Multidecadal Changes in the UTLS Ozone from the MERRA-2 Reanalysis and the GMI Chemistry Model

Science.gov (United States)

Wargan, Krzysztof; Orbe, Clara; Pawson, Steven; Ziemke, Jerald R.; Oman, Luke; Olsen, Mark; Coy, Lawrence; Knowland, Emma

2018-01-01

Long-term changes of ozone in the UTLS (Upper Troposphere / Lower Stratosphere) reflect the response to decreases in the stratospheric concentrations of ozone-depleting substances as well as changes in the stratospheric circulation induced by climate change. To date, studies of UTLS ozone changes and variability have relied mainly on satellite and in-situ observations as well as chemistry-climate model simulations. By comparison, the potential of reanalysis ozone data remains relatively untapped. This is despite evidence from recent studies, including detailed analyses conducted under SPARC (Scalable Processor Architecture) Reanalysis Intercomparison Project (S-RIP), that demonstrate that stratospheric ozone fields from modern atmospheric reanalyses exhibit good agreement with independent data while delineating issues related to inhomogeneities in the assimilated observations. In this presentation, we will explore the possibility of inferring long-term geographically and vertically resolved behavior of the lower stratospheric (LS) ozone from NASA's MERRA-2 (Modern-Era Retrospective Analysis for Research and Applications -2) reanalysis after accounting for the few known discontinuities and gaps in its assimilated input data. This work builds upon previous studies that have documented excellent agreement between MERRA-2 ozone and ozonesonde observations in the LS. Of particular importance is a relatively good vertical resolution of MERRA-2 allowing precise separation of tropospheric and stratospheric ozone contents. We also compare the MERRA-2 LS ozone results with the recently completed 37-year simulation produced using Goddard Earth Observing System in "replay"� mode coupled with the GMI (Global Modeling Initiative) chemistry mechanism. Replay mode dynamically constrains the model with the MERRA-2 reanalysis winds, temperature, and pressure. We will emphasize the areas of agreement of the reanalysis and replay and interpret differences between them in the context

Estimation of the frequency and magnetic field dependence of the skin depth in Co-rich magnetic microwires from GMI experiments

Directory of Open Access Journals (Sweden)

Arcady Zhukov

2016-09-01

Full Text Available We studied giant magnetoimpedance (GMI effect in magnetically soft amorphous Co-rich microwires in the extended frequency range. From obtained experimentally dependences of the GMI ratio on magnetic field at different frequencies we estimated the penetration depth and its dependence on applied magnetic field and frequency.

Activities of NASA's Global Modeling Initiative (GMI) in the Assessment of Subsonic Aircraft Impact

Science.gov (United States)

Rodriquez, J. M.; Logan, J. A.; Rotman, D. A.; Bergmann, D. J.; Baughcum, S. L.; Friedl, R. R.; Anderson, D. E.

2004-01-01

The Intergovernmental Panel on Climate Change estimated a peak increase in ozone ranging from 7-12 ppbv (zonal and annual average, and relative to a baseline with no aircraft), due to the subsonic aircraft in the year 2015, corresponding to aircraft emissions of 1.3 TgN/year. This range of values presumably reflects differences in model input (e.g., chemical mechanism, ground emission fluxes, and meteorological fields), and algorithms. The model implemented by the Global Modeling Initiative allows testing the impact of individual model components on the assessment calculations. We present results of the impact of doubling the 1995 aircraft emissions of NOx, corresponding to an extra 0.56 TgN/year, utilizing meteorological data from NASA's Data Assimilation Office (DAO), the Goddard Institute for Space Studies (GISS), and the Middle Atmosphere Community Climate Model, version 3 (MACCM3). Comparison of results to observations can be used to assess the model performance. Peak ozone perturbations ranging from 1.7 to 2.2 ppbv of ozone are calculated using the different fields. These correspond to increases in total tropospheric ozone ranging from 3.3 to 4.1 Tg/Os. These perturbations are consistent with the IPCC results, due to the difference in aircraft emissions. However, the range of values calculated is much smaller than in IPCC.

Evaluation of GMI and PMI diffeomorphic-based demons algorithms for aligning PET and CT Images.

Science.gov (United States)

Yang, Juan; Wang, Hongjun; Zhang, You; Yin, Yong

2015-07-08

Fusion of anatomic information in computed tomography (CT) and functional information in 18F-FDG positron emission tomography (PET) is crucial for accurate differentiation of tumor from benign masses, designing radiotherapy treatment plan and staging of cancer. Although current PET and CT images can be acquired from combined 18F-FDG PET/CT scanner, the two acquisitions are scanned separately and take a long time, which may induce potential positional errors in global and local caused by respiratory motion or organ peristalsis. So registration (alignment) of whole-body PET and CT images is a prerequisite for their meaningful fusion. The purpose of this study was to assess the performance of two multimodal registration algorithms for aligning PET and CT images. The proposed gradient of mutual information (GMI)-based demons algorithm, which incorporated the GMI between two images as an external force to facilitate the alignment, was compared with the point-wise mutual information (PMI) diffeomorphic-based demons algorithm whose external force was modified by replacing the image intensity difference in diffeomorphic demons algorithm with the PMI to make it appropriate for multimodal image registration. Eight patients with esophageal cancer(s) were enrolled in this IRB-approved study. Whole-body PET and CT images were acquired from a combined 18F-FDG PET/CT scanner for each patient. The modified Hausdorff distance (d(MH)) was used to evaluate the registration accuracy of the two algorithms. Of all patients, the mean values and standard deviations (SDs) of d(MH) were 6.65 (± 1.90) voxels and 6.01 (± 1.90) after the GMI-based demons and the PMI diffeomorphic-based demons registration algorithms respectively. Preliminary results on oncological patients showed that the respiratory motion and organ peristalsis in PET/CT esophageal images could not be neglected, although a combined 18F-FDG PET/CT scanner was used for image acquisition. The PMI diffeomorphic-based demons

Neutron guides and scientific neutron equipment at CILAS/GMI

International Nuclear Information System (INIS)

Gautier-Picard, P.

