseudomallei in vitro following expansion with phosphoantigen. This suggests that the marmoset is an appropriate model for examining the immunotherapeutic potential of compounds which target γ9δ2 T cells.

  13. The role of harmonic resolvability in pitch perception in a vocal nonhuman primate, the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Osmanski, Michael S; Song, Xindong; Wang, Xiaoqin

    2013-05-22

    Pitch is one of the most fundamental percepts in the auditory system and can be extracted using either spectral or temporal information in an acoustic signal. Although pitch perception has been extensively studied in human subjects, it is far less clear how nonhuman primates perceive pitch. We have addressed this question in a series of behavioral studies in which marmosets, a vocal nonhuman primate species, were trained to discriminate complex harmonic tones differing in either spectral (fundamental frequency [f0]) or temporal envelope (repetition rate) cues. We found that marmosets used temporal envelope information to discriminate pitch for acoustic stimuli with higher-order harmonics and lower f0 values and spectral information for acoustic stimuli with lower-order harmonics and higher f0 values. We further measured frequency resolution in marmosets using a psychophysical task in which pure tone thresholds were measured as a function of notched noise masker bandwidth. Results show that only the first four harmonics are resolved at low f0 values and up to 16 harmonics are resolved at higher f0 values. Resolvability in marmosets is different from that in humans, where the first five to nine harmonics are consistently resolved across most f0 values, and is likely the result of a smaller marmoset cochlea. In sum, these results show that marmosets use two mechanisms to extract pitch (harmonic templates [spectral] for resolved harmonics, and envelope extraction [temporal] for unresolved harmonics) and that species differences in stimulus resolvability need to be taken into account when investigating and comparing mechanisms of pitch perception across animals.

  14. On-going elucidation of mechanisms of primate specific synaptic spine development using the common marmoset (Callithrix jacchus).

    Science.gov (United States)

    Ichinohe, Noritaka

    2015-04-01

    Recently, pathophysiology of human psychiatry originates from abnormal numbers of synapses/spines. There are generally two-types of development of spines from birth depending on species. One is, after birth, synaptogenesis occurs, and there is a clear peak of spines, and then rapidly pruning occurring, which are called "overshoot-type" of development of synapses/spines. Primates including human belong to this type. In other type including rodents, even after a peak, general number of spines does not decrease so much. Although these differences, most of human psychiatric models have been genetic modified rodents. Now, transgenic primate (the common marmoset) became available. In near future, we can, examine pathophysiology of psychiatric disorders using this animal model, which is closer to human being. To begin with this endeavor, we should know how synapses/spines of normal marmosets developed, and molecular mechanisms of "overshoot-type" of spine development, which human being also shows. Here, we will present our recent effort to explore these questions, and future experiments will be discussed.

  15. Susceptibility of Marmosets (Callithrix jacchus to Monkeypox Virus: A Low Dose Prospective Model for Monkeypox and Smallpox Disease.

    Directory of Open Access Journals (Sweden)

    Eric M Mucker

    Full Text Available Although current nonhuman primate models of monkeypox and smallpox diseases provide some insight into disease pathogenesis, they require a high titer inoculum, use an unnatural route of infection, and/or do not accurately represent the entire disease course. This is a concern when developing smallpox and/or monkeypox countermeasures or trying to understand host pathogen relationships. In our studies, we altered half of the test system by using a New World nonhuman primate host, the common marmoset. Based on dose finding studies, we found that marmosets are susceptible to monkeypox virus infection, produce a high viremia, and have pathological features consistent with smallpox and monkeypox in humans. The low dose (48 plaque forming units required to elicit a uniformly lethal disease and the extended incubation (preclinical signs are unique features among nonhuman primate models utilizing monkeypox virus. The uniform lethality, hemorrhagic rash, high viremia, decrease in platelets, pathology, and abbreviated acute phase are reflective of early-type hemorrhagic smallpox.

  16. Comparison of three different sedative anaesthetic protocols (ketamine, ketamine-medetomidine and alphaxalone) in common marmosets (Callithrix jacchus)

    National Research Council Canada - National Science Library

    Bakker, J; Uilenreef, J.J; Pelt, E.R.J; Brok, H.P.M; Remarque, E.J; Langermans, J.A.M

    2013-01-01

    .... Ketamine has been associated with muscle damage in primates, while common marmosets, compared to other primates, additionally display an exceptional high sensitivity to ketamine-associated side-effects...

  17. Susceptibility of Marmosets (Callithrix jacchus) to Monkeypox Virus: A Low Dose Prospective Model for Monkeypox and Smallpox Disease.

    Science.gov (United States)

    Mucker, Eric M; Chapman, Jennifer; Huzella, Louis M; Huggins, John W; Shamblin, Joshua; Robinson, Camenzind G; Hensley, Lisa E

    2015-01-01

    Although current nonhuman primate models of monkeypox and smallpox diseases provide some insight into disease pathogenesis, they require a high titer inoculum, use an unnatural route of infection, and/or do not accurately represent the entire disease course. This is a concern when developing smallpox and/or monkeypox countermeasures or trying to understand host pathogen relationships. In our studies, we altered half of the test system by using a New World nonhuman primate host, the common marmoset. Based on dose finding studies, we found that marmosets are susceptible to monkeypox virus infection, produce a high viremia, and have pathological features consistent with smallpox and monkeypox in humans. The low dose (48 plaque forming units) required to elicit a uniformly lethal disease and the extended incubation (preclinical signs) are unique features among nonhuman primate models utilizing monkeypox virus. The uniform lethality, hemorrhagic rash, high viremia, decrease in platelets, pathology, and abbreviated acute phase are reflective of early-type hemorrhagic smallpox.

  18. Distinct structural plasticity in the hippocampus and amygdala of the middle-aged common marmoset (Callithrix jacchus)

    NARCIS (Netherlands)

    Marlatt, M.W.; Philippens, I.; Manders, E.; Czeh, B.; Joëls, M.; Krugers, H.; Lucassen, P.J.

    2011-01-01

    Adult neurogenesis in the primate brain is generally accepted to occur primarily in two specific areas; the subgranular zone (SGZ) of the hippocampal dentate gyrus (DG) and the subventricular zone (SVZ) of the lateral ventricles. Hippocampal neurogenesis is well known to be downregulated by stress

  19. Evidence of hemispheric specialization in marmosets (Callithrix penicillata using tympanic membrane thermometry

    Directory of Open Access Journals (Sweden)

    C. Tomaz

    2003-07-01

    Full Text Available Recent studies have employed tympanic thermometry to assess lateralization of cognitive and emotional functions in primates. However, no studies using this technique have investigated the possibility of hemispheric specialization in New World monkeys. Therefore, the aim of the present study was to investigate tympanic membrane (TM temperature asymmetries and their possible correlation with stress responses in marmosets (Callithrix penicillata. Infrared TM thermometry was completed bilaterally in 24 animals (14 males and 10 females during a stressful situation of capture and restraint. There were no significant differences between gender. A significant negative correlation was observed between TM temperature of the right ear and the number of captures (r = -0.633; P<0.001. Subjects with a more frequent previous history of captures (5 to 9 captures; N = 11 showed lower TM temperature when compared to those with fewer previous captures (1 to 4 captures; N = 13. No differences were observed for the left TM temperature. These results suggest that under intense emotional challenge (capture and restraint there is a stronger activation of the neural structures situated in the right brain hemisphere. Taken together, the data reveal for the first time evidence of hemispheric specialization in emotional physiological processing in a New World monkey.

  20. Molecular studies of Callithrix pygmaea (Primates, Platyrrhini based on transferrin intronic and ND1 regions: implications for taxonomy and conservation

    Directory of Open Access Journals (Sweden)

    Tagliaro Claudia Helena

    2000-01-01

    Full Text Available Traditional classifications of Platyrrhini monkeys, based mainly on morphological features, are being contested by recent molecular data. The subfamily Callitrichinae (Platyrrhini, Primates consists of a diverse group of species, many of them considered endangered. Our analysis of two DNA regions, a mtDNA gene (ND1 and a nuclear gene (intronic regions of the transferrin gene, suggests that Callithrix pygmaea may have sufficient variability to justify the existence of subspecies or even separate species. Phylogenetic dendrograms based on the ND1 region show that this species is more closely related to Amazonian than to Atlantic forest marmosets. These results reopen the discussion about diversity and conservation programs based exclusively on traditional classifications.

  1. Development of the first marmoset-specific DNA microarray (EUMAMA): a new genetic tool for large-scale expression profiling in a non-human primate

    NARCIS (Netherlands)

    Datson, N.A.; Morsink, M.C.; Atanasova, S.; Armstrong, V.W.; Zischler, H.; Schlumbohm, C.; Dutilh, B.E.; Huynen, M.A.; Waegele, B.; Ruepp, A.; Kloet, E.R. de; Fuchs, E.

    2007-01-01

    BACKGROUND: The common marmoset monkey (Callithrix jacchus), a small non-endangered New World primate native to eastern Brazil, is becoming increasingly used as a non-human primate model in biomedical research, drug development and safety assessment. In contrast to the growing interest for the marmo

  2. Persistence of various polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDDs and PCDFs) in hepatic and adipose tissue of marmoset monkeys

    Energy Technology Data Exchange (ETDEWEB)

    Neubert, D.; Abraham, K.; Krowke, R. (Freie Univ. Berlin (Germany, F.R.). Inst. fuer Toxikologie und Embryonalpharmakologie); Wiesmueller, T.; Hagenmaier, H. (Tuebingen Univ. (Germany, F.R.). Inst. fuer Organische Chemie)

    1990-08-01

    A defined mixture of polychlorinated dibenzo-p-dioxins and dibenzofurans (PCDDs and PCDFs) was subcutaneously administered to marmoset monkeys (Callithrix jacchus). Tissue concentrations in hepatic and adipose tissue were measured at different times after treatment (1-28 weeks). One week after application high concentrations could be detected for the 2,3,7,7,8-substituted congeners only. The percent of the administered dose in whole liver differed for the various 2,3,7,8-substituted congeners, ranging from 24.5 {plus minus} 4.5% for 2,3,7,8-TCDD to 74.1 {plus minus} 4.9% for 2,3,4,6,7,8-H6CDF. Therefore, the concentration ratio (liver/adipose tissue) was also very different, ranging from about 1 (2,3,7,8-T4CDD or 2,3,7,8-T4CDF) to > 10 in the case of some higher chlorinated PCDDs and PCDFs. Half-lives of PCDDs and PCDFs were very different for the various 2,3,7,8-substituted congeners. For the most toxic compound (2,3,7,8-T4CDD) a t/2 of about 8 weeks in hepatic tissue and about 11 weeks in adipose tissue was found when calculated from data obtained later than 6 weeks after injection. For 2,3,7,8-T4CDD and 1,2,3,7,8-P5CDD the decreases in hepatic concentrations were much faster during the first 6 weeks after administration (t/2 of 4 weeks). This was apparently due to redistribution phenomena. Half-life increased with increasing degrees of chlorination. In some cases (e.g. OCDD, OCDF) no significant decrease in tissue concentrations could be observed after 28 weeks. The shortest t/2 was determined for 2,3,7,8-T4CDF: shorter than 6 days in hepatic tissue and about 10 days in adipose tissue. Calculation of the body burden of the non-2,3,7,8-substituted PCDDs/PCDFs 1 week after injection revealed that all groups of isomers were present at less than 5%. Consequences of these findings for the use of TCDD-toxic-equivalency factors are discussed and a change in strategy is suggested. (orig.).

  3. Vegetable exudates as food for Callithrix spp. (Callitrichidae: exploratory patterns.

    Directory of Open Access Journals (Sweden)

    Talitha Mayumi Francisco

    Full Text Available Marmosets of the genus Callithrix are specialized in the consumption of tree exudates to obtain essential nutritional resource by boring holes into bark with teeth. However, marmoset preferences for particular tree species, location, type, and other suitable factors that aid in exudate acquisition need further research. In the current study, the intensity of exudate use from Anadenanthera peregrina var. peregrina trees by hybrid marmosets Callithrix spp. groups was studied in five forest fragments in Viçosa, in the state of Minas, Brazil. Thirty-nine A. peregrina var. peregrina trees were examined and 8,765 active and non-active holes were analyzed. The trunk of A. peregrina var. peregrina had a lower number of holes than the canopy: 11% were found on the trunk and 89% were found on the canopy. The upper canopy was the preferred area by Callithrix spp. for obtaining exudates. The intensity of tree exploitation by marmosets showed a moderate-to-weak correlation with diameter at breast height (DBH and total tree height. The overall results indicate that Anadenanthera peregrina var. peregrina provides food resources for hybrid marmosets (Callithrix spp. and these animals prefer to explore this resource on the apical parts of the plant, where the thickness, location, and age of the branches are the main features involved in the acquisition of exudates.

  4. Vegetable exudates as food for Callithrix spp. (Callitrichidae): exploratory patterns.

    Science.gov (United States)

    Francisco, Talitha Mayumi; Couto, Dayvid Rodrigues; Zanuncio, José Cola; Serrão, José Eduardo; Silva, Ita de Oliveira; Boere, Vanner

    2014-01-01

    Marmosets of the genus Callithrix are specialized in the consumption of tree exudates to obtain essential nutritional resource by boring holes into bark with teeth. However, marmoset preferences for particular tree species, location, type, and other suitable factors that aid in exudate acquisition need further research. In the current study, the intensity of exudate use from Anadenanthera peregrina var. peregrina trees by hybrid marmosets Callithrix spp. groups was studied in five forest fragments in Viçosa, in the state of Minas, Brazil. Thirty-nine A. peregrina var. peregrina trees were examined and 8,765 active and non-active holes were analyzed. The trunk of A. peregrina var. peregrina had a lower number of holes than the canopy: 11% were found on the trunk and 89% were found on the canopy. The upper canopy was the preferred area by Callithrix spp. for obtaining exudates. The intensity of tree exploitation by marmosets showed a moderate-to-weak correlation with diameter at breast height (DBH) and total tree height. The overall results indicate that Anadenanthera peregrina var. peregrina provides food resources for hybrid marmosets (Callithrix spp.) and these animals prefer to explore this resource on the apical parts of the plant, where the thickness, location, and age of the branches are the main features involved in the acquisition of exudates.

  5. Distribution of collagen types I, III, and IV in gastric tissue of marmosets (Callithrix spp., Callitrichidae: Primates Distribuição dos colágenos tipo I, III e IV em tecido gástrico de sagüis (Callithrix spp., Callitrichidae: Primates

    Directory of Open Access Journals (Sweden)

    Marcela F.V. de Mello

    2010-04-01

    Full Text Available Extracellular matrix (ECM components such as fibrillar collagens play a fundamental role in wound repair and have also been studied in association with the gastric ulcer healing process in gastroenterology. Nevertheless, there have been no studies in the literature to date regarding the description and characterization of ECM components, neither in normal nor in injured gastric tissue of primate species. The objective of this study was to investigate the expression of gastric collagen types I, III, and IV in marmosets (Callithrix sp.. Histological specimens from the stomach of 6 Callithrix jacchus, 12 C. kuhli, and 12 C. geoffroyi were evaluated. The specimens were immunostained with anti-types I and III collagen polyclonal antibodies and anti-type IV collagen monoclonal antibody. Collagen types I and III were detected in the submucosa and lamina propria between the mucosal glands while collagen type IV was detected in the muscularis mucosae, muscular layers, blood vessels, and gastric mucosa between the mucosal glands. It is hoped that these findings can contribute to future studies on the gastric extracellular matrix components in primates and to comparative studies in the area of gastroenterology.Os componentes da matriz extra-celular (MEC, como os colágenos fibrilares, desempenham um papel fundamental no reparo de feridas, tendo sido estudados em gastroenterologia, em associação com a cicatrização da úlcera gástrica. No entanto, não há estudos até o presente momento, que relatem a descrição e caracterização de componentes da MEC no tecido gástrico, quer seja normal ou com lesão, de espécies de primatas. O objetivo deste estudo foi investigar a expressão dos colágenos tipo I, III e IV no tecido gástrico de sagüis (Callithrix sp.. Foram avaliadas amostras do estômago de 6 Callithrix jacchus, 12 C. kuhli e 12 C. geoffroyi. As amostras foram submetidas à reação de imuno-histoquímica com anticorpos policlonais anti

  6. Detection of fruit by the Cerrado's marmoset (Callithrix penicillata): modeling color signals for different background scenarios and ambient light intensities.

    Science.gov (United States)

    Perini, Eduardo Sosti; Pessoa, Valdir Filgueiras; Pessoa, Daniel Marques de Almeida

    2009-04-01

    Among placental mammals, only primates have trichromatic color vision, however this is not a uniform condition. Under different genetic status, Old World monkeys have routine trichromacy, while New World monkeys show a visual polymorphism, characterized by obligatory male dichromacy. The ecological role of this genetic difference still remains unclear, but some studies show that dichromats and trichromats appear to have different abilities in detecting colored targets against a background of leaves. The Cerrado's marmoset (Callithrix penicillata) is known to forage in brightly illuminated (savanna-like vegetation) and dimly illuminated (forests) environments, exploiting a high amount of dark fruits. Hence, it seems to be a good model for studying the differential advantages enjoyed by each color vision phenotype under natural conditions. Our aim was to verify how the different phenotypes of Cerrado's marmoset detect components of their diet, evaluating the existence of differential phenotype advantages. Under two different light conditions, visual signals of naturally consumed fruits were modeled against different backgrounds scenarios. Even though dichromats and trichromats appear to be equally suited for tasks involving fruit detection, phenotype differential advantages are observed in this marmoset. In many conditions trichromats are predicted to perform better than dichromats, but under low ambient light dichromats manage to outperform trichromats in some scenarios. Phenotypes that carry widely spaced and longer M/L pigments enjoy the most advantage. These differential performances of trichromatic phenotypes, together with overdominance selection, seem to explain the maintenance of the tri-allelic system found in callitrichids.

  7. Monkey Business

    Science.gov (United States)

    Blackwood, Christine Horvatis

    2012-01-01

    A ballerina, a gladiator, a camper, a baseball player, a surfer, and a shopper; these are just a few of the amazing monkeys that the author's seventh graders created from papier-mache. This project provided an opportunity for students to express themselves through the creation of sculptural characters based on their own interests, hobbies, and…

  8. Monkey Business

    Science.gov (United States)

    Blackwood, Christine Horvatis

    2012-01-01

    A ballerina, a gladiator, a camper, a baseball player, a surfer, and a shopper; these are just a few of the amazing monkeys that the author's seventh graders created from papier-mache. This project provided an opportunity for students to express themselves through the creation of sculptural characters based on their own interests, hobbies, and…

  9. NCBI nr-aa BLAST: CBRC-OANA-01-2156 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2156 gb|AAF87984.1|AF252554_1 CC chemokine receptor 5 [Callithrix jacc...hus] gb|AAK43361.1|AF177878_1 C-C chemokine receptor 5 [Callithrix jacchus] gb|AAN14530.1|AF452614_1 chemokine receptor CCR5 [Call...ithrix jacchus] gb|AAQ20011.1| CC chemokine receptor 5 [Callithrix jacchus] AAF87984.1 1e-145 69% ...

  10. NCBI nr-aa BLAST: CBRC-PCAP-01-1263 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1263 gb|AAC25655.1| X-linked visual pigment protein P556 [Callithrix j...acchus] dbj|BAB58963.1| P553 cone opsin [Callithrix jacchus] dbj|BAB58967.1| P553 cone opsin [Callithrix jac...chus] gb|ABZ10484.1| opsin 1, medium-wave-sensitive 2 (predicted) [Callithrix jacchus] AAC25655.1 0.0 90% ...

  11. NCBI nr-aa BLAST: CBRC-OANA-01-2157 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OANA-01-2157 gb|AAF87984.1|AF252554_1 CC chemokine receptor 5 [Callithrix jacc...hus] gb|AAK43361.1|AF177878_1 C-C chemokine receptor 5 [Callithrix jacchus] gb|AAN14530.1|AF452614_1 chemokine receptor CCR5 [Call...ithrix jacchus] gb|AAQ20011.1| CC chemokine receptor 5 [Callithrix jacchus] AAF87984.1 1e-141 70% ...

  12. NCBI nr-aa BLAST: CBRC-CJAC-01-0968 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0968 gb|AAF87984.1|AF252554_1 CC chemokine receptor 5 [Callithrix jacc...hus] gb|AAK43361.1|AF177878_1 C-C chemokine receptor 5 [Callithrix jacchus] gb|AAN14530.1|AF452614_1 chemokine receptor CCR5 [Call...ithrix jacchus] gb|AAQ20011.1| CC chemokine receptor 5 [Callithrix jacchus] AAF87984.1 0.0 100% ...

  13. NCBI nr-aa BLAST: CBRC-TBEL-01-2360 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-2360 gb|AAF87984.1|AF252554_1 CC chemokine receptor 5 [Callithrix jacc...hus] gb|AAK43361.1|AF177878_1 C-C chemokine receptor 5 [Callithrix jacchus] gb|AAN14530.1|AF452614_1 chemokine receptor CCR5 [Call...ithrix jacchus] gb|AAQ20011.1| CC chemokine receptor 5 [Callithrix jacchus] AAF87984.1 1e-161 77% ...

  14. NCBI nr-aa BLAST: CBRC-TBEL-01-2598 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-2598 gb|AAC25655.1| X-linked visual pigment protein P556 [Callithrix j...acchus] dbj|BAB58963.1| P553 cone opsin [Callithrix jacchus] dbj|BAB58967.1| P553 cone opsin [Callithrix jacchus] AAC25655.1 0.0 91% ...

  15. NCBI nr-aa BLAST: CBRC-OGAR-01-0185 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-OGAR-01-0185 gb|AAC25656.1| X-linked visual pigment protein P543 [Callithrix j...acchus] dbj|BAB58964.1| P539 cone opsin [Callithrix jacchus] dbj|BAB58968.1| P539 cone opsin [Callithrix jacchus] AAC25656.1 1e-140 71% ...

  16. NCBI nr-aa BLAST: CBRC-TBEL-01-2598 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-TBEL-01-2598 gb|AAC25656.1| X-linked visual pigment protein P543 [Callithrix j...acchus] dbj|BAB58964.1| P539 cone opsin [Callithrix jacchus] dbj|BAB58968.1| P539 cone opsin [Callithrix jacchus] AAC25656.1 0.0 92% ...

  17. NCBI nr-aa BLAST: CBRC-HSAP-23-0071 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0071 gb|AAC25654.1| X-linked visual pigment protein P561 [Callithrix j...acchus] dbj|BAB58962.1| P561 cone opsin [Callithrix jacchus] dbj|BAB58966.1| P561 cone opsin [Callithrix jacchus] AAC25654.1 0.0 96% ...

  18. NCBI nr-aa BLAST: CBRC-CJAC-01-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0050 gb|AAC25655.1| X-linked visual pigment protein P556 [Callithrix j...acchus] dbj|BAB58963.1| P553 cone opsin [Callithrix jacchus] dbj|BAB58967.1| P553 cone opsin [Callithrix jacchus] AAC25655.1 0.0 98% ...

  19. NCBI nr-aa BLAST: CBRC-HSAP-23-0072 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0072 gb|AAC25656.1| X-linked visual pigment protein P543 [Callithrix j...acchus] dbj|BAB58964.1| P539 cone opsin [Callithrix jacchus] dbj|BAB58968.1| P539 cone opsin [Callithrix jacchus] AAC25656.1 0.0 95% ...

  20. NCBI nr-aa BLAST: CBRC-PTRO-24-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PTRO-24-0050 gb|AAC25654.1| X-linked visual pigment protein P561 [Callithrix j...acchus] dbj|BAB58962.1| P561 cone opsin [Callithrix jacchus] dbj|BAB58966.1| P561 cone opsin [Callithrix jacchus] AAC25654.1 0.0 96% ...

  1. NCBI nr-aa BLAST: CBRC-CJAC-01-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0050 gb|AAC25654.1| X-linked visual pigment protein P561 [Callithrix j...acchus] dbj|BAB58962.1| P561 cone opsin [Callithrix jacchus] dbj|BAB58966.1| P561 cone opsin [Callithrix jacchus] AAC25654.1 0.0 100% ...

  2. NCBI nr-aa BLAST: CBRC-PCAP-01-1263 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PCAP-01-1263 gb|AAC25656.1| X-linked visual pigment protein P543 [Callithrix j...acchus] dbj|BAB58964.1| P539 cone opsin [Callithrix jacchus] dbj|BAB58968.1| P539 cone opsin [Callithrix jacchus] AAC25656.1 0.0 90% ...

  3. NCBI nr-aa BLAST: CBRC-HSAP-23-0073 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-HSAP-23-0073 gb|AAC25656.1| X-linked visual pigment protein P543 [Callithrix j...acchus] dbj|BAB58964.1| P539 cone opsin [Callithrix jacchus] dbj|BAB58968.1| P539 cone opsin [Callithrix jacchus] AAC25656.1 0.0 95% ...

  4. NCBI nr-aa BLAST: CBRC-GGOR-01-0729 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-GGOR-01-0729 gb|AAC25656.1| X-linked visual pigment protein P543 [Callithrix j...acchus] dbj|BAB58964.1| P539 cone opsin [Callithrix jacchus] dbj|BAB58968.1| P539 cone opsin [Callithrix jacchus] AAC25656.1 1e-171 82% ...

  5. NCBI nr-aa BLAST: CBRC-PABE-24-0067 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-PABE-24-0067 gb|AAC25656.1| X-linked visual pigment protein P543 [Callithrix j...acchus] dbj|BAB58964.1| P539 cone opsin [Callithrix jacchus] dbj|BAB58968.1| P539 cone opsin [Callithrix jacchus] AAC25656.1 1e-127 90% ...

  6. NCBI nr-aa BLAST: CBRC-RMAC-21-0052 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-RMAC-21-0052 gb|AAC25654.1| X-linked visual pigment protein P561 [Callithrix j...acchus] dbj|BAB58962.1| P561 cone opsin [Callithrix jacchus] dbj|BAB58966.1| P561 cone opsin [Callithrix jacchus] AAC25654.1 1e-174 82% ...

  7. NCBI nr-aa BLAST: CBRC-CJAC-01-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0050 gb|AAC25656.1| X-linked visual pigment protein P543 [Callithrix j...acchus] dbj|BAB58964.1| P539 cone opsin [Callithrix jacchus] dbj|BAB58968.1| P539 cone opsin [Callithrix jacchus] AAC25656.1 0.0 97% ...

  8. Antibody-enhanced dengue disease generates a marked CNS inflammatory response in the black-tufted marmoset Callithrix penicillata.

    Science.gov (United States)

    Vasconcelos, Barbara Cristina Baldez; Vieira, Juliana Almeida; Silva, Geane Oliveira; Fernandes, Taiany Nogueira; Rocha, Luciano Chaves; Viana, André Pereira; Serique, Cássio Diego Sá; Filho, Carlos Santos; Bringel, Raissa Aires Ribeiro; Teixeira, Francisco Fernando Dacier Lobato; Ferreira, Milene Silveira; Casseb, Samir Mansour Moraes; Carvalho, Valéria Lima; de Melo, Karla Fabiane Lopes; de Castro, Paulo Henrique Gomes; Araújo, Sanderson Corrêa; Diniz, José Antonio Picanço; Demachki, Samia; Anaissi, Ana Karyssa Mendes; Sosthenes, Marcia Consentino Kronka; Vasconcelos, Pedro Fernando da Costa; Anthony, Daniel Clive; Diniz, Cristovam Wanderley Picanço; Diniz, Daniel Guerreiro

    2016-02-01

    Severe dengue disease is often associated with long-term neurological impairments, but it is unclear what mechanisms are associated with neurological sequelae. Previously, we demonstrated antibody-enhanced dengue disease (ADE) dengue in an immunocompetent mouse model with a dengue virus 2 (DENV2) antibody injection followed by DENV3 virus infection. Here we migrated this ADE model to Callithrix penicillata. To mimic human multiple infections of endemic zones where abundant vectors and multiple serotypes co-exist, three animals received weekly subcutaneous injections of DENV3 (genotype III)-infected supernatant of C6/36 cell cultures, followed 24 h later by anti-DENV2 antibody for 12 weeks. There were six control animals, two of which received weekly anti-DENV2 antibodies, and four further animals received no injections. After multiple infections, brain, liver, and spleen samples were collected and tissue was immunolabeled for DENV3 antigens, ionized calcium binding adapter molecule 1, Ki-67, TNFα. There were marked morphological changes in the microglial population of ADE monkeys characterized by more highly ramified microglial processes, higher numbers of trees and larger surface areas. These changes were associated with intense TNFα-positive immunolabeling. It is unclear why ADE should generate such microglial activation given that IgG does not cross the blood-brain barrier, but this study reveals that in ADE dengue therapy targeting the CNS host response is likely to be important.

  9. Quality of maternal and paternal care predicts later stress reactivity in the cooperatively-breeding marmoset (Callithrix geoffroyi).

    Science.gov (United States)

    Birnie, Andrew K; Taylor, Jack H; Cavanaugh, Jon; French, Jeffrey A

    2013-12-01

    Variation in the early postnatal social environment can have lasting effects on hypothalamic-pituitary-adrenal (HPA) axis stress responses. Both rats and macaque monkeys subjected to low quality or abusive maternal care during the early postnatal period have more pronounced HPA responses to environmental stressors throughout development and into adulthood compared to animals reared in higher quality early maternal environments. However, little is known about the relative contributions to HPA stress response styles in developing offspring in species in which offspring care is routinely provided by group members other than the mother, such as in cooperatively breeding mammals. Marmoset monkeys exhibit cooperative offspring rearing, with fathers and older siblings providing care in addition to that provided by the mother. We evaluated the effects of early maternal, paternal, and older sibling care on HPA responses to social separation across development in captive white-faced marmoset offspring (Callithrix geoffroyi). We monitored offspring care by mothers, fathers, and older siblings in marmosets for the first 60 days of life. Later in development, each marmoset experienced three standardized social separation/novelty exposure stressors at 6, 12, and 18 months of age. During separation, we collected urine samples and analyzed them via enzyme immunoassay for cortisol levels. Infants that received higher rates of rejections from the entire family group showed higher cortisol responses to social separation. This relationship was found when mothers, fathers, and older siblings, were analyzed separately as well. No differences in cortisol responses were found between offspring that received high and low rates of carrying or high and low rates of licking and grooming by any group member. In the cooperatively breeding marmoset, early social cues from multiple classes of caregivers may influence HPA stress responses throughout the lifespan.

  10. Pattern of maternal circulating CRH in laboratory-housed squirrel and owl monkeys.

    Science.gov (United States)

    Power, M L; Williams, L E; Gibson, S V; Schulkin, J; Helfers, J; Zorrilla, E P

    2010-11-01

    The anthropoid primate placenta appears to be unique in producing corticotropin-releasing hormone (CRH). Placental CRH is involved in an endocrine circuit key to the production of estrogens during pregnancy. CRH induces cortisol production by the maternal and fetal adrenal glands, leading to further placental CRH production. CRH also stimulates the fetal adrenal glands to produce dehydroepiandrostendione sulfate (DHEAS), which the placenta converts into estrogens. There are at least two patterns of maternal circulating CRH across gestation among anthropoids. Monkeys examined to date (Papio and Callithrix) have an early-to-mid gestational peak of circulating CRH, followed by a steady decline to a plateau level, with a possible rise near parturition. In contrast, humans and great apes have an exponential rise in circulating CRH peaking at parturition. To further document and compare patterns of maternal circulating CRH in anthropoid primates, we collected monthly blood samples from 14 squirrel monkeys (Saimiri boliviensis) and ten owl monkeys (Aotus nancymaae) during pregnancy. CRH immunoreactivity was measured from extracted plasma by using solid-phase radioimmunoassay. Both squirrel and owl monkeys displayed a mid-gestational peak in circulating CRH: days 45-65 of the 152-day gestation for squirrel monkeys (mean±SEM CRH=2,694±276 pg/ml) and days 60-80 of the 133-day gestation for owl monkeys (9,871±974 pg/ml). In squirrel monkeys, circulating CRH declined to 36% of mean peak value by 2 weeks before parturition and then appeared to increase; the best model for circulating CRH over gestation in squirrel monkeys was a cubic function, similar to previous results for baboons and marmosets. In owl monkeys, circulating CRH appeared to reach plateau with no subsequent significant decline approaching parturition, although a cubic function was the best fit. This study provides additional evidence for a mid-gestational peak of maternal circulating CRH in ancestral

  11. Progress of Assisted Reproductive Technology and Genetic Modification in Marmoset (Callithrix jacchus)%狨猴生殖工程与基因修饰研究进展

    Institute of Scientific and Technical Information of China (English)

    张晓辉; 卢红宇; 黄群山; 杨世华

    2015-01-01

    人类疾病相关基因修饰动物模型已成为研究人类疾病分子机理和治疗靶点的重要途径和材料.狨猴是最小型实验灵长类动物,其体型小、繁殖快、遗传进化及生理生化方面与人类接近,是人类疾病动物模型研究的理想实验动物之一.因此,利用高效的生殖工程技术和基因编辑技术创制基因修饰狨猴具有巨大的生物医药价值.本文就狨猴生殖工程技术和基因修饰进行综述,旨在开拓人类疾病动物模型,推动疾病机理和新药创制的突破性发展.

  12. A case report of spontaneous opening of congenitally fused labia in a female common marmoset (Callithrix jacchus) followed by pregnancy and birth of twins.

    Science.gov (United States)

    Wedi, E; Nayudu, P L; Michelmann, H W

    2011-10-01

    A first case of spontaneous opening of congenitally fused labia (CFL phenotype) in a captive common marmoset followed by pregnancy and birth is presented here. The occurrence of this phenotype has been previously published in captive marmosets, but so far the etiology is unknown.

  13. Effect of antiprogestin ZK 98. 734 on the ovarian cycle, early pregnancy, and on its binding to progesterone receptors in the myometrium of marmoset Callithrix jacchus

    Energy Technology Data Exchange (ETDEWEB)

    Puri, C.P.; Kholkute, S.D.; Pongubala, J.M.; Patil, R.K.; Elger, W.A.; Jayaraman, S.

    1988-04-01

    The antiprogestin ZK 98.734 (11 beta-(4-dimethylaminophenyl-17 beta-hydroxy-17 alpha-(3-hydroxy-prop-1(Z)-enyl-4,9(10)-estradien-3-one) was administered i.m. (5 mg/day) for three consecutive days to two groups of common marmosets. In one group (nonpregnant, n = 6), it was injected during the luteal phase, and to the second group (pregnant, n = 7), it was injected during early pregnancy, on Days 24-26 of the mid-cycle estradiol peak. Administration of ZK 98.734 during the luteal phase caused a sharp drop in plasma progesterone levels. The luteal phase was shortened whether the drug was administered during the early or the late luteal phase. Similarly, administration of ZK 98.734 during early pregnancy caused a significant drop in progesterone levels, and pregnancy was terminated in all of the animals. The post-treatment cycles in both groups of animals were ovulatory and of normal duration. /sup 3/H-ZK 98.734 showed specific binding to myometrial cytosol fraction. ZK 98.734 also displaced the binding of /sup 3/H-progesterone to progesterone receptors. However, progesterone had higher binding affinity than did ZK 98.734. The antifertility action of ZK 98.734 could be a result either of its luteolytic action or of its blocking the progesterone receptors in the target tissue. This study, therefore, indicates that in the common marmoset ZK 98.734 is a progesterone antagonist with a potential to terminate early pregnancy.

  14. An operant conditioning method for studying auditory behaviors in marmoset monkeys.

    Directory of Open Access Journals (Sweden)

    Evan D Remington

    Full Text Available The common marmoset (Callithrix jacchus is a small New World primate that has increasingly been used as a non-human model in the fields of sensory, motor, and cognitive neuroscience. However, little knowledge exists regarding behavioral methods in this species. Developing an understanding of the neural basis of perception and cognition in an animal model requires measurement of both brain activity and behavior. Here we describe an operant conditioning behavioral training method developed to allow controlled psychoacoustic measurements in marmosets. We demonstrate that marmosets can be trained to consistently perform a Go/No-Go auditory task in which a subject licks at a feeding tube when it detects a sound. Correct responses result in delivery of a food reward. Crucially, this operant conditioning task generates little body movement and is well suited for pairing behavior with single-unit electrophysiology. Successful implementation of an operant conditioning behavior opens the door to a wide range of new studies in the field of auditory neuroscience using the marmoset as a model system.

  15. Atlas of the developing brain of the marmoset monkey constructed using magnetic resonance histology.

    Science.gov (United States)

    Hikishima, K; Sawada, K; Murayama, A Y; Komaki, Y; Kawai, K; Sato, N; Inoue, T; Itoh, T; Momoshima, S; Iriki, A; Okano, H J; Sasaki, E; Okano, H

    2013-01-29

    The developmental anatomy of the brain is largely directed by neural-based cues. Despite this knowledge, the developmental trajectory of the primate brain has not yet been fully characterized. To realize this goal, the advance in noninvasive imaging methods and new brain atlases are essential. The common marmoset (Callithrix jacchus), a small New World primate, is widely used in neuroscience research. The recent introduction of transgenic techniques has enabled the marmoset to be used as a genetically modifiable primate model for brain development. Here, a magnetic resonance histology technique involving the use of ultra-high-resolution ex vivo magnetic resonance imaging (MRI) was performed to identify the developmental anatomy of the marmoset brain at different time points from gestational week 8 through to birth. The data allowed the generation of a multidimensional atlas of brain structures at different developmental stages. Furthermore, in utero MRI techniques were developed to noninvasively monitor brain development during the embryonic and fetal stages. The multidimensional atlas and the MRI tools developed herein are anticipated to further our understanding of the developing primate brain. Copyright © 2012 IBRO. Published by Elsevier Ltd. All rights reserved.

  16. Kenya's Monkeys

    Institute of Scientific and Technical Information of China (English)

    唐天麒

    2004-01-01

    It's difficult to get close to patas monkeys(花脸猴). Clever and nervous, they run away at the sight of humans. The long-legged monkeys, clocked ( 记录 [ 速度 ] ) at 34 miles an hour, easily escaped from the zoologist Lynne Isbell when she arrived in Kenya in 1992.

  17. Estudo anatômico do osso temporal de um primata não-humano (Callithrix sp Anatomical study of a temporal bone from a non-human primate (Callithrix sp

    Directory of Open Access Journals (Sweden)

    Andrei Borin

    2008-06-01

    Full Text Available A busca por modelos experimentais constitui passo fundamental para o avanço da medicina. OBJETIVO: Demonstrar, através da dissecção com técnicas microcirúrgicas, as estruturas anatômicas do osso temporal do primata Callithrix sp. FORMA DE ESTUDO: Experimental. MÉTODO: Dissecção de ossos temporais de Callithrix sp e documentação fotográfica. RESULTADOS: Identificamos as principais estruturas do osso temporal (orelhas externa, média e interna, e nervo facial. CONCLUSÃO: O primata não-humano Callithrix sp representa aparentemente um modelo viável para o estudo do osso temporal uma vez que apresenta alta similaridade anatômica com humanos.The search for experimental (animal models is essential to the development of clinical studies. AIM: To demonstrate, by means of micro dissection techniques, the anatomical structures of temporal bones from the primate Callithrix sp. STUDY DESIGN: Experimental. METHODS: Dissection of temporal bone structures of Callithrix sp and photographic documentation. RESULTS: We identified the main constituents of the temporal bone (external, medium and inner ear and facial nerve. CONCLUSION: The non-human primate Callithrix sp. is an adequate experimental model for the studies of temporal bone structures given its close anatomical similarities to that found in humans.

  18. Occurrence of Ehrlichia canis in free-living primates of the genus Callithrix

    Directory of Open Access Journals (Sweden)

    Claudio Mafra

    Full Text Available Bacteria of the genus Ehrlichia are Gram-negative and coccoid-shaped microorganisms that cause ehrlichiosis – a serious infectious disease that often leads to death. These bacteria present a strong zoonotic potential and primates may act as reservoir hosts. This study involved a molecular analysis to detect these microorganisms in blood samples collected from nineteen primates of the genus Callithrix living free in an Atlantic Forest fragment in the municipality of Viçosa, state of Minas Gerais, Brazil. One of the 19 primates was found to be infected with Ehrlichia canis. This finding points to a new wild host of E. canis with a strong potential for transmission to humans because of its increasing contact with people. This is the first report of Ehrlichia spp. in primate of the genus Callithrix.

  19. New potential Plasmodium brasilianum hosts: tamarin and marmoset monkeys (family Callitrichidae).

    Science.gov (United States)

    Alvarenga, Denise A M; Pina-Costa, Anielle; Bianco, Cesare; Moreira, Silvia B; Brasil, Patricia; Pissinatti, Alcides; Daniel-Ribeiro, Claudio T; Brito, Cristiana F A

    2017-02-10

    Non-human primates (NHPs) as a source for Plasmodium infections in humans are a challenge for malaria elimination. In Brazil, two species of Plasmodium have been described infecting NHPs, Plasmodium brasilianum and Plasmodium simium. Both species are infective to man. Plasmodium brasilianum resembles morphologically, genetically and immunologically the human quartan Plasmodium malariae. Plasmodium brasilianum naturally infects species of non-human primates from all New World monkey families from a large geographic area. In the family Callitrichidae only the genus Saguinus has been described infected so far. The present study describes the natural infection of P. brasilianum in tamarins and marmosets of the genera Callithrix, Mico and Leontopithecus in the Atlantic forest. One hundred and twenty-two NHPs of the family Callitrichidae housed in the Primate Centre of Rio de Janeiro (CPRJ) were sampled in June 2015, and January and July 2016. The CPRJ is located in the Atlantic forest in the Guapimirim municipality, in the Rio de Janeiro state, where human autochthonous cases of malaria have been reported. The samples were screened for the presence of Plasmodium using optical microscopy and nested PCR for detection of 18S small subunit rRNA gene. The amplicon was sequenced to confirm the molecular diagnosis. The frequency of Plasmodium infections detected by nested PCR in New World monkeys of the family Callitrichidae was 6.6%. For the first time, Callitrichidae primates of genera Callithrix, Mico and Leontopithecus were found naturally infected with P. brasilianum. Infection was confirmed by sequencing a small fragment of 18S rRNA gene, although no parasites were detected in blood smears. The reported P. brasilianum infection in NHP species maintained in captivity suggests that infection can be favoured by the presence of vectors and the proximity between known (and unknown) hosts of malaria. Thus, the list of potential malaria reservoirs needs to be further explored.

  20. Gene : CBRC-CJAC-01-0050 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0050 UN A Opsins OPSL_CALJA 0.0 100% gb|AAC25654.1| X-linked visual pi...gment protein P561 [Callithrix jacchus] dbj|BAB58962.1| P561 cone opsin [Callithrix jacchus] dbj|BAB58966.1|... P561 cone opsin [Callithrix jacchus] 0.0 100% MGKAGGTEPIAKARAVGRRGGGEGGGPDGTGRGPFEGPNYHIAPRWVYHLTSVWMLFVVVA

  1. The Genial Monkeys of Emei

    Institute of Scientific and Technical Information of China (English)

    CAOHONG

    2004-01-01

    MANY of China's beautiful mountainous areas are home to monkeys,the most famous monkey resort being Emei Mountain. Perhaps affected by the mountain's Buddhist atmosphere, Emei's monkeys are gentle and often approach tourists for food and play. Cute and impish, these delightful creatures are the main attraction for many visitors.

  2. Gene : CBRC-CJAC-01-0968 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0968 UN A Chemokines and chemotactic factors receptors CCR5_CALHU 0.0 ...99% gb|AAF87984.1|AF252554_1 CC chemokine receptor 5 [Callithrix jacchus] gb|AAK43361.1|AF177878_1 C-C chemo...kine receptor 5 [Callithrix jacchus] gb|AAN14530.1|AF452614_1 chemokine receptor CCR5 [Callithrix jacchus] g...b|AAQ20011.1| CC chemokine receptor 5 [Callithrix jacchus] 0.0 100% MDYQVSSPIYDID

  3. THE CLEVER MONKEYS

    Institute of Scientific and Technical Information of China (English)

    付惠娟

    2004-01-01

    A man was walking through a forest. He had a few caps in his hands. In the forest there were a lot of monkeys. The day was hot, so he decided to have a rest under a tree. I-le put one cap on his head and lay down to sleep.

  4. Polymorphism in Trypomastigotes of Trypanosoma (Megatrypanum minasense in the blood of experimentally infected squirrel monkey and marmosets

    Directory of Open Access Journals (Sweden)

    Mariangela Ziccardi

    1999-09-01

    Full Text Available Experimental infections by Trypanosoma (Megatrypanum minasense were performed in primates - Saimiri sciureus and Callithrix penicillata - with the objective of searching for morphological variations of the blood trypomastigotes with respect to hosts and time of infection. We carried out morphological and morphometric analysis of blood trypomastigotes. Illustrations are given. Both the squirrel monkey and marmoset became infected after the injection of blood trypomastigotes of T. minasense , although the parasitaemia were briefer in the squirrel monkey. The parasites detected in the later host were narrower and shorter than those found in the inoculated marmoset. In the marmoset, the blood stream parasites derived from culture metacyclic trypomastigotes were considerably smaller than those derived from the inoculation of infected blood. Stronger evidence of polymorphism was found when, at the same time of infection, the blood trypomastigotes found in squirrel monkey had smaller length, body width and the distance from posterior end of the body to the kinetoplast almost four times smaller than the parasite found in the marmoset. Therefore, conflicting results on morphology and morphometry of T. minasense obtained by previous investigators could be due to polymorphism.

  5. The Elephant and the Monkey

    Institute of Scientific and Technical Information of China (English)

    朱妤

    2009-01-01

    @@ Once an Elephant met a Monkey."Look how big and strong I am!"he said."I can break a tree.Can you break a tree?" "Look how quickly I can run and climb!"said the Monkey."Can you climb a tree?" The elephant was proud because he was so strong,and the Monkey Was proud because she was so quick.

  6. Image collection: 67 [Togo Picture Gallery[Archive

    Lifescience Database Archive (English)

    Full Text Available 67 Callithrix_jacchus_NL.png コモンマーモセット Common marmoset Callithrix jacchus 9483 生物アイコン,脊索動物門,脊椎動物亜門,哺乳綱,獣亜綱,真獣下綱,霊長目

  7. Efeitos da ausência de glicose e glicose e oxigênio sobre neurônios gabaérgicos e retina interna do primata do novo mundo Callithrix jacchus

    OpenAIRE

    José Lira Ferreira, Renato

    2004-01-01

    Sob condições fisiológicas o aminoácido glutamato é o principal neurotransmissor excitatório da retina, mas em situações patológicas tais como a isquemia ele pode atuar como uma neurotoxina, promovendo despolarização excessiva e dano neuronal a partir da ativação de receptores glutamatérgicos ionotrópicos. Neste estudo analisamos os efeitos excitotóxicos agudos induzidos pela ausência de glicose ou ausência de glicose e oxigênio (isquemia simulada in vitro) na retina do primata...

  8. Formation of infectious dengue virus-antibody immune complex in vivo in marmosets (Callithrix jacchus) after passive transfer of anti-dengue virus monoclonal antibodies and infection with dengue virus.

    Science.gov (United States)

    Moi, Meng Ling; Ami, Yasushi; Shirai, Kenji; Lim, Chang-Kweng; Suzaki, Yuriko; Saito, Yuka; Kitaura, Kazutaka; Saijo, Masayuki; Suzuki, Ryuji; Kurane, Ichiro; Takasaki, Tomohiko

    2015-02-01

    Infection with a dengue virus (DENV) serotype induces cross-reactive, weakly neutralizing antibodies to different dengue serotypes. It has been postulated that cross-reactive antibodies form a virus-antibody immune complex and enhance DENV infection of Fc gamma receptor (FcγR)-bearing cells. We determined whether infectious DENV-antibody immune complex is formed in vivo in marmosets after passive transfer of DENV-specific monoclonal antibody (mAb) and DENV inoculation and whether infectious DENV-antibody immune complex is detectable using FcγR-expressing cells. Marmosets showed that DENV-antibody immune complex was exclusively infectious to FcγR-expressing cells on days 2, 4, and 7 after passive transfer of each of the mAbs (mAb 4G2 and mAb 6B6C) and DENV inoculation. Although DENV-antibody immune complex was detected, contribution of the passively transferred antibody to overall viremia levels was limited in this study. The results indicate that DENV cross-reactive antibodies form DENV-antibody immune complex in vivo, which is infectious to FcγR-bearing cells but not FcγR-negative cells.

  9. Spontaneous Metacognition in Rhesus Monkeys.

    Science.gov (United States)

    Rosati, Alexandra G; Santos, Laurie R

    2016-09-01

    Metacognition is the ability to think about thinking. Although monitoring and controlling one's knowledge is a key feature of human cognition, its evolutionary origins are debated. In the current study, we examined whether rhesus monkeys (Macaca mulatta; N = 120) could make metacognitive inferences in a one-shot decision. Each monkey experienced one of four conditions, observing a human appearing to hide a food reward in an apparatus consisting of either one or two tubes. The monkeys tended to search the correct location when they observed this baiting event, but engaged in information seeking-by peering into a center location where they could check both potential hiding spots-if their view had been occluded and information seeking was possible. The monkeys only occasionally approached the center when information seeking was not possible. These results show that monkeys spontaneously use information about their own knowledge states to solve naturalistic foraging problems, and thus provide the first evidence that nonhumans exhibit information-seeking responses in situations with which they have no prior experience.

  10. Rhesus monkey heart rate during exercise

    Science.gov (United States)

    Delorge, J.; Thach, J. S., Jr.

    1972-01-01

    Various schedules of reinforcement and their relation to heart rates of rhesus monkeys during exercise are described. All the reinforcement schedules produced 100 per cent or higher increments in the heart rates of the monkeys during exercise. Resting heart rates were generally much lower than those previously reported, which was attributed to the lack of physical restraint of the monkeys during recording.

  11. Monkeys Match and Tally Quantities across Senses

    Science.gov (United States)

    Jordan, Kerry E.; MacLean, Evan L.; Brannon, Elizabeth M.

    2008-01-01

    We report here that monkeys can actively match the number of sounds they hear to the number of shapes they see and present the first evidence that monkeys sum over sounds and sights. In Experiment 1, two monkeys were trained to choose a simultaneous array of 1-9 squares that numerically matched a sample sequence of shapes or sounds. Monkeys…

  12. Get the Monkey off Your Back

    Science.gov (United States)

    Ciabattini, David; Custer, Timothy J.

    2008-01-01

    Monkeys are the problems that need solutions, the tasks that need to be accomplished, the decisions that need to be made, and the actions that need to be taken. According to a theory, people carry monkeys around on their backs until they can successfully shift their burden to someone else and the monkey leaps from one back to the next. Managers…

  13. ENRIQUECIMENTO AMBIENTAL X COMPORTAMENTO EM CATIVEIRO DE CALLITHRIX AURITA (É. Geoffroy, 1812

    Directory of Open Access Journals (Sweden)

    Marcellus Pereira Souza

    2017-02-01

    Full Text Available Técnicas de enriquecimento ambiental foram utilizadas para avaliação dos comportamentos em cativeiro de um grupo de três indivíduos, duas fêmeas e um macho de Callithrix aurita (sagui-da-serra-escuro, cativos do Mantenedor de Fauna Silvestre da UNIVAP, São José dos Campos, SP. Foram implantados seis diferentes enriquecimentos alimentares e observações com duração de uma hora pelo método “focal sampling grupal” no período de agosto a novembro de 2015. Os comportamentos categorizados, inicialmente, eram Alimentação, Alerta, Comunicação, Social, Manutenção e Território. A categoria Cuidado Parental foi adicionada após o nascimento de dois filhotes. Percebeu-se que Alimentação e Alerta foram as categorias mais evidentes, que Cuidado Parental apareceu equilibrada entre os membros e as expressões de comportamentos típicos foram significantes para concluir que enriquecimentos ambientais melhoram o bem-estar animal de animal em cativeiro.

  14. Morphology of pericardium of black-tufted-ear-marmoset (Callithrix penicillata

    Directory of Open Access Journals (Sweden)

    Luana Célia Stunitz da Silva

    2012-03-01

    Full Text Available Although many of the diseases that affect the marmosets have already been described, there is a lack of anatomical information on them. In this regard, this study aimed to describe the histological and ultrastructural morphology of the pericardium of black-tufted-ear-marmoset (Callithrix penicillata using four adult specimens from a breeding of wild animals that died from natural causes. Initially, the dissection for exposing and removing the pericardium was carried out in all the primates, which was afterwards sent for analysis both through scanning electronic microscopy and through light microscopy, stained with hematoxylin/eosin (HE and Masson trichrome. This resulted in the observation of a single layer of epithelial cells, named mesothelium, and the presence of cellular extensions and pores. Thus, one can conclude that the pericardium of black-tufted-ear-marmoset has microscopic and ultrastructural characteristics very similar to those of rat, mouse, and golden hamster. It has, however, cellular extensions instead of microvilli previously described in other animal species.

  15. Novel mastadenovirus infection and clinical disease in a pygmy marmoset (Callithrix [Cebuella] pygmaea).

    Science.gov (United States)

    Gál, János; Hornyák, Ákos; Mándoki, Míra; Bakonyi, Tamás; Balka, Gyula; Szeredi, Levente; Marosán, Miklós; Ludányi, Tibor; Forgách, Petra; Sós, Endre; Demeter, Zoltán; Farkas, Szilvia L

    2013-12-27

    We describe the detection and successful isolation of a novel mastadenovirus from a pygmy marmoset (Callithrix [Cebuella] pygmaea) that died following an episode of severe respiratory signs. Pathologic/histopathologic examination revealed hydrothorax and catarrhal bronchopneumonia with pronounced desquamation of the bronchiolar epithelial cells, while in other airways a marked hyperplasia of the epithelial lining and numerous giant cells could be observed. We obtained partial sequence data from the adenoviral DNA-dependent DNA-polymerase gene of the isolated strain and analyses of this region showed the highest level of identity to the recently described bat adenoviruses (strains PPV1 and TJM) and the type 2 canine adenovirus. Similar results were gained by phylogenetic calculations indicating that this novel marmoset adenovirus is only distantly related to reference Old and New World primate adenoviruses and formed a monophyletic group with bat and canine adenoviruses and the equine adenovirus 1. Even though the source of the infection remained unknown, our results could imply the possibility of a cross-species transmission of the virus from an anonymous host to the pygmy marmoset.

  16. Helminths of wild hybrid marmosets (Callithrix sp. living in an environment with high human activity

    Directory of Open Access Journals (Sweden)

    Alexandre de Oliveira Tavela

    Full Text Available The objective of this study was to identify the helminth fauna in hybrid, non-native marmosets, through analysis of fecal samples. The study involved 51 marmosets (genus Callithrix from five groups living in places with levels of human impact in Viçosa-MG. The marmosets were caught using a multiple-entrance trap and were anaesthetized. Feces were collected, refrigerated and analyzed by means of the sedimentation technique (Hoffmann-Pons-Janner. Eggs and parasites were identified, but not counted. Most of the marmosets (86% were parasitized by at least one genus of helminths. Among the infected marmosets, 37% presented co-infection. The intestinal helminths comprised four different taxa: Primasubulura jacchi, Ancylostomatidae, Prosthenorchis sp. and Dilepididae.P. jacchi and Ancylostomatidae had higher prevalences (> 80% and > 40%, respectively and were found in all marmoset groups. Dilepididae species were found in almost all the groups, but only accounted for around 30% of the marmosets. Prosthenorchis sp. showed a relatively low prevalence (< 10% and was only found in one group. Although two parasites are commonly found in marmosets and other primates (P. jacchi and Prosthenorchis sp., our study is the first record for Ancylostomatidae and Dilepididae. Factors like marmosets' feeding behavior and their contact with humans and other species of nonhuman primates seem to be determinants of infection among marmosets.

  17. Clinical, hematological, biochemical, and ultrasonographic aspects of Platynosomum sp. (Trematoda: Dicrocoeliidae) infection of captive Callithrix penicillata.

    Science.gov (United States)

    Mattioli, Mariana Portugal; Batista, Juliana dos Santos; Ferrari, Marlon; Paludo, Giane Regina; Dias, Cecília Azevedo; Hoppe, Estevam G L; da Rocha, Gino Chaves; Monteiro, Rafael Veríssimo

    2016-04-01

    Trematodes from the genus Platynosomum have been found to infect Neotropical primates in captivity, but little is known about their pathogeny in such hosts. This study evaluated the physiological effects of natural infection by the liver-dwelling trematode Platynosomum sp. in ten males and ten females of Callithrix penicillata kept in captivity at the Primate Center of the University of Brasília. The marmosets were examined twice, 6 months apart. The following parameters were analyzed: complete blood count, bleeding time, serum total protein, albumin, and the liver enzymes AST and ALT, and both a stool analysis and a liver ultrasonic evaluation were performed. We were able to characterize a group of abnormalities associated with this trematode infection which were mainly derived from the hepatitis caused by it: coagulation disorders, abnormal red blood cells, hypoalbuminemia, and abnormal levels of liver-linked serum enzymes. Eosinophilia and thrombocytopenia were also commonly seen. All of the aforementioned abnormalities were in good accord with typical effects of trematodes on liver parenchyma. We suggest that this set of abnormalities is characteristic of the infection of C. penicillata with Platynosomum sp., and should be among the most prominent aspects that the veterinary surgeon considers when suspecting such an infection. We also suggest that these clinical signs and abnormalities will be similar in other liver-dwelling trematode-infected primate species.

  18. Breeding monkeys for biomedical research

    Science.gov (United States)

    Bourne, G. H.; Golarzdebourne, M. N.; Keeling, M. E.

    1973-01-01

    Captive bred rhesus monkeys show much less pathology than wild born animals. The monkeys may be bred in cages or in an outdoor compound. Cage bred animals are not psychologically normal which makes then unsuited for some types of space related research. Compound breeding provides contact between mother and infant and an opportunity for the infants to play with their peers which are important requirements to help maintain their behavioral integrity. Offspring harvested after a year in the compound appear behaviorally normal and show little histopathology. Compound breeding is also an economical method for the rapid production of young animals. The colony can double its size about every two and a half years.

  19. Population parameters of the endangered titi monkey, Callicebus coimbrai Kobayashi and Langguth, 1999, in the fragmented landscape of southern Sergipe, Brazil

    Directory of Open Access Journals (Sweden)

    RRD. Chagas

    Full Text Available The recently-discovered titi, Callicebus coimbrai, is endemic to the coastal Brazilian Atlantic Forest south of the São Francisco River, a region with a long tradition of deforestation. While a number of C. coimbrai populations have now been identified, little is known about basic population parameters. Considering the importance of this information for conservation planning, the population of a site in southern Sergipe (with a total area of forest of approximately 500 ha was surveyed between April and October 2008. Standard line transect procedures were used in the four largest fragments, and additional monitoring included the use of playback broadcasts for the observation of titi groups. The presence of titis was confirmed in all the forest fragments at the site, including one of only five hectares. Two other primates - Callithrix jacchus and Cebus xanthosternos - were also recorded at the site, but were less abundant than titis. A total transect walk of 476 km provided 164 sightings of primates, the majority of which (104 were of Callicebus coimbrai. Titi groups ranged in size between two and five individuals. The most reliable estimate of overall population density, derived from the combined data set, was 12.6 individuals per km²;, although density was much higher in smaller (more disturbed fragments. The total population of Callicebus coimbrai at the site was estimated to be at least 50 individuals, which may represent a considerable proportion of the population of the species remaining in the wild. In addition to its apparent tolerance of habitat fragmentation, densities of C. coimbrai recorded at the site compare favourably with those of other Atlantic Forest titi species.

  20. Population parameters of the endangered titi monkey, Callicebus coimbrai Kobayashi and Langguth, 1999, in the fragmented landscape of southern Sergipe, Brazil.

    Science.gov (United States)

    Chagas, R R D; Ferrari, S F

    2011-08-01

    The recently-discovered titi, Callicebus coimbrai, is endemic to the coastal Brazilian Atlantic Forest south of the São Francisco River, a region with a long tradition of deforestation. While a number of C. coimbrai populations have now been identified, little is known about basic population parameters. Considering the importance of this information for conservation planning, the population of a site in southern Sergipe (with a total area of forest of approximately 500 ha) was surveyed between April and October 2008. Standard line transect procedures were used in the four largest fragments, and additional monitoring included the use of playback broadcasts for the observation of titi groups. The presence of titis was confirmed in all the forest fragments at the site, including one of only five hectares. Two other primates - Callithrix jacchus and Cebus xanthosternos - were also recorded at the site, but were less abundant than titis. A total transect walk of 476 km provided 164 sightings of primates, the majority of which (104) were of Callicebus coimbrai. Titi groups ranged in size between two and five individuals. The most reliable estimate of overall population density, derived from the combined data set, was 12.6 individuals per km²;, although density was much higher in smaller (more disturbed) fragments. The total population of Callicebus coimbrai at the site was estimated to be at least 50 individuals, which may represent a considerable proportion of the population of the species remaining in the wild. In addition to its apparent tolerance of habitat fragmentation, densities of C. coimbrai recorded at the site compare favourably with those of other Atlantic Forest titi species.

  1. Sequence and evolution of the blue cone pigment gene in old and new world primates

    Energy Technology Data Exchange (ETDEWEB)

    Hunt, D.M.; Cowing, J.A.; Patel, R. [Univ. of London (United Kingdom)] [and others

    1995-06-10

    The sequences of the blue cone photopigments in the talapoin monkey (Miopithecus talapoin), an Old World primate, and in the marmoset (Callithrix jacchus), a New World monkey, are presented. Both genes are composed of 5 exons separated by 4 introns. In this respect, they are identical to the human blue gene, and intron sizes are also similar. Based on the level of amino acid identity, both monkey pigments are members of the S branch of pigments. Alignment of these sequences with the human gene requires the insertion/deletion of two separate codons in exon 1. The silent site divergence between these primate blue genes indicates a separation of the Old and New World primate lineages around 43 million years ago. 41 refs., 1 fig., 3 tabs.

  2. Monkeys in a prisoner's dilemma.

    Science.gov (United States)

    Tian, Ju; Uchida, Naoshige

    2015-03-12

    Haroush and Williams trained pairs of monkeys to play in a prisoner's dilemma game, a model of social interactions. Recording from the dorsal anterior cingulate cortex (dACC), they find neurons whose activity reflects the anticipation of the opponent's yet unknown choice, which may be important in guiding animals' performance in the game.

  3. Modelling Social Learning in Monkeys

    Science.gov (United States)

    Kendal, Jeremy R.

    2008-01-01

    The application of modelling to social learning in monkey populations has been a neglected topic. Recently, however, a number of statistical, simulation and analytical approaches have been developed to help examine social learning processes, putative traditions, the use of social learning strategies and the diffusion dynamics of socially…

  4. The evaluation of enteric viruses in asymptomatic free-ranging non-human primates (Alouatta guariba clamitans, Alouatta caraya, Callithrix spp., Callithrix penicillata, and Leontopithecus caissara) in southern Brazil.

    Science.gov (United States)

    Souza, Fabiana; Alfieri, Amauri A; Alfieri, Alice F; Lorenzetti, Elis; Headley, Selwyn A; Passos, Fernando; Silvestre, Thiago; Zago, Luciana; Mottin, Viviane; Montiani-Ferreira, Fabiano; Lange, Rogério; Svoboda, Walfrido; Gomes, Eliane

    2012-10-01

    This study evaluated the presence of rotavirus groups A, B, and C (RV-A, RV-B, and RV-C), sapovirus (SaV), and norovirus (NoV) in asymptomatic non-human primates (NHP). Fecal samples were collected from 19 recently captured (Red-howler, Alouatta guariba clamitans, n = 18; Howler, Alouatta caraya, n = 1) and 43 free-ranging NHP (Marmosets, Callithrix spp., Callithrix penicillata, n = 30; Black-faced lion tamarin, Leontopithecus caissara, n = 12, Red-howler, Alouatta guariba clamitans, n = 1) that were maintained in southern Brazil without manifestation of diarrhea. Screening was performed by a combination of silver-stained polyacrylamide gel electrophoresis (ss-PAGE) and RT-PCR analyses. All samples were negative for RV-A, RV-B, RV-C, SaV, and NoV by both assays. The negative results obtained might be due to the absence of clinical manifestations of disease in the population of NHP evaluated. © 2012 John Wiley & Sons A/S.

  5. A foraging advantage for dichromatic marmosets (Callithrix geoffroyi) at low light intensity.

    Science.gov (United States)

    Caine, Nancy G; Osorio, Daniel; Mundy, Nicholas I

    2010-02-23

    Most New World monkey species have both dichromatic and trichromatic individuals present in the same population. The selective forces acting to maintain the variation are hotly debated and are relevant to the evolution of the 'routine' trichromatic colour vision found in catarrhine primates. While trichromats have a foraging advantage for red food compared with dichromats, visual tasks which dichromats perform better have received less attention. Here we examine the effects of light intensity on foraging success among marmosets. We find that dichromats outperform trichomats when foraging in shade, but not in sun. The simplest explanation is that dichromats pay more attention to achromatic cues than trichromats. However, dichromats did not show a preference for foraging in shade compared with trichromats. Our results reveal several interesting parallels with a recent study in capuchin monkeys (Cebus capucinus), and suggest that dichromat advantage for certain tasks contributes to maintenance of the colour vision polymorphism.

  6. Seasonality of the activity pattern of Callithrix penicillata (Primates, Callitrichidae in the cerrado (scrub savanna vegetation

    Directory of Open Access Journals (Sweden)

    S. L. Vilela

    Full Text Available Two wild groups of Callithrix penicillata, the Black Pincelled Marmoset, were observed from January to September 1998, in two areas, one an area of dense scrub savanna vegetation (cerrado and the other, a semidecidual woodland (cerradão, both within the boundaries of the Ecological Reserve of IBGE (Brazilian Institute of Geography and Statistics, in an environmentally protected area, the APA (Portuguese abbreviation for "environmental protected area" Gama/Cabeça-de-Veado, Brasília, DF. The behavioral data collected during the rainy (January 15 to April 15 and dry season (June 1 to September 15 were compared. Because of the proximity to the Reserve facilities, the group from the dense scrub savanna vegetation (CD was submitted to antropic impacts different from the group in the semidecidual woodland (CE, which was using as territory an area that had been suffering from man-made fires every two years as part of a long-term experimental project on fire impacts. The behavioral data was quantified by instantaneous cross-section ("scan sampling" every ten minutes with records of locomotion, rest, foraging for insects, use of exudate, and feeding. During the whole year, the greatest percentage of time spent by CE and CD was in foraging for insects, with 44% and 39%, respectively. It was evident when comparing the data for the two seasons that, for both groups, foraging for insects was more intense during the dry season, possibly to complement the shortage of food, and locomotion increased during the rainy season. The greater the availability and distribution of fruit in the areas, the greater the locomotion of the groups to obtain these resources. None of the other behavioral patterns, including the use of exudates, presented significant differences between the two seasons. Both groups foraged more frequently during the dry season and locomoted more during the rainy one.

  7. Behavioral sleep in captive owl monkey (Aotus azarae) and squirrel monkey (Saimiri boliviensis).

    Science.gov (United States)

    Sri Kantha, Sachi; Suzuki, Juri; Hirai, Yuriko; Hirai, Hirohisa

    2009-01-01

    The objective of this study was to test the hypothesis that activity-behavioral sleep parameters differ between nocturnallyactive owl monkeys and diurnally-active squirrel monkeys which are sympatric and of Bolivian origin. The total sleep time (TST) and sleep episode length (SEL) of 7 adult owl monkey siblings and 4 adult squirrel monkeys were quantitated by actigraphy for 7 days under captive conditions. The higher TST/24 h values and longer SEL/12 h quiescent phase quantitated for owl monkeys in comparison to that of squirrel monkeys clearly indicate that the behavioral sleep is markedly different between these two groups, though they are sympatric in wild. Significant differences noted in the sleep architecture between squirrel monkeys and owl monkeys can be attributed to the influences in the selected sleep niche, threat perception from predators, and disturbances from natural elements (especially rain) in the natural habitat.

  8. Cooperation and competition in two forest monkeys

    OpenAIRE

    Eckardt, Winnie; Zuberbühler, Klaus

    2017-01-01

    Putty-nosed monkeys, Cercopithecus nictitans stampflii, occur at various sites in West Africa, particularly in the transition zone between rainforest and savannah. The species is sometimes seen in primary rainforest, although at a curiously low density compared with that of other monkey species. We conducted a 24-month field study in the tropical rainforest of Taï National Park, Ivory Coast, and found that putty-nosed monkeys require an ecological niche almost identical to that of the Diana m...

  9. Genetic analysis of captive proboscis monkeys.

    Science.gov (United States)

    Ogata, Mitsuaki; Seino, Satoru

    2015-01-01

    Information on the genetic relationships of captive founders is important for captive population management. In this study, we investigated DNA polymorphisms of four microsatellite loci and the mitochondrial control region sequence of five proboscis monkeys residing in a Japanese zoo as captive founders, to clarify their genetic relationship. We found that two of the five monkeys appeared to be genetically related. Furthermore, the haplotypes of the mitochondrial control region of the five monkeys were well differentiated from the haplotypes previously reported from wild populations from the northern area of Borneo, indicating a greater amount of genetic diversity in proboscis monkeys than previously reported. © 2014 Wiley Periodicals, Inc.

  10. Macaque monkeys experience visual crowding.

    Science.gov (United States)

    Crowder, Erin A; Olson, Carl R

    2015-01-01

    In peripheral vision, objects that are easily discriminated on their own become less discriminable in the presence of surrounding clutter. This phenomenon is known as crowding.The neural mechanisms underlying crowding are not well understood. Better insight might come from single-neuron recording in nonhuman primates, provided they exhibit crowding; however, previous demonstrations of crowding have been confined to humans. In the present study, we set out to determine whether crowding occurs in rhesus macaque monkeys. We found that animals trained to identify a target letter among flankers displayed three hallmarks of crowding as established in humans. First, at a given eccentricity, increasing the spacing between the target and the flankers improved recognition accuracy. Second, the critical spacing, defined as the minimal spacing at which target discrimination was reliable, was proportional to eccentricity. Third, the critical spacing was largely unaffected by object size. We conclude that monkeys, like humans, experience crowding. These findings open the door to studies of crowding at the neuronal level in the monkey visual system.

  11. Artificial Nursing Procedure Establishment for Infant Rhesus Monkeys

    Institute of Scientific and Technical Information of China (English)

    Wang Hong; Si Wei; Zhou Yin; Chen Lixian

    2015-01-01

    Rhesus monkey can not achieve natural delivery due to various reasons,and cesarean section becomes an important midwifery to get infant monkeys. After caesarean section,the pregnant monkey is weak and postoperative wound pain,so it can not personally feed infant monkeys which must be artificially fed. Thus,establishing suitable feeding management program is very important for improving survival rate of infant rhesus monkey and maintaining good health. We summarized food preparation method for infant rhesus monkeys as well as temperature setting and light control,and established the nursing program for newborn infant monkey and daily management process for infant monkeys.

  12. Cup tool use by squirrel monkeys.

    Science.gov (United States)

    Buckmaster, Christine L; Hyde, Shellie A; Parker, Karen J; Lyons, David M

    2015-12-01

    Captive-born male and female squirrel monkeys spontaneously 'invented' a cup tool use technique to Contain (i.e., hold and control) food they reduced into fragments for consumption and to Contain water collected from a valve to drink. Food cup use was observed more frequently than water cup use. Observations indicate that 68% (n = 39/57) of monkeys in this population used a cup (a plastic slip cap) to Contain food, and a subset of these monkeys, 10% (n = 4/39), also used a cup to Contain water. Cup use was optional and did not replace, but supplemented, the hand/arm-to-mouth eating and direct valve drinking exhibited by all members of the population. Strategies monkeys used to bring food and cups together for food processing activity at preferred upper-level perching areas, in the arboreal-like environment in which they lived, provides evidence that monkeys may plan food processing activity with the cups. Specifically, prior to cup use monkeys obtained a cup first before food, or obtained food and a cup from the floor simultaneously, before transporting both items to upper-level perching areas. After food processing activity with cups monkeys rarely dropped the cups and more often placed the cups onto perching. Monkeys subsequently returned to use cups that they previously placed on perching after food processing activity. The latter behavior is consistent with the possibility that monkeys may keep cups at preferred perching sites for future food processing activity and merits experimental investigation. Reports of spontaneous tool use by squirrel monkeys are rare and this is the first report of population-level tool use. These findings offer insights into the cognitive abilities of squirrel monkeys and provide a new context for behavior studies with this genus and for comparative studies with other primates.

  13. Metacognition in Monkeys during an Oculomotor Task

    Science.gov (United States)

    Middlebrooks, Paul G.; Sommer, Marc A.

    2011-01-01

    This study investigated whether rhesus monkeys show evidence of metacognition in a reduced, visual oculomotor task that is particularly suitable for use in fMRI and electrophysiology. The 2-stage task involved punctate visual stimulation and saccadic eye movement responses. In each trial, monkeys made a decision and then made a bet. To earn…

  14. Metacognition in Monkeys during an Oculomotor Task

    Science.gov (United States)

    Middlebrooks, Paul G.; Sommer, Marc A.

    2011-01-01

    This study investigated whether rhesus monkeys show evidence of metacognition in a reduced, visual oculomotor task that is particularly suitable for use in fMRI and electrophysiology. The 2-stage task involved punctate visual stimulation and saccadic eye movement responses. In each trial, monkeys made a decision and then made a bet. To earn…

  15. Prototype Abstraction by Monkeys ("Macaca Mulatta")

    Science.gov (United States)

    Smith, J. David; Redford, Joshua S.; Haas, Sarah M.

    2008-01-01

    The authors analyze the shape categorization of rhesus monkeys ("Macaca mulatta") and the role of prototype- and exemplar-based comparison processes in monkeys' category learning. Prototype and exemplar theories make contrasting predictions regarding performance on the Posner-Homa dot-distortion categorization task. Prototype theory--which…

  16. On Loss Aversion in Capuchin Monkeys

    Science.gov (United States)

    Silberberg, Alan; Roma, Peter G.; Huntsberry, Mary E.; Warren-Boulton, Frederick R.; Sakagami, Takayuki; Ruggiero, Angela M.; Suomi, Stephen J.

    2008-01-01

    Chen, Lakshminarayanan, and Santos (2006) claim to show in three choice experiments that monkeys react rationally to price and wealth shocks, but, when faced with gambles, display hallmark, human-like biases that include loss aversion. We present three experiments with monkeys and humans consistent with a reinterpretation of their data that…

  17. Spatial information processing in humans and monkeys

    NARCIS (Netherlands)

    Oleksiak, A.

    2010-01-01

    In this thesis a series of experiments are described on human volunteers and rhesus monkeys (Macaca mulatta) in the context of spatial information processing. In the first single-unit recording experiments in monkeys a spatial summation algorithm was investigated. The responses of single neurons to

  18. Influence of environmental enrichment techniques in improvement of welfare of Callithrix penicillata (E. Geoffroy, 1812 (Primates: Callitrichidae

    Directory of Open Access Journals (Sweden)

    Mariana Prado Borges

    2011-02-01

    Full Text Available This study applied environmental enrichment techniques to a captive Callithrix penicillata group aiming to improve the welfare of these animals. Enrichment was carried out with six animals, three males and three females, of Sabiá Municipal Park zoo (Uberlândia, MG, Brazil. Data were collected in three phases, before enrichment, during enrichment and after enrichment, each phase with 40h of quantitative observations. We used two sensorial and four feeding enrichment devices. The animals’ responses to the enrichment were positive. We observed an increase in some of the behavioral categories, such as “exploring”, “foraging”, “social” and “territorial”. On the other hand, other behaviors decreased, e.g. “stereotypic” (a behavior that indicates stress. During and after the application of enrichment, new behaviors appeared particularly reproductive behaviors, which we had not seen previously. The behavioral changes observed indicate that the enrichment promoted an increase in welfare.

  19. The common marmoset genome provides insight into primate biology and evolution.

    Science.gov (United States)

    2014-08-01

    We report the whole-genome sequence of the common marmoset (Callithrix jacchus). The 2.26-Gb genome of a female marmoset was assembled using Sanger read data (6×) and a whole-genome shotgun strategy. A first analysis has permitted comparison with the genomes of apes and Old World monkeys and the identification of specific features that might contribute to the unique biology of this diminutive primate, including genetic changes that may influence body size, frequent twinning and chimerism. We observed positive selection in growth hormone/insulin-like growth factor genes (growth pathways), respiratory complex I genes (metabolic pathways), and genes encoding immunobiological factors and proteases (reproductive and immunity pathways). In addition, both protein-coding and microRNA genes related to reproduction exhibited evidence of rapid sequence evolution. This genome sequence for a New World monkey enables increased power for comparative analyses among available primate genomes and facilitates biomedical research application.

  20. Pluripotent hybrid stem cells from transgenic Huntington's disease monkey.

    Science.gov (United States)

    Laowtammathron, Chuti; Chan, Anthony W S

    2013-01-01

    Huntington's disease (HD) is a devastating disease that currently has no cure. Transgenic HD monkeys have developed key neuropathological and cognitive behavioral impairments similar to HD patients. Thus, pluripotent stem cells derived from transgenic HD monkeys could be a useful comparative model for clarifying HD pathogenesis and developing novel therapeutic approaches, which could be validated in HD monkeys. In order to create personal pluripotent stem cells from HD monkeys, here we present a tetraploid technique for deriving pluripotent hybrid HD monkey stem cells.

  1. Hypertrophic cardiomyopathy in owl monkeys (Aotus spp.).

    Science.gov (United States)

    Knowlen, Grant G; Weller, Richard E; Perry, Ruby L; Baer, Janet F; Gozalo, Alfonso S

    2013-06-01

    Cardiac hypertrophy is a common postmortem finding in owl monkeys. In most cases the animals do not exhibit clinical signs until the disease is advanced, making antemortem diagnosis of subclinical disease difficult and treatment unrewarding. We obtained echocardiograms, electrocardiograms, and thoracic radiographs from members of a colony of owl monkeys that previously was identified as showing a 40% incidence of gross myocardial hypertrophy at necropsy, to assess the usefulness of these modalities for antemortem diagnosis. No single modality was sufficiently sensitive and specific to detect all monkeys with cardiac hypertrophy. Electrocardiography was the least sensitive method for detecting owl monkeys with hypertrophic cardiomyopathy. Thoracic radiographs were more sensitive than was electrocardiography in this context but cannot detect animals with concentric hypertrophy without an enlarged cardiac silhouette. Echocardiography was the most sensitive method for identifying cardiac hypertrophy in owl monkeys. The most useful parameters suggestive of left ventricular hypertrophy in our owl monkeys were an increased average left ventricular wall thickness to chamber radius ratio and an increased calculated left ventricular myocardial mass. Parameters suggestive of dilative cardiomyopathy were an increased average left ventricular myocardial mass and a decreased average ratio of left ventricular free wall thickness to left ventricular chamber radius. When all 4 noninvasive diagnostic modalities (physical examination, echocardiography, electrocardiography, and thoracic radiography) were used concurrently, the probability of detecting hypertrophic cardiomyopathy in owl monkeys was increased greatly.

  2. UniProt search blastx result: AK288291 [KOME

    Lifescience Database Archive (English)

    Full Text Available C 2.7.10.1) (HGF receptor) (Scatter factor receptor) (SF receptor) (HGF/SF receptor) (Met proto-oncogene tyrosine kinase) (c-Met) - Callithrix jacchus (Common marmoset) 1.00E-13 ...

  3. UniProt search blastx result: AK288287 [KOME

    Lifescience Database Archive (English)

    Full Text Available C 2.7.10.1) (HGF receptor) (Scatter factor receptor) (SF receptor) (HGF/SF receptor) (Met proto-oncogene tyrosine kinase) (c-Met) - Callithrix jacchus (Common marmoset) 7.00E-18 ...

  4. UniProt search blastx result: AK287970 [KOME

    Lifescience Database Archive (English)

    Full Text Available C 2.7.10.1) (HGF receptor) (Scatter factor receptor) (SF receptor) (HGF/SF receptor) (Met proto-oncogene tyrosine kinase) (c-Met) - Callithrix jacchus (Common marmoset) 3.00E-20 ...

  5. UniProt search blastx result: AK288206 [KOME

    Lifescience Database Archive (English)

    Full Text Available C 2.7.10.1) (HGF receptor) (Scatter factor receptor) (SF receptor) (HGF/SF receptor) (Met proto-oncogene tyrosine kinase) (c-Met) - Callithrix jacchus (Common marmoset) 3.00E-21 ...

  6. UniProt search blastx result: AK287692 [KOME

    Lifescience Database Archive (English)

    Full Text Available C 2.7.10.1) (HGF receptor) (Scatter factor receptor) (SF receptor) (HGF/SF receptor) (Met proto-oncogene tyrosine kinase) (c-Met) - Callithrix jacchus (Common marmoset) 1.00E-15 ...

  7. UniProt search blastx result: AK287484 [KOME

    Lifescience Database Archive (English)

    Full Text Available C 2.7.10.1) (HGF receptor) (Scatter factor receptor) (SF receptor) (HGF/SF receptor) (Met proto-oncogene tyrosine kinase) (c-Met) - Callithrix jacchus (Common marmoset) 3.00E-16 ...

  8. UniProt search blastx result: AK289170 [KOME

    Lifescience Database Archive (English)

    Full Text Available C 2.7.10.1) (HGF receptor) (Scatter factor receptor) (SF receptor) (HGF/SF receptor) (Met proto-oncogene tyrosine kinase) (c-Met) - Callithrix jacchus (Common marmoset) 8.00E-19 ...

  9. Gene : CBRC-CJAC-01-0342 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0342 UN A Releasing hormones receptors GHSR_HUMAN 0.0 97% gb|ABP88930....1| ghrelin receptor [Callithrix jacchus] 0.0 100% MWNATPSEEPGLNLTLEDLDWDASPGNDSLGDELLPPFTAPLLAGVTATCVALFVVGI

  10. Assisted reproductive technologies in the common marmoset: an integral species for developing nonhuman primate models of human diseases

    National Research Council Canada - National Science Library

    Kropp, Jenna; Di Marzo, Andrea; Golos, Thaddeus

    2017-01-01

    .... Callithrix jacchus, or the common marmoset, is a New World, nonhuman primate species that exhibits great reproductive fitness in captivity with an ovarian cycle that can be easily managed with pharmacological agents...

  11. Generation of chimeric rhesus monkeys.

    Science.gov (United States)

    Tachibana, Masahito; Sparman, Michelle; Ramsey, Cathy; Ma, Hong; Lee, Hyo-Sang; Penedo, Maria Cecilia T; Mitalipov, Shoukhrat

    2012-01-20

    Totipotent cells in early embryos are progenitors of all stem cells and are capable of developing into a whole organism, including extraembryonic tissues such as placenta. Pluripotent cells in the inner cell mass (ICM) are the descendants of totipotent cells and can differentiate into any cell type of a body except extraembryonic tissues. The ability to contribute to chimeric animals upon reintroduction into host embryos is the key feature of murine totipotent and pluripotent cells. Here, we demonstrate that rhesus monkey embryonic stem cells (ESCs) and isolated ICMs fail to incorporate into host embryos and develop into chimeras. However, chimeric offspring were produced following aggregation of totipotent cells of the four-cell embryos. These results provide insights into the species-specific nature of primate embryos and suggest that a chimera assay using pluripotent cells may not be feasible.

  12. Vitreal syneresis in rhesus monkeys.

    Science.gov (United States)

    Stuck, B E; Talsma, D M; Beatrice, E S

    1977-11-01

    The eyes of 15 rhesus monkeys were evaluated. Various degrees of vitreal syneresis were observed in 28 of the 30 eyes. The observed vitreal structures varied from fine strands randomly spaced throughout the vitreous to thick, intertwining, fibrous networks with some clumping of the collagenous condensate at the fiber junctions. Qualitatively, the degree of syneresis was slightly more extensive in the eight older mature males than in the seven younger animals. In all animals a clear view of the fundus could be obtained with the ophthalmoscope. The vitreous structures may be one cause of variability in ocular dose-response relationships for exposure to laser radiation. The effect on retinal exposure experiments of the finer vitreal structure is considered minimal.

  13. 3 Zika Vaccines Effective in Monkeys

    Science.gov (United States)

    ... https://medlineplus.gov/news/fullstory_160252.html 3 Zika Vaccines Effective in Monkeys Human trial set to ... In another key step toward a vaccine against Zika virus, scientists have found that three different experimental ...

  14. Can Monkeys (Macaca mulatta) Represent Invisible Displacement?

    Science.gov (United States)

    Filion, Christine M.; Washburn, David A.; Gulledge, Jonathan P.

    1996-01-01

    Four experiments were conducted to assess whether or not rhesus macaques (Macaca mulatta) could represent the unperceived movements of a stimulus. Subjects were tested on 2 computerized tasks, HOLE (monkeys) and LASER (humans and monkeys), in which subjects needed to chase or shoot at, respectively, a moving target that either remained visible or became invisible for a portion of its path of movement. Response patterns were analyzed and compared between target-visible and target-invisible conditions. Results of Experiments 1, 2, and 3 demonstrated that the monkeys are capable of extrapolating movement. That this extrapolation involved internal representation of the target's invisible movement was suggested but not confirmed. Experiment 4, however, demonstrated that the monkeys are capable of representing the invisible displacements of a stimulus.

  15. [Raman spectra of monkey cerebral cortex tissue].

    Science.gov (United States)

    Zhu, Ji-chun; Guo, Jian-yu; Cai, Wei-ying; Wang, Zu-geng; Sun, Zhen-rong

    2010-01-01

    Monkey cerebral cortex, an important part in the brain to control action and thought activities, is mainly composed of grey matter and nerve cell. In the present paper, the in situ Raman spectra of the cerebral cortex of the birth, teenage and aged monkeys were achieved for the first time. The results show that the Raman spectra for the different age monkey cerebral cortex exhibit most obvious changes in the regions of 1000-1400 and 2800-3000 cm(-1). With monkey growing up, the relative intensities of the Raman bands at 1313 and 2885 cm(-1) mainly assigned to CH2 chain vibrational mode of lipid become stronger and stronger whereas the relative intensities of the Raman bands at 1338 and 2932 cm(-1) mainly assigned to CH3 chain vibrational mode of protein become weaker and weaker. In addition, the two new Raman bands at 1296 and 2850 cm(-1) are only observed in the aged monkey cerebral cortex, therefore, the two bands can be considered as a character or "marker" to differentiate the caducity degree with monkey growth In order to further explore the changes, the relative intensity ratios of the Raman band at 1313 cm(-1) to that at 1338 cm(-1) and the Raman band at 2885 cm(-1) to that at 2 932 cm(-1), I1313/I1338 and I2885/I2932, which are the lipid-to-protein ratios, are introduced to denote the degree of the lipid content. The results show that the relative intensity ratios increase significantly with monkey growth, namely, the lipid content in the cerebral cortex increases greatly with monkey growth. So, the authors can deduce that the overmuch lipid is an important cause to induce the caducity. Therefore, the results will be a powerful assistance and valuable parameter to study the order of life growth and diagnose diseases.

  16. Monkey brain cortex imaging by photoacoustic tomography

    OpenAIRE

    Yang, Xinmai; Wang, Lihong V.

    2008-01-01

    Photoacoustic tomography (PAT) is applied to image the brain cortex of a monkey through the intact scalp and skull ex vivo. The reconstructed PAT image shows the major blood vessels on the monkey brain cortex. For comparison, the brain cortex is imaged without the scalp, and then imaged again without the scalp and skull. Ultrasound attenuation through the skull is also measured at various incidence angles. This study demonstrates that PAT of the brain cortex is capable of surviving the ultras...

  17. Physiology responses of Rhesus monkeys to vibration

    Science.gov (United States)

    Hajebrahimi, Zahra; Ebrahimi, Mohammad; Alidoust, Leila; Arabian Hosseinabadi, Maedeh

    Vibration is one of the important environmental factors in space vehicles that it can induce severe physiological responses in most of the body systems such as cardiovascular, respiratory, skeletal, endocrine, and etc. This investigation was to assess the effect of different vibration frequencies on heart rate variability (HRV), electrocardiograms (ECG) and respiratory rate in Rhesus monkeys. Methods: two groups of rhesus monkey (n=16 in each group) was selected as control and intervention groups. Monkeys were held in a sitting position within a specific fixture. The animals of this experiment were vibrated on a table which oscillated right and left with sinusoidal motion. Frequency and acceleration for intervention group were between the range of 1 to 2000 Hz and +0.5 to +3 G during 36 weeks (one per week for 15 min), respectively. All of the animals passed the clinical evaluation (echocardiography, sonography, radiography and blood analysis test) before vibration test and were considered healthy and these tests repeated during and at the end of experiments. Results and discussions: Our results showed that heart and respiratory rates increased significantly in response to increased frequency from 1 to 60 Hz (p monkeys passed vibration experiment successfully without any arrhythmic symptoms due to electrocardiography analysis. Conclusion: Our results indicate that vibration in low frequency can effect respiratory and cardiovascular function in rhesus monkey. Keywords: Vibration, rhesus monkey, heart rate, respiratory rate

  18. Squirrel monkey cytomegalovirus antibodies in free-ranging black howler monkeys (Alouatta caraya), Misiones, Argentina.

    Science.gov (United States)

    Ferreyra, Hebe; Argibay, Hernan; Rinas, Miguel A; Uhart, Marcela

    2012-04-01

    Serum from four black howler monkeys (Alouatta caraya) was screened for antibodies to seven viruses by dot immunoassay. Cytomegalovirus antibodies were detected in three of four individuals and provide the first evidence of exposure by black howler monkeys to this virus.

  19. DNA-Based Vaccine Guards Against Zika in Monkey Study

    Science.gov (United States)

    ... page: https://medlineplus.gov/news/fullstory_161106.html DNA-Based Vaccine Guards Against Zika in Monkey Study ... THURSDAY, Sept. 22, 2016 (HealthDay News) -- An experimental DNA-based vaccine protected monkeys from infection with the ...

  20. Atlas-Guided Segmentation of Vervet Monkey Brain MRI

    OpenAIRE

    Li, Xiaoxing; Pohl, Kilian M.; Styner, Martin; Addicott, Merideth; Wyatt, Chris; Daunais, James B.; Fedorov, Andriy; Bouix, Sylvain; Wells, William Mercer; Kikinis, Ron

    2011-01-01

    The vervet monkey is an important nonhuman primate model that allows the study of isolated environmental factors in a controlled environment. Analysis of monkey MRI often suffers from lower quality images compared with human MRI because clinical equipment is typically used to image the smaller monkey brain and higher spatial resolution is required. This, together with the anatomical differences of the monkey brains, complicates the use of neuroimage analysis pipelines tuned for human MRI anal...

  1. A Paradoxical Property of the Monkey Book

    CERN Document Server

    Bernhardsson, Sebastian; Minnhagen, Petter

    2011-01-01

    A "monkey book" is a book consisting of a random distribution of letters and blanks, where a group of letters surrounded by two blanks is defined as a word. We compare the statistics of the word distribution for a monkey book with the corresponding distribution for the general class of random books, where the latter are books for which the words are randomly distributed. It is shown that the word distribution statistics for the monkey book is different and quite distinct from a typical sampled book or real book. In particular the monkey book obeys Heaps' power law to an extraordinary good approximation, in contrast to the word distributions for sampled and real books, which deviate from Heaps' law in a characteristics way. The somewhat counter-intuitive conclusion is that a "monkey book" obeys Heaps' power law precisely because its word-frequency distribution is not a smooth power law, contrary to the expectation based on simple mathematical arguments that if one is a power law, so is the other.

  2. Somatosensory thresholds in monkeys exposed to acrylamide

    Energy Technology Data Exchange (ETDEWEB)

    Maurissen, J.P.J.; Weiss, B.; Davis, H.T.

    1983-01-01

    Six monkeys were trained to report detection of a vibratory or electrical stimulus applied to the fingertip. The vibratory stimuli were presented at two frequencies (40 and 150 Hz). Thresholds were determined with a tracking procedure before, during, and after dosing. Each monkey served as its own control. Four monkeys were dosed orally with 10 mg/kg of acrylamide 5 days a week until the appearance of toxic signs. The total administered dose varied between 320 and 450 mg/kg. The other two monkeys served as time-matched controls. All the monkeys were observed 5 days a week. They were also weighed and presented with a visuomotor task twice a week. Weight loss usually preceded the onset of gross behavioral disturbances, such as loss of balance, tremor, or decreased activity. Impaired coordination, as revealed with the pickup test, paralleled weight loss. Electrical sensitivity was not affected. Vibration sensitivity, however, fell during dosing and remained impaired for several months after dosing ended. These data indicate that vibration sensitivity testing can trace the time course of intoxication and recovery in toxic peripheral neuropathies. Furthermore, the differential results obtained with vibratory and electrical stimulation are consonant with a primary effect on end-organ receptors.

  3. Monkey cortex through fMRI glasses.

    Science.gov (United States)

    Vanduffel, Wim; Zhu, Qi; Orban, Guy A

    2014-08-06

    In 1998 several groups reported the feasibility of fMRI experiments in monkeys, with the goal to bridge the gap between invasive nonhuman primate studies and human functional imaging. These studies yielded critical insights in the neuronal underpinnings of the BOLD signal. Furthermore, the technology has been successful in guiding electrophysiological recordings and identifying focal perturbation targets. Finally, invaluable information was obtained concerning human brain evolution. We here provide a comprehensive overview of awake monkey fMRI studies mainly confined to the visual system. We review the latest insights about the topographic organization of monkey visual cortex and discuss the spatial relationships between retinotopy and category- and feature-selective clusters. We briefly discuss the functional layout of parietal and frontal cortex and continue with a summary of some fascinating functional and effective connectivity studies. Finally, we review recent comparative fMRI experiments and speculate about the future of nonhuman primate imaging.

  4. Evaluation of arboviruses of public health interest in free-living non-human primates (Alouatta spp., Callithrix spp., Sapajus spp.) in Brazil

    OpenAIRE

    2015-01-01

    INTRODUCTION: The aim of the present study was to evaluate the presence of arboviruses from the Flavivirus genus in asymptomatic free-living non-human primates (NHPs) living in close contact with humans and vectors in the States of Paraná and Mato Grosso do Sul, Brazil. METHODS: NHP sera samples (total n = 80, Alouatta spp. n = 07, Callithrix spp. n = 29 and Sapajus spp. n = 44) were screened for the presence of viral genomes using reverse transcription polymerase chain reaction and 10% ...

  5. Default mode of brain function in monkeys.

    Science.gov (United States)

    Mantini, Dante; Gerits, Annelis; Nelissen, Koen; Durand, Jean-Baptiste; Joly, Olivier; Simone, Luciano; Sawamura, Hiromasa; Wardak, Claire; Orban, Guy A; Buckner, Randy L; Vanduffel, Wim

    2011-09-07

    Human neuroimaging has revealed a specific network of brain regions-the default-mode network (DMN)-that reduces its activity during goal-directed behavior. So far, evidence for a similar network in monkeys is mainly indirect, since, except for one positron emission tomography study, it is all based on functional connectivity analysis rather than activity increases during passive task states. Here, we tested whether a consistent DMN exists in monkeys using its defining property. We performed a meta-analysis of functional magnetic resonance imaging data collected in 10 awake monkeys to reveal areas in which activity consistently decreases when task demands shift from passive tasks to externally oriented processing. We observed task-related spatially specific deactivations across 15 experiments, implying in the monkey a functional equivalent of the human DMN. We revealed by resting-state connectivity that prefrontal and medial parietal regions, including areas 9/46d and 31, respectively, constitute the DMN core, being functionally connected to all other DMN areas. We also detected two distinct subsystems composed of DMN areas with stronger functional connections between each other. These clusters included areas 24/32, 8b, and TPOC and areas 23, v23, and PGm, respectively. Such a pattern of functional connectivity largely fits, but is not completely consistent with anatomical tract tracing data in monkeys. Also, analysis of afferent and efferent connections between DMN areas suggests a multisynaptic network structure. Like humans, monkeys increase activity during passive epochs in heteromodal and limbic association regions, suggesting that they also default to internal modes of processing when not actively interacting with the environment.

  6. Monkey brain cortex imaging by photoacoustic tomography.

    Science.gov (United States)

    Yang, Xinmai; Wang, Lihong V

    2008-01-01

    Photoacoustic tomography (PAT) is applied to image the brain cortex of a monkey through the intact scalp and skull ex vivo. The reconstructed PAT image shows the major blood vessels on the monkey brain cortex. For comparison, the brain cortex is imaged without the scalp, and then imaged again without the scalp and skull. Ultrasound attenuation through the skull is also measured at various incidence angles. This study demonstrates that PAT of the brain cortex is capable of surviving the ultrasound signal attenuation and distortion caused by a relatively thick skull.

  7. [Cycloferon therapy of cytomegalovirus infection in monkeys].

    Science.gov (United States)

    Mezentseva, M V; Agrba, V Z; Karal-ogly, D D; Agumava, A A

    2012-01-01

    Cytomegalovirus (CMV) infection is a wide-spread disease throw humans and monkeys, which and associated with various diseases. The development of this infection in human organism is much like that in rhesus macaque, which makes CMV-infected monkeys adequate model for studying and elaborating prophylactic and therapeutic measures against this disease in humans. This article presents data on the efficiency of cycloferon action on animals with the M. mulatta CMV infection. Cycloferon stimulated an increase in the IFN-alpha production and promoted the period of remission in CMV-infected animals.

  8. Measurement of fetal biparietal diameter in owl monkeys (Aotus nancymaae).

    Science.gov (United States)

    Schuler, A Michele; Brady, Alan G; Tustin, George W; Parks, Virginia L; Morris, Chris G; Abee, Christian R

    2010-09-01

    Owl monkeys are New World primates frequently used in biomedical research. Despite the historical difficulty of breeding owl monkeys in captivity, several productive owl monkey breeding colonies exist currently. The animals in the colony we describe here are not timed-pregnant, and determination of gestational age is an important factor in prenatal care. Gestational age of human fetuses is often determined by using transabdominal measurements of fetal biparietal diameter. The purpose of this study was to correlate biparietal diameter measurements with gestational age in owl monkeys. We found that biparietal diameter can be used to accurately predict gestational age in owl monkeys.

  9. Molecular detection of Yaba monkey tumour virus from a vervet monkey

    Directory of Open Access Journals (Sweden)

    Helene Brettschneider

    2013-02-01

    Full Text Available Yaba monkey tumour virus (YMTV was first diagnosed in a colony of captive rhesus monkeys (Macaca mulatta in Yaba, Nigeria. It has been implicated as the cause of cutaneous nodules in wild baboons (Papio species, rhesus monkeys (Macaca mulatta and cynomolgus monkeys (Macaca fascicularis. This article reports a case of cutaneous pox lesions caused by YMTV in a  free-ranging  adult  female  vervet  monkey  (Chlorocebus  pygerythrus  from  the  Umkomaas coastal area in South Africa. The virus was identified by molecular sequencing from fragments of the insulin metalloprotease-like protein and intracellular mature virion membrane protein as well as the DNA polymerase genes. Phylogenetic analyses of these gene regions revealed a 99% similarity of the sample to YMTV. Although human disease caused by YMTV is normally mild,  it  is  recommended  that  persons  in  contact  with  non-human  primates  in  the  area  of Umkomaas who develop cutaneous lesions should inform their doctors of the possibility of this infection. The extent and significance of the virus to human and non-human primates in South Africa are not known. To the authors’ knowledge, this is the first diagnosis of YMTV in South Africa and in vervet monkeys.

  10. Computing Arm Movements with a Monkey Brainet.

    Science.gov (United States)

    Ramakrishnan, Arjun; Ifft, Peter J; Pais-Vieira, Miguel; Byun, Yoon Woo; Zhuang, Katie Z; Lebedev, Mikhail A; Nicolelis, Miguel A L

    2015-07-09

    Traditionally, brain-machine interfaces (BMIs) extract motor commands from a single brain to control the movements of artificial devices. Here, we introduce a Brainet that utilizes very-large-scale brain activity (VLSBA) from two (B2) or three (B3) nonhuman primates to engage in a common motor behaviour. A B2 generated 2D movements of an avatar arm where each monkey contributed equally to X and Y coordinates; or one monkey fully controlled the X-coordinate and the other controlled the Y-coordinate. A B3 produced arm movements in 3D space, while each monkey generated movements in 2D subspaces (X-Y, Y-Z, or X-Z). With long-term training we observed increased coordination of behavior, increased correlations in neuronal activity between different brains, and modifications to neuronal representation of the motor plan. Overall, performance of the Brainet improved owing to collective monkey behaviour. These results suggest that primate brains can be integrated into a Brainet, which self-adapts to achieve a common motor goal.

  11. Canine distemper outbreak in rhesus monkeys, China.

    Science.gov (United States)

    Qiu, Wei; Zheng, Ying; Zhang, Shoufeng; Fan, Quanshui; Liu, Hua; Zhang, Fuqiang; Wang, Wei; Liao, Guoyang; Hu, Rongliang

    2011-08-01

    Since 2006, canine distemper outbreaks have occurred in rhesus monkeys at a breeding farm in Guangxi, People's Republic of China. Approximately 10,000 animals were infected (25%-60% disease incidence); 5%-30% of infected animals died. The epidemic was controlled by vaccination. Amino acid sequence analysis of the virus indicated a unique strain.

  12. OBSERVATIONS ON THE BEHAVIOUR OF VERVET MONKEYS ...

    African Journals Online (AJOL)

    an order is admittedly more difficult to evaluate in the Cercopithecus monkeys ... being offered; if, on the other hand, the relationship is in doubt, competition will result ... The fact that size alone is not a significant factor in dominance was well ...

  13. Japanese monkeys perceive sensory consonance of chords.

    Science.gov (United States)

    Izumi, A

    2000-12-01

    Consonance/dissonance affects human perception of chords from early stages of development [e.g., Schellenberg and Trainor, J. Acoust. Soc. Am. 100, 3321-3328 (1996)]. To examine whether consonance has some role in audition of nonhumans, three Japanese monkeys (Macaca fuscata) were trained to discriminate simultaneous two-tone complexes (chords). The task was serial discrimination (AX procedure) with repetitive presentation of background stimuli. Each tone in a chord was comprised of six harmonics, and chords with complex ratios of fundamental frequency (e.g., frequency ratio of 8:15 in major seventh) resulted in dissonance. The chords were transposed for each presentation to make monkeys attend to cues other than the absolute frequency of a component tone. Monkeys were initially trained to detect changes from consonant (octave) to dissonant (major seventh). Following the successful acquisition of the task, transfer tests with novel chords were conducted. In these transfer tests, the performances with detecting changes from consonant to dissonant chords (perfect fifth to major seventh; perfect fourth to major seventh) were better than those with detecting reverse changes. These results suggested that the consonance of chords affected the performances of monkeys.

  14. Cell-Type-Specific Optogenetics in Monkeys.

    Science.gov (United States)

    Namboodiri, Vijay Mohan K; Stuber, Garret D

    2016-09-08

    The recent advent of technologies enabling cell-type-specific recording and manipulation of neuronal activity spurred tremendous progress in neuroscience. However, they have been largely limited to mice, which lack the richness in behavior of primates. Stauffer et al. now present a generalizable method for achieving cell-type specificity in monkeys.

  15. Transcranial photoacoustic tomography of the monkey brain

    Science.gov (United States)

    Nie, Liming; Huang, Chao; Guo, Zijian; Anastasio, Mark; Wang, Lihong V.

    2012-02-01

    A photoacoustic tomography (PAT) system using a virtual point ultrasonic transducer was developed for transcranial imaging of monkey brains. The virtual point transducer provided a 10 times greater field-of-view (FOV) than finiteaperture unfocused transducers, which enables large primate imaging. The cerebral cortex of a monkey brain was accurately mapped transcranially, through up to two skulls ranging from 4 to 8 mm in thickness. The mass density and speed of sound distributions of the skull were estimated from adjunct X-ray CT image data and utilized with a timereversal algorithm to mitigate artifacts in the reconstructed image due to acoustic aberration. The oxygenation saturation (sO2) in blood phantoms through a monkey skull was also imaged and quantified, with results consistent with measurements by a gas analyzer. The oxygenation saturation (sO2) in blood phantoms through a monkey skull was also imaged and quantified, with results consistent with measurements by a gas analyzer. Our experimental results demonstrate that PAT can overcome the optical and ultrasound attenuation of a relatively thick skull, and the imaging aberration caused by skull can be corrected to a great extent.

  16. Mycobacterium marinum Infection from Sea Monkeys

    Directory of Open Access Journals (Sweden)

    Jaclyn LeBlanc

    2012-01-01

    Full Text Available A case of cutaneous Mycobacterium marinum infection acquired from Artemia nyos (sea monkeys is presented. The infection was unresponsive to initial antimicrobial therapies. A biopsy of a lesion revealed granulomatous inflammation with cultures that subsequently grew M marinum. A three-month course of clarithromycin provided complete resolution.

  17. The pattern of the arterial supply of the pancreas in anthropoid apes, catarrhine monkeys and platyrrhine monkeys.

    Science.gov (United States)

    Shawuti, Alimujiang; Miyaki, Takayoshi; Saito, Toshiyuki; Itoh, Masahiro

    2009-11-01

    To get the full understanding of the arterial distribution to the pancreas, the analysis of the distribution of the variety of monkey species would be helpful. In this study, we studied the layout of the pancreatic artery in anthropoids (1 gorilla, 3 chimpanzees and 2 white-handed gibbons), in catarrhine monkeys (1 hamadryas baboon, 2 anubid baboons, 10 savannah monkeys) and in platyrrhine monkeys (6 squirrel monkeys). The pancreas of the monkeys was supplied by the arteries originating from the celiac trunk and/or superior mesenteric artery. There were three patterns in the arterial distribution; (1) the celiac artery supplied the major area of the pancreas. (2) the superior mesenteric artery supplied the major area of the pancreas. (3) the celiac artery supplied the whole pancreas. The pattern of the arterial distribution to the monkey pancreas had a wide variety. The result would be helpful for the elucidation of the development of the vascular distribution in the pancreas.

  18. Development of a modified artificial insemination technique combining penile vibration stimulation and the swim-up method in the common marmoset.

    Science.gov (United States)

    Takabayashi, Shuji; Suzuki, Yuiko; Katoh, Hideki

    2015-05-01

    The common marmoset, Callithrix jacchus, is used as a New World monkey species in biomedical studies because of its small body size and good reproduction in captivity. A modified artificial insemination technique was developed in this species to encourage breeding of lines carrying interesting genes and traits. Fresh semen was collected by penile vibratory stimulation. Medium containing highly motile sperm was inseminated into the uterus using a catheter. Seven females were inseminated using freshly prepared sperm from different males every day for 3 days including the expected ovulation day. As a result, four females conceived, and three females delivered six offspring in total (two singletons and one quadruplet). The paternity of the newborns was determined using microsatellite markers to accurately pinpoint the timing of insemination and ovulation. It is expected that our artificial insemination protocol can be effectively used to establish marmoset lines and genetically manage marmoset colonies.

  19. Marmoset cytochrome P450 2J2 mainly expressed in small intestines and livers effectively metabolizes human P450 2J2 probe substrates, astemizole and terfenadine.

    Science.gov (United States)

    Uehara, Shotaro; Uno, Yasuhiro; Inoue, Takashi; Okamoto, Eriko; Sasaki, Erika; Yamazaki, Hiroshi

    2016-11-01

    1. Common marmoset (Callithrix jacchus), a New World Monkey, has potential to be a useful animal model in preclinical studies. However, drug metabolizing properties have not been fully understood due to insufficient information on cytochrome P450 (P450), major drug metabolizing enzymes. 2. Marmoset P450 2J2 cDNA was isolated from marmoset livers. The deduced amino acid sequence showed a high-sequence identity (91%) with cynomolgus monkey and human P450 2J2 enzymes. A phylogenetic tree revealed that marmoset P450 2J2 was evolutionarily closer to cynomolgus monkey and human P450 2J2 enzymes, than P450 2J forms in pigs, rabbits, rats or mice. 3. Marmoset P450 2J2 mRNA was abundantly expressed in the small intestine and liver, and to a lesser extent in the brain, lung and kidney. Immunoblot analysis also showed expression of marmoset P450 2J2 protein in the small intestine and liver. 4. Enzyme assays using marmoset P450 2J2 protein heterologously expressed in Escherichia coli indicated that marmoset P450 2J2 effectively catalyzed astemizole O-demethylation and terfenadine t-butyl hydroxylation, similar to human and cynomolgus monkey P450 2J2 enzymes. 5. These results suggest the functional characteristics of P450 2J2 enzymes are similar among marmosets, cynomolgus monkeys and humans.

  20. Head Rotation Detection in Marmoset Monkeys

    Science.gov (United States)

    Simhadri, Sravanthi

    Head movement is known to have the benefit of improving the accuracy of sound localization for humans and animals. Marmoset is a small bodied New World monkey species and it has become an emerging model for studying the auditory functions. This thesis aims to detect the horizontal and vertical rotation of head movement in marmoset monkeys. Experiments were conducted in a sound-attenuated acoustic chamber. Head movement of marmoset monkey was studied under various auditory and visual stimulation conditions. With increasing complexity, these conditions are (1) idle, (2) sound-alone, (3) sound and visual signals, and (4) alert signal by opening and closing of the chamber door. All of these conditions were tested with either house light on or off. Infra-red camera with a frame rate of 90 Hz was used to capture of the head movement of monkeys. To assist the signal detection, two circular markers were attached to the top of monkey head. The data analysis used an image-based marker detection scheme. Images were processed using the Computation Vision Toolbox in Matlab. The markers and their positions were detected using blob detection techniques. Based on the frame-by-frame information of marker positions, the angular position, velocity and acceleration were extracted in horizontal and vertical planes. Adaptive Otsu Thresholding, Kalman filtering and bound setting for marker properties were used to overcome a number of challenges encountered during this analysis, such as finding image segmentation threshold, continuously tracking markers during large head movement, and false alarm detection. The results show that the blob detection method together with Kalman filtering yielded better performances than other image based techniques like optical flow and SURF features .The median of the maximal head turn in the horizontal plane was in the range of 20 to 70 degrees and the median of the maximal velocity in horizontal plane was in the range of a few hundreds of degrees per

  1. Uniformity of colour vision in Old World monkeys.

    OpenAIRE

    Jacobs, G.H.; Deegan, J F

    1999-01-01

    It is often assumed that all Old World monkeys share the same trichromatic colour vision, but the evidence in support of this conclusion is sparse as only a small fraction of all Old World monkey species have been tested. To address this issue, spectral sensitivity functions were measured in animals from eight species of Old World monkey (five cercopithecine species and three colobine species) using a non-invasive electrophysiological technique. Each of the 25 animals examined had spectrally ...

  2. Color-detection thresholds in rhesus macaque monkeys and humans

    OpenAIRE

    Gagin, Galina; Bohon, Kaitlin S.; Butensky, Adam; Gates, Monica A.; Hu, Jiun-Yiing; Lafer-Sousa, Rosa; Pulumo, Reitumetse L.; Qu, Jane; Stoughton, Cleo M.; Swanbeck, Sonja N.; Conway, Bevil R.

    2014-01-01

    Macaque monkeys are a model of human color vision. To facilitate linking physiology in monkeys with psychophysics in humans, we directly compared color-detection thresholds in humans and rhesus monkeys. Colors were defined by an equiluminant plane of cone-opponent color space. All subjects were tested on an identical apparatus with a four-alternative forced-choice task. Targets were 2° square, centered 2° from fixation, embedded in luminance noise. Across all subjects, the change in detection...

  3. Simpatria e dieta de Callithrix penicillata (Hershkovitz (Callitrichidae e Cebus libidinosus (Spix (Cebidae em matas de galeria do Distrito Federal, Brasil Sympatry and diet of Callithrix penicillata (Hershkovitz (Callitrichidae and Cebus libidinosus (Spix (Cebidae in gellery forests from Distrito Federal, Brasil

    Directory of Open Access Journals (Sweden)

    Sinara L. Vilela

    2007-01-01

    Full Text Available Primatas conseguem viver em simpatria diferenciando o uso do habitat, recursos alimentares, estrato vertical e técnicas de forrageamento. Um grupo de Callithrix penicillata (Hershkovitz, 1977 e um grupo de Cebus libidinosus (Spix, 1823 foram observados em matas de galeria do Distrito Federal (DF com o objetivo de detectar a influência da dieta na simpatria destas duas espécies. O clima no DF é bem definido, com uma estação seca de maio a setembro e outra chuvosa de outubro a abril. As observações feitas sobre as espécies vegetais utilizadas como alimento por cada gênero de primata forneceram dados sobre a porcentagem de utilização dos alimentos, elucidando as diferenças no consumo dos itens nas duas estações do ano. Apenas duas espécies vegetais tiveram seus frutos consumidos pelos dois grupos de primatas, Sacoglottis guianensis Benth. (Humiriaceae e Cheiloclinium cognatum (Miers A.C.Sm. (Hippocrateaceae. As diferenças no consumo dos alimentos ingeridos por Callithrix e Cebus nas duas estações climáticas elucidam que algumas espécies vegetais e alguns invertebrados são preferenciais, enriquecendo a dieta nos períodos de menor disponibilidade de recursos.Primates are able to live in simpatry distinguishing the use of habitat, food resources, vertical stratum and foraging techniques. A group of Callithrix penicillata (Hershkovitz, 1977 and a group of Cebus libidinosus (Spix, 1823 were observed in the gallery forests of the Distrito Federal (DF with the objective of detecting diet influence on the simpatry of these two species. The climate in the DF is well defined, with one dry season from May to September and another rainy season from October to April. The observations made over the plant species used as food for each primate genus provided data on the percentage of food utilization, elucidating the differences on the consumption of the items in both seasons of the studied year. Only two vegetal species had their fruits

  4. Anatomic brain asymmetry in vervet monkeys.

    Science.gov (United States)

    Fears, Scott C; Scheibel, Kevin; Abaryan, Zvart; Lee, Chris; Service, Susan K; Jorgensen, Matthew J; Fairbanks, Lynn A; Cantor, Rita M; Freimer, Nelson B; Woods, Roger P

    2011-01-01

    Asymmetry is a prominent feature of human brains with important functional consequences. Many asymmetric traits show population bias, but little is known about the genetic and environmental sources contributing to inter-individual variance. Anatomic asymmetry has been observed in Old World monkeys, but the evidence for the direction and extent of asymmetry is equivocal and only one study has estimated the genetic contributions to inter-individual variance. In this study we characterize a range of qualitative and quantitative asymmetry measures in structural brain MRIs acquired from an extended pedigree of Old World vervet monkeys (n = 357), and implement variance component methods to estimate the proportion of trait variance attributable to genetic and environmental sources. Four of six asymmetry measures show pedigree-level bias and one of the traits has a significant heritability estimate of about 30%. We also found that environmental variables more significantly influence the width of the right compared to the left prefrontal lobe.

  5. A freely-moving monkey treadmill model

    Science.gov (United States)

    Foster, Justin D.; Nuyujukian, Paul; Freifeld, Oren; Gao, Hua; Walker, Ross; Ryu, Stephen I.; Meng, Teresa H.; Murmann, Boris; Black, Michael J.; Shenoy, Krishna V.

    2014-08-01

    Objective. Motor neuroscience and brain-machine interface (BMI) design is based on examining how the brain controls voluntary movement, typically by recording neural activity and behavior from animal models. Recording technologies used with these animal models have traditionally limited the range of behaviors that can be studied, and thus the generality of science and engineering research. We aim to design a freely-moving animal model using neural and behavioral recording technologies that do not constrain movement. Approach. We have established a freely-moving rhesus monkey model employing technology that transmits neural activity from an intracortical array using a head-mounted device and records behavior through computer vision using markerless motion capture. We demonstrate the flexibility and utility of this new monkey model, including the first recordings from motor cortex while rhesus monkeys walk quadrupedally on a treadmill. Main results. Using this monkey model, we show that multi-unit threshold-crossing neural activity encodes the phase of walking and that the average firing rate of the threshold crossings covaries with the speed of individual steps. On a population level, we find that neural state-space trajectories of walking at different speeds have similar rotational dynamics in some dimensions that evolve at the step rate of walking, yet robustly separate by speed in other state-space dimensions. Significance. Freely-moving animal models may allow neuroscientists to examine a wider range of behaviors and can provide a flexible experimental paradigm for examining the neural mechanisms that underlie movement generation across behaviors and environments. For BMIs, freely-moving animal models have the potential to aid prosthetic design by examining how neural encoding changes with posture, environment and other real-world context changes. Understanding this new realm of behavior in more naturalistic settings is essential for overall progress of basic

  6. A freely-moving monkey treadmill model.

    Science.gov (United States)

    Foster, Justin D; Nuyujukian, Paul; Freifeld, Oren; Gao, Hua; Walker, Ross; I Ryu, Stephen; H Meng, Teresa; Murmann, Boris; J Black, Michael; Shenoy, Krishna V

    2014-08-01

    Motor neuroscience and brain-machine interface (BMI) design is based on examining how the brain controls voluntary movement, typically by recording neural activity and behavior from animal models. Recording technologies used with these animal models have traditionally limited the range of behaviors that can be studied, and thus the generality of science and engineering research. We aim to design a freely-moving animal model using neural and behavioral recording technologies that do not constrain movement. We have established a freely-moving rhesus monkey model employing technology that transmits neural activity from an intracortical array using a head-mounted device and records behavior through computer vision using markerless motion capture. We demonstrate the flexibility and utility of this new monkey model, including the first recordings from motor cortex while rhesus monkeys walk quadrupedally on a treadmill. Using this monkey model, we show that multi-unit threshold-crossing neural activity encodes the phase of walking and that the average firing rate of the threshold crossings covaries with the speed of individual steps. On a population level, we find that neural state-space trajectories of walking at different speeds have similar rotational dynamics in some dimensions that evolve at the step rate of walking, yet robustly separate by speed in other state-space dimensions. Freely-moving animal models may allow neuroscientists to examine a wider range of behaviors and can provide a flexible experimental paradigm for examining the neural mechanisms that underlie movement generation across behaviors and environments. For BMIs, freely-moving animal models have the potential to aid prosthetic design by examining how neural encoding changes with posture, environment and other real-world context changes. Understanding this new realm of behavior in more naturalistic settings is essential for overall progress of basic motor neuroscience and for the successful

  7. Monkey King —Prime Candidate for 2008 Olympics Mascot

    Institute of Scientific and Technical Information of China (English)

    LIDAOYING; YOUZHENGJUN; LIWUZHOU

    2003-01-01

    IS the monkey an appropriate 2008 Olympic mascot? No one will know for sure until next year. Now that the Chinese Seal has been officially des-ignated as the 2008 Olympics emblem,the games'' mascot has taken over as hot topic. Animal images like the panda, dragon, lion, tiger, Tibetan ante-lope, and rabbit are also under consid-eration, but monkeyking2008.com, a website promoting the Monkey King as 2008 Olympics mascot, reports that 89 percent of its visitors want the monkey. Results of a survey conducted by China''s largest portal site, Sina.com, also indicate the Monkey King as hot favorite for mascot.

  8. Malaria in cynomolgus monkeys used in toxicity studies in Japan.

    Science.gov (United States)

    Ohta, Etsuko; Nagayama, Yuko; Koyama, Naoki; Kakiuchi, Dai; Hosokawa, Satoru

    2016-01-01

    Plasmodium spp. protozoa cause malaria and are known to infect humans and a variety of animal species including macaque monkeys. Here we report both our experience with malaria recrudescence in cynomolgus monkeys (Macaca fascicularis) in a toxicity study and the results of a survey on Plasmodium infection in cynomolgus monkeys imported to Japan for laboratory use. A cynomolgus monkey from the toxicity study presented with severe anemia and Plasmodium protozoa in erythrocytes on a thin blood smear and was subsequently diagnosed with symptomatic malaria. In this animal, congestion and accumulation of hemozoin (malaria pigment) in macrophages were noted in the enlarged and darkly discolored spleen. As a follow-up for the experience, spleen sections from 800 cynomolgus monkeys in toxicity studies conducted between 2003 and 2013 were retrospectively examined for hemozoin deposition as a marker of Plasmodium infection. The origin of the animals included Cambodia, China, Indonesia, and Vietnam. Hemozoin deposition was confirmed in 44% of all examined monkeys. Monkeys from Indonesia showed the highest incidence of hemozoin deposition (approx. 80%). A high prevalence of Plasmodium infection in laboratory monkeys was also confirmed with polymerase chain reaction (PCR) by using Plasmodium genus-specific primers. Although Japan is not a country with endemic malaria, it is important to be aware of the prevalence and potential impact of background infection with Plasmodium spp. and recrudescence of symptomatic malaria in imported laboratory monkeys on pharmaceutical toxicity studies.

  9. Spaceflight and Immune Responses of Rhesus Monkeys

    Science.gov (United States)

    Sonnenfeld, Gerald

    1997-01-01

    In the grant period, we perfected techniques for determination of interleukin production and leukocyte subset analysis of rhesus monkeys. These results are outlined in detail in publication number 2, appended to this report. Additionally, we participated in the ARRT restraint test to determine if restraint conditions for flight in the Space Shuttle could contribute to any effects of space flight on immune responses. All immunological parameters listed in the methods section were tested. Evaluation of the data suggests that the restraint conditions had minimal effects on the results observed, but handling of the monkeys could have had some effect. These results are outlined in detail in manuscript number 3, appended to this report. Additionally, to help us develop our rhesus monkey immunology studies, we carried out preliminary studies in mice to determine the effects of stressors on immunological parameters. We were able to show that there were gender-based differences in the response of immunological parameters to a stressor. These results are outlined in detail in manuscript number 4, appended to this report.

  10. Translocation and radiotelemetry monitoring of black-tailed marmosets, Callithrix (Mico melanura(É. Geoffroy in Humboldt, in a wildlife rescue operation in Brazil

    Directory of Open Access Journals (Sweden)

    AAB. Marques

    Full Text Available Five black-tailed marmoset Callithrix (Mico melanura (Primates - Callitrichidae individuals were monitored by radiotelemetry as part of a project on translocated wildlife affected by flooding the Manso River reservoir in the state of Mato Grosso, western Brazil (14° 52' S and 55° 48' W. The animals were monitored for eight months from October 2000 through August 2001. Only one death was recorded among the translocated animals. Two pairs established their home ranges in the new area, after some exploratory behavior. The new home range sizes varied from 0.72 to 4.27 km². The home ranges of male and female overlapped in the case of both pairs by 0.59 to 2.30 km². Trips were always made in pairs and not individually. The results indicate the feasibility of a successful translocation program for this species, as long as the animals are translocated to a similar habitat nearby.

  11. Comportamento e desenvolvimento de Fasciola hepatica (linnaeus, 1758) de bovinos naturalmente infectados em sagüi (Callithrix penicillata) e gerbil (Meriones unguiculatus)

    OpenAIRE

    Eveline Albuquerque Mendes

    2006-01-01

    RESUMO Metacercárias de Fasciola hepatica foram utilizadas na infecção de Callithrix penicillata e Meriones unguiculatus. Os C. penicillata foram infectados via oral com dez metacercárias. Foi verificada uma media diária de 1.089 a 4.356 ovos, sugerindo que estes constituem modelos animais adequados à manutenção do ciclo biológico de F. hepatica em laboratório. Os M. unguiculatus foram infectados via oral com cinco metacercárias. O período pré-patente foi em média de 55,57 ± 2,34 dias. O b...

  12. Evaluation of arboviruses of public health interest in free-living non-human primates (Alouatta spp., Callithrix spp., Sapajus spp. in Brazil

    Directory of Open Access Journals (Sweden)

    Tatiana Carneiro da Rocha

    2015-04-01

    Full Text Available INTRODUCTION: The aim of the present study was to evaluate the presence of arboviruses from the Flavivirus genus in asymptomatic free-living non-human primates (NHPs living in close contact with humans and vectors in the States of Paraná and Mato Grosso do Sul, Brazil. METHODS: NHP sera samples (total n = 80, Alouatta spp. n = 07, Callithrix spp. n = 29 and Sapajus spp. n = 44 were screened for the presence of viral genomes using reverse transcription polymerase chain reaction and 10% polyacrylamide gel electrophoresis techniques. RESULTS: All of the samples were negative for the Flavivirus genome following the 10% polyacrylamide gel electrophoresis analysis. CONCLUSIONS: These negative results indicate that the analyzed animals were not infected with arboviruses from the Flavivirus genus and did not represent a risk for viral transmission through vectors during the period in which the samples were collected.

  13. Aged monkeys as a partial model for Parkinson's disease.

    Science.gov (United States)

    Hurley, P J; Elsworth, J D; Whittaker, M C; Roth, R H; Redmond, D E

    2011-09-01

    Parkinson's Disease (PD) and the natural aging process share a number of biochemical mechanisms, including reduced function of dopaminergic systems. The present study aims to determine the extent that motor and behavioral changes in aged monkeys resemble parkinsonism induced by the neurotoxin 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine. The behavioral and physiological changes in PD are believed to result largely from selective depletion of dopamine in the nigrostriatal system. In the present study, ten aged female monkeys were compared with three groups: 9 untreated young adult female monkeys, 10 young adult male monkeys and 13 older male monkeys that had been exposed to MPTP. Trained observers, blind as to age and drug condition and without knowledge of the hypotheses, scored the monkeys using the Parkinson's factor score (Parkscore), which has been validated by a high correlation with post mortem striatal dopamine (DA) concentrations. The aged animals had higher scores on the Parkscore compared with the young adults, with most of its component behavioral items showing significance (tremor, Eating Problems, Delayed initiation of movement, and Poverty of Movement). L-Dopa and DA-agonists did not clearly reverse the principal measure of parkinsonism. DA concentrations post mortem were 63% lower in 3 aged monkeys in the ventral putamen compared with 4 young adults, with greater reductions in putamen than in caudate (45%). We conclude that aged monkeys, unexposed to MPTP, show a similar profile of parkinsonism to that seen after the neurotoxin exposure to MPTP in young adult monkeys. The pattern of greater DA depletion in putamen than in caudate in aged monkeys is the same as in human Parkinson's disease and contrasts with the greater depletion in caudate seen after MPTP. Aged monkeys of this species reflect many facets of Parkinson's disease, but like older humans do not improve with standard dopamine replacement pharmacotherapies.

  14. Evaluation of diabetes determinants in woolly monkeys (Lagothrix lagotricha)

    NARCIS (Netherlands)

    Ange-van Heugten, K.D.; Burns, R.; Verstegen, M.W.A.; Jansen, W.L.; Ferket, P.R.; Heugten, E.

    2007-01-01

    Woolly monkeys (Lagothrix lagotricha) are a threatened specie in the wild with limited successful management in captivity due to diagnosed hypertension and suspected diabetic conditions. Six woolly monkeys with known hypertension problems were tested to determine if diabetes mellitus and current dai

  15. Evaluation of diabetes determinants in woolly monkeys (Lagothrix lagotricha)

    NARCIS (Netherlands)

    Ange-van Heugten, K.D.; Burns, R.; Verstegen, M.W.A.; Jansen, W.L.; Ferket, P.R.; Heugten, E.

    2007-01-01

    Woolly monkeys (Lagothrix lagotricha) are a threatened specie in the wild with limited successful management in captivity due to diagnosed hypertension and suspected diabetic conditions. Six woolly monkeys with known hypertension problems were tested to determine if diabetes mellitus and current dai

  16. Monkeys, Apes and Other Primates. Young Discovery Library Series.

    Science.gov (United States)

    Lucas, Andre

    This book is written for children 5 through 10. Part of a series designed to develop their curiosity, fascinate them and educate them, this volume introduces the primate family, their physiology, and habits. Topics described include: (1) kinds of monkeys, including lemur, chimpanzee, gorilla, squirrel monkey, and marmoset; (2) behaviors when…

  17. Spatial Relational Memory in 9-Month-Old Macaque Monkeys

    Science.gov (United States)

    Lavenex, Pierre; Lavenex, Pamela Banta

    2006-01-01

    This experiment assesses spatial and nonspatial relational memory in freely moving 9-mo-old and adult (11-13-yr-old) macaque monkeys ("Macaca mulatta"). We tested the use of proximal landmarks, two different objects placed at the center of an open-field arena, as conditional cues allowing monkeys to predict the location of food rewards hidden in…

  18. The Effect of Heterogeneity on Numerical Ordering in Rhesus Monkeys

    Science.gov (United States)

    Cantlon, Jessica F.; Brannon, Elizabeth M.

    2006-01-01

    We investigated how within-stimulus heterogeneity affects the ability of rhesus monkeys to order pairs of the numerosities 1 through 9. Two rhesus monkeys were tested in a touch screen task where the variability of elements within each visual array was systematically varied by allowing elements to vary in color, size, shape, or any combination of…

  19. "Mohandas Fire" Year of the Fire Monkey (Chinese Zodiac)

    OpenAIRE

    Mumberson, Stephen

    2016-01-01

    Exhibition of cartoons on the theme of the Fire Monkey - Chinese New Year at the Museo de Humor Grafico Diodenes Taborda, Buenos Aires, Argentina. Only British artist involved, with two works. 29 different nations entered and 51 artists involved. All works different approaches to the year of the Fire Monkey.

  20. Serum Chemistry concentrations of captive Woolly Monkeys (Lagothrix Lagotricha)

    NARCIS (Netherlands)

    Ange-van Heugten, K.D.; Verstegen, M.W.A.; Ferket, P.; Stoskopf, M.; Heugten, van E.

    2008-01-01

    Woolly monkeys (Lagothrix sp.) are threatened species and numerous zoos have failed to sustain successful populations. The most common causes of death in captive woolly monkeys are related to pregnancy and hypertension. The objective of this retrospective study was to evaluate serum concentrations o

  1. Perceptual Learning: 12-Month-Olds' Discrimination of Monkey Faces

    Science.gov (United States)

    Fair, Joseph; Flom, Ross; Jones, Jacob; Martin, Justin

    2012-01-01

    Six-month-olds reliably discriminate different monkey and human faces whereas 9-month-olds only discriminate different human faces. It is often falsely assumed that perceptual narrowing reflects a permanent change in perceptual abilities. In 3 experiments, ninety-six 12-month-olds' discrimination of unfamiliar monkey faces was examined. Following…

  2. Discrimination Reversal Learning in Capuchin Monkeys ("Cebus apella")

    Science.gov (United States)

    Beran, Michael J.; Klein, Emily D.; Evans, Theodore A.; Chan, Betty; Flemming, Timothy M.; Harris, Emily H.; Washburn, David A.; Rumbaugh, Duane M.

    2008-01-01

    Learning styles in capuchin monkeys were assessed with a computerized reversal-learning task called the mediational paradigm. First, monkeys were trained to respond with 90% accuracy on a two-choice discrimination (A+B-). Then the authors examined differences in performance on three different types of reversal trials (A-B+, A-C+, B+C-), each of…

  3. Locomotor Anatomy and Behavior of Patas Monkeys (Erythrocebus patas with Comparison to Vervet Monkeys (Cercopithecus aethiops

    Directory of Open Access Journals (Sweden)

    Adrienne L. Zihlman

    2013-01-01

    Full Text Available Patas monkeys (Erythrocebus patas living in African savanna woodlands and grassland habitats have a locomotor system that allows them to run fast, presumably to avoid predators. Long fore- and hindlimbs, long foot bones, short toes, and a digitigrade foot posture were proposed as anatomical correlates with speed. In addition to skeletal proportions, soft tissue and whole body proportions are important components of the locomotor system. To further distinguish patas anatomy from other Old World monkeys, a comparative study based on dissection of skin, muscle, and bone from complete individuals of patas and vervet monkeys (Cercopithecus aethiops was undertaken. Analysis reveals that small adjustments in patas skeletal proportions, relative mass of limbs and tail, and specific muscle groups promote efficient sagittal limb motion. The ability to run fast is based on a locomotor system adapted for long distance walking. The patas’ larger home range and longer daily range than those of vervets give them access to highly dispersed, nutritious foods, water, and sleeping trees. Furthermore, patas monkeys have physiological adaptations that enable them to tolerate and dissipate heat. These features all contribute to the distinct adaptation that is the patas monkeys’ basis for survival in grassland and savanna woodland areas.

  4. Monkeying around: Use of Survey Monkey as a Tool for School Social Work

    Science.gov (United States)

    Massat, Carol Rippey; McKay, Cassandra; Moses, Helene

    2009-01-01

    This article describes the use of an online survey tool called Survey Monkey, which can be used by school social workers and school social work educators for evaluation of practice, needs assessment, and program evaluation. Examples of questions are given. Principles of writing good survey questions are described. (Contains 2 tables and 1…

  5. Rhesus Monkeys (Macaca mulatta) and Capuchin Monkeys (Cebus apella) Remember Future Responses in a Computerized Task

    Science.gov (United States)

    Beran, Michael J.; Evans, Theodore A.; Klein, Emily D.; Einstein, Gilles O.

    2012-01-01

    Planning is an important aspect of many daily activities for humans. Planning involves forming a strategy in anticipation of a future need. However, evidence that nonhuman animals can plan for future situations is limited, particularly in relation to the many other kinds of cognitive capacities that they appear to share with humans. One critical aspect of planning is the ability to remember future responses, or what is called prospective coding. Two monkey species performed a series of computerized tasks that required encoding a future response at the outset of each trial. Monkeys of both species showed competence in all tests that were given, providing evidence that they anticipated future responses, and that they appropriately engaged in those responses when the time was right for such responses. In addition, some tests demonstrated that monkeys even remembered future responses that were not as presently motivating as were other aspects of the task environment. These results indicated that monkeys can anticipate future responses and retain and implement those responses when appropriate. PMID:22545901

  6. Outbreak of pasteurellosis in captive Bolivian squirrel monkeys (Saimiri boliviensis)

    Science.gov (United States)

    YOSHINO, Mizuki; SASAKI, Jun; KURAMOCHI, Konomi; IKEZAWA, Mitsutaka; MUKAIZAWA, Natsuko; GORYO, Masanobu

    2017-01-01

    In September 2012, five Bolivian squirrel monkeys housed in a zoological park died within sequential several days without obvious clinical signs. In a necrospy, one monkey presented swelling of the kidney with multifocal white nodules in the parenchyma, and other two had pulmonary congestion. Histopathologically, multifocal bacterial colonies of gram-negative coccobacillus were found in the sinusoid of the liver in all monkeys examined (Nos.1−4). Additionally, purulent pyelonephritis, pneumonia and disseminated small bacterial colonies in blood vessels were observed. Immunohistochemically, the bacterial colonies from two monkeys were positive for P. multocida capsular serotype D. Based on these findings, these monkeys were diagnosed as septicemia caused by acute P. multocida infection. PMID:28190821

  7. Vestibular adaptation to space in monkeys

    Science.gov (United States)

    Dai, M.; Raphan, T.; Kozlovskaya, I.; Cohen, B.

    1998-01-01

    Otolith-induced eye movements of rhesus monkeys were studied before and after the 1989 COSMOS 2044 and the 1992 to 1993 COSMOS 2229 flights. Two animals flew in each mission for approximately 2 weeks. After flight, spatial orientation of the angular vestibulo-ocular reflex was altered. In one animal the time constant of postrotatory nystagmus, which had been shortened by head tilts with regard to gravity before flight, was unaffected by the same head tilts after flight. In another animal, eye velocity, which tended to align with a gravitational axis before flight, moved toward a body axis after flight. This shift of orientation disappeared by 7 days after landing. After flight, the magnitude of compensatory ocular counter-rolling was reduced by about 70% in both dynamic and static tilts. Modulation in vergence in response to naso-occipital linear acceleration during off-vertical axis rotation was reduced by more than 50%. These changes persisted for 11 days after recovery. An up and down asymmetry of vertical nystagmus was diminished for 7 days. Gains of the semicircular canal-induced horizontal and vertical angular vestibulo-ocular reflexes were unaffected in both flights, but the gain of the roll angular vestibulo-ocular reflex was decreased. These data indicate that there are short- and long-term changes in otolith-induced eye movements after adaptation to microgravity. These experiments also demonstrate the unique value of the monkey as a model for studying effects of vestibular adaptation in space. Eye movements can be measured in three dimensions in response to controlled vestibular and visual stimulation, and the results are directly applicable to human beings. Studies in monkeys to determine how otolith afferent input and central processing is altered by adaptation to microgravity should be an essential component of future space-related research.

  8. Early life stress and novelty seeking behavior in adolescent monkeys.

    Science.gov (United States)

    Parker, Karen J; Rainwater, Kimberly L; Buckmaster, Christine L; Schatzberg, Alan F; Lindley, Steven E; Lyons, David M

    2007-08-01

    Recent evidence suggests that early exposure to mild stress promotes the development of novelty seeking behavior. Here we test this hypothesis in squirrel monkeys and investigate whether novelty seeking behavior is associated with differences in cerebrospinal fluid (CSF) levels of the serotonin metabolite 5-hydroxyindoleacetic acid (5HIAA), the dopamine metabolite homovanillic acid (HVA), the norepinephrine metabolite 3-methoxy-4-hydroxyphenylethylene glycol (MHPG), and the neuropeptide corticotrophin-releasing factor (CRF). Monkeys were randomized early in life to either mild intermittent stress (IS) or no stress (NS) conditions, and subsequently presented with opportunities to interact with a familiar or novel object in a test box that was connected to each monkey's home cage. To further minimize the potentially stressful nature of the test situation, monkeys were acclimated to the test procedures prior to study initiation. Post-test plasma levels of cortisol in IS and NS monkeys did not differ significantly from baseline levels measured in undisturbed conditions. During testing, more IS than NS monkeys voluntarily left the home cage, and IS monkeys spent more time in the test box compared to NS monkeys. More IS than NS monkeys engaged in object exploration in the test box, and IS monkeys preferred to interact with the novel vs. familiar object. Novelty seeking was not associated with differences in 5HIAA, HVA, MHPG, or CRF, but correlated with differences in object exploration observed in a different test situation at an earlier age. These trait-like differences in novelty seeking appear to reflect mild early stress-induced adaptations that enhance curiosity and resilience.

  9. ARCTIC MONKEYS:猴子凶猛!

    Institute of Scientific and Technical Information of China (English)

    青鸟

    2007-01-01

    @@ 我不是成长于星条旗下的美利坚自由人民,所以英国乐队Arctic Monkeys在我跟前很能吃得开,打从我听到他们的第一个音符起.这或许是我从小看多了充满暴力的电视剧《西游记》,并对猴子产生了偏爱的缘故,而对Arctic Monkeys,来自北极的猴子,更是充满了好奇.

  10. Do wild titi monkeys show empathy?

    OpenAIRE

    Clyvia, A; Kaizer, M. C.; Santos,R.V.; Young, R.J.; C. Cäsar

    2014-01-01

    We observed a putative case of empathy among wild black-fronted titi monkeys (Callicebus nigrifrons)\\ud from two different groups (D and R). In over 10 years of behavioural observations of five habituated\\ud groups of this species, only low levels of inter-group tolerance have been observed. However, on one day, we\\ud encountered the adult male from group D limping (poor hind limb motor coordination) as he travelled alone\\ud along the ground. Interestingly, we observed that members of group R...

  11. Spaceflight and immune responses of rhesus monkeys

    Science.gov (United States)

    Sonnenfeld, Gerald; Morton, Darla S.; Swiggett, Jeanene P.; Hakenewerth, Anne M.; Fowler, Nina A.

    1995-01-01

    The effects of restraint on immunological parameters was determined in an 18 day ARRT (adult rhesus restraint test). The monkeys were restrained for 18 days in the experimental station for the orbiting primate (ESOP), the chair of choice for Space Shuttle experiments. Several immunological parameters were determined using peripheral blood, bone marrow, and lymph node specimens from the monkeys. The parameters included: response of bone marrow cells to GM-CSF (granulocyte-macrophage colony stimulating factor), leukocyte subset distribution, and production of IFN-a (interferon-alpha) and IFN-gamma (interferon-gamma). The only parameter changed after 18 days of restraint was the percentage of CD8+ T cells. No other immunological parameters showed changes due to restraint. Handling and changes in housing prior to the restraint period did apparently result in some restraint-independent immunological changes. Handling must be kept to a minimum and the animals allowed time to recover prior to flight. All experiments must be carefully controlled. Restraint does not appear to be a major issue regarding the effects of space flight on immune responses.

  12. Explicit information reduces discounting behavior in monkeys

    Directory of Open Access Journals (Sweden)

    John ePearson

    2010-12-01

    Full Text Available Animals are notoriously impulsive in common laboratory experiments, preferring smaller, sooner rewards to larger, delayed rewards even when this reduces average reward rates. By contrast, the same animals often engage in natural behaviors that require extreme patience, such as food caching, stalking prey, and traveling long distances to high quality food sites. One possible explanation for this discrepancy is that standard laboratory delay discounting tasks artificially inflate impulsivity by subverting animals’ common learning strategies. To test this idea, we examined choices made by rhesus macaques in two variants of a standard delay discounting task. In the conventional variant, post-reward delays were uncued and adjusted to render total trial length constant; in the second, all delays were cued explicitly. We found that measured discounting was significantly reduced in the cued task, with discount rates well below those reported in studies using the standard uncued design. When monkeys had complete information, their decisions were more consistent with a strategy of reward rate maximization. These results indicate that monkeys, and perhaps other animals, are more patient than is normally assumed, and that laboratory measures of delay discounting may overstate impulsivity.

  13. Predicting rhesus monkey eye movements during natural-image search.

    Science.gov (United States)

    Segraves, Mark A; Kuo, Emory; Caddigan, Sara; Berthiaume, Emily A; Kording, Konrad P

    2017-03-01

    There are three prominent factors that can predict human visual-search behavior in natural scenes: the distinctiveness of a location (salience), similarity to the target (relevance), and features of the environment that predict where the object might be (context). We do not currently know how well these factors are able to predict macaque visual search, which matters because it is arguably the most popular model for asking how the brain controls eye movements. Here we trained monkeys to perform the pedestrian search task previously used for human subjects. Salience, relevance, and context models were all predictive of monkey eye fixations and jointly about as precise as for humans. We attempted to disrupt the influence of scene context on search by testing the monkeys with an inverted set of the same images. Surprisingly, the monkeys were able to locate the pedestrian at a rate similar to that for upright images. The best predictions of monkey fixations in searching inverted images were obtained by rotating the results of the model predictions for the original image. The fact that the same models can predict human and monkey search behavior suggests that the monkey can be used as a good model for understanding how the human brain enables natural-scene search.

  14. Perception of chasing in squirrel monkeys (Saimiri sciureus).

    Science.gov (United States)

    Atsumi, Takeshi; Nagasaka, Yasuo

    2015-11-01

    Understanding the intentions of others is crucial in developing positive social relationships. Comparative human and non-human animal studies have addressed the phylogenetic origin of this ability. However, few studies have explored the importance of motion information in distinguishing others' intentions and goals in non-human primates. This study addressed whether squirrel monkeys (Saimiri sciureus) are able to perceive a goal-directed motion pattern-specifically, chasing-represented by two geometric objects. In Experiment 1, we trained squirrel monkeys to discriminate a "Chasing" sequence from a "Random" sequence. We then confirmed that this discrimination transferred to new stimuli ("Chasing" and "Random") in a probe test. To determine whether the monkeys used similarities of trajectory to discriminate chasing from random motion, we also presented a non-chasing "Clone" sequence in which the trajectories of the two figures were identical. Three of six monkeys were able to discriminate "Chasing" from the other sequences. In Experiment 2, we confirmed humans' recognition of chasing with the stimuli from Experiment 1. In Experiment 3, the three monkeys for which discrimination did not transfer to the new stimuli in Experiment 1 were trained to discriminate between "Chasing" and "Clone" sequences. At testing, all three monkeys had learned to discriminate chasing, and two transferred their learning to new stimuli. Our results suggest that squirrel monkeys use goal-directed motion patterns, rather than simply similarity of trajectory, to discriminate chasing. Further investigation is necessary to identify the motion characteristics that contribute to this discrimination.

  15. Pulse register phonation in Diana monkey alarm calls

    Science.gov (United States)

    Riede, Tobias; Zuberbühler, Klaus

    2003-05-01

    The adult male Diana monkeys (Cercopithecus diana) produce predator-specific alarm calls in response to two of their predators, the crowned eagles and the leopards. The acoustic structure of these alarm calls is remarkable for a number of theoretical and empirical reasons. First, although pulsed phonation has been described in a variety of mammalian vocalizations, very little is known about the underlying production mechanism. Second, Diana monkey alarm calls are based almost exclusively on this vocal production mechanism to an extent that has never been documented in mammalian vocal behavior. Finally, the Diana monkeys' pulsed phonation strongly resembles the pulse register in human speech, where fundamental frequency is mainly controlled by subglottal pressure. Here, we report the results of a detailed acoustic analysis to investigate the production mechanism of Diana monkey alarm calls. Within calls, we found a positive correlation between the fundamental frequency and the pulse amplitude, suggesting that both humans and monkeys control fundamental frequency by subglottal pressure. While in humans pulsed phonation is usually considered pathological or artificial, male Diana monkeys rely exclusively on pulsed phonation, suggesting a functional adaptation. Moreover, we were unable to document any nonlinear phenomena, despite the fact that they occur frequently in the vocal repertoire of humans and nonhumans, further suggesting that the very robust Diana monkey pulse production mechanism has evolved for a particular functional purpose. We discuss the implications of these findings for the structural evolution of Diana monkey alarm calls and suggest that the restricted variability in fundamental frequency and robustness of the source signal gave rise to the formant patterns observed in Diana monkey alarm calls, used to convey predator information.

  16. Loss of metabolites from monkey striatum during PET with FDOPA

    DEFF Research Database (Denmark)

    Cumming, P; Munk, O L; Doudet, D

    2001-01-01

    constants using data recorded during 240 min of FDOPA circulation in normal monkeys and in monkeys with unilateral 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (MPTP) lesions. Use of the extended models increased the magnitudes of K(D)(i) and k(D)(3) in striatum; in the case of k(D)(3), variance...... of the estimate was substantially improved upon correction for metabolite loss. The rate constants for metabolite loss were higher in MPTP-lesioned monkey striatum than in normal striatum. The high correlation between individual estimates of k(Lin)(cl) and k(DA)(9) suggests that both rate constants reveal loss...

  17. Desferrioxamine suppresses Plasmodium falciparum in Aotus monkeys.

    Science.gov (United States)

    Pollack, S; Rossan, R N; Davidson, D E; Escajadillo, A

    1987-02-01

    Clinical observation has suggested that iron deficiency may be protective in malaria, and we have found that desferrioxamine (DF), an iron-specific chelating agent, inhibited Plasmodium falciparum growth in vitro. It was difficult to be confident that DF would be effective in an intact animal, however, because continuous exposure to DF was required in vitro and, in vivo, DF is rapidly excreted. Also, the in vitro effect of DF was overcome by addition of iron to the culture and in vivo there are potentially high local iron concentrations when iron is absorbed from the diet or released from reticuloendothelial cells. We now show that DF given by constant subcutaneous infusion does suppress parasitemia in P. falciparum-infected Aotus monkeys.

  18. Amygdalar vocalization pathways in the squirrel monkey.

    Science.gov (United States)

    Jürgens, U

    1982-06-10

    In 22 squirrel monkeys (Saimiri sciureus) vocalization-eliciting electrodes were implanted into the amygdala and along the trajectory of the stria terminalis. Then, lesions were placed in the stria terminalis, its bed nucleus, the ventral amygdalofugal pathway and several di- and mesencephalic structures in order to find out the pathways along which the amygdala exerts its vocalization-controlling influence. It was found that different call types are controlled by different pathways. Purring and chattering calls, which express a self-confident, challenging attitude and an attempt to recruit fellow-combatants in intra-specific mobbing, respectively, are controlled via the stria terminalis; alarm peep and groaning calls, in contrast, which indicate flight motivation and resentment, respectively, are triggered via the ventral amygdalofugal fibre bundle. Both pathways traverse the dorsolateral and dorsomedial hypothalamus, respectively, and unite in the periaqueductal grey of the midbrain.

  19. Keep children away from macaque monkeys!

    Science.gov (United States)

    Bréhin, Camille; Debuisson, Cécile; Mansuy, Jean-Michel; Niphuis, Henk; Buitendijk, Hester; Mengelle, Catherine; Grouteau, Erick; Claudet, Isabelle

    2016-03-01

    To warn physicians and parents about the risk of macaque bites, we present two pediatric cases (a 4-year-old boy and a 10-year-old girl) of bites sustained while on holiday. The young boy developed febrile dermohypodermitis and was hospitalized for IV antibiotic treatment. He received an initial antirabies vaccine while still in the holiday destination. Except for local wound disinfection and antibiotic ointment, the girl did not receive any specific treatment while abroad. Both were negative for simian herpes PCR. When travelling in countries or cities with endemic simian herpes virus, parents should keep children away from monkeys. Travel agencies, pediatricians and family physicians should better inform families about the zoonotic risk.

  20. Molecular cloning of pituitary glycoprotein alpha-subunit and follicle stimulating hormone and chorionic gonadotropin beta-subunits from New World squirrel monkey and owl monkey.

    Science.gov (United States)

    Scammell, Jonathan G; Funkhouser, Jane D; Moyer, Felricia S; Gibson, Susan V; Willis, Donna L

    2008-02-01

    The goal of this study was to characterize the gonadotropins expressed in pituitary glands of the New World squirrel monkey (Saimiri sp.) and owl monkey (Aotus sp.). The various subunits were amplified from total RNA from squirrel monkey and owl monkey pituitary glands by reverse transcription-polymerase chain reaction and the deduced amino acid sequences compared to those of other species. Mature squirrel monkey and owl monkey glycoprotein hormone alpha-polypeptides (96 amino acids in length) were determined to be 80% homologous to the human sequence. The sequences of mature beta subunits of follicle stimulating hormone (FSHbeta) from squirrel monkey and owl monkey (111 amino acids in length) are 92% homologous to human FSHbeta. New World primate glycoprotein hormone alpha-polypeptides and FSHbeta subunits showed conservation of all cysteine residues and consensus N-linked glycosylation sites. Attempts to amplify the beta-subunit of luteinizing hormone from squirrel monkey and owl monkey pituitary glands were unsuccessful. Rather, the beta-subunit of chorionic gonadotropin (CG) was amplified from pituitaries of both New World primates. Squirrel monkey and owl monkey CGbeta are 143 and 144 amino acids in length and 77% homologous with human CGbeta. The greatest divergence is in the C terminus, where all four sites for O-linked glycosylation in human CGbeta, responsible for delayed metabolic clearance, are predicted to be absent in New World primate CGbetas. It is likely that CG secreted from pituitary of New World primates exhibits a relatively short half-life compared to human CG.

  1. jMonkeyEngine 3.0 cookbook

    CERN Document Server

    Edén, Rickard

    2014-01-01

    If you are a jMonkey developer or a Java developer who is interested to delve further into the game making process to expand your skillset and create more technical games, then this book is perfect for you.

  2. Monkey visual behavior falls into the uncanny valley.

    Science.gov (United States)

    Steckenfinger, Shawn A; Ghazanfar, Asif A

    2009-10-27

    Very realistic human-looking robots or computer avatars tend to elicit negative feelings in human observers. This phenomenon is known as the "uncanny valley" response. It is hypothesized that this uncanny feeling is because the realistic synthetic characters elicit the concept of "human," but fail to live up to it. That is, this failure generates feelings of unease due to character traits falling outside the expected spectrum of everyday social experience. These unsettling emotions are thought to have an evolutionary origin, but tests of this hypothesis have not been forthcoming. To bridge this gap, we presented monkeys with unrealistic and realistic synthetic monkey faces, as well as real monkey faces, and measured whether they preferred looking at one type versus the others (using looking time as a measure of preference). To our surprise, monkey visual behavior fell into the uncanny valley: They looked longer at real faces and unrealistic synthetic faces than at realistic synthetic faces.

  3. Stem Cells Transplanted in Monkeys without Anti-Rejection Drugs

    Science.gov (United States)

    ... page: https://medlineplus.gov/news/fullstory_160989.html Stem Cells Transplanted in Monkeys Without Anti-Rejection Drugs Scientists say goal is to create banks of stem cells that could be used for any human patient ...

  4. Monkey King by Zhengjiang General Troupe of Quyi and Acrobatics

    Institute of Scientific and Technical Information of China (English)

    王玉

    2008-01-01

    Monkey King,the grand acrobatic and magical theme show, has successfully given its first dozen shows at Hangzhou Theater since July 27.The show was presented by Zhejiang General Troupe of Quyi and Acrobatics, and

  5. INTERCEPTIVE EFFECTS OF EPOSTANE IN RATS AND RHESUS MONKEYS

    Institute of Scientific and Technical Information of China (English)

    LINZhong-Ming; LIUChang-Guan; CHENHui-Qing; LIWei-Kang; XURui-Ying

    1989-01-01

    Interceptives arc defined as agents which interrupt pregnancy after implantation.Epostane, a potent 3β-hydroxysteruid dehydrogenase inhibitor, possessed interceptive activities in rats and rhesus monkeys. In rats, day 10 and day 11 of pregnancy were the

  6. Comparison of Plasmodium falciparum infections in Panamanian and Colombian owl monkeys.

    Science.gov (United States)

    Rossan, R N; Harper, J S; Davidson, D E; Escajadillo, A; Christensen, H A

    1985-11-01

    Parameters of blood-induced infections of the Vietnam Oak Knoll, Vietnam Smith, and Uganda Palo Alto strains of Plasmodium falciparum studied in 395 Panamanian owl monkeys in this laboratory between 1976-1984 were compared with those reported from another laboratory for 665 Colombian owl monkeys, studied between 1968-1975, and, at the time, designated Aotus trivirgatus griseimembra. The virulence of these strains was less in Panamanian than in Colombian owl monkeys, as indicated by lower mortality rates of the Panamanian monkeys during the first 30 days of patency. Maximum parasitemias of the Vietnam Smith and Uganda Palo Alto strain, in Panamanian owl monkeys dying during the first 15 days of patent infection, were significantly higher than in Colombian owl monkeys. Panamanian owl monkeys that survived the primary attack had significantly higher maximum parasitemias than the surviving Colombian owl monkeys. Peak parasitemias were attained significantly earlier after patency in Panamanian than in Colombian owl monkeys, irrespective of the strain of P. falciparum. More Panamanian than Colombian owl monkeys evidenced self-limited infection after the primary attack of either the Vietnam Smith or Uganda Palo Alto strain. The duration of the primary attacks and recrudescences were significantly shorter in Panamanian than in Colombian owl monkeys. Mean peak parasitemias during recrudescence were usually higher in Panamanian owl monkeys than in Colombian monkeys. Differences of infection parameters were probably attributable, in part, to geographical origin of the two monkey hosts and parasite strains.

  7. Depth perception from moving cast shadow in macaque monkey.

    Science.gov (United States)

    Mizutani, Saneyuki; Usui, Nobuo; Yokota, Takanori; Mizusawa, Hidehiro; Taira, Masato; Katsuyama, Narumi

    2015-07-15

    In the present study, we investigate whether the macaque monkey can perceive motion in depth using a moving cast shadow. To accomplish this, we conducted two experiments. In the first experiment, an adult Japanese monkey was trained in a motion discrimination task in depth by binocular disparity. A square was presented on the display so that it appeared with a binocular disparity of 0.12 degrees (initial position), and moved toward (approaching) or away from (receding) the monkey for 1s. The monkey was trained to discriminate the approaching and receding motion of the square by GO/delayed GO-type responses. The monkey showed a significantly high accuracy rate in the task, and the performance was maintained when the position, color, and shape of the moving object were changed. In the next experiment, the change in the disparity was gradually decreased in the motion discrimination task. The results showed that the performance of the monkey declined as the distance of the approaching and receding motion of the square decreased from the initial position. However, when a moving cast shadow was added to the stimulus, the monkey responded to the motion in depth induced by the cast shadow in the same way as by binocular disparity; the reward was delivered randomly or given in all trials to prevent the learning of the 2D motion of the shadow in the frontal plane. These results suggest that the macaque monkey can perceive motion in depth using a moving cast shadow as well as using binocular disparity.

  8. Monkey Feeding Assay for Testing Emetic Activity of Staphylococcal Enterotoxin.

    Science.gov (United States)

    Seo, Keun Seok

    2016-01-01

    Staphylococcal enterotoxins (SEs) are unique bacterial toxins that cause gastrointestinal toxicity as well as superantigenic activity. Since systemic administration of SEs induces superantigenic activity leading to toxic shock syndrome that may mimic enterotoxic activity of SEs such as vomiting and diarrhea, oral administration of SEs in the monkey feeding assay is considered as a standard method to evaluate emetic activity of SEs. This chapter summarizes and discusses practical considerations of the monkey feeding assay used in studies characterizing classical and newly identified SEs.

  9. Pulpal Response to Intraligamentary Injection in the Cynomologus Monkey

    OpenAIRE

    Peurach, James C.

    1985-01-01

    The objective of this study was to determine if intraligamentary injection causes qualitative histopathologic changes in the dental pulp of a Cynomologus monkey. In as much as the pulp and periapical tissues of the monkey are similar to that of humans, nonresolving damage to the pulp would contraindicate periodontal ligament injection in procedures where the tooth would not be extracted or the pulp extirpated. Periodontal ligament injection in this study did not produce any histopathological ...

  10. Preference transitivity and symbolic representation in capuchin monkeys (Cebus apella.

    Directory of Open Access Journals (Sweden)

    Elsa Addessi

    Full Text Available BACKGROUND: Can non-human animals comprehend and employ symbols? The most convincing empirical evidence comes from language-trained apes, but little is known about this ability in monkeys. Tokens can be regarded as symbols since they are inherently non-valuable objects that acquire an arbitrarily assigned value upon exchange with an experimenter. Recent evidence suggested that capuchin monkeys, which diverged from the human lineage 35 million years ago, can estimate, represent and combine token quantities. A fundamental and open question is whether monkeys can reason about symbols in ways similar to how they reason about real objects. METHODOLOGY/PRINCIPAL FINDINGS: Here we examined this broad question in the context of economic choice behavior. Specifically, we assessed whether, in a symbolic context, capuchins' preferences satisfy transitivity--a fundamental trait of rational decision-making. Given three options A, B and C, transitivity holds true if A > or = B, B > or = C and A > or = C (where > or = indicates preference. In this study, we trained monkeys to exchange three types of tokens for three different foods. We then compared choices monkeys made between different types of tokens with choices monkeys made between the foods. Qualitatively, capuchins' preferences revealed by the way of tokens were similar to those measured with the actual foods. In particular, when choosing between tokens, monkeys displayed strict economic preferences and their choices satisfied transitivity. Quantitatively, however, values measured by the way of tokens differed systematically from those measured with the actual foods. In particular, for any pair of foods, the relative value of the preferred food increased when monkeys chose between the corresponding tokens. CONCLUSIONS/SIGNIFICANCE: These results indicate that indeed capuchins are capable of treating tokens as symbols. However, as they do so, capuchins experience the cognitive burdens imposed by symbolic

  11. Monkey and dung beetle activities influence soil seed bank structure

    OpenAIRE

    Feer, François; Ponge, Jean-François; Jouard, Sylvie; Gomez, Doris

    2013-01-01

    International audience; In Neotropical forests, dung beetles act as efficient secondary dispersers of seeds that are dispersed primarily by red howler monkeys. Here, we investigated the origins of soil seed bank variability in relation to monkey and dung beetle activity, to assess the impact of dung beetles on seed fate, and their adaptability to resource availability. This question is important to better understand the process of tree regeneration, and is especially timely in the current con...

  12. Performing monkeys of Bangladesh: characterizing their source and genetic variation.

    Science.gov (United States)

    Hasan, M Kamrul; Feeroz, M Mostafa; Jones-Engel, Lisa; Engel, Gregory A; Akhtar, Sharmin; Kanthaswamy, Sree; Smith, David Glenn

    2016-04-01

    The acquisition and training of monkeys to perform is a centuries-old tradition in South Asia, resulting in a large number of rhesus macaques kept in captivity for this purpose. The performing monkeys are reportedly collected from free-ranging populations, and may escape from their owners or may be released into other populations. In order to determine whether this tradition involving the acquisition and movement of animals has influenced the population structure of free-ranging rhesus macaques in Bangladesh, we first characterized the source of these monkeys. Biological samples from 65 performing macaques collected between January 2010 and August 2013 were analyzed for genetic variation using 716 base pairs of mitochondrial DNA. Performing monkey sequences were compared with those of free-ranging rhesus macaque populations in Bangladesh, India and Myanmar. Forty-five haplotypes with 116 (16 %) polymorphic nucleotide sites were detected among the performing monkeys. As for the free-ranging rhesus population, most of the substitutions (89 %) were transitions, and no indels (insertion/deletion) were observed. The estimate of the mean number of pair-wise differences for the performing monkey population was 10.1264 ± 4.686, compared to 14.076 ± 6.363 for the free-ranging population. Fifteen free-ranging rhesus macaque populations were identified as the source of performing monkeys in Bangladesh; several of these populations were from areas where active provisioning has resulted in a large number of macaques. The collection of performing monkeys from India was also evident.

  13. A notion of graph likelihood and an infinite monkey theorem

    CERN Document Server

    Banerji, Christopher R S; Severini, Simone

    2013-01-01

    We play with a graph-theoretic analogue of the folklore infinite monkey theorem. We define a notion of graph likelihood as the probability that a given graph is constructed by a monkey in a number of time steps equal to the number of vertices. We present an algorithm to compute this graph invariant and closed formulas for some infinite classes. We have to leave the computational complexity of the likelihood as an open problem.

  14. A notion of graph likelihood and an infinite monkey theorem

    Science.gov (United States)

    Banerji, Christopher R. S.; Mansour, Toufik; Severini, Simone

    2014-01-01

    We play with a graph-theoretic analogue of the folklore infinite monkey theorem. We define a notion of graph likelihood as the probability that a given graph is constructed by a monkey in a number of time steps equal to the number of vertices. We present an algorithm to compute this graph invariant and closed formulas for some infinite classes. We have to leave the computational complexity of the likelihood as an open problem.

  15. Dyscoria Associated with Herpesvirus Infection in Owl Monkeys (Aotus nancymae)

    OpenAIRE

    Gozalo, Alfonso S; Montoya, Enrique J; Weller, Richard E

    2008-01-01

    Dyscoria was noted in a female owl monkey and 2 of her offspring. The third offspring was found dead with necrohemorrhagic encephalitis. Two male monkeys paired with the female died, 1 of which showed oral ulcers at necropsy. Histologic examination of the oral ulcers revealed syncytia and eosinophilic intranuclear inclusion bodies in epithelial cells. Ocular examination revealed posterior synechia associated with the dyscoria in all 3 animals. Serum samples from the female and her offspring w...

  16. Transcriptional profiling of rhesus monkey embryonic stem cells.

    Science.gov (United States)

    Byrne, James A; Mitalipov, Shoukhrat M; Clepper, Lisa; Wolf, Don P

    2006-12-01

    Embryonic stem cells (ESCs) may be able to cure or alleviate the symptoms of various degenerative diseases. However, unresolved issues regarding survival, functionality, and tumor formation mean a prudent approach should be adopted towards advancing ESCs into human clinical trials. The rhesus monkey provides an ideal model organism for developing strategies to prevent immune rejection and test the feasibility, safety, and efficacy of ESC-based medical treatments. Transcriptional profiling of rhesus monkey ESCs provides a foundation for pre-clinical ESC research in this species. In the present study, we used microarray technology, immunocytochemistry, reverse transcription polymerase chain reaction (RT-PCR) and quantitative real-time PCR (qPCR) to characterize and transcriptionally profile rhesus monkey ESCs. We identified 367 stemness gene candidates that were highly (>85%) conserved across five different ESC lines. Rhesus monkey ESC lines maintained a pluripotent undifferentiated state over a wide range of POU5F1 (also known as OCT4) expression levels, and comparisons between rhesus monkey, mouse, and human stemness genes revealed five mammalian stemness genes: CCNB1, GDF3, LEFTB, POU5F1, and NANOG. These five mammalian genes are strongly expressed in rhesus monkey, mouse, and human ESCs, albeit only in the undifferentiated state, and represent the core key mammalian stemness factors.

  17. Evaluation of seven hypotheses for metamemory performance in rhesus monkeys.

    Science.gov (United States)

    Basile, Benjamin M; Schroeder, Gabriel R; Brown, Emily Kathryn; Templer, Victoria L; Hampton, Robert R

    2015-02-01

    Knowing the extent to which nonhumans and humans share mechanisms for metacognition will advance our understanding of cognitive evolution and will improve selection of model systems for biomedical research. Some nonhuman species avoid difficult cognitive tests, seek information when ignorant, or otherwise behave in ways consistent with metacognition. There is agreement that some nonhuman animals "succeed" in these metacognitive tasks, but little consensus about the cognitive mechanisms underlying performance. In one paradigm, rhesus monkeys visually searched for hidden food when ignorant of the location of the food, but acted immediately when knowledgeable. This result has been interpreted as evidence that monkeys introspectively monitored their memory to adaptively control information seeking. However, convincing alternative hypotheses have been advanced that might also account for the adaptive pattern of visual searching. We evaluated seven hypotheses using a computerized task in which monkeys chose either to take memory tests immediately or to see the answer again before proceeding to the test. We found no evidence to support the hypotheses of behavioral cue association, rote response learning, expectancy violation, response competition, generalized search strategy, or postural mediation. In contrast, we repeatedly found evidence to support the memory monitoring hypothesis. Monkeys chose to see the answer when memory was poor, either from natural variation or experimental manipulation. We found limited evidence that monkeys also monitored the fluency of memory access. Overall, the evidence indicates that rhesus monkeys can use memory strength as a discriminative cue for information seeking, consistent with introspective monitoring of explicit memory.

  18. Insect-foraging in captive owl monkeys (Aotus nancymaae).

    Science.gov (United States)

    Wolovich, Christy K; Rivera, Jeanette; Evans, Sian

    2010-08-01

    Whereas the diets of diurnal primate species vary greatly, almost all nocturnal primate species consume insects. Insect-foraging has been described in nocturnal prosimians but has not been investigated in owl monkeys (Aotus spp.). We studied 35 captive owl monkeys (Aotus nancymaae) in order to describe their foraging behavior and to determine if there were any age or sex differences in their ability to capture insect prey. Because owl monkeys cooperate in parental care and in food-sharing, we expected social interactions involving insect prey. We found that owl monkeys most often snatched flying insects from the air and immobilized crawling insects against a substrate using their hands. Immatures and adult female owl monkeys attempted to capture prey significantly more often than did adult males; however, there was no difference in the proportion of attempts that resulted in capture. Social interactions involving prey appeared similar to those with provisioned food, but possessors of prey resisted begging attempts more so than did possessors of other food. Owl monkeys attempted to capture prey often (mean = 9.5 +/- 5.8 attempts/h), and we speculate that the protein and lipid content of captured prey is important for meeting the metabolic demands for growth and reproduction.

  19. Intrapericardial Denervation: Responses to Water Immersion in Rhesus Monkeys

    Science.gov (United States)

    McKeever, Kenneth H.; Keil, Lanny C.; Sandler, Harold

    1995-01-01

    Eleven anesthetized rhesus monkeys were used to study cardiovascular, renal, and endocrine alterations associated with 120 min of head-out water immersion. Five animals underwent complete intrapericardial denervation using the Randall technique, while the remaining six monkeys served as intact controls. Each animal was chronically instrumented with an electromagnetic flow probe on the ascending aorta, a strain gauge pressure transducer implanted in the apex of the left ventricle (LV), and electrocardiogram leads anchored to the chest wall and LV. During immersion, LV end-diastolic pressure, urine flow, glomerular filtration rate, sodium excretion, and circulating atrial natriuretic peptide (ANP) each increased (P less than 0.05) for intact and denervated monkeys. There were no alterations in free water clearance in either group during immersion, yet fractional excretion of free water increased (P less than 0.05) in the intact monkeys. Plasma renin activity (PRA) decreased (P less than 0.05) during immersion in intact monkeys but not the denervated animals. Plasma vasopressin (PVP) concentration decreased (P less than 0.05) during the first 30 min of immersion in both groups but was not distinguishable from control by 60 min of immersion in denervated monkeys. These data demonstrate that complete cardiac denervation does not block the rise in plasma ANP or prevent the natriuresis associated with head-out water immersion. The suppression of PVP during the first minutes of immersion after complete cardiac denervation suggests that extracardiac sensing mechanisms associated with the induced fluid shifts may be responsible for the findings.

  20. Color-detection thresholds in rhesus macaque monkeys and humans.

    Science.gov (United States)

    Gagin, Galina; Bohon, Kaitlin S; Butensky, Adam; Gates, Monica A; Hu, Jiun-Yiing; Lafer-Sousa, Rosa; Pulumo, Reitumetse L; Qu, Jane; Stoughton, Cleo M; Swanbeck, Sonja N; Conway, Bevil R

    2014-07-15

    Macaque monkeys are a model of human color vision. To facilitate linking physiology in monkeys with psychophysics in humans, we directly compared color-detection thresholds in humans and rhesus monkeys. Colors were defined by an equiluminant plane of cone-opponent color space. All subjects were tested on an identical apparatus with a four-alternative forced-choice task. Targets were 2° square, centered 2° from fixation, embedded in luminance noise. Across all subjects, the change in detection thresholds from initial testing to plateau performance (“learning”) was similar for +L − M (red) colors and +M − L (bluish-green) colors. But the extent of learning was higher for +S (lavender) than for −S (yellow-lime); moreover, at plateau performance, the cone contrast at the detection threshold was higher for +S than for −S. These asymmetries may reflect differences in retinal circuitry for S-ON and S-OFF. At plateau performance, the two species also had similar detection thresholds for all colors, although monkeys had shorter reaction times than humans and slightly lower thresholds for colors that modulated L/M cones. We discuss whether these observations, together with previous work showing that monkeys have lower spatial acuity than humans, could be accounted for by selective pressures driving higher chromatic sensitivity at the cost of spatial acuity amongst monkeys, specifically for the more recently evolved L − M mechanism.

  1. Auditory artificial grammar learning in macaque and marmoset monkeys.

    Science.gov (United States)

    Wilson, Benjamin; Slater, Heather; Kikuchi, Yukiko; Milne, Alice E; Marslen-Wilson, William D; Smith, Kenny; Petkov, Christopher I

    2013-11-27

    Artificial grammars (AG) are designed to emulate aspects of the structure of language, and AG learning (AGL) paradigms can be used to study the extent of nonhuman animals' structure-learning capabilities. However, different AG structures have been used with nonhuman animals and are difficult to compare across studies and species. We developed a simple quantitative parameter space, which we used to summarize previous nonhuman animal AGL results. This was used to highlight an under-studied AG with a forward-branching structure, designed to model certain aspects of the nondeterministic nature of word transitions in natural language and animal song. We tested whether two monkey species could learn aspects of this auditory AG. After habituating the monkeys to the AG, analysis of video recordings showed that common marmosets (New World monkeys) differentiated between well formed, correct testing sequences and those violating the AG structure based primarily on simple learning strategies. By comparison, Rhesus macaques (Old World monkeys) showed evidence for deeper levels of AGL. A novel eye-tracking approach confirmed this result in the macaques and demonstrated evidence for more complex AGL. This study provides evidence for a previously unknown level of AGL complexity in Old World monkeys that seems less evident in New World monkeys, which are more distant evolutionary relatives to humans. The findings allow for the development of both marmosets and macaques as neurobiological model systems to study different aspects of AGL at the neuronal level.

  2. Etiologic structure of bacterial intestinal infections in monkeys of Adler breeding center.

    Science.gov (United States)

    Ardasheliya, S N; Kalashnikova, V A; Dzhikidze, E K

    2011-10-01

    We studied etiologic structure of bacterial intestinal infections in monkeys of Adler nursery. A total of 533 monkeys with diarrhea syndrome and monkeys dead from intestinal infections, as well as clinically healthy monkeys and animals dead from other pathologies were examined by bacteriological and molecular-genetic methods. Pathogenic enterobacteria Shigella and Salmonella and microaerophile Campylobacter were found in 5 and 19%, respectively. A high percentage (49%) of intestinal diseases of unknown etiology was revealed in monkeys. The fact that the number of detected opportunistic enterobacteria did not differ in healthy and diseased monkeys suggests that they are not involved into the etiology of intestinal disease.

  3. Spontaneous lesions of the cardiovascular system in purpose-bred laboratory nonhuman primates.

    Science.gov (United States)

    Chamanza, Ronnie; Parry, Nicola M A; Rogerson, Petrina; Nicol, Jen R; Bradley, Alys E

    2006-01-01

    This retrospective study was performed to determine the range, occurrence and incidence of spontaneously arising histopathological findings of the cardiovascular system in purpose-bred laboratory nonhuman primates. Data were collected from 84 controlled toxicological studies with equal numbers of male and female animals and full tissue lists. Attempts were also made to standardize pathological terms used by various original pathologists. Tissue sections from 2464 animals, which included 2050 cynomolgus monkeys (Macaca fascicularis), 284 common marmosets (Callithrix jacchus) and 130 rhesus monkeys (Macaca mulatta) were examined. The most common cardiac finding was focal myocardial inflammation, subcategorized as either "inflammatory cell infiltration" (339) or "focal myocarditis" (131). Other cardiac findings included mineralization (29), endocarditis (16), pericarditis (10), squamous cysts (6) and ectopic thyroid tissue (5). Perivasculitis/vasculitis in the kidney, lung, meninges, sciatic nerve, and other tissues (206) was the most common vascular lesion. Focal myocarditis was more common in male (60%) than female (40%) animals. Cardiac mineralization and extramedullary hematopoiesis were more common in marmosets than other species while ectopic thyroid tissue was present in marmosets and cynomolgus monkeys. To our knowledge, this is the first study to demonstrate the range and incidence of spontaneous cardiovascular lesions in laboratory nonhuman primates.

  4. Argentine hemorrhagic fever: a primate model.

    Science.gov (United States)

    Weissenbacher, M C; Calello, M A; Colillas, O J; Rondinone, S N; Frigerio, M J

    1979-01-01

    Experimental Junin virus infection of a New World primate, Callithrix jacchus, was evaluated. The virus produced anorexia, loss of weight, thrombocytopenia, leukopenia, and hemorrhagic and neurological symptoms and terminated in death. Virus was recovered from urine, blood samples and all tissues taken at autopsy. These preliminary observations show that several aspects of the experimental disease in C. jacchus are quite similar to severe natural Argentine hemorrhagic fever of man.

  5. Male-directed infanticide in spider monkeys (Ateles spp.).

    Science.gov (United States)

    Alvarez, Sara; Di Fiore, Anthony; Champion, Jane; Pavelka, Mary Susan; Páez, Johanna; Link, Andrés

    2015-04-01

    Infanticide is considered a conspicuous expression of sexual conflict amongst mammals, including at least 35 primate species. Here we describe two suspected and one attempted case of intragroup infanticide in spider monkeys that augment five prior cases of observed or suspected infanticide in this genus. Contrary to the typical pattern of infanticide seen in most primate societies, where infants are killed by conspecifics independent of their sex, all eight cases of observed or suspected infanticide in spider monkeys have been directed toward male infants within their first weeks of life. Moreover, although data are still scant, infanticides seem to be perpetrated exclusively by adult males against infants from their own social groups and are not associated with male takeovers or a sudden rise in male dominance rank. Although the slow reproductive cycles of spider monkeys might favor the presence of infanticide because of the potential to shorten females' interbirth intervals, infanticide is nonetheless uncommon among spider monkeys, and patterns of male-directed infanticide are not yet understood. We suggest that given the potentially close genetic relationships among adult males within spider monkey groups, and the need for males to cooperate with one another in territorial interactions with other groups of related males, infanticide may be expected to occur primarily where the level of intragroup competition among males outweighs that of competition between social groups. Finally, we suggest that infanticide in spider monkeys may be more prevalent than previously thought, given that it may be difficult for observers to witness cases of infanticide or suspected infanticide that occur soon after birth in taxa that are characterized by high levels of fission-fusion dynamics. Early, undetected, male-biased infanticide could influence the composition of spider monkey groups and contribute to the female-biased adult sex ratios often reported for this genus.

  6. Seroepidemiological survey of pathogenic Yersinia in breeding squirrel monkeys in Japan.

    Science.gov (United States)

    Iwata, Taketoshi; Une, Yumi; Lee, Ken-ichi; Nakamura, Shin-ichi; Taniguchi, Takahide; Hayashidani, Hideki

    2010-08-01

    To investigate the prevalence of antibodies to pathogenic Yersinia in breeding squirrel monkeys, the serum samples of 252 squirrel monkeys from 9 zoological gardens in Japan were tested by ELISA using plasmid-encoded Yersinia outer membrane protein (Yops) as the antigen. The cutoff value was calculated by using the serum samples of the squirrel monkeys from Suriname, where no prevalence of pathogenic Yersinia have been reported. According to the cutoff value, 164 of 252 (65.1%) squirrel monkeys were considered positive against pathogenic Yersinia. These positive monkeys belonged to 8 of the 9 zoological gardens, and the percentage of the seropositive monkeys ranged from 22.2 to 89.4%. Furthermore, in one zoological garden, the positive rate of the squirrel monkeys which were over 1 year old (95.7%) was significantly higher than those which were under 1 year old (23.3%). These results suggested that pathogenic Yersinia is highly prevalent among breeding monkeys in Japan.

  7. Fetal malformations and early embryonic gene expression response in cynomolgus monkeys maternally exposed to thalidomide

    Science.gov (United States)

    The present study was performed to determine experimental conditions for thalidomide induction of fetal malformations and to understand the molecular mechanisms underlying thalidomide teratogenicity in cynomolgus monkeys. Cynomolgus monkeys were orally administered (±)-thalidomid...

  8. Microsatellite polymorphisms of Sichuan golden monkeys

    Institute of Scientific and Technical Information of China (English)

    PAN Deng; LI Ying; HU Hongxing; MENG Shijie; MEN Zhengrning; FU Yunxin; ZHANG Yaping

    2005-01-01

    Previous study using protein electrophoresis shows no polymorphism in 44 nuclear loci of Sichuan golden monkey (Rhinopithecus roxellana), which limits our understandings of its population genetic patterns in the nuclear genome. In order to obtain sufficient information, we scanned 14 microsatellite loci in a sample of 32 individuals from its three major habitats (Minshan, Qinling and Shennongjia). A considerable amount of polymorphisms were detected. The average heterozygosities in the local populations were all above 0.5. The differentiations among local populations were significant. There was evidence of geneflow among subpopulations, but geneflow between Qinling and Shennongjia local populations was the weakest. Minshan and Qinling populations might have gone through recent bottlenecks. The estimation of the ratio of the effective population sizes among local populations was close to that from census sizes. Comparisons to available mitochondria data suggested that R. roxellana's social structures played an important role in shaping its population genetic patterns. Our study showed that the polymorphism level of R. roxellana was no higher than other endangered species; therefore, measures should be taken to preserve genetic diversity of this species.

  9. The Thatcher illusion in humans and monkeys.

    Science.gov (United States)

    Dahl, Christoph D; Logothetis, Nikos K; Bülthoff, Heinrich H; Wallraven, Christian

    2010-10-01

    Primates possess the remarkable ability to differentiate faces of group members and to extract relevant information about the individual directly from the face. Recognition of conspecific faces is achieved by means of holistic processing, i.e. the processing of the face as an unparsed, perceptual whole, rather than as the collection of independent features (part-based processing). The most striking example of holistic processing is the Thatcher illusion. Local changes in facial features are hardly noticeable when the whole face is inverted (rotated 180 degrees ), but strikingly grotesque when the face is upright. This effect can be explained by a lack of processing capabilities for locally rotated facial features when the face is turned upside down. Recently, a Thatcher illusion was described in the macaque monkey analogous to that known from human investigations. Using a habituation paradigm combined with eye tracking, we address the critical follow-up questions raised in the aforementioned study to show the Thatcher illusion as a function of the observer's species (humans and macaques), the stimulus' species (humans and macaques) and the level of perceptual expertise (novice, expert).

  10. [Visually-guided discrimination and preference of sexuality in female macaque monkeys].

    Science.gov (United States)

    Mizuno, M

    1997-04-01

    Visual information about face and body including facial expression and bodily behavioral patterns has been known to play an important role in social and emotional communication in monkeys. Its involvement in sexual activity has also been demonstrated in male monkeys but it is poorly understood in female monkeys. In the present study, visually-guided discrimination and preference of sexuality were investigated in female macaque monkeys performing operant bar-press tasks in an experimental cage which had a transparent panel facing a display. In the sex discrimination task, two rhesus monkeys (Macaca mulatta) were trained to discriminate sex of a monkey shown in a picture which was randomly selected from six photographs (three males and three females) and was presented on the display. The monkey pressed a right or left bar for male or female monkey, respectively, to get water as a reward. Under this discrimination task, the monkeys could discriminate the sexes of monkeys shown in newly presented pictures. When choice bars were reversed, correct responses significantly decreased below chance level. In the sex preference task, three rhesus monkeys and three Japanese monkeys (M. juscata) were used. The monkeys voluntarily pressed the bar to watch the video movie showing either male or female rhesus monkeys. The movies were presented as long as the subject kept pressing the bar. The same movie was continued when the monkey pressed the bar again within 10s after the previous release of the bar, while it was changed to the other when 10s passed after the subject released the bar. The total duration of the responses in daily sessions was measured. In this visual preference task, four out of six monkeys showed sex preference. Three adult Japanese monkeys (6-8 y) pressed the bar to watch the video movie of male monkeys which was taken in breeding season with longer duration than that of female monkeys taken in the same season. The other two adult rhesus monkeys (7 8 y) did not

  11. Behavioral effects in monkeys of racemates of two biologically active marijuana constituents.

    Science.gov (United States)

    Scheckel, C L; Boff, E; Dahlen, P; Smart, T

    1968-06-28

    Both dl-Delta(8)- and dl-Delta(9)-tetrahydrocannabinol produced marked alterations of behavior in rhesus and squirrel monkeys. Squirrel monkeys appeared to have visual hallucinations. Continuous avoidance behavior of squirrel monkeys was stimulated by both drugs, but high doses of dl-Delta(9)-tetrahydrocannabinol also caused depression after the stimulant phase. Complex behavior involving memory and visual discrimination in rhesus monkeys was markedly disrupted by both drugs.

  12. Chronic experimental infection by Trypanosoma cruzi in Cebus apella monkeys

    Directory of Open Access Journals (Sweden)

    A. Riarte

    1995-12-01

    Full Text Available Twenty young male Cebus apella monkeys were infected with CAl Trypanosoma cruzi strain and reinfected with CA l or Tulahuen T.cruzi strains, with different doses and parasite source. Subpatent parasitemia was usually demonstrated in acute and chronic phases. Patent parasitemia was evident in one monkey in the acute phase and in four of them in the chronic phase after re-inoculations with high doses of CAl strain. Serological conversion was observed in all monkeys; titers were low, regardless of the methods used to investigate anti-T. cruzi specific antibodies. Higher titers were induced only when re-inoculations were perfomed with the virulent Tulahuén strain or high doses of CAl strain. Clinical electrocardiographic and ajmaline test evaluations did not reveal changes between infected and control monkeys. Histopathologically, cardiac lesions were always characterized by focal or multifocal mononuclear infiltrates and/or isolated fibrosis, as seen during the acute and chronic phases; neither amastigote nests nor active inflammation and fibrogenic processes characteristic of human acute and chronic myocarditis respectively, were observed. These morphological aspects more closely resemble those found in the "indeterminate phase" and contrast with the more diffuse and progressive pattern of the human chagasic myocarditis. All monkeys survived and no mortality was observed.

  13. Economic choices reveal probability distortion in macaque monkeys.

    Science.gov (United States)

    Stauffer, William R; Lak, Armin; Bossaerts, Peter; Schultz, Wolfram

    2015-02-18

    Economic choices are largely determined by two principal elements, reward value (utility) and probability. Although nonlinear utility functions have been acknowledged for centuries, nonlinear probability weighting (probability distortion) was only recently recognized as a ubiquitous aspect of real-world choice behavior. Even when outcome probabilities are known and acknowledged, human decision makers often overweight low probability outcomes and underweight high probability outcomes. Whereas recent studies measured utility functions and their corresponding neural correlates in monkeys, it is not known whether monkeys distort probability in a manner similar to humans. Therefore, we investigated economic choices in macaque monkeys for evidence of probability distortion. We trained two monkeys to predict reward from probabilistic gambles with constant outcome values (0.5 ml or nothing). The probability of winning was conveyed using explicit visual cues (sector stimuli). Choices between the gambles revealed that the monkeys used the explicit probability information to make meaningful decisions. Using these cues, we measured probability distortion from choices between the gambles and safe rewards. Parametric modeling of the choices revealed classic probability weighting functions with inverted-S shape. Therefore, the animals overweighted low probability rewards and underweighted high probability rewards. Empirical investigation of the behavior verified that the choices were best explained by a combination of nonlinear value and nonlinear probability distortion. Together, these results suggest that probability distortion may reflect evolutionarily preserved neuronal processing. Copyright © 2015 Stauffer et al.

  14. NUTRITIONAL CYTOPENIA (VITAMIN M DEFICIENCY) IN THE MONKEY.

    Science.gov (United States)

    Langston, W C; Darby, W J; Shukers, C F; Day, P L

    1938-10-31

    Young rhesus monkeys (Macaca mulatta) were given a diet containing casein, polished rice, whole wheat, salt mixture, sodium chloride, cod liver oil, and ascorbic acid. They developed a syndrome characterized by anemia, leukopenia, and loss of weight. Ulceration of the gums and diarrhea were common, and death occurred between the 26th and 100th day. 4 monkeys were given the deficient diet supplemented with 1 mg. of riboflavin daily, and these developed the characteristic signs and died. in periods of time similar to the survival of monkeys receiving the deficient diet alone. Nicotinic acid, either alone or in combination with riboflavin and thiamin chloride, failed to alter appreciably the course of the deficiency manifestations. Thus, it is evident that this nutritional cytopenia is not the result of a deficiency of vitamin B, riboflavin, or nicotinic acid. The deficient diet supplemented with either 10 gm. of dried brewers' yeast or 2 gm. of liver extract (Cohn fraction G) daily supported good growth, permitted normal body development, and maintained a normal blood picture over long periods. It is obvious that yeast and liver extract contain a substance essential to the nutrition of the monkey which is not identical with any of those factors of the vitamin B complex that have been chemically identified. We have proposed the term vitamin M for this factor which prevents nutritional cytopenia in the monkey.

  15. Endocrine responses in the rhesus monkey during acute cold exposure

    Energy Technology Data Exchange (ETDEWEB)

    Lotz, W.G.; Saxton, J.L. (Naval Aerospace Medical Research Lab., Pensacola, FL (United States))

    1991-03-11

    The authors studied five young male rhesus monkeys (Macaca mulatta), 3.4 to 6.7 kg, to determine the relationship between fluid balance hormones and urine production during acute, dry cold exposure. Each monkey served as its own control in duplicate experimental sessions at 6C or 26C. A 6-h experimental session consisted of 120 min equilibration at 26C, 120 min experimental exposure, and 120 min recovery at 26C. Urinary and venous catheters were inserted on the morning of a session. Rectal (Tre) and skin temperatures were monitored continuously. Blood samples were taken at 0, 30, 60 and 120 min of exposure, and at 60 min postexposure. Plasma was analyzed for arginine vasopressin (AVP), atrial natriuretic factor (ANF), plasma renin activity (PRA), plasma aldosterone (PA), and osmolality. Urine samples were analyzed for osmolality, electrolytes, and creatinine. Mean Tre was 1.6C lower after 120 min at 6C than at 26C. Urine volume and osmolality were not altered by cold exposure, as they are in humans and rats. Vasopressin and PA increased sharply, with mean plasma levels in monkeys exposed to cold more than threefold and tenfold, respectively, the levels in monkeys exposed at 26C. In contrast, ANF, PRA, and plasma osmolality were not significantly changed by cold exposure. The absence of a cold-induced diuresis in the monkey may be related to the marked increase in plasma AVP level.

  16. Observational learning in capuchin monkeys: a video deficit effect.

    Science.gov (United States)

    Anderson, James R; Kuroshima, Hika; Fujita, Kazuo

    2017-07-01

    Young human children have been shown to learn less effectively from video or televised images than from real-life demonstrations. Although nonhuman primates respond to and can learn from video images, there is a lack of direct comparisons of task acquisition from video and live demonstrations. To address this gap in knowledge, we presented capuchin monkeys with video clips of a human demonstrator explicitly hiding food under one of two containers. The clips were presented at normal, faster than normal, or slower than normal speed, and then the monkeys were allowed to choose between the real containers. Even after 55 sessions and hundreds of video demonstration trials the monkeys' performances indicated no mastery of the task, and there was no effect of video speed. When given live demonstrations of the hiding act, the monkeys' performances were vastly improved. Upon subsequent return to video demonstrations, performances declined to pre-live-demonstration levels, but this time with evidence for an advantage of fast video demonstrations. Demonstration action speed may be one aspect of images that influence nonhuman primates' ability to learn from video images, an ability that in monkeys, as in young children, appears limited compared to learning from live models.

  17. Selective hippocampal lesions yield nonspatial memory impairments in rhesus monkeys.

    Science.gov (United States)

    Doré, F Y; Thornton, J A; White, N M; Murray, E A

    1998-01-01

    Monkeys with removals of medial temporal lobe (MTL) structures are widely recognized as valid models of human global anterograde amnesia, a syndrome that arises consequent to damage to a finite set of brain structures situated in the medial temporal lobe and/or medial diencephalon. However, a comparison of memory deficits in human and nonhuman primates with MTL damage has presented a long-standing puzzle. Whereas amnesic patients are impaired in learning object discrimination problems, monkeys with MTL damage are typically not. One possible explanation for this difference is that object discrimination tasks for humans and monkeys differ in that the former but not the latter requires the use of contextual information. If this analysis is correct, monkeys with MTL damage might be disadvantaged in learning to discriminate similar objects presented in different contexts. To test this possibility, we evaluated the effects of excitotoxic lesions of one of the MTL structures, the hippocampus, on the rate of learning of discrimination problems embedded within unique contexts. Monkeys with hippocampal lesions were impaired relative to controls in learning object discrimination problems of this type. These findings strongly support the idea that the difference in the effect on object memory of MTL damage in human and nonhuman primates is due to a difference in the opportunity to employ contextual cues rather than to a difference in the organization of memory.

  18. Monkey steering responses reveal rapid visual-motor feedback.

    Directory of Open Access Journals (Sweden)

    Seth W Egger

    Full Text Available The neural mechanisms underlying primate locomotion are largely unknown. While behavioral and theoretical work has provided a number of ideas of how navigation is controlled, progress will require direct physiolgical tests of the underlying mechanisms. In turn, this will require development of appropriate animal models. We trained three monkeys to track a moving visual target in a simple virtual environment, using a joystick to control their direction. The monkeys learned to quickly and accurately turn to the target, and their steering behavior was quite stereotyped and reliable. Monkeys typically responded to abrupt steps of target direction with a biphasic steering movement, exhibiting modest but transient overshoot. Response latencies averaged approximately 300 ms, and monkeys were typically back on target after about 1 s. We also exploited the variability of responses about the mean to explore the time-course of correlation between target direction and steering response. This analysis revealed a broad peak of correlation spanning approximately 400 ms in the recent past, during which steering errors provoke a compensatory response. This suggests a continuous, visual-motor loop controls steering behavior, even during the epoch surrounding transient inputs. Many results from the human literature also suggest that steering is controlled by such a closed loop. The similarity of our results to those in humans suggests the monkey is a very good animal model for human visually guided steering.

  19. Responses of squirrel monkeys to their experimentally modified mobbing calls

    Science.gov (United States)

    Fichtel, Claudia; Hammerschmidt, Kurt

    2003-05-01

    Previous acoustic analyses suggested emotion-correlated changes in the acoustic structure of squirrel monkey (Saimiri sciureus) vocalizations. Specifically, calls given in aversive contexts were characterized by an upward shift in frequencies, often accompanied by an increase in amplitude. In order to test whether changes in frequencies or amplitude are indeed relevant for conspecific listeners, playback experiments were conducted in which either frequencies or amplitude of mobbing calls were modified. Latency and first orienting response were measured in playback experiments with six adult squirrel monkeys. After broadcasting yaps with increased frequencies or amplitude, squirrel monkeys showed a longer orienting response towards the speaker than after the corresponding control stimuli. Furthermore, after broadcasting yaps with decreased frequencies or amplitude, squirrel monkeys showed a shorter orienting response towards the speaker than after the corresponding manipulated calls with higher frequencies or amplitude. These results suggest that changes in frequencies or amplitude were perceived by squirrel monkeys, indicating that the relationship between call structure and the underlying affective state of the caller agreed with the listener's assessment of the calls. However, a simultaneous increase in frequencies and amplitude did not lead to an enhanced response, compared to each single parameter. Thus, from the receiver's perspective, both call parameters may mutually replace each other.

  20. Fanjing Mountain:the Only Home of the Guizhou Golden Monkey

    Institute of Scientific and Technical Information of China (English)

    JENNIFER; LIM

    2000-01-01

    THE Guizhou golden monkey is one of three breeds of golden monkey (the others are in Sichuan and Yunnan) that are found only in China, and is an extremely rare and precious wild animal. Inhabiting a very small area around Guizhou's Fanjing Mountain, there are only about 750 monkeys in existence making it

  1. Comparative plasma lipidome between human and cynomolgus monkey: are plasma polar lipids good biomarkers for diabetic monkeys?

    Directory of Open Access Journals (Sweden)

    Guanghou Shui

    Full Text Available BACKGROUND: Non-human primates (NHP are now being considered as models for investigating human metabolic diseases including diabetes. Analyses of cholesterol and triglycerides in plasma derived from NHPs can easily be achieved using methods employed in humans. Information pertaining to other lipid species in monkey plasma, however, is lacking and requires comprehensive experimental analysis. METHODOLOGIES/PRINCIPAL FINDINGS: We examined the plasma lipidome from 16 cynomolgus monkey, Macaca fascicularis, using liquid chromatography coupled with mass spectrometry (LC/MS. We established novel analytical approaches, which are based on a simple gradient elution, to quantify polar lipids in plasma including (i glycerophospholipids (phosphatidylcholine, PC; phosphatidylethanolamine, PE; phosphatidylinositol, PI; phosphatidylglycerol, PG; phosphatidylserine, PS; phosphatidic acid, PA; (ii sphingolipids (sphingomyelin, SM; ceramide, Cer; Glucocyl-ceramide, GluCer; ganglioside mannoside 3, GM3. Lipidomic analysis had revealed that the plasma of human and cynomolgus monkey were of similar compositions, with PC, SM, PE, LPC and PI constituting the major polar lipid species present. Human plasma contained significantly higher levels of plasmalogen PE species (p<0.005 and plasmalogen PC species (p<0.0005, while cynomolgus monkey had higher levels of polyunsaturated fatty acyls (PUFA in PC, PE, PS and PI. Notably, cynomolgus monkey had significantly lower levels of glycosphingolipids, including GluCer (p<0.0005 and GM(3 (p<0.0005, but higher level of Cer (p<0.0005 in plasma than human. We next investigated the biochemical alterations in blood lipids of 8 naturally occurring diabetic cynomolgus monkeys when compared with 8 healthy controls. CONCLUSIONS: For the first time, we demonstrated that the plasma of human and cynomolgus monkey were of similar compositions, but contained different mol distribution of individual molecular species. Diabetic monkeys

  2. Movement disorders induced in monkeys by chronic haloperidol treatment

    Energy Technology Data Exchange (ETDEWEB)

    Weiss, B.; Santelli, S.; Lusink, G.

    1977-01-01

    After several months of treatment, Cebus apella, Cebus albifrons, and Saimiri sciurea monkeys maintained on haloperidol, in doses of 0.5 or 1.0 mg/kg orally 5 days per week, began to display severe movement disorders, typically 1 to 6 h post-drug. Cebus monkeys exhibited violent, uncontrolled movements that flung the animals about the cage. Such episodes usually lasted only a few minutes, recurring several times during the period following drug ingestion. Writhing and bizarre postures dominated the response in S. sciurea. Cessation of drug treatment produced no distinctive after-effects. When tested as long as 508 days after the last administration, however, Cebus monkeys responded to haloperidol with several episodes of hyperkinesis, even at challenge doses considerably lower than those in the original treatment.

  3. Movement disorders induced in monkeys by chronic haloperidol treatment.

    Science.gov (United States)

    Weiss, B; Santelli, S; Lusink, G

    1977-08-16

    After several months of treatment, Cebus apella, Cebus albifrons, and Saimiri sciurea monkeys maintained on haloperidol, in doses of 0.5 or 1.0 mg/kg orally 5 days per week, began to display severe movement disorders, typically 1-6 h post-drug. Cebus monkeys exhibited violent, uncontrolled movements that flung the animals about the cage. Such episodes usually lasted only a few minutes, recurring several times during the period following drug ingestion. Writhing and bizarre postures dominated the response in S. sciurea. Cessation of drug treatment produced no distinctive after-effects. When tested as long as 508 days after the last administration, however, Cebus monkeys responded to haloperidol with several episodes of hyperkinesis, even at challenge doses considerably lower than those in the original treatment.

  4. Dyskinesias evoked in monkeys by weekly administration of haloperidol

    Energy Technology Data Exchange (ETDEWEB)

    Weiss, B.; Santelli, S.

    1978-05-19

    In two cebus (Cebus albifrons) monkeys given weekly oral doses of 0.25 milligram of haloperidol per kilogram, movement disorders appeared 1 to 8 hours after drug administration following the tenth weekly dose. These disorders included oral movements, peculiar postures, writhing, and stretching. Such reactions faded in intensity after the next two doses. Increasing the dose to 0.5 milligram per kilogram has elicited the disorders reliably after each weekly dose for almost 2 years. Similar reactions also developed in a squirrel monkey (Saimiri sciurea) treated weekly with haloperidol and in a third cebus monkey previously maintained for a year on a regimen of 0.25 milligram of haloperidol per kilogram on 5 days per week. These findings suggest an experimental model for determining the etiology of drug-induced movement disorders. They also suggest an unrecognized clinical problem.

  5. Dyskinesias evoked in monkeys by weekly administration of haloperidol.

    Science.gov (United States)

    Weiss, B; Santelli, S

    1978-05-19

    In two cebus (Cebus albifrons) monkeys given weekly oral doses of 0.25 milligram of haloperidol per kilogram, movement disorders appeared 1 to 8 hours after drug administration following the tenth weekly dose. These disorders included oral movements, peculiar postures, writhing, and stretching. Such reactions faded in intensity after the next two doses. Increasing the dose to 0.5 milligram per kilogram has elicited the disorders reliably after each weekly dose for almost 2 years. Similar reactions also developed in a squirrel monkey (Saimiri sciurea) treated weekly with haloperidol and in a third cebus monkey previously maintained for a year on a regimen of 0.25 milligram of haloperidol per kilogram on 5 days per week. These findings suggest an experimental model for determining the etiology of drug-induced movement disorders. They also suggest an unrecognized clinical problem.

  6. Photoacoustic tomography of monkey brain using virtual point ultrasonic transducers.

    Science.gov (United States)

    Nie, Liming; Guo, Zijian; Wang, Lihong V

    2011-07-01

    A photoacoustic tomography system (PAT) using virtual point ultrasonic transducers was developed and applied to image a monkey brain. The custom-built transducers provide a 10-fold greater field-of-view (FOV) than finite-aperture unfocused transducers as well as an improved signal-to-noise ratio (SNR) and reduced artifacts rather than negative-lens transducers. Their tangential resolution, radial resolution, and (SNR) improvements were quantified using tissue phantoms. Our PAT system can achieve high uniformity in both resolution (8) within a large FOV of 6 cm in diameter, even when the imaging objects are enclosed by a monkey skull. The cerebral cortex of a monkey brain was accurately mapped transcranially, through a skull ranging from 2 to 4 mm in thickness. This study demonstrates that PAT can overcome the optical and ultrasound attenuation of a relatively thick skull and can potentially be applied to human neonatal brain imaging.

  7. Rhesus monkey brain imaging through intact skull with thermoacoustic tomography.

    Science.gov (United States)

    Xu, Yuan; Wang, Lihong V

    2006-03-01

    Two-dimensional microwave-induced thermoacoustic tomography (TAT) is applied to imaging the Rhesus monkey brain through the intact skull. To reduce the wavefront distortion caused by the skull, only the low-frequency components of the thermoacoustic signals (images. The methods of signal processing and image reconstruction are validated by imaging a lamb kidney. The resolution of the system is found to be 4 mm when we image a 1-month-old monkey head containing inserted needles. We also image the coronal and axial sections of a 7-month-old monkey head. Brain features that are 3 cm deep in the head are imaged clearly. Our results demonstrate that TAT has potential for use in portable, cost-effective imagers for pediatric brains.

  8. Predation of wild spider monkeys at La Macarena, Colombia.

    Science.gov (United States)

    Matsuda, Ikki; Izawa, Kosei

    2008-01-01

    The killing of an adult male spider monkey (Ateles belzebuth ) by a jaguar (Panthera onca) and a predation attempt by a puma (Felis concolor) on an adult female spider monkey have been observed at the CIEM (Centro de Investigaciones Ecológicas La Macarena), La Macarena, Colombia. These incidents occurred directly in front of an observer, even though it is said that predation under direct observation on any type of primate rarely occurs. On the basis of a review of the literature, and the observations reported here, we suggest that jaguars and pumas are likely to be the only significant potential predators on adult spider monkeys, probably because of their large body size.

  9. Neural Monkey: An Open-source Tool for Sequence Learning

    Directory of Open Access Journals (Sweden)

    Helcl Jindřich

    2017-04-01

    Full Text Available In this paper, we announce the development of Neural Monkey – an open-source neural machine translation (NMT and general sequence-to-sequence learning system built over the TensorFlow machine learning library. The system provides a high-level API tailored for fast prototyping of complex architectures with multiple sequence encoders and decoders. Models’ overall architecture is specified in easy-to-read configuration files. The long-term goal of the Neural Monkey project is to create and maintain a growing collection of implementations of recently proposed components or methods, and therefore it is designed to be easily extensible. Trained models can be deployed either for batch data processing or as a web service. In the presented paper, we describe the design of the system and introduce the reader to running experiments using Neural Monkey.

  10. Composição de grupos, conflitos intergrupais e uso do espaço em Callithrix penicillata (Geoffroy, 1812 introduzidos em um fragmento urbano

    Directory of Open Access Journals (Sweden)

    Luciana Zago

    2014-03-01

    Full Text Available http://dx.doi.org/10.5007/2175-7925.2014v27n2p193 O uso do espaço pelo gênero Callithrix pode ser relacionado a diferentes fatores. O objetivo deste trabalho foi avaliar as influências de diferentes fatores sobre o uso do espaço em C. penicillata introduzidos em um fragmento urbano. Foram monitorados dois grupos, denominados GL e GG, em duas fases de seis meses no Parque Ecológico do Córrego Grande, Florianópolis, SC. Ambos os grupos eram compostos por oito indivíduos ao início do estudo. Ao longo da Fase I ocorreram desaparecimentos de indivíduos em GL e nascimentos em GG, alterando as composições para cinco e 11 indivíduos, respectivamente. Na Fase II, GL deslocou-se para uma área pouco acessível impossibilitando a realização de observações suficientes. Em GG desapareceram três indivíduos e nasceram outros dois. Comportamentos agonísticos intergrupais foram registrados em todos os meses da Fase I, enquanto na Fase II houve uma abrupta redução. Ocorreram sobreposições das áreas de vida em toda Fase I. Entre a Fase I e II, GL afastou-se da sobreposição e GG ocupou espaços de GL. Tais mudanças parecem associadas ao aumento de indivíduos em GG e sua necessidade em acessar recursos alimentares. As dinâmicas no uso do espaço parecem resultantes de: limitações espaciais, conflitos intergrupais, composições dos grupos e disponibilidade de recursos alimentares.

  11. Oct-4 expression in pluripotent cells of the rhesus monkey.

    Science.gov (United States)

    Mitalipov, Shoukhrat M; Kuo, Hung-Chih; Hennebold, Jon D; Wolf, Don P

    2003-12-01

    The POU (Pit-Oct-Unc)-domain transcription factor, Oct-4, has become a useful marker of pluripotency in the mouse. It is found exclusively in mouse preimplantation-stage embryos after embryonic genome activation and is a characteristic of mouse embryonic stem (ES) cells, and its absence in knockout mice precludes inner cell mass (ICM) formation in blastocysts. Expression of Oct-4 has also been associated with pluripotency in primate cells. Here, we undertook a systematic study of Oct-4 expression in rhesus macaque preimplantation embryos produced by intracytoplasmic sperm injection and in ES cells before and after exposure to differentiating conditions in vitro. We also evaluated Oct-4 expression as a means of monitoring the extent of reprogramming following somatic cell nuclear transfer. Oct-4 was detected by reverse transcription-polymerase chain reaction and immunocytochemistry with a monoclonal antibody. Monkey pronuclear-stage zygotes and cleaving embryos up to the 8-cell stage showed no detectable Oct-4. Nuclear staining for Oct-4 first became obvious at the 16-cell stage, and a strong signal was observed in morula and compact morula stages. Both ICM and trophectodermal cell nuclei of monkey early blastocysts were positive for Oct-4. However, the signal was diminished in trophectodermal cells of expanded blastocysts, whereas expression remained high in ICM nuclei. Similar to the mouse, hatched monkey blastocysts showed strong Oct-4 expression in the ICM, with no detectable signal in the trophectoderm. Undifferentiated monkey ES cells derived from the ICM of in vitro-produced blastocysts expressed Oct-4, consistent with their pluripotent nature, whereas ES cell differentiation was associated with signal loss. Therefore, Oct-4 expression in the monkey, as in the mouse, provides a useful marker for pluripotency after activation of the embryonic genome. Finally, the observed lack or abnormal expression of Oct-4 in monkey nuclear transfer embryos suggests

  12. Socialization of adult owl monkeys (Aotus sp.) in Captivity.

    Science.gov (United States)

    Williams, Lawrence E; Coke, C S; Weed, J L

    2017-01-01

    Social housing has often been recommended as one-way to address the psychological well-being of captive non-human primates. Published reports have examined methods to socialize compatible animals by forming pairs or groups. Successful socialization rates vary depending on the species, gender, and environment. This study presents a retrospective look at pairing attempts in two species of owl monkeys, Aotus nancymaae and A. azarae, which live in monogamous pairs in the wild. The results of 477 pairing attempt conducted with captive, laboratory housed owl monkeys and 61 hr of behavioral observations are reported here. The greatest success pairing these owl monkeys occurred with opposite sex pairs, with an 82% success rate. Opposite sex pairs were more successful when females were older than males. Female-female pairs were more successful than male-male (MM) pairs (62% vs 40%). Successful pairs stayed together between 3 and 7 years before the animals were separated due to social incompatibility. Vigilance, eating, and sleeping during introductions significantly predicted success, as did the performance of the same behavior in both animals. The results of this analysis show that it is possible to give captive owl monkeys a social alternative even if species appropriate social partners (i.e., opposite sex partners) are not available. The focus of this report is a description of one potential way to enhance the welfare of a specific new world primate, the owl monkey, under laboratory conditions. More important is how the species typical social structure of owl monkeys in nature affects the captive management of this genus. Am. J. Primatol. 79:e22521, 2017. © 2015 Wiley Periodicals, Inc.

  13. Positive reinforcement training in squirrel monkeys using clicker training.

    Science.gov (United States)

    Gillis, Timothy E; Janes, Amy C; Kaufman, Marc J

    2012-08-01

    Nonhuman primates in research environments experience regular stressors that have the potential to alter physiology and brain function, which in turn can confound some types of research studies. Operant conditioning techniques such as positive reinforcement training (PRT), which teaches animals to voluntarily perform desired behaviors, can be applied to improve behavior and reactivity. PRT has been used to train rhesus macaques, marmosets, and several other nonhuman primate species. To our knowledge, the method has yet to be used to train squirrel monkeys to perform complex tasks. Accordingly, we sought to establish whether PRT, utilizing a hand-box clicker (which emits a click sound that acts as the conditioned reinforcer), could be used to train adult male squirrel monkeys (Saimiri boliviensis, N = 14). We developed and implemented a training regimen to elicit voluntary participation in routine husbandry, animal transport, and injection procedures. Our secondary goal was to quantify the training time needed to achieve positive results. Squirrel monkeys readily learned the connection between the conditioned reinforcer (the clicker) and the positive reinforcer (food). They rapidly developed proficiency on four tasks of increasing difficulty: target touching, hand sitting, restraint training, and injection training. All subjects mastered target touching behavior within 2 weeks. Ten of 14 subjects (71%) mastered all tasks in 59.2 ± 2.6 days (range: 50-70 days). In trained subjects, it now takes about 1.25 min per monkey to weigh and administer an intramuscular injection, one-third of the time it took before training. From these data, we conclude that clicker box PRT can be successfully learned by a majority of squirrel monkeys within 2 months and that trained subjects can be managed more efficiently. These findings warrant future studies to determine whether PRT may be useful in reducing stress-induced experimental confounds in studies involving squirrel monkeys.

  14. A more consistent intraluminal rhesus monkey model of ischemic stroke

    Institute of Scientific and Technical Information of China (English)

    Bo Zhao; Fauzia Akbary; Shengli Li; Jing Lu; Feng Ling; Xunming Ji; Guowei Shang; Jian Chen; Xiaokun Geng; Xin Ye; Guoxun Xu; Ju Wang; Jiasheng Zheng; Hongjun Li

    2014-01-01

    Endovascular surgery is advantageous in experimentally induced ischemic stroke because it causes fewer cranial traumatic lesions than invasive surgery and can closely mimic the pathophysiol-ogy in stroke patients. However, the outcomes are highly variable, which limits the accuracy of evaluations of ischemic stroke studies. In this study, eight healthy adult rhesus monkeys were randomized into two groups with four monkeys in each group:middle cerebral artery occlusion at origin segment (M1) and middle cerebral artery occlusion at M2 segment. The blood lfow in the middle cerebral artery was blocked completely for 2 hours using the endovascular microcoil placement technique (1 mm × 10 cm) (undetachable), to establish a model of cerebral ischemia. The microcoil was withdrawn and the middle cerebral artery blood lfow was restored. A revers-ible middle cerebral artery occlusion model was identiifed by hematoxylin-eosin staining, digital subtraction angiography, magnetic resonance angiography, magnetic resonance imaging, and neurological evaluation. The results showed that the middle cerebral artery occlusion model was successfully established in eight adult healthy rhesus monkeys, and ischemic lesions were apparent in the brain tissue of rhesus monkeys at 24 hours after occlusion. The rhesus monkeys had symp-toms of neurological deifcits. Compared with the M1 occlusion group, the M2 occlusion group had lower infarction volume and higher neurological scores. These experimental ifndings indicate that reversible middle cerebral artery occlusion can be produced with the endovascular microcoil technique in rhesus monkeys. The M2 occluded model had less infarction and less neurological impairment, which offers the potential for application in the ifeld of brain injury research.

  15. Atlas-guided segmentation of vervet monkey brain MRI.

    Science.gov (United States)

    Fedorov, Andriy; Li, Xiaoxing; Pohl, Kilian M; Bouix, Sylvain; Styner, Martin; Addicott, Merideth; Wyatt, Chris; Daunais, James B; Wells, William M; Kikinis, Ron

    2011-01-01

    The vervet monkey is an important nonhuman primate model that allows the study of isolated environmental factors in a controlled environment. Analysis of monkey MRI often suffers from lower quality images compared with human MRI because clinical equipment is typically used to image the smaller monkey brain and higher spatial resolution is required. This, together with the anatomical differences of the monkey brains, complicates the use of neuroimage analysis pipelines tuned for human MRI analysis. In this paper we developed an open source image analysis framework based on the tools available within the 3D Slicer software to support a biological study that investigates the effect of chronic ethanol exposure on brain morphometry in a longitudinally followed population of male vervets. We first developed a computerized atlas of vervet monkey brain MRI, which was used to encode the typical appearance of the individual brain structures in MRI and their spatial distribution. The atlas was then used as a spatial prior during automatic segmentation to process two longitudinal scans per subject. Our evaluation confirms the consistency and reliability of the automatic segmentation. The comparison of atlas construction strategies reveals that the use of a population-specific atlas leads to improved accuracy of the segmentation for subcortical brain structures. The contribution of this work is twofold. First, we describe an image processing workflow specifically tuned towards the analysis of vervet MRI that consists solely of the open source software tools. Second, we develop a digital atlas of vervet monkey brain MRIs to enable similar studies that rely on the vervet model.

  16. A more consistent intraluminal rhesus monkey model of ischemic stroke.

    Science.gov (United States)

    Zhao, Bo; Shang, Guowei; Chen, Jian; Geng, Xiaokun; Ye, Xin; Xu, Guoxun; Wang, Ju; Zheng, Jiasheng; Li, Hongjun; Akbary, Fauzia; Li, Shengli; Lu, Jing; Ling, Feng; Ji, Xunming

    2014-12-01

    Endovascular surgery is advantageous in experimentally induced ischemic stroke because it causes fewer cranial traumatic lesions than invasive surgery and can closely mimic the pathophysiology in stroke patients. However, the outcomes are highly variable, which limits the accuracy of evaluations of ischemic stroke studies. In this study, eight healthy adult rhesus monkeys were randomized into two groups with four monkeys in each group: middle cerebral artery occlusion at origin segment (M1) and middle cerebral artery occlusion at M2 segment. The blood flow in the middle cerebral artery was blocked completely for 2 hours using the endovascular microcoil placement technique (1 mm × 10 cm) (undetachable), to establish a model of cerebral ischemia. The microcoil was withdrawn and the middle cerebral artery blood flow was restored. A reversible middle cerebral artery occlusion model was identified by hematoxylin-eosin staining, digital subtraction angiography, magnetic resonance angiography, magnetic resonance imaging, and neurological evaluation. The results showed that the middle cerebral artery occlusion model was successfully established in eight adult healthy rhesus monkeys, and ischemic lesions were apparent in the brain tissue of rhesus monkeys at 24 hours after occlusion. The rhesus monkeys had symptoms of neurological deficits. Compared with the M1 occlusion group, the M2 occlusion group had lower infarction volume and higher neurological scores. These experimental findings indicate that reversible middle cerebral artery occlusion can be produced with the endovascular microcoil technique in rhesus monkeys. The M2 occluded model had less infarction and less neurological impairment, which offers the potential for application in the field of brain injury research.

  17. Characteristics of histologically confirmed endometriosis in cynomolgus monkeys

    Science.gov (United States)

    Nishimoto-Kakiuchi, A.; Netsu, S.; Matsuo, S.; Hayashi, S.; Ito, T.; Okabayashi, S.; Yasmin, L.; Yuzawa, K.; Kondoh, O.; Kato, A.; Suzuki, M.; Konno, R.; Sankai, T.

    2016-01-01

    STUDY QUESTION What are the characteristics of spontaneous endometriosis in cynomolgus monkeys? SUMMARY ANSWER Spontaneous endometriosis in cynomolgus monkeys exhibited similar characteristics to the human disease. WHAT IS KNOWN ALREADY One previous report described the prevalence and the basic histopathology of spontaneous endometriosis in cynomolgus monkeys. STUDY DESIGN, SIZE, DURATION Endometriotic lesions that had been histologically confirmed in 8 female cynomolgus monkeys between 5 and 21 years old were subjected to study. PARTICIPANTS/MATERIALS, SETTING, METHODS The monkeys died of, or were sacrificed because of, sickness consequent on endometriosis. Specimens were evaluated histopathologically with haematoxylin and eosin staining, iron staining and immunohistochemistry (CD10, CD31, α-SMA and PGP9.5), and by observing them under a microscope. MAIN RESULTS AND THE ROLE OF CHANCE Endometriotic and stromal cells (CD10-positive) with haemorrhage and inflammation were observed. Smooth muscle metaplasia and nerve fibres were also noted in the endometriotic lesions. Endometriotic lesions in lymph nodes were incidentally found. LIMITATIONS AND REASONS FOR CAUTION Since laparoscopic analysis for monitoring the disease state was not set as a parameter of the current study, time course changes (progression) of the disease were not assessed. WIDER IMPLICATIONS OF THE FINDINGS Further investigation of spontaneous endometriosis in cynomolgus monkeys may contribute to better understanding of the disease pathobiology. STUDY FUNDING/COMPETING INTEREST(S) No external funds were used for this study. A.N.K., S.M., S.H., T.I., O.K., A.K. and M.S. are full-time employees of Chugai Pharmaceutical Co., Ltd. R.K. received lecture fees from Chugai Pharmaceutical Co., Ltd., unrelated to the submitted work. S.N., S. O., L.Y., K.Y. and T.S. have nothing to declare. TRIAL REGISTRATION NUMBER N/A. PMID:27591226

  18. Comparative Overview of Visuospatial Working Memory in Monkeys and Rats.

    Science.gov (United States)

    Tsutsui, Ken-Ichiro; Oyama, Kei; Nakamura, Shinya; Iijima, Toshio

    2016-01-01

    Neural mechanisms of working memory, particularly its visuospatial aspect, have long been studied in non-human primates. On the other hand, rodents are becoming more important in systems neuroscience, as many of the innovative research methods have become available for them. There has been a question on whether primates and rodents have similar neural backgrounds for working memory. In this article, we carried out a comparative overview of the neural mechanisms of visuospatial working memory in monkeys and rats. In monkeys, a number of lesion studies indicate that the brain region most responsible for visuospatial working memory is the ventral dorsolateral prefrontal cortex (vDLPFC), as the performance in the standard tests for visuospatial working memory, such as delayed response and delayed alternation tasks, are impaired by lesions in this region. Single-unit studies revealed a characteristic firing pattern in neurons in this area, a sustained delay activity. Further studies indicated that the information maintained in the working memory, such as cue location and response direction in a delayed response, is coded in the sustained delay activity. In rats, an area comparable to the monkey vDLPFC was found to be the dorsal part of the medial prefrontal cortex (mPFC), as the delayed alternation in a T-maze is impaired by its lesion. Recently, the sustained delay activity similar to that found in monkeys has been found in the dorsal mPFC of rats performing the delayed response task. Furthermore, anatomical studies indicate that the vDLPFC in monkeys and the dorsal mPFC in rats have much in common, such as that they are both the major targets of parieto-frontal projections. Thus lines of evidence indicate that in both monkeys and rodents, the PFC plays a critical role in working memory.

  19. Atlas-Guided Segmentation of Vervet Monkey Brain MRI

    Science.gov (United States)

    Fedorov, Andriy; Li, Xiaoxing; Pohl, Kilian M; Bouix, Sylvain; Styner, Martin; Addicott, Merideth; Wyatt, Chris; Daunais, James B; Wells, William M; Kikinis, Ron

    2011-01-01

    The vervet monkey is an important nonhuman primate model that allows the study of isolated environmental factors in a controlled environment. Analysis of monkey MRI often suffers from lower quality images compared with human MRI because clinical equipment is typically used to image the smaller monkey brain and higher spatial resolution is required. This, together with the anatomical differences of the monkey brains, complicates the use of neuroimage analysis pipelines tuned for human MRI analysis. In this paper we developed an open source image analysis framework based on the tools available within the 3D Slicer software to support a biological study that investigates the effect of chronic ethanol exposure on brain morphometry in a longitudinally followed population of male vervets. We first developed a computerized atlas of vervet monkey brain MRI, which was used to encode the typical appearance of the individual brain structures in MRI and their spatial distribution. The atlas was then used as a spatial prior during automatic segmentation to process two longitudinal scans per subject. Our evaluation confirms the consistency and reliability of the automatic segmentation. The comparison of atlas construction strategies reveals that the use of a population-specific atlas leads to improved accuracy of the segmentation for subcortical brain structures. The contribution of this work is twofold. First, we describe an image processing workflow specifically tuned towards the analysis of vervet MRI that consists solely of the open source software tools. Second, we develop a digital atlas of vervet monkey brain MRIs to enable similar studies that rely on the vervet model. PMID:22253661

  20. Stereopsis and disparity vergence in monkeys with subnormal binocular vision.

    Science.gov (United States)

    Harwerth, R S; Smith, E L; Crawford, M L; von Noorden, G K

    1997-02-01

    The surgical treatment for strabismus in infants generally results in microtropia or subnormal binocular vision. Although the clinical characteristics of these conditions are well established, there are important questions about the mechanisms of binocular vision in these patients that can best be investigated in an appropriate animal model. In the present psychophysical investigations, spatial frequency response functions for disparity-induced fusional vergence and for local stereopsis were studied in macaque monkeys, who demonstrated many of the major visual characteristics of patients whose eyes were surgically aligned during infancy. In six rhesus monkeys, unilateral esotropia was surgically induced at various ages (30-184 days of age). However, over the next 12 months, all of the monkeys recovered normal eye alignment. Behavioral measurements at 4-6 years of age showed that the monkeys' prism-induced fusional vergence responses were indistinguishable from those of control monkeys or humans with normal binocular vision. Investigations of stereo-depth discrimination demonstrated that each of the experimental monkeys also had stereoscopic vision, but their stereoacuities varied from being essentially normal to severely stereo-deficient. The degree of stereo-deficiency was not related to the age at which surgical esotropia was induced, or to the presence or absence of amblyopia, and was not dependent on the spatial frequency of the test stimulus. Altogether, these experiments demonstrate that a temporary, early esotropia can affect the binocular disparity responses of motor and sensory components of binocular vision differently, probably because of different sensitive periods of development for the two components.

  1. Functional analysis of aldehyde oxidase using expressed chimeric enzyme between monkey and rat.

    Science.gov (United States)

    Itoh, Kunio; Asakawa, Tasuku; Hoshino, Kouichi; Adachi, Mayuko; Fukiya, Kensuke; Watanabe, Nobuaki; Tanaka, Yorihisa

    2009-01-01

    Aldehyde oxidase (AO) is a homodimer with a subunit molecular mass of approximately 150 kDa. Each subunit consists of about 20 kDa 2Fe-2S cluster domain storing reducing equivalents, about 40 kDa flavine adenine dinucleotide (FAD) domain and about 85 kDa molybdenum cofactor (MoCo) domain containing a substrate binding site. In order to clarify the properties of each domain, especially substrate binding domain, chimeric cDNAs were constructed by mutual exchange of 2Fe-2S/FAD and MoCo domains between monkey and rat. Chimeric monkey/rat AO was referred to one with monkey type 2Fe-2S/FAD domains and a rat type MoCo domain. Rat/monkey AO was vice versa. AO-catalyzed 2-oxidation activities of (S)-RS-8359 were measured using the expressed enzyme in Escherichia coli. Substrate inhibition was seen in rat AO and chimeric monkey/rat AO, but not in monkey AO and chimeric rat/monkey AO, suggesting that the phenomenon might be dependent on the natures of MoCo domain of rat. A biphasic Eadie-Hofstee profile was observed in monkey AO and chimeric rat/monkey AO, but not rat AO and chimeric monkey/rat AO, indicating that the biphasic profile might be related to the properties of MoCo domain of monkey. Two-fold greater V(max) values were observed in monkey AO than in chimeric rat/monkey AO, and in chimeric monkey/rat AO than in rat AO, suggesting that monkey has the more effective electron transfer system than rat. Thus, the use of chimeric enzymes revealed that 2Fe-2S/FAD and MoCo domains affect the velocity and the quantitative profiles of AO-catalyzed (S)-RS-8359 2-oxidation, respectively.

  2. Infection of capuchin monkeys (Cebus albifrons) with Herpesvirus saimiri.

    Science.gov (United States)

    Rabin, H; Pearson, G R; Wallen, W C; Neubauer, R H; Cicmanec, J L; Orr, T W

    1975-03-01

    Herpesvirus saimiri (HVS) induced persistent, clinically inapparent infections of long-term duration in capuchin monkeys (Cebus albifrons). The infections were characterized by development of antibody to HVS-associated antigens and recovery of low levels of virus-genome-carrying lymphocytes in the peripheral blood. Peripheral lymphocyte counts remained in low-normal to normal ranges and no physical signs of lymphoma were evident. Prednisolone treatment caused immunosuppression in one monkey; this was accompanied by a progressive loss of humoral antibody to HVS-associated antigens, but neoplastic disease did not develop.

  3. Electroretinogram measurements of cone spectral sensitivity in dichromatic monkeys.

    Science.gov (United States)

    Neitz, J; Jacobs, G H

    1984-12-01

    The corneal electroretinogram (ERG) was used to investigate the spectral sensitivities of cones in 12 dichromatic squirrel monkeys (Saimiri sciureus) whose color-vision capacities were established in behavioral tests. Three different varieties of dichromacy were represented among these animals. A flicker-photometric procedure was used in which the ERG response to a rapidly flickering monochromatic test light was compared with the response elicited by a similarly flickering reference light. The spectral-sensitivity functions obtained by the use of this technique are similar to previous estimates of cone spectral sensitivity in dichromatic squirrel monkeys derived from direct microspectrophotometric measurements.

  4. "Zeroing" in on mathematics in the monkey brain.

    Science.gov (United States)

    Beran, Michael J

    2016-03-01

    A new study documented that monkeys showed selective neuronal responding to the concept of zero during a numerical task, and that there were two distinct classes of neurons that coded the absence of stimuli either through a discrete activation pattern (zero or not zero) or a continuous one for which zero was integrated with other numerosities in the relative rate of activity. These data indicate that monkeys, like humans, have a concept of zero that is part of their analog number line but that also may have unique properties compared to other numerosities.

  5. Terminal leptospirosis in a woolly monkey (Lagothrix lagothricha in Colombia

    Directory of Open Access Journals (Sweden)

    Viviana González A.

    2015-01-01

    Full Text Available A captive woolly monkey (Lagothrix lagothricha displayed severe lethargy, vomiting and diarrhea. Laboratory tests revealed anemia, leukopenia, hypoproteinemia, severe azotemia and positive Leptospira IgM ELISA. The monkey was humanely euthanized and the necropsy revealed a multifocal tubulointerstitial glomerulonephritis; in addition to splenic lymphoid depletion, and interstitial pneumonia, all of which are compatible with leptospirosis. Rodent control and biosecurity measures should be done at all zoological collections in order to prevent transmission to facility personnel and to threatened mammals maintained in captivity.

  6. Bat Predation by Cercopithecus Monkeys: Implications for Zoonotic Disease Transmission.

    Science.gov (United States)

    Tapanes, Elizabeth; Detwiler, Kate M; Cords, Marina

    2016-06-01

    The relationship between bats and primates, which may contribute to zoonotic disease transmission, is poorly documented. We provide the first behavioral accounts of predation on bats by Cercopithecus monkeys, both of which are known to harbor zoonotic disease. We witnessed 13 bat predation events over 6.5 years in two forests in Kenya and Tanzania. Monkeys sometimes had prolonged contact with the bat carcass, consuming it entirely. All predation events occurred in forest-edge or plantation habitat. Predator-prey relations between bats and primates are little considered by disease ecologists, but may contribute to transmission of zoonotic disease, including Ebolavirus.

  7. Rhesus monkey brain imaging through intact skull with thermoacoustic tomography

    OpenAIRE

    Xu, Yuan; Wang, Lihong V.

    2006-01-01

    Two-dimensional microwave-induced thermoacoustic tomography (TAT) is applied to imaging the Rhesus monkey brain through the intact skull. To reduce the wavefront distortion caused by the skull, only the low-frequency components of the thermoacoustic signals (< 1 MHz) are used to reconstruct the TAT images. The methods of signal processing and image reconstruction are validated by imaging a lamb kidney. The resolution of the system is found to be 4 mm when we image a 1-month-old monkey head co...

  8. Informative Cues Facilitate Saccadic Localization in Blindsight Monkeys.

    Science.gov (United States)

    Yoshida, Masatoshi; Hafed, Ziad M; Isa, Tadashi

    2017-01-01

    Patients with damage to the primary visual cortex (V1) demonstrate residual visual performance during laboratory tasks despite denying having a conscious percept. The mechanisms behind such performance, often called blindsight, are not fully understood, but the use of surgically-induced unilateral V1 lesions in macaque monkeys provides a useful animal model for exploring such mechanisms. For example, V1-lesioned monkeys localize stimuli in a forced-choice condition while at the same time failing to report awareness of identical stimuli in a yes-no detection condition, similar to human patients. Moreover, residual cognitive processes, including saliency-guided eye movements, bottom-up attention with peripheral non-informative cues, and spatial short-term memory, have all been demonstrated in these animals. Here we examined whether post-lesion residual visuomotor processing can be modulated by top-down task knowledge. We tested two V1-lesioned monkeys with a visually guided saccade task in which we provided an informative foveal pre-cue about upcoming target location. Our monkeys fixated while we presented a leftward or rightward arrow (serving as a pre-cue) superimposed on the fixation point (FP). After various cue-target onset asynchronies (CTOAs), a saccadic target (of variable contrast across trials) was presented either in the affected (contra-lesional) or seeing (ipsi-lesional) hemifield. Critically, target location was in the same hemifield that the arrow pre-cue pointed towards in 80% of the trials (valid-cue trials), making the cue highly useful for task performance. In both monkeys, correct saccade reaction times were shorter during valid than invalid trials. Moreover, in one monkey, the ratio of correct saccades towards the affected hemifield was higher during valid than invalid trials. We replicated both reaction time and correct ratio effects in the same monkey using a symbolic color cue. These results suggest that V1-lesion monkeys can use informative

  9. Oral focal epithelial hyperplasia in a howler monkey (Alouatta fusca).

    Science.gov (United States)

    Sá, L R; DiLoreto, C; Leite, M C; Wakamatsu, A; Santos, R T; Catão-Dias, J L

    2000-09-01

    Oral focal epithelial hyperplasia is a rare and seldom reported disease in animals and humans induced by a papillomavirus. The present report is the first description of this disease in a Neotropical primate, a howler monkey (Alouatta fusca). The diagnosis was based on gross and microscopic findings. The generic papillomavirus antigen was identified by immunohistochemistry and was found not to be related to any human papillomavirus DNA tested by in situ hybridization. This virus is probably a specific papillomavirus of the howler monkey (HMPV).

  10. A hybrid monkey search algorithm for clustering analysis.

    Science.gov (United States)

    Chen, Xin; Zhou, Yongquan; Luo, Qifang

    2014-01-01

    Clustering is a popular data analysis and data mining technique. The k-means clustering algorithm is one of the most commonly used methods. However, it highly depends on the initial solution and is easy to fall into local optimum solution. In view of the disadvantages of the k-means method, this paper proposed a hybrid monkey algorithm based on search operator of artificial bee colony algorithm for clustering analysis and experiment on synthetic and real life datasets to show that the algorithm has a good performance than that of the basic monkey algorithm for clustering analysis.

  11. A Hybrid Monkey Search Algorithm for Clustering Analysis

    Directory of Open Access Journals (Sweden)

    Xin Chen

    2014-01-01

    Full Text Available Clustering is a popular data analysis and data mining technique. The k-means clustering algorithm is one of the most commonly used methods. However, it highly depends on the initial solution and is easy to fall into local optimum solution. In view of the disadvantages of the k-means method, this paper proposed a hybrid monkey algorithm based on search operator of artificial bee colony algorithm for clustering analysis and experiment on synthetic and real life datasets to show that the algorithm has a good performance than that of the basic monkey algorithm for clustering analysis.

  12. Informative Cues Facilitate Saccadic Localization in Blindsight Monkeys

    Science.gov (United States)

    Yoshida, Masatoshi; Hafed, Ziad M.; Isa, Tadashi

    2017-01-01

    Patients with damage to the primary visual cortex (V1) demonstrate residual visual performance during laboratory tasks despite denying having a conscious percept. The mechanisms behind such performance, often called blindsight, are not fully understood, but the use of surgically-induced unilateral V1 lesions in macaque monkeys provides a useful animal model for exploring such mechanisms. For example, V1-lesioned monkeys localize stimuli in a forced-choice condition while at the same time failing to report awareness of identical stimuli in a yes-no detection condition, similar to human patients. Moreover, residual cognitive processes, including saliency-guided eye movements, bottom-up attention with peripheral non-informative cues, and spatial short-term memory, have all been demonstrated in these animals. Here we examined whether post-lesion residual visuomotor processing can be modulated by top-down task knowledge. We tested two V1-lesioned monkeys with a visually guided saccade task in which we provided an informative foveal pre-cue about upcoming target location. Our monkeys fixated while we presented a leftward or rightward arrow (serving as a pre-cue) superimposed on the fixation point (FP). After various cue-target onset asynchronies (CTOAs), a saccadic target (of variable contrast across trials) was presented either in the affected (contra-lesional) or seeing (ipsi-lesional) hemifield. Critically, target location was in the same hemifield that the arrow pre-cue pointed towards in 80% of the trials (valid-cue trials), making the cue highly useful for task performance. In both monkeys, correct saccade reaction times were shorter during valid than invalid trials. Moreover, in one monkey, the ratio of correct saccades towards the affected hemifield was higher during valid than invalid trials. We replicated both reaction time and correct ratio effects in the same monkey using a symbolic color cue. These results suggest that V1-lesion monkeys can use informative

  13. Emergence of Cryptosporidium hominis Monkey Genotype II and Novel Subtype Family Ik in the Squirrel Monkey (Saimiri sciureus) in China.

    Science.gov (United States)

    Liu, Xuehan; Xie, Na; Li, Wei; Zhou, Ziyao; Zhong, Zhijun; Shen, Liuhong; Cao, Suizhong; Yu, Xingming; Hu, Yanchuan; Chen, Weigang; Peng, Gangneng

    2015-01-01

    A single Cryptosporidium isolate from a squirrel monkey with no clinical symptoms was obtained from a zoo in Ya'an city, China, and was genotyped by PCR amplification and DNA sequencing of the small-subunit ribosomal RNA (SSU rRNA), 70-kDa heat shock protein (HSP70), Cryptosporidium oocyst wall protein, and actin genes. This multilocus genetic characterization determined that the isolate was Cryptosporidium hominis, but carried 2, 10, and 6 nucleotide differences in the SSU rRNA, HSP70, and actin loci, respectively, which is comparable to the variations at these loci between C. hominis and the previously reported monkey genotype (2, 3, and 3 nucleotide differences). Phylogenetic studies, based on neighbor-joining and maximum likelihood methods, showed that the isolate identified in the current study had a distinctly discordant taxonomic status, distinct from known C. hominis and also from the monkey genotype, with respect to the three loci. Restriction fragment length polymorphisms of the SSU rRNA gene obtained from this study were similar to those of known C. hominis but clearly differentiated from the monkey genotype. Further subtyping was performed by sequence analysis of the gene encoding the 60-kDa glycoprotein (gp60). Maximum homology of only 88.3% to C. hominis subtype IdA10G4 was observed for the current isolate, and phylogenetic analysis demonstrated that this particular isolate belonged to a novel C. hominis subtype family, IkA7G4. This study is the first to report C. hominis infection in the squirrel monkey and, based on the observed genetic characteristics, confirms a new C. hominis genotype, monkey genotype II. Thus, these results provide novel insights into genotypic variation in C. hominis.

  14. Cynomolgus monkey induced pluripotent stem cells established by using exogenous genes derived from the same monkey species.

    Science.gov (United States)

    Shimozawa, Nobuhiro; Ono, Ryoichi; Shimada, Manami; Shibata, Hiroaki; Takahashi, Ichiro; Inada, Hiroyasu; Takada, Tatsuyuki; Nosaka, Tetsuya; Yasutomi, Yasuhiro

    2013-01-01

    Induced pluripotent stem (iPS) cells established by introduction of the transgenes POU5F1 (also known as Oct3/4), SOX2, KLF4 and c-MYC have competence similar to embryonic stem (ES) cells. iPS cells generated from cynomolgus monkey somatic cells by using genes taken from the same species would be a particularly important resource, since various biomedical investigations, including studies on the safety and efficacy of drugs, medical technology development, and research resource development, have been performed using cynomolgus monkeys. In addition, the use of xenogeneic genes would cause complicating matters such as immune responses when they are expressed. In this study, therefore, we established iPS cells by infecting cells from the fetal liver and newborn skin with amphotropic retroviral vectors containing cDNAs for the cynomolgus monkey genes of POU5F1, SOX2, KLF4 and c-MYC. Flat colonies consisting of cells with large nuclei, similar to those in other primate ES cell lines, appeared and were stably maintained. These cell lines had normal chromosome numbers, expressed pluripotency markers and formed teratomas. We thus generated cynomolgus monkey iPS cell lines without the introduction of ecotropic retroviral receptors or other additional transgenes by using the four allogeneic transgenes. This may enable detailed analysis of the mechanisms underlying the reprogramming. In conclusion, we showed that iPS cells could be derived from cynomolgus monkey somatic cells. To the best of our knowledge, this is the first report on iPS cell lines established from cynomolgus monkey somatic cells by using genes from the same species.

  15. Interactions of motivation and reinforcement during the performance of a simple instrumental reflex by a monkey.

    Science.gov (United States)

    Norkin, I M; Shul'govskii, V V

    1992-01-01

    The dynamics of the performance of an instrumental task by Macaca rhesus monkeys was investigated in an automated experiment. Three monkeys were trained to complete a movement with a lever in response to a light stimulus. It was demonstrated that the performance of the instrumental reflex by the monkeys is comprised of the alternation of blocks of more or less continuous realizations and pauses between them. The relationship of the intensity of the work of the monkeys to the time from the beginning of the experiment was studied, and a comparison was made of the magnitude of the intensity for the three monkeys. The average intensity of the work of the monkeys within the blocks of continuous realizations is a constant and individual value. The influence of the degree of deprivation and of the delivery of out-of-turn reinforcement on the work of the monkeys was also investigated.

  16. A Deficit in Face-Voice Integration in Developing Vervet Monkeys Exposed to Ethanol during Gestation

    DEFF Research Database (Denmark)

    Zangenehpour, Shahin; Javadi, Pasha; Ervin, Frank R

    2014-01-01

    monkey model of fetal alcohol exposure (FAE) provides an unparalleled opportunity to study the neurobehavioral outcomes of prenatal ethanol exposure in a controlled experimental setting. Recent work has revealed a significant reduction of the neuronal population in the frontal lobes of these monkeys. We...... used an intersensory matching procedure to investigate audiovisual perception of socially relevant stimuli in young FAE vervet monkeys. Here we show a domain-specific deficit in audiovisual integration of socially relevant stimuli. When FAE monkeys were shown a pair of side-by-side videos of a monkey....... However, a group of normally developing monkeys exhibited a significant preference for the non-matching video. This inability to integrate and thereby discriminate audiovisual stimuli was confined to the integration of faces and voices as revealed by the monkeys' ability to match a dynamic face...

  17. Monkey hybrid stem cells develop cellular features of Huntington's disease

    Directory of Open Access Journals (Sweden)

    Lorthongpanich Chanchao

    2010-02-01

    Full Text Available Abstract Background Pluripotent stem cells that are capable of differentiating into different cell types and develop robust hallmark cellular features are useful tools for clarifying the impact of developmental events on neurodegenerative diseases such as Huntington's disease. Additionally, a Huntington's cell model that develops robust pathological features of Huntington's disease would be valuable for drug discovery research. Results To test this hypothesis, a pluripotent Huntington's disease monkey hybrid cell line (TrES1 was established from a tetraploid Huntington's disease monkey blastocyst generated by the fusion of transgenic Huntington's monkey skin fibroblast and a wild-type non-transgenic monkey oocyte. The TrES1 developed key Huntington's disease cellular pathological features that paralleled neural development. It expressed mutant huntingtin and stem cell markers, was capable of differentiating to neural cells, and developed teratoma in severely compromised immune deficient (SCID mice. Interestingly, the expression of mutant htt, the accumulation of oligomeric mutant htt and the formation of intranuclear inclusions paralleled neural development in vitro , and even mutant htt was ubiquitously expressed. This suggests the development of Huntington's disease cellular features is influenced by neural developmental events. Conclusions Huntington's disease cellular features is influenced by neural developmental events. These results are the first to demonstrate that a pluripotent stem cell line is able to mimic Huntington's disease progression that parallels neural development, which could be a useful cell model for investigating the developmental impact on Huntington's disease pathogenesis.

  18. Effect of physical restraint on glucose tolerance in cynomolgus monkeys.

    Science.gov (United States)

    Shirasaki, Yasufumi; Yoshioka, Naoya; Kanazawa, Kanpei; Maekawa, Tsuyoshi; Horikawa, Tadahiro; Hayashi, Toshiaki

    2013-06-01

    Physiologic stress has been demonstrated to impair glucose tolerance. Glucose tolerance tests were performed using six cynomolgus monkeys. Chair-restrained subjects elicited higher elevations of plasma glucose and cortisol compared with squeezing device-restrained subjects. The responses to a glucose challenge are altered by different restraint procedures.

  19. New insights into samango monkey speciation in South Africa.

    Science.gov (United States)

    Dalton, Desiré L; Linden, Birthe; Wimberger, Kirsten; Nupen, Lisa Jane; Tordiffe, Adrian S W; Taylor, Peter John; Madisha, M Thabang; Kotze, Antoinette

    2015-01-01

    The samango monkey is South Africa's only exclusively forest dwelling primate and represents the southernmost extent of the range of arboreal guenons in Africa. The main threats to South Africa's forests and thus to the samango are linked to increasing land-use pressure and increasing demands for forest resources, resulting in deforestation, degradation and further fragmentation of irreplaceable habitats. The species belongs to the highly polytypic Cercopithecus nictitans group which is sometimes divided into two species C. mitis and C. albogularis. The number of subspecies of C. albogularis is also under debate and is based only on differences in pelage colouration and thus far no genetic research has been undertaken on South African samango monkey populations. In this study we aim to further clarify the number of samango monkey subspecies, as well as their respective distributions in South Africa by combining molecular, morphometric and pelage data. Overall, our study provides the most comprehensive view to date into the taxonomic description of samango monkeys in South Africa. Our data supports the identification of three distinct genetic entities namely; C. a. labiatus, C. a. erythrarchus and C. a. schwarzi and argues for separate conservation management of the distinct genetic entities defined by this study.

  20. Mononeuropathy multiplex in rhesus monkeys with chronic Lyme disease.

    Science.gov (United States)

    England, J D; Bohm, R P; Roberts, E D; Philipp, M T

    1997-03-01

    Peripheral neuropathy is a recognized but poorly understood manifestation of Lyme disease. We performed serial electrophysiological studies on 8 rhesus monkeys chronically infected with the JD1 strain of Borrelia burgdorferi and compared the results with those of similar studies on 10 uninfected control monkeys. Four infected and 2 uninfected animals underwent sural nerve biopsy. Five of the infected and 1 of the uninfected animals also had postmortem neuropathological examinations. Altogether, 5 of the infected monkeys demonstrated primarily axonal-loss-variety multifocal neuropathies. Only one nerve lesion exhibited findings compatible with demyelination. Pathologically, peripheral nerve specimens showed multifocal axonal degeneration and regeneration and occasional perivascular inflammatory cellular infiltrates without vessel wall necrosis. Free spirochetal structures were not seen, but several macrophages exhibited positive immunostaining with a highly specific anti-B. burgdorferi, 7.5-kd lipoprotein monoclonal antibody. In the infected animals, serial analysis of serum antibodies to B. burgdorferi showed increasing numbers of IgG specificities and new IgM specificities, suggesting persistent infection. Thus, peripheral neuropathy in the form of a mononeuropathy multiplex develops frequently in rhesus monkeys chronically infected with B. burgdorferi. The pathogenesis of these nerve lesions is not yet known, but our studies suggest an immune-mediated process perhaps driven by persistent infection with B. burgdorferi.

  1. GLP-1 receptor localization in monkey and human tissue

    DEFF Research Database (Denmark)

    Pyke, Charles; Heller, R Scott; Kirk, Rikke Kaae

    2014-01-01

    and increase heart rate. Using a new monoclonal antibody for immunohistochemistry, we detected GLP-1 receptor (GLP-1R) in important target organs in humans and monkeys. In the pancreas, GLP-1R was predominantly localized in β-cells with a markedly weaker expression in acinar cells. Pancreatic ductal epithelial...

  2. Call Combinations in Monkeys: Compositional or Idiomatic Expressions?

    Science.gov (United States)

    Arnold, Kate; Zuberbuhler, Klaus

    2012-01-01

    Syntax is widely considered the feature that most decisively sets human language apart from other natural communication systems. Animal vocalisations are generally considered to be holistic with few examples of utterances meaning something other than the sum of their parts. Previously, we have shown that male putty-nosed monkeys produce call…

  3. New insights into samango monkey speciation in South Africa.

    Directory of Open Access Journals (Sweden)

    Desiré L Dalton

    Full Text Available The samango monkey is South Africa's only exclusively forest dwelling primate and represents the southernmost extent of the range of arboreal guenons in Africa. The main threats to South Africa's forests and thus to the samango are linked to increasing land-use pressure and increasing demands for forest resources, resulting in deforestation, degradation and further fragmentation of irreplaceable habitats. The species belongs to the highly polytypic Cercopithecus nictitans group which is sometimes divided into two species C. mitis and C. albogularis. The number of subspecies of C. albogularis is also under debate and is based only on differences in pelage colouration and thus far no genetic research has been undertaken on South African samango monkey populations. In this study we aim to further clarify the number of samango monkey subspecies, as well as their respective distributions in South Africa by combining molecular, morphometric and pelage data. Overall, our study provides the most comprehensive view to date into the taxonomic description of samango monkeys in South Africa. Our data supports the identification of three distinct genetic entities namely; C. a. labiatus, C. a. erythrarchus and C. a. schwarzi and argues for separate conservation management of the distinct genetic entities defined by this study.

  4. Prospective and Retrospective Metacognitive Abilities in Rhesus Monkeys

    Directory of Open Access Journals (Sweden)

    Jennifer Ding

    2007-06-01

    Full Text Available Metacognition refers to a knowledge of one’s own cognitive abilities and one’s aptitude to alter these abilities if necessary. Previous research from our lab shows that monkeys exhibit metacognitive abilities by accurately judging their own performance on perceptual and serial working memory tasks. The present study includes two phases during which a monkey makes retrospective and prospective judgments of confidence. In the retrospective phase of this experiment, the subject completes a recall task, and then judges his performance on the test phase by choosing from high and low-risk confidence choices. In the prospective task, the monkey makes his confidence judgment before the test, instead judging how well he learned during the study phase. An analysis of results indicates that monkeys can immediately transfer the ability to make metacognitive judgments from the serial working memory tasks in previous experiments to retrospective and prospective recall tasks in the present study. These findings underline the similarity between the non-human primate and human abilities to make confidence judgments. Further, they are the first evidence to date of a non-human primate making a prospective judgment of future performance, suggesting that the ability to use a metacognitive state to control one’s actions is not uniquely human.

  5. Phospholipid organization in monkey erythrocytes upon Plasmodium knowlesi infection

    NARCIS (Netherlands)

    Schaft, P.H. van der; Beaumelle, B.; Vial, H.; Roelofsen, B.; Kamp, J.A.F. op den; Deenen, L.L.M. van

    1987-01-01

    The phospholipid organization in monkey erythrocytes upon Plasmodium knowlesi infection has been studied. Parasitized and nonparasitized erythrocytes from malaria-infected blood were separated and pure erythrocyte membranes from parasitized cells were isolated using Affi-Gel beads. In this way, the

  6. Serial memory strategies in macaque monkeys: behavioral and theoretical aspects.

    Science.gov (United States)

    Orlov, Tanya; Yakovlev, Volodya; Amit, Daniel; Hochstein, Shaul; Zohary, Ehud

    2002-03-01

    Serial memory is the ability to encode and retrieve a list of items in their correct temporal order. To study nonverbal strategies involved in serial memory, we trained four macaque monkeys on a novel delayed sequence-recall task and analysed the mechanisms underlying their performance in terms of a neural network model. Thirty fractal images, divided into 10 triplets, were presented repeatedly in fixed temporal order. On each trial the monkeys viewed three sequentially presented sample images, followed by a test stimulus consisting of the same triplet of images and a distractor image (chosen randomly from the remaining 27). The task was to touch the three images in their original order, avoiding the distractor. The monkeys' most common error was touching the distractor when it had the same ordinal position (in its own triplet) as the correct image. This finding suggests that monkeys naturally categorize images by their ordinal number. Additional, secondary strategies were eventually used to avoid distractor images. These include memory of the sample images (working memory) and associations between triplet members. Further direct evidence for ordinal number categorization was provided by a transfer of learning to untrained images of the same ordinal category, following reassignment of image categories within each triplet. We propose a generic three-tier neuronal framework that can explain the components and complex set of characteristics of the observed behavior. This framework, with its intermediate level representing ordinal categories, can also explain the transfer of learning following category reassignment.

  7. Monkey Malaria in a European Traveler Returning from Malaysia

    Science.gov (United States)

    Marti, Hanspeter; Felger, Ingrid; Müller, Dania; Jokiranta, T. Sakari

    2008-01-01

    In 2007, a Finnish traveler was infected in Peninsular Malaysia with Plasmodium knowlesi, a parasite that usually causes malaria in monkeys. P. knowlesi has established itself as the fifth Plasmodium species that can cause human malaria. The disease is potentially life-threatening in humans; clinicians and laboratory personnel should become more aware of this pathogen in travelers. PMID:18760013

  8. [The principles of the therapy of glanders in monkeys].

    Science.gov (United States)

    Khomiakov, Iu N; Manzeniuk, I N; Naumov, D V; Svetoch, E A

    1998-01-01

    The effect of pathogenetic therapy in the normalization of homeostasis disturbances in monkeys has been shown under experimental conditions. Data on the possibility of using hemosorption in the treatment of severe forms of glanders are presented. The conclusion on the necessity of using complex treatment for the effective therapy of glanders in humans has been made.

  9. Multimodal convergence within the intraparietal sulcus of the macaque monkey.

    Science.gov (United States)

    Guipponi, Olivier; Wardak, Claire; Ibarrola, Danielle; Comte, Jean-Christophe; Sappey-Marinier, Dominique; Pinède, Serge; Ben Hamed, Suliann

    2013-02-27

    The parietal cortex is highly multimodal and plays a key role in the processing of objects and actions in space, both in human and nonhuman primates. Despite the accumulated knowledge in both species, we lack the following: (1) a general description of the multisensory convergence in this cortical region to situate sparser lesion and electrophysiological recording studies; and (2) a way to compare and extrapolate monkey data to human results. Here, we use functional magnetic resonance imaging (fMRI) in the monkey to provide a bridge between human and monkey studies. We focus on the intraparietal sulcus (IPS) and specifically probe its involvement in the processing of visual, tactile, and auditory moving stimuli around and toward the face. We describe three major findings: (1) the visual and tactile modalities are strongly represented and activate mostly nonoverlapping sectors within the IPS. The visual domain occupies its posterior two-thirds and the tactile modality its anterior one-third. The auditory modality is much less represented, mostly on the medial IPS bank. (2) Processing of the movement component of sensory stimuli is specific to the fundus of the IPS and coincides with the anatomical definition of monkey ventral intraparietal area (VIP). (3) A cortical sector within VIP processes movement around and toward the face independently of the sensory modality. This amodal representation of movement may be a key component in the construction of peripersonal space. Overall, our observations highlight strong homologies between macaque and human VIP organization.

  10. Monkeys Exhibit Prospective Memory in a Computerized Task

    Science.gov (United States)

    Evans, Theodore A.; Beran, Michael J.

    2012-01-01

    Prospective memory (PM) involves forming intentions, retaining those intentions, and later executing those intended responses at the appropriate time. Few studies have investigated this capacity in animals. Monkeys performed a computerized task that assessed their ability to remember to make a particular response if they observed a PM cue embedded…

  11. Play Initiating Behaviors and Responses in Red Colobus Monkeys

    Science.gov (United States)

    Worch, Eric A.

    2012-01-01

    Red colobus monkeys are playful primates, making them an important species in which to study animal play. The author examines play behaviors and responses in the species for its play initiation events, age differences in initiating frequency and initiating behavior, and the types of social play that result from specific initiating behaviors. Out…

  12. Servants, Managers and Monkeys: New Perspectives on Leadership

    Science.gov (United States)

    Buskey, Frederick C.

    2014-01-01

    In this article the author questions whether the understanding of teaching and leading is the same today as it was last year? The chances are that the concept of what it means to be a teacher and a leader has changed. After describing three leadership types: servants, managers, and monkeys, Buskey suggest several things that are needed to improve…

  13. MAC of xenon and halothane in rhesus monkeys.

    Science.gov (United States)

    Whitehurst, S L; Nemoto, E M; Yao, L; Yonas, H

    1994-10-01

    Local cerebral blood flow (LCBF) maps produced by 33% xenon-enhanced computed tomographic scanning (Xe/CT LCBF) are useful in the clinical diagnosis and management of patients with cerebrovascular disorders. However, observations in humans that 25-35% xenon (Xe) inhalation increases cerebral blood flow (CBF) have raised concerns that Xe/CT LCBF measurements may be inaccurate and that Xe inhalation may be hazardous in patients with decreased intracranial compliance. In contrast, 33% Xe does not increase CBF in rhesus monkeys. To determine whether this interspecies difference in the effect of Xe on CBF correlates with an interspecies difference in the anesthetic potency of Xe, we measured the minimum alveolar concentration (MAC) of Xe preventing movement to a tail-clamp stimulus in rhesus monkeys. Using a standard protocol for the determination of MAC in animals, we first measured the MAC of halothane (n = 5), and then used a combination of halothane and Xe to measure the MAC of Xe (n = 7). The halothane MAC was 0.99 +/- 0.12% (M +/- SD), and the Xe MAC was 98 +/- 15%. These results suggest that the MAC of Xe in rhesus monkeys is higher than the reported human Xe MAC value of 71%. Thus the absence of an effect of 33% Xe on CBF in the rhesus monkey may be related to its lower anesthetic potency.

  14. Assessing Unit-Price Related Remifentanil Choice in Rhesus Monkeys

    Science.gov (United States)

    Galuska, Chad M.; Winger, Gail; Woods, James H.; Hursh, Steven R.

    2006-01-01

    Given a commodity available at different prices, a unit-price account of choice predicts preference for the cheaper alternative. This experiment determined if rhesus monkeys preferred remifentanil (an ultra-short-acting [mu]-opioid agonist) delivered at a lower unit price over a higher-priced remifentanil alternative (Phases 1 and 3). Choice…

  15. Call Combinations in Monkeys: Compositional or Idiomatic Expressions?

    Science.gov (United States)

    Arnold, Kate; Zuberbuhler, Klaus

    2012-01-01

    Syntax is widely considered the feature that most decisively sets human language apart from other natural communication systems. Animal vocalisations are generally considered to be holistic with few examples of utterances meaning something other than the sum of their parts. Previously, we have shown that male putty-nosed monkeys produce call…

  16. Monkey malaria in a European traveler returning from Malaysia.

    Science.gov (United States)

    Kantele, Anu; Marti, Hanspeter; Felger, Ingrid; Müller, Dania; Jokiranta, T Sakari

    2008-09-01

    In 2007, a Finnish traveler was infected in Peninsular Malaysia with Plasmodium knowlesi, a parasite that usually causes malaria in monkeys. P. knowlesi has established itself as the fifth Plasmodium species that can cause human malaria. The disease is potentially life-threatening in humans; clinicians and laboratory personnel should become more aware of this pathogen in travelers.

  17. Polioencephalomalacia secondary to hypernatremia in squirrel monkeys (Saimiri sciureus).

    Science.gov (United States)

    Macri, S M Cummings; Masek-Hammerman, K; Crowell, A M; Fenn, M S; Knight, H L; Westmoreland, S V; Miller, A D

    2014-05-01

    Squirrel monkeys (Saimiri spp) are one of the most consistently used New World primates in biomedical research and are increasingly being used in neuroscience research, including models of drug abuse and addiction. Spontaneous neurologic disease in the squirrel monkey is uncommonly reported but includes various infectious diseases as well as cerebral amyloidosis. Hypernatremia is an extremely serious condition of hyperosmolarity that occurs as a result of water loss, adipsia, or excess sodium intake. Neurologic effects of hypernatremia reflect the cellular dehydration produced by the shift of water from the intracellular fluid space into the hypertonic extracellular fluid space. Severe hypernatremia may result in cerebrocortical laminar necrosis (polioencephalomalacia) in human patients as well as in a number of domestic species, including pigs, poultry, and ruminants. We report the clinical, histopathologic, and immunohistochemical findings of polioencephalomalacia in 13 squirrel monkeys. Polioencephalomalacia in these animals was associated with hypernatremia that was confirmed by serum levels of sodium greater than 180 mmol/L (reference range, 134.0-154.0 mmol/L [mEq/L]). All animals had concurrent diseases or experimental manipulation that predisposed to adipsia. Immunohistochemical investigation using antibodies to neuronal nuclei (NeuN), CNPase, Iba-1, and CD31 revealed necrosis of predominantly cerebral cortical layers 3, 4, and 5 characterized by neuronal degeneration and loss, oligodendrocytic loss, microglial proliferation, and vascular reactivity. The squirrel monkey is exquisitely sensitive to hyperosmolar metabolic disruption and it is associated with laminar cortical necrosis.

  18. The Monkey Kid: A Personal Glimpse into the Cultural Revolution

    Directory of Open Access Journals (Sweden)

    Anita M. Andrew

    2011-04-01

    Full Text Available Wang, Xiao-Yen (Director/Writer, 'The Monkey Kid '(1995. San Francisco, Calif.: Beijing–San Francisco Film Group. Also released in France by Les Films du Parodoxe under the title, 'La Mome Singe '(1997. 95 minutes. Mandarin Chinese with English subtitles.

  19. A New Marmoset P450 4F12 Enzyme Expressed in Small Intestines and Livers Efficiently Metabolizes Antihistaminic Drug Ebastine.

    Science.gov (United States)

    Uehara, Shotaro; Uno, Yasuhiro; Yuki, Yukako; Inoue, Takashi; Sasaki, Erika; Yamazaki, Hiroshi

    2016-06-01

    Common marmosets (Callithrix jacchus) are attracting attention as animal models in preclinical studies for drug development. However, cytochrome P450s (P450s), major drug-metabolizing enzymes, have not been fully identified and characterized in marmosets. In this study, based on the four novel P450 4F genes found on the marmoset genome, we successfully isolated P450 4F2, 4F3B, 4F11, and 4F12 cDNAs in marmoset livers. Deduced amino acid sequences of the four marmoset P450 4F forms exhibited high sequence identities (87%-93%) to the human and cynomolgus monkey P450 4F homologs. Marmoset P450 4F3B and 4F11 mRNAs were predominantly expressed in livers, whereas marmoset P450 4F2 and 4F12 mRNAs were highly expressed in small intestines and livers. Four marmoset P450 4F proteins heterologously expressed in Escherichia coli catalyzed the ω-hydroxylation of leukotriene B4 In addition, marmoset P450 4F12 effectively catalyzed the hydroxylation of antiallergy drug ebastine, a human P450 2J/4F probe substrate. Ebastine hydroxylation activities by small intestine and liver microsomes from marmosets and cynomolgus monkeys showed greatly higher values than those of humans. Ebastine hydroxylation activities by marmoset and cynomolgus monkey small intestine microsomes were inhibited (approximately 60%) by anti-P450 4F antibodies, unlike human small intestine microsomes, suggesting that contribution of P450 4F enzymes for ebastine hydroxylation in the small intestine might be different between marmosets/cynomolgus monkeys and humans. These results indicated that marmoset P450 4F2, 4F3B, 4F11, and 4F12 were expressed in livers and/or small intestines and were functional in the metabolism of endogenous and exogenous compounds, similar to those of cynomolgus monkeys and humans.

  20. Experimental toxoplasmosis and vaccine tests in Aotus monkeys.

    Science.gov (United States)

    Escajadillo, A; Frenkel, J K

    1991-04-01

    We studied Aotus lemurinus, Panamanian night monkeys, for susceptibility to Toxoplasma infection and for their capacity to develop immunity using either sufadiazine prophylaxis or the non-persistent ts-4 vaccine. The animals were highly susceptible to infection with a mouse pathogenic (T265) and a mouse nonpathogenic (T163) Toxoplasma isolate. A calculated single bradyzoite by mouth gave rise to infection which was fatal in nine to 12 days. Chemoprophylaxis with 60-300 of sulfadiazine mg per day for up to 40 days protected the animals; however this was followed by fatal reactivation of infection between 11 and 70 days after treatment was stopped. Vaccination was carried out in two or three doses subcutaneously. Challenge was performed in 26 animals using both Toxoplasma isolates. Five monkeys (19%) survived for over a year, 10 died after a prolonged illness, and 11 died as rapidly as the seven controls. Safety tests showed the vaccine to be nonpathogenic in 111 adults except for slight fever and local inflammation, although one of four juveniles died from disseminated infection. Vaccination of 25 pregnant monkeys was non-pathogenic; however two of 25 fetuses were aborted, one of which was infected and one newborn had microphthalmia, retinitis and a cataract; four of the offspring were not tested. When six lactating monkeys were vaccinated, Toxoplasma was not transmitted to the infants. The high susceptibility to Toxoplasma and the low immunizability was circumstantially attributed to absence of exposure and lack of selection by Toxoplasma of these arboreal monkeys even though about 50% of terrestrial animals from the same area were infected.(ABSTRACT TRUNCATED AT 250 WORDS)

  1. Synaptic connectivity in the midget-parvocellular pathway of primate central retina.

    Science.gov (United States)

    Jusuf, Patricia R; Martin, Paul R; Grünert, Ulrike

    2006-01-10

    The synaptic connectivity of OFF midget bipolar cells was investigated in the central retina of two primate species, the New World common marmoset monkey, Callithrix jacchus, and the Old World macaque monkey, Macaca fascicularis. In marmosets, dichromatic and trichromatic animals were compared. Bipolar output synapses were identified with antibodies against ribbon proteins (kinesin, C-terminal binding protein 2) or with an antiserum that recognizes postsynaptic glutamate receptor clusters (GluR4). The midget bipolar cells were identified immunocytochemically with antibodies to CD15 (marmoset) or an antiserum to recoverin (macaque). In marmosets, midget ganglion cells were retrogradely labeled from the parvocellular layers of the dorsal lateral geniculate nucleus. Consistent with previous studies of Old World primates, in marmoset, midget bipolar cells contacted midget ganglion cells at a ratio of 1:1. The number of output synapses made by OFF midget bipolar cells was quantified for 104 cells in two dichromatic marmosets, 108 cells in one trichromatic marmoset, and 118 cells in one macaque. The number of output synapses was comparable for all animals, ranging from 10-71 in the dichromatic marmoset (average 29.7 +/- 12.4 SD), 12-86 in the trichromatic marmoset (average 28.6 +/- 11.7 SD) and 9-48 in the macaque (average 26.5 +/- 9.3 SD) per axon terminal. In all animals the number of output synapses per axon terminal showed a unimodal distribution. Our results suggest that the midget circuitry is comparable in dichromatic and trichromatic animals.

  2. Rhesus monkeys see who they hear: spontaneous cross-modal memory for familiar conspecifics.

    Directory of Open Access Journals (Sweden)

    Ikuma Adachi

    Full Text Available Rhesus monkeys gather much of their knowledge of the social world through visual input and may preferentially represent this knowledge in the visual modality. Recognition of familiar faces is clearly advantageous, and the flexibility and utility of primate social memory would be greatly enhanced if visual memories could be accessed cross-modally either by visual or auditory stimulation. Such cross-modal access to visual memory would facilitate flexible retrieval of the knowledge necessary for adaptive social behavior. We tested whether rhesus monkeys have cross-modal access to visual memory for familiar conspecifics using a delayed matching-to-sample procedure. Monkeys learned visual matching of video clips of familiar individuals to photographs of those individuals, and generalized performance to novel videos. In crossmodal probe trials, coo-calls were played during the memory interval. The calls were either from the monkey just seen in the sample video clip or from a different familiar monkey. Even though the monkeys were trained exclusively in visual matching, the calls influenced choice by causing an increase in the proportion of errors to the picture of the monkey whose voice was heard on incongruent trials. This result demonstrates spontaneous cross-modal recognition. It also shows that viewing videos of familiar monkeys activates naturally formed memories of real monkeys, validating the use of video stimuli in studies of social cognition in monkeys.

  3. Evaluation of third-party reciprocity by squirrel monkeys (Saimiri sciureus) and the question of mechanisms.

    Science.gov (United States)

    Anderson, James R; Bucher, Benoit; Kuroshima, Hika; Fujita, Kazuo

    2016-07-01

    Social evaluation during third-party interactions emerges early in human ontogeny, and it has been shown in adult capuchin monkeys who witness violations of reciprocity in object exchanges: Monkeys were less inclined to accept food from humans who refused to reciprocate with another human. A recent study reporting similar evidence in marmoset monkeys raised the possibility that such evaluations might be based on species' inherent cooperativeness. We tested a species not renowned for cooperativeness-squirrel monkeys-using the procedure used with marmosets and found a similar result. This finding rules out any crucial role for cooperative tendencies in monkeys' responses to unfair exchanges. We then tested squirrel monkeys using procedures more similar to those used in the original study with capuchins. Squirrel monkeys again accepted food less frequently from non-reciprocators, but unlike capuchins, they also strongly preferred reciprocators. We conclude that neither squirrel monkeys nor marmoset monkeys engaged in emotional bookkeeping of the type that probably underlies social evaluation in capuchin monkeys; instead, they employed one or more simple behavioral rules. Further comparative studies are required to clarify the mechanisms underlying social evaluation processes across species.

  4. NCBI nr-aa BLAST: CBRC-TSYR-01-1476 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available rmone receptor; AltName: Full=LH/CG-R; AltName: Full=LSH-R; AltName: Full=Luteinizing hormone receptor; Flag...s: Precursor gb|AAB53698.1| luteinizing hormone receptor [Callithrix jacchus] O02721 0.0 86% ...

  5. Two new test methods to quantify motor deficits in a marmoset model for Parkinson's disease

    NARCIS (Netherlands)

    Verhave, P.S.; Vanwersch, R.A.P.; Helden, H.P.M.; Smit, A.B.; Philippens, I.H.C.H.M.

    2009-01-01

    The validity of the common marmoset (Callithrix jacchus) as a model for human disease depends on the development of parameters with clinical relevance. We tested the effect of treatment with MPTP in two newly developed non-invasive motor behavioral paradigms in the context of Parkinson's disease. Th

  6. Gene : CBRC-CJAC-01-1122 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1122 UN A Releasing hormones receptors GNRR2_CALJA 0.0 99% sp|Q95MG6|G...8286_1 type II GnRH receptor [Callithrix jacchus] 0.0 99% MSAVNGTPWGSSAREEVWAGSGVEVEGSELPTFSTAAKVRVGVTIVLFVS

  7. Gene : CBRC-CJAC-01-0628 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0628 UN A Family T2R receptors (taste receptors) T2R38_PANPA 1e-170 87...% dbj|BAD98034.1| bitter taste receptor T2R38 [Callithrix jacchus] 1e-179 100% MLTLTSTSTVSYEVKSTFLFISVLEFAVG

  8. Gene : CBRC-CJAC-01-0709 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0709 UN A Chemokines and chemotactic factors receptors CCR1_HUMAN 0.0 ...90% gb|AAF36453.1|AF127528_1 chemokine receptor [Callithrix jacchus] 0.0 100% METSATTEDYDMITEFDYSDATPCHKANER

  9. Gene : CBRC-CJAC-01-1033 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1033 UN A Family T2R receptors (taste receptors) TA2R4_PANPA 1e-143 85...% dbj|BAD97930.1| bitter taste receptor T2R4 [Callithrix jacchus] 1e-160 99% MQELLYFSATIASLILNFVGIIMNLFITVVS

  10. Gene : CBRC-CJAC-01-0782 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0782 UN A Family T2R receptors (taste receptors) T2R13_PAPHA 1e-140 82...% dbj|BAD98000.1| bitter taste receptor T2R13 [Callithrix jacchus] 1e-156 97% MESVLQSIFTLVIIAEFIIGNLSNGFIVLI

  11. NCBI nr-aa BLAST: CBRC-CJAC-01-1122 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1122 sp|Q95MG6|GNRR2_CALJA Gonadotropin-releasing hormone II receptor ...(Type II GnRH receptor) (GnRH-II-R) gb|AAK60927.1|AF368286_1 type II GnRH receptor [Callithrix jacchus] Q95MG6 0.0 99% ...

  12. Gene : CBRC-CJAC-01-0975 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0975 UN A Melanocortins receptors MSHR_CALJA 0.0 100% sp|Q864H7|MSHR_C...R) gb|AAP30994.1| melanocortin-1 receptor [Callithrix jacchus] 0.0 100% MPMQGAQRKLLGSLNSTPTATSNPGLAANHTGAPCL

  13. Gene : CBRC-CJAC-01-0125 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0125 UN A Family T2R receptors (taste receptors) TA2R1_PANTR 1e-129 77...% dbj|BAD97896.1| bitter taste receptor T2R1 [Callithrix jacchus] 1e-140 99% MLESDLILCFLLAVMQFLLGISMNGIIVVVN

  14. Gene : CBRC-CJAC-01-0860 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0860 UN A Family T2R receptors (taste receptors) T2R42_PANTR 1e-137 77...% dbj|BAD98117.1| bitter taste receptor T2R55 [Callithrix jacchus] 1e-144 100% MATELDNIFLIVTIVEFIIGMLGNVFIGL

  15. Gene : CBRC-CJAC-01-1067 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1067 UN A Family T2R receptors (taste receptors) TA2R5_HUMAN 1e-151 87...% dbj|BAD97940.1| bitter taste receptor T2R5 [Callithrix jacchus] 1e-158 99% MLSTALGLLMLVAVVEFLIGLIGNGVLVVWS

  16. Gene : CBRC-CJAC-01-1020 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1020 UN A Orphan receptors GPR34_PANTR 0.0 93% gb|AAP04277.1| G-protei...n-coupled receptor GPR34 [Callithrix jacchus] 0.0 100% MRSHTITMMTTTSVSSWPYSSHRMCFETNHSDQSPQNFSGRPDVTTCPMDENL

  17. Gene : CBRC-CJAC-01-1116 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1116 UN A Family T2R receptors (taste receptors) T2R10_PONPY 1e-132 77...% dbj|BAD97983.1| bitter taste receptor T2R10 [Callithrix jacchus] 1e-141 100% MLSVVDGIFIFVVISESVLGVLGNGFIGL

  18. Gene : CBRC-CJAC-01-0537 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0537 Novel UN A Family T2R receptors (taste receptors) T2R13_PAPHA 1e-...137 82% dbj|BAD98000.1| bitter taste receptor T2R13 [Callithrix jacchus] 1e-148 93% MESVLQSIFTVVNIAEFIIGNLSN

  19. Gene : CBRC-CJAC-01-1190 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1190 UN A Family T2R receptors (taste receptors) TA2R7_MACMU 3e-47 34%... dbj|BAD97905.1| bitter taste receptor T2R2 [Callithrix jacchus] 1e-139 100% MAFSFSAILHVIIMSAEFFTGITVNGFLIIV

  20. Gene : CBRC-CJAC-01-0541 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0541 UN A Family T2R receptors (taste receptors) T2R62_PANPA 1e-141 82...% dbj|BAD98132.1| bitter taste receptor T2R62 [Callithrix jacchus] 1e-167 99% MPSSLTLIFMAIFCLETLAAMLQNGFLVTM

  1. Gene : CBRC-CJAC-01-1013 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1013 UN A Family T2R receptors (taste receptors) TA2R3_PAPHA 1e-145 81...% dbj|BAD97916.1| bitter taste receptor T2R3 [Callithrix jacchus] 1e-157 100% MKLTEGVFLFLCGIQFTLGILVNGFIGLVN

  2. Gene : CBRC-CJAC-01-0514 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0514 UN A Family T2R receptors (taste receptors) T2R40_PANTR 1e-173 93...% dbj|BAD98049.1| bitter taste receptor T2R40 [Callithrix jacchus] 1e-174 100% MATVNTDATDKDISRFKVTFTLVVSGIQC

  3. Gene : CBRC-CJAC-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0472 UN A Glycoprotein hormones receptors LSHR_CALJA 0.0 98% sp|O02721...ceptor) gb|AAB53698.1| luteinizing hormone receptor [Callithrix jacchus] 0.0 98% MPVPPPCSPRQSLAYLPVKVIPSQAFR

  4. Gene : CBRC-CJAC-01-0887 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0887 UN A Family T2R receptors (taste receptors) T2R16_PANTR 1e-138 82...% dbj|BAD98020.1| bitter taste receptor T2R16 [Callithrix jacchus] 1e-148 100% MISFQLTVFFMIIYVLESLTIIVQSRLIV

  5. Gene : CBRC-CJAC-01-0905 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0905 pseudo UN A Family T2R receptors (taste receptors) T2R16_PANTR 1e...-139 82% dbj|BAD98020.1| bitter taste receptor T2R16 [Callithrix jacchus] 1e-145 98% MISFQLTVFFMIIYVLESLTIIV

  6. NCBI nr-aa BLAST: CBRC-CJAC-01-0975 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0975 sp|Q864H7|MSHR_CALJA Melanocyte-stimulating hormone receptor (MSH...-R) (Melanotropin receptor) (Melanocortin receptor 1) (MC1-R) gb|AAP30994.1| melanocortin-1 receptor [Callithrix jacchus] Q864H7 0.0 100% ...

  7. NCBI nr-aa BLAST: CBRC-CJAC-01-1379 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-1379 sp|Q8HZU1|CXCR4_CALJA C-X-C chemokine receptor type 4 (CXC-R4) (C...XCR-4) (CD184 antigen) gb|AAN14528.1|AF452612_1 chemokine receptor CXCR4 [Callithrix jacchus] Q8HZU1 0.0 99% ...

  8. NCBI nr-aa BLAST: CBRC-CJAC-01-0472 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-CJAC-01-0472 sp|O02721|LSHR_CALJA Lutropin-choriogonadotropic hormone receptor... precursor (LH/CG-R) (LSH-R) (Luteinizing hormone receptor) gb|AAB53698.1| luteinizing hormone receptor [Callithrix jacchus] O02721 0.0 98% ...

  9. Growth and immunity conferred by a Plasmodium falciparum temperature sensitive mutant in Panamanian owl monkeys.

    Science.gov (United States)

    Inselburg, J; Rossan, R N; Escajadillo, A

    1989-05-01

    We have compared the growth of the wild type Plasmodium falciparum strain Honduras 1 and a previously isolated temperature sensitive mutant of it, AP1-16, in Panamanian owl monkeys. We examined serially infected splenectomized and normal animals that were initially infected with cultured parasites that had been grown in a mixture of owl monkey and human erythrocytes. Initial infections in splenectomized monkeys were marked by multiple recrudescences. The mutant grew less well than the wild type in the splenectomized monkeys, as determined by lower peak and total parasitemias. In the splenectomized monkeys tested by rechallenge with the wild type parasite, the mutant stimulated a comparable degree of protection. That protection was manifested in 2 ways. There was a marked reduction in the level of the primary parasitemia in the rechallenged monkeys and an absence of recrudescent parasitemias after the primary parasitemia. The potential value of generating and studying temperature sensitive P. falciparum strains that show attenuated growth is considered.

  10. Captive spider monkeys (Ateles geoffroyi) arm-raise to solicit allo-grooming.

    Science.gov (United States)

    Scheel, Matthew H; Edwards, Dori

    2012-03-01

    Old World monkeys solicit allo-grooming from conspecifics. However, there are relatively few studies of allo-grooming among spider monkeys, and descriptions of allo-grooming solicitation among spider monkeys are anecdotal. In this study, eighty-one hours of video, shot over eight weeks, captured 271 allo-grooming bouts among small groups of captive spider monkeys. Six of eight monkeys made heretofore unreported arm-raises that solicited higher than normal rates of allo-grooming. Allo-grooming bout durations following arm-raises also tended to be longer than bouts not preceded by arm-raises. The efficacy of the arm-raise at soliciting allo-grooming suggests spider monkeys are capable of intentional communication.

  11. Effect of radiation and age on immunoglobulin levels in rhesus monkeys (Macaca mulatta)

    Science.gov (United States)

    Stone, W. H.; Saphire, D. G.; Hackleman, S. M.; Braun, A. M.; Pennington, P.; Scheffler, J.; Wigle, J. C.; Cox, A. B.

    1994-01-01

    We report the results of a study on the immunoglobulin levels of rhesus monkeys (Macaca mulatta) in a colony consisting of the survivors of monkeys that received a single whole-body exposure to protons, electrons or X rays between 1964 and 1969. This colony has been maintained to assess the long-term effects of ionizing radiation on astronauts and high-flying pilots. Of the original 358 monkeys that were retained for lifetime studies, 129 (97 irradiated and 32 controls) were available for our study. We found no significant difference between the irradiated and control monkeys in mean levels of IgA, IgG and IgM, irrespective of the radiation treatment. The availability of these aged monkeys provided a unique opportunity to compare their immunoglobulin levels to those of other monkeys of various ages, and thus assess the effect of age on immunoglobulin levels. We found that only the IgA levels increase with age.

  12. [The interrelationships of motivation and reinforcement in the performance of a simple instrumental reflex by the monkey].

    Science.gov (United States)

    Norkin, I M; Shul'govskiĭ, V V

    1991-01-01

    The dynamics of instrumental reflex of rhesus monkey was studied in automatic experiment. Three monkeys performed a movement of the lever in response to the light stimulus. It was shown, that the realization of the instrumental reflex by monkeys represented blocks of continuous or interrupted realizations and pauses between them. The dependence was studied of intensity of performance upon the time from the beginning of the experiment, and a comparison was drawn of intensities for three monkeys. The average intensity in block is constant and individual for each monkey. Also the influence of food deprivation and complementary reinforcement on the monkey's performance was studied.

  13. Streptococcus oralis cerebral abscess following monkey bite in a 2-month-old infant.

    Science.gov (United States)

    Thiagarajan, Srinivasan; Krishnamurthy, Sriram; Raghavan, Renitha; Mahadevan, Subramanian; Madhugiri, Venkatesh S; Sistla, Sujatha

    2016-05-01

    Although cerebral abscesses caused by animal bites have been reported, they are extremely rare in infants and have not been described following monkey bite. A 55-day-old male infant presented with a multi-loculated Streptococcus oralis cerebral abscess following a monkey bite on the scalp. There was a clinical response to antibiotic therapy and repeated surgical aspiration followed by a ventriculoperitoneal shunt. This is the first report of a patient with a brain abscess following a monkey bite.

  14. Immunization with Recombinant Helicobacter pylori Urease in Specific-Pathogen-Free Rhesus Monkeys (Macaca mulatta)

    OpenAIRE

    Solnick, Jay V.; Canfield, Don R.; Hansen, Lori M.; Torabian, Sima Z.

    2000-01-01

    Immunization with urease can protect mice from challenge with Helicobacter pylori, though results vary depending on the particular vaccine, challenge strain, and method of evaluation. Unlike mice, rhesus monkeys are naturally colonized with H. pylori and so may provide a better estimate of vaccine efficacy in humans. The purpose of this study was to examine the effectiveness of H. pylori urease as a vaccine in specific-pathogen (H. pylori)-free rhesus monkeys. Monkeys raised from birth and do...

  15. ‘‘What's wrong with my monkey?''

    DEFF Research Database (Denmark)

    Olsson, I. Anna S.; Sandøe, Peter

    2010-01-01

    it is acceptable to use animals as models of human disease; whether it is acceptable to genetically modify animals; and whether these animals' being monkeys makes a difference. The analysis considers the prospect of transgenic marmoset studies coming to replace transgenic mouse studies and lesion studies......, readily available in the way that transgenic laboratory mice are currently, prompts excitement in the scientific community; but the idea of monkeys being bred to carry diseases is also contentious. We structure an ethical analysis of the transgenic marmoset case around three questions: whether...... in marmosets in some areas of research. The mainstream, broadly utilitarian view of animal research suggests that such a transition will not give rise to greater ethical problems than those presently faced. It can be argued that using marmosets rather than mice will not result in more animal suffering...

  16. Protein deficiency and energy restriction in young cebus monkeys.

    Science.gov (United States)

    Samonds, K W; Hegsted, D M

    1978-03-01

    Infant cebus monkeys (Cebus albifrons) were fed liquid formulas that were limited in protein, energy, or a combination of the two restrictions. Weight gain, food intake, hematological development, and plasma protein and cholesterol levels were monitored over a 20-week period. The animals restricted in protein developed the classical signs of protein deficiency--reductions in plasma albumin, a mild anemia, accumulation of fat in the liver, and, in a few cases, facial edema. These animals maintained a relatively high energy intake, and apparently wasted energy when compared to similarly non-growing energy-restricted animals. Energy-restricted animals did not exhibit these symptoms, even when their daily protein intake was reduced to match that of protein-restricted monkeys. It is concluded that an energy restriction superimposed upon a limited protein intake did not increase protein requirements or precipitate protein deficiency.

  17. Grooming, rank, and agonistic support in tufted capuchin monkeys.

    Science.gov (United States)

    Schino, Gabriele; Di Giuseppe, Francesca; Visalberghi, Elisabetta

    2009-02-01

    Studies investigating the relation between allogrooming and social rank in capuchin monkeys (genus Cebus) have yielded inconsistent results. In this study, we investigated the relation between grooming, agonistic support, aggression and social rank in a captive group of tufted capuchin monkeys (C. apella). Differently from most previous studies, we based our analyses on a relatively large database and studied a group with known genealogical relationships. Tufted capuchin females did not exchange grooming for rank-related benefits such as agonistic support or reduced aggression. Coherently with this picture, they did not groom up the hierarchy and did not compete for accessing high-ranking grooming partners. It is suggested that a small group size, coupled with a strong kin bias, may make the exchange of grooming for rank-related benefits impossible or unprofitable, thus eliminating the advantages of grooming up the hierarchy. We provide several possible explanations for the heterogeneity of results across capuchin studies that have addressed similar questions.

  18. Metabolic alkalosis during immobilization in monkeys (M. nemestrina)

    Science.gov (United States)

    Young, D. R.; Yeh, I.; Swenson, R. S.

    1983-01-01

    The systemic and renal acid-base response of monkeys during ten weeks of immobilization was studied. By three weeks of immobilization, arterial pH and bicarbonate concentrations were elevated (chronic metabolic alkalosis). Net urinary acid excretion increased in immobilized animals. Urinary bicarbonate excretion decreased during the first three weeks of immobilization, and then returned to control levels. Sustained increases in urinary ammonium excretion were seen throughout the time duration of immobilization. Neither potassium depletion nor hypokalemia was observed. Most parameters returned promptly to the normal range during the first week of recovery. Factors tentatively associated with changes in acid-base status of monkeys include contraction of extracellular fluid volume, retention of bicarbonate, increased acid excretion, and possible participation of extrarenal buffers.

  19. Protein composition of rhesus monkey milk: comparison to human milk.

    Science.gov (United States)

    Kunz, C; Lönnerdal, B

    1993-04-01

    1. Proteins in human milk and Rhesus monkey milk have been compared by FPLC gel filtration and anion exchange chromatography, SDS-Polyacrylamide gel electrophoresis, nitrogen and protein determination. 2. Mature Rhesus milk is higher in protein concentration (15-20 mg/ml) than human milk (8-9 mg/ml). 3. Non-Protein nitrogen is 6-13% in Rhesus milk but 25-30% in human milk. 4. Secretory IgA, lactoferrin, serum albumin, alpha-lactalbumin and lysozyme are present in Rhesus milk, but at a lower concentration than in human milk. 5. The casein subunit pattern is more complex in Rhesus milk compared to human milk. 6. The ratio of whey proteins to casein is similar in both milks (approximately 60/40). 7. A protein with a M(r) of 21,600 is a major component in monkey whey but is not found in human milk.

  20. Hemodynamic effects of barnidipine hydrochloride in conscious squirrel monkeys.

    Science.gov (United States)

    Shibasaki, M; Inagaki, O; Takenaka, T

    1994-05-01

    1. The effects of barnidipine, a new dihydropyridine Ca2+ antagonist, on cardiovascular and renin-angiotensin-aldosterone systems were investigated in conscious squirrel monkeys. 2. Barnidipine (0.3-3 mg/kg p.o.) produced a dose-related decrease in systolic blood pressure. The hypotensive action after 3 mg/kg p.o. lasted more than 8 hr. 3. Barnidipine increased heart rate, but did not affect the PQ-interval of the electrocardiograph. 4. Barnidipine (1 and 3 mg/kg p.o.) increased plasma renin activity dose-dependently. However, it had no significant effect on plasma aldosterone concentration. 5. These results indicate that barnidipine produces a sustained hypotension without affecting atrioventricular conduction time and plasma aldosterone concentration in conscious squirrel monkeys.

  1. Evidence of Apeu Virus Infection in Wild Monkeys, Brazilian Amazon.

    Science.gov (United States)

    Oliveira, Danilo B; Luiz, Ana Paula Moreira Franco; Fagundes, Alexandre; Pinto, Carla Amaral; Bonjardim, Cláudio A; Trindade, Giliane S; Kroon, Erna G; Abrahão, Jônatas S; Ferreira, Paulo C P

    2016-03-01

    Orthobunyaviruses are arboviruses in which at least 30 members are human pathogens. The members of group C orthobunyaviruses were first isolated in the Brazilian Amazon in 1950, since that time little information is accumulated about ecology and the medical impact of these virus groups in Brazil. Herein, we describe the evidence of Apeu virus (APEUV; an Orthobunyavirus member) infection in wild monkeys from the Brazilian Amazon forest. APEUV was detected by using a neutralizing antibody in serum and its RNA, suggesting past and acute infection of Amazonian monkeys by this virus. These results altogether represent an important contribution of orthobunyavirus ecology in the Amazon and an update about recent circulation and risk for humans with expansion of the cities to Amazon forest.

  2. Spontaneous Cholelithiasis in a Squirrel Monkey (Saimiri sciureus).

    Science.gov (United States)

    Lieberman, Mia T; Wachtman, Lynn M; Marini, Robert P; Bakthavatchalu, Vasu; Fox, James G

    2016-02-01

    A mature female squirrel monkey was noted during routine semiannual examinations to have moderate progressive weight loss. Serum chemistry panels revealed marked increases in hepatic enzyme, bilirubin, and bile salt concentrations and hypoalbuminemia. Abdominal ultrasonography revealed echogenic, shadowing debris in the gallbladder, consistent with cholelithiasis. At necropsy, marked thickening and distension of the gallbladder, cystic duct, and common bile duct was noted, and more than 50 irregularly shaped, black gallstones were removed from the biliary tract. Gallbladder tissue, bile, and gallstones cultured positive for Escherichia coli and Proteus spp., suggesting a brown-pigment gallstone type secondary to a bacterial nidus. Histopathology revealed severe chronic-active diffuse cholecystitis and severe chronic-active hepatic degeneration and necrosis with severe cholestasis. To our knowledge, this report is the first description of spontaneous choleilthiasis in a squirrel monkey.

  3. A monkey metabolism pod for space-flight weightlessness studies.

    Science.gov (United States)

    Pace, N.; Rahlmann, D. F.; Kodama, A. M.; Mains, R. C.; Grunbaum, B. W.

    1973-01-01

    The system described will permit quantitative physiological studies in adult monkeys, weighing from 8 to 14 kg, during future space flights. The system comprises a fiberglass pod containing a comfortable restraint couch for the animal. The pod is divided into upper and lower halves. When the monkey occupies the couch, a rubber belly-band forms a gas seal between the upper and lower portions of the animal. The upper-pod ventilating air stream is monitored for the partial pressures of oxygen, carbon dioxide, nitrogen, and water to permit continuous metabolic gas-exchange measurements for computation of metabolic energy expediture. The lower pod is lined with ashless filter paper for excreta collection.

  4. Dyscoria associated with herpesvirus infection in owl monkeys (Aotus nancymae).

    Science.gov (United States)

    Gozalo, Alfonso S; Montoya, Enrique J; Weller, Richard E

    2008-07-01

    "Dyscoria was noted in a female owl monkey and 2 of her offspring. The third offspring was found dead with necrohemorrhagic encephalitis. Two male monkeys paired with the female died, 1 of which showed oral ulcers at necropsy. Histologic examination of the oral ulcers revealed syncytia and eosinophilic intranuclear inclusion bodies in epithelial cells. Ocular examination revealed posterior synechia associated with the dyscoria in all 3 animals. Serum samples from the female and her offspring were positive for Herpesvirus simplex antibodies by ELISA. The clinical history, gross and microscopic lesions, and serology results suggests a herpesviral etiology, possibly H. simplex or H. saimiri 1. This report underscores the risks associated with introducing into breeding or research colonies animals that previously were kept as pets or those from unknown origin that could carry asymptomatic pathogenic Herpesvirus infections. In addition, herpesviral infection should be considered among the differential diagnoses if dyscoria is noted in nonhuman primates."

  5. Monkeying with the Goodness-of-Fit Test

    Directory of Open Access Journals (Sweden)

    George Marsaglia

    2005-09-01

    Full Text Available The familiar Σ(OBS - EXP 2/EXP goodness-of-fit measure is commonly used to test whether an observed sequence came from the realization of n independent identically distributed (iid discrete random variables. It can be quite effective for testing for identical distribution, but is not suited for assessing independence, as it pays no attention to the order in which output values are received. This note reviews a way to adjust or tamper, that is, monkey-with the classical test to make it test for independence as well as identical distribution--in short, to test for both the i's in iid, using monkey tests similar to those in the Diehard Battery of Tests of Randomness (Marsaglia 1995.

  6. Present and potential distribution of Snub-nosed Monkey

    DEFF Research Database (Denmark)

    Nüchel, Jonas; Bøcher, Peder Klith; Svenning, Jens-Christian

    are the Snub-nosed Monkeys (Rhinopithecus), a temperate-subtropical East Asian genus. We use species distribution modeling to assess the following question of key relevancy for conservation management of Rhinopithecus; 1. Which climatic factors determine the present distribution of Rhinopithecus within...... distribution of Rhinopithecus within the region, considering climate, habitat availability and the locations of nature reserves. Keywords: biodiversity, biogeography, conservation, China, snub-nosed monkey, rhinopithecus, primates, species distribution modeling......Around 28 % of mammal species are threatened or near threatened with extinction. One of the mammal taxa with many threatened species are the primates. Of which more than 65 % of the world’s 424 know species are threatened or near threatened (IUCN, 2014). One group of threatened primates...

  7. Rapidly evolving marmoset MSMB genes are differently expressed in the male genital tract

    Directory of Open Access Journals (Sweden)

    Ceder Yvonne

    2009-09-01

    Full Text Available Abstract Background Beta-microseminoprotein, an abundant component in prostatic fluid, is encoded by the potential tumor suppressor gene MSMB. Some New World monkeys carry several copies of this gene, in contrast to most mammals, including humans, which have one only. Here we have investigated the background for the species difference by analyzing the chromosomal organization and expression of MSMB in the common marmoset (Callithrix jacchus. Methods Genes were identified in the Callithrix jacchus genome database using bioinformatics and transcripts were analyzed by RT-PCR and quantified by real time PCR in the presence of SYBR green. Results The common marmoset has five MSMB: one processed pseudogene and four functional genes. The latter encompass homologous genomic regions of 32-35 kb, containing the genes of 12-14 kb and conserved upstream and downstream regions of 14-19 kb and 3-4 kb. One gene, MSMB1, occupies the same position on the chromosome as the single human gene. On the same chromosome, but several Mb away, is another MSMB locus situated with MSMB2, MSMB3 and MSMB4 arranged in tandem. Measurements of transcripts demonstrated that all functional genes are expressed in the male genital tract, generating very high transcript levels in the prostate. The transcript levels in seminal vesicles and testis are two and four orders of magnitude lower. A single gene, MSMB3, accounts for more than 90% of MSMB transcripts in both the prostate and the seminal vesicles, whereas in the testis around half of the transcripts originate from MSMB2. These genes display rapid evolution with a skewed distribution of mutated nucleotides; in MSMB2 they affect nucleotides encoding the N-terminal Greek key domain, whereas in MSMB3 it is the C-terminal MSMB-unique domain that is affected. Conclusion Callitrichide monkeys have four functional MSMB that are all expressed in the male genital tract, but the product from one gene, MSMB3, will predominate in seminal

  8. Photoacoustic tomography of monkey brain using virtual point ultrasonic transducers

    OpenAIRE

    Nie, Liming; Guo, Zijian; Wang, Lihong V.

    2011-01-01

    A photoacoustic tomography system (PAT) using virtual point ultrasonic transducers was developed and applied to image a monkey brain. The custom-built transducers provide a 10-fold greater field-of-view (FOV) than finite-aperture unfocused transducers as well as an improved signal-to-noise ratio (SNR) and reduced artifacts rather than negative-lens transducers. Their tangential resolution, radial resolution, and (SNR) improvements were quantified using tissue phantoms. Our PAT system can achi...

  9. Mirror neurons and mirror systems in monkeys and humans.

    Science.gov (United States)

    Fabbri-Destro, Maddalena; Rizzolatti, Giacomo

    2008-06-01

    Mirror neurons are a distinct class of neurons that transform specific sensory information into a motor format. Mirror neurons have been originally discovered in the premotor and parietal cortex of the monkey. Subsequent neurophysiological (TMS, EEG, MEG) and brain imaging studies have shown that a mirror mechanism is also present in humans. According to its anatomical locations, mirror mechanism plays a role in action and intention understanding, imitation, speech, and emotion feeling.

  10. Monkeys get a silver in Abstract Art Olympics

    CERN Document Server

    Simkin, M V

    2011-01-01

    Experiment shows that art students prefer abstract art to monkey art in about two-third of the cases. Since the number is above 50%, some argue that abstract art is different and better than animal art. I compare this result with figure skating competitions, where on average 73% of judges prefer gold medalist to silver medalist. This means that the difference between abstract artists and animal artists is less than the difference between gold and silver medalists.

  11. Rhesus monkeys (Macaca mulatta) map number onto space

    OpenAIRE

    Drucker, Caroline B.; Brannon, Elizabeth M.

    2014-01-01

    Humans map number onto space. However, the origins of this association, and particularly the degree to which it depends upon cultural experience, are not fully understood. Here we provide the first demonstration of a number-space mapping in a non-human primate. We trained four adult male rhesus macaques (Macaca mulatta) to select the fourth position from the bottom of a five-element vertical array. Monkeys maintained a preference to choose the fourth position through changes in the appearance...

  12. Plasmodium simium/Plasmodium vivax infections in southern brown howler monkeys from the Atlantic Forest

    Directory of Open Access Journals (Sweden)

    Daniela Camargos Costa

    2014-08-01

    Full Text Available Blood infection by the simian parasite, Plasmodium simium, was identified in captive (n = 45, 4.4% and in wild Alouatta clamitans monkeys (n = 20, 35% from the Atlantic Forest of southern Brazil. A single malaria infection was symptomatic and the monkey presented clinical and haematological alterations. A high frequency of Plasmodium vivax-specific antibodies was detected among these monkeys, with 87% of the monkeys testing positive against P. vivax antigens. These findings highlight the possibility of malaria as a zoonosis in the remaining Atlantic Forest and its impact on the epidemiology of the disease.

  13. Effect of new training technique on affinity of cynomolgus monkeys for animal care personnel.

    Science.gov (United States)

    Nishimoto, Ai; Tachibana, Yuki; Takaura, Kaoru; Ochi, Takehiro; Koyama, Hironari

    2015-01-01

    To confirm our hypothesis that the sex and age of cynomolgus monkeys influences the effect of training, we employed a new training technique designed to increase the animal's affinity for animal care personnel. During 151 days of training, monkeys aged 2 to 10 years accepted each 3 raisins/3 times/day, and communicated with animal care personnel (5 times/day). Behavior was scored using integers between -1 and 5. Before training, 35 of the 61 monkeys refused raisins offered directly by animal care personnel (Score -1, 0 and 1). After training, 28 of these 35 monkeys (80%) accepted raisins offered directly by animal care personnel (>Score 2). The mean score of monkeys increased from 1.2 ± 0.1 to 4.3 ± 0.2. The minimum training period required for monkeys to reach Score 2 was longer for females than for males. After 151 days, 6 of the 31 females and 1 of the 30 males still refused raisins offered directly by animal care personnel. Beneficial effects of training were obtained in both young and adult monkeys. These results indicate that our new training technique markedly improves the affinity of monkeys for animal care personnel, and that these effects tend to vary by sex but not age. In addition, abnormal behavior and symptoms of monkeys were improved by this training.

  14. A coprological survey of parasites of wild mantled howling monkeys, Alouatta palliata palliata.

    Science.gov (United States)

    Stuart, M D; Greenspan, L L; Glander, K E; Clarke, M R

    1990-10-01

    Fecal samples from 155 mantled howling monkeys (Alouatta palliata palliata) examined at Centro Ecologico La Pacifica, Guanacaste Province, Costa Rica, revealed 75 (48%) had parasitic infections. A sampling of nine howling monkeys from Santa Rosa National Park. Costa Rica indicated only one infected animal (11%). Only three of 19 (16%) spider monkeys (Ateles geoffroyi) also from Santa Rosa were infected. Controrchis biliophilus, Trypanoxyuris minutus, unidentified strongylid eggs and Isospora sp. oocysts were found. Three monkeys from La Pacifica died and were examined for adult helminths. They were infected with Ascaris lumbricoides, C. biliophilus and T. minutus.

  15. Color vision test for dichromatic and trichromatic macaque monkeys.

    Science.gov (United States)

    Koida, Kowa; Yokoi, Isao; Okazawa, Gouki; Mikami, Akichika; Widayati, Kanthi Arum; Miyachi, Shigehiro; Komatsu, Hidehiko

    2013-11-01

    Dichromacy is a color vision defect in which one of the three cone photoreceptors is absent. Individuals with dichromacy are called dichromats (or sometimes "color-blind"), and their color discrimination performance has contributed significantly to our understanding of color vision. Macaque monkeys, which normally have trichromatic color vision that is nearly identical to humans, have been used extensively in neurophysiological studies of color vision. In the present study we employed two tests, a pseudoisochromatic color discrimination test and a monochromatic light detection test, to compare the color vision of genetically identified dichromatic macaques (Macaca fascicularis) with that of normal trichromatic macaques. In the color discrimination test, dichromats could not discriminate colors along the protanopic confusion line, though trichromats could. In the light detection test, the relative thresholds for longer wavelength light were higher in the dichromats than the trichromats, indicating dichromats to be less sensitive to longer wavelength light. Because the dichromatic macaque is very rare, the present study provides valuable new information on the color vision behavior of dichromatic macaques, which may be a useful animal model of human dichromacy. The behavioral tests used in the present study have been previously used to characterize the color behaviors of trichromatic as well as dichromatic new world monkeys. The present results show that comparative studies of color vision employing similar tests may be feasible to examine the difference in color behaviors between trichromatic and dichromatic individuals, although the genetic mechanisms of trichromacy/dichromacy is quite different between new world monkeys and macaques.

  16. Vitamins in the monkey brain: An immunocytochemical study.

    Science.gov (United States)

    Mangas, A; Coveñas, R; Bodet, D; Duleu, S; Marcos, P; Geffard, M

    2009-09-01

    Using highly specific antisera directed against vitamins, the distribution of pyridoxal-, pyridoxine-, vitamin C- and nicotinamide-immunoreactive structures in the monkey (Macaca fascicularis) brain was studied. Neither immunoreactive structures containing pyridoxine or nicotinamide, nor immunoreactive fibers containing vitamin C were found in the monkey brain. However, this work reports the first visualization and the morphological characteristics of pyridoxal- and vitamin C-immunoreactive cell bodies in the mammalian central nervous system using an indirect immunoperoxidase technique. A high density of pyridoxal-immunoreactive cell bodies was found in the paraventricular hypothalamic nucleus and in the supraoptic nucleus and a low density of the same was observed in the periventricular hypothalamic region, whereas a moderate density of vitamin C-immunoreactive cell bodies was observed in the somatosensorial cortex (precentral gyrus). Immunoreactive fibers containing pyridoxal were only visualized in the anterior commissure. The restricted distribution of pyridoxal and vitamin C in the monkey brain suggests that both vitamins could be involved in very specific physiological mechanisms.

  17. Cognitive performance of juvenile monkeys after chronic fluoxetine treatment

    Directory of Open Access Journals (Sweden)

    Mari S. Golub

    2017-08-01

    Full Text Available Potential long term effects on brain development are a concern when drugs are used to treat depression and anxiety in childhood. In this study, male juvenile rhesus monkeys (three-four years of age were dosed with fluoxetine or vehicle (N = 16/group for two years. Histomorphometric examination of cortical dendritic spines conducted after euthanasia at one year postdosing (N = 8/group suggested a trend toward greater dendritic spine synapse density in prefrontal cortex of the fluoxetine-treated monkeys. During dosing, subjects were trained for automated cognitive testing, and evaluated with a test of sustained attention. After dosing was discontinued, sustained attention, recognition memory and cognitive flexibility were evaluated. Sustained attention was affected by fluoxetine, both during and after dosing, as indexed by omission errors. Response accuracy was not affected by fluoxetine in post-dosing recognition memory and cognitive flexibility tests, but formerly fluoxetine-treated monkeys compared to vehicle controls had more missed trial initiations and choices during testing. Drug treatment also interacted with genetic and environmental variables: MAOA genotype (high- and low transcription rate polymorphisms and testing location (upper or lower tier of cages. Altered development of top-down cortical regulation of effortful attention may be relevant to this pattern of cognitive test performance after juvenile fluoxetine treatment.

  18. Atopic dermatitis with possible polysensitization and monkey esophagus reactivity

    Directory of Open Access Journals (Sweden)

    Ana Maria Abreu Velez

    2010-01-01

    Full Text Available Context: Atopic dermatitis is a chronic inflammatory skin disease resulting from interactions between environmental and genetic factors. Recent studies link atopic dermatitis with asthma and with eosinophilic esophagitis. Case Report: Based on this association, we investigated by indirect immunofluorescence the immunoreactivity patterns on monkey esophagus substrate utilizing the serum of a patient with severe atopic dermatitis. We also examined the patient′s skin biopsy by H&E histology and immunohistochemistry. We detected strong deposits of albumin, IgE, IgG, IgD, IgA, Complement/C1q and mast cell tryptase in multiples structures of the skin, as well as a broad pattern of intraepithelial staining on monkey esophagus. Strong staining positivity was also detected within the inflammatory infiltrate around the upper dermal vessels, as well as additional positive staining for the human leukocyte antigen system antigens DR DP and DQ. Conclusion: Our findings demonstrate that there could be an indication for testing patients with severe atopic dermatitis for autoreactivity to filaggrin (anti-keratin antibodies utilizing monkey esophagus. Larger studies are needed to clarify any immunologic interaction between the reactivity to albumin and food allergens that may sensitize patients via the esophageal mucosa.

  19. Phenytoin and/or stiripentol in pregnancy: infant monkey hyperexcitability.

    Science.gov (United States)

    Phillips, N K; Lockard, J S

    1993-01-01

    A monkey (Macaca fascicularis) model was used to assess infant hyperexcitability after prenatal exposure to phenytoin (PHT, n = 4), stiripentol (STP, n = 5), or PHT + STP (n = 4). Adult female monkeys were equipped with tether systems and stomach catheters so that drug administration could start 1 month before mating and could be continued throughout gestation. During pregnancy, PHT and STP plasma levels were maintained between 4-12 and 4-10 micrograms/ml respectively (for both monotherapy and polytherapy). Infants were separated from mothers at birth and transferred to the University of Washington's (Seattle) Infant Primate Research Laboratory (IPRL) for postnatal care and testing. Data on a hyperexcitability scale were obtained during cognitive testing for visual and cross-modal recognition memory in 13 infant monkeys when they were between 2 weeks and 3 months of age. The data indicated that infants prenatally exposed to PHT, whether alone or in combination with STP, were at increased risk for hyperexcitability (screeching, refusing to attend to stimuli, lack of visual orientation). This was not true of infants prenatally exposed to STP monotherapy (drug group differences, p < 0.05).

  20. Electrons at the monkey saddle: A multicritical Lifshitz point

    Science.gov (United States)

    Shtyk, A.; Goldstein, G.; Chamon, C.

    2017-01-01

    We consider two-dimensional interacting electrons at a monkey saddle with dispersion ∝px3-3 pxpy2 . Such a dispersion naturally arises at the multicritical Lifshitz point when three Van Hove saddles merge in an elliptical umbilic elementary catastrophe, which we show can be realized in biased bilayer graphene. A multicritical Lifshitz point of this kind can be identified by its signature Landau level behavior Em∝(Bm ) 3 /2 and related oscillations in thermodynamic and transport properties, such as de Haas-Van Alphen and Shubnikov-de Haas oscillations, whose period triples as the system crosses the singularity. We show, in the case of a single monkey saddle, that the noninteracting electron fixed point is unstable to interactions under the renormalization-group flow, developing either a superconducting instability or non-Fermi-liquid features. Biased bilayer graphene, where there are two non-nested monkey saddles at the K and K' points, exhibits an interplay of competing many-body instabilities, namely, s -wave superconductivity, ferromagnetism, and spin- and charge-density waves.