2001-01-01

The French company CILAS is the world's leading supplier of complete neutron guide systems. The neutron optics with multilayer coatings produced by CILAS has become an international standard for neutron beam transportation at modern research institutes. During the last 30 years, CILAS designed, produced and installed more than 5000 meters of guides in many European, American and Asian countries. By these projects the company has acquired a very strong experience with: conception, design, manufacturing, setting up of Neutron Guides. In most cases, CILAS was in charge of the design, as well as the manufacturing of the whole system, comprising optical and mechanical components, vacuum system, shutter and shielding definition. By our long experience we have also acquired good knowledge of the materials used in this specific nuclear environment and their behavior under radiation such as glass, borated or not, coatings, glue or metal. To reinforce its leadership and presence in neutron research, CILAS acquired the company Grenoble Modular Instruments (GMI) a leading company in high precision mechanics, engineering and manufacturing of spectrometers and scientific equipment for neutron and synchrotron research. This merger allows us to design and to supply a complete range of high precision optical and mechanical eqipment for neutron research. CILAS and GMI have designed, manufactured and installed a High Resolution Powder Diffractometer for the 30MW Korean Hanaro Reactor. This project included the calculation, design and supply of the complete biological shielding of the instrument as well as for the primary beam shutter on the thermal beamport. (author)

Neutron guides and scientific neutron equipment at CILAS/GMI

International Nuclear Information System (INIS)

Gautier-Picard, P.

2003-01-01

CILAS company is the world's leading supplier of complete neutron guides systems. The neutron optics with multilayer coatings produced by CILAS have become an international standard for neutron beam transportation in the modern research institutes. During the last 30 years, CILAS designed, produced and installed more than 5000 meters of guides in many European, American and Asian countries. To reinforce its leadership and presence in neutron research, CILAS acquired the company Grenoble Modular Instruments (GMI), a leading company in high precision mechanics, engineering and manufacturing of spectrometers and scientific equipment for neutron and synchrotron research. (author)

Assessment and Applications of NASA Ozone Data Products Derived from Aura OMI-MLS Satellite Measurements in Context of the GMI Chemical Transport Model

Science.gov (United States)

Ziemke, J. R.; Olsen, M. A.; Witte, J. C.; Douglass, A. R.; Strahan, S. E.; Wargan, K.; Liu, X.; Schoeberl, M. R.; Yang, K.; Kaplan, T. B.;

The Sensitivity of Arctic Ozone Loss to Polar Stratospheric Cloud Volume and Chlorine and Bromine Loading in a Chemistry and Transport Model

Science.gov (United States)

Douglass, A. R.; Stolarski, R. S.; Strahan, S. E.; Polansky, B. C.

2006-01-01

The sensitivity of Arctic ozone loss to polar stratospheric cloud volume (V(sub PSC)) and chlorine and bromine loading is explored using chemistry and transport models (CTMs). A simulation using multi-decadal output from a general circulation model (GCM) in the Goddard Space Flight Center (GSFC) CTM complements one recycling a single year s GCM output in the Global Modeling Initiative (GMI) CTM. Winter polar ozone loss in the GSFC CTM depends on equivalent effective stratospheric chlorine (EESC) and polar vortex characteristics (temperatures, descent, isolation, polar stratospheric cloud amount). Polar ozone loss in the GMI CTM depends only on changes in EESC as the dynamics repeat annually. The GSFC CTM simulation reproduces a linear relationship between ozone loss and Vpsc derived from observations for 1992 - 2003 which holds for EESC within approx.85% of its maximum (approx.1990 - 2020). The GMI simulation shows that ozone loss varies linearly with EESC for constant, high V(sub PSC).

GMI发布新一代在线市场研究系统 GMI X%GMI Released a New Online Market Research System

Institute of Scientific and Technical Information of China (English)

GMI; 王凯

2009-01-01

@@ 全球领先的在线市场研究服务公司GMI日前在中国宣布,将在中国推出和应用其最新的在线研究系统--"GMI X",向中国的市场研究公司提供更精准的样本收集和分析工具,真正实现"在正确的时候从正确的人群中获取正确的信息"的市场研究的目的.这个一个月前在北美市场发布的新技术,"将在线市场研究的质量提升到一个新高度".

A New 1DVAR Retrieval for AMSR2 and GMI: Validation and Sensitivites

Science.gov (United States)

Duncan, D.; Kummerow, C. D.

2015-12-01

A new non-raining retrieval has been developed for microwave imagers and applied to the GMI and AMSR2 sensors. With the Community Radiative Transfer Model (CRTM) as the forward model for the physical retrieval, a 1-dimensional variational method finds the atmospheric state which minimizes the difference between observed and simulated brightness temperatures. A key innovation of the algorithm development is a method to calculate the sensor error covariance matrix that is specific to the forward model employed and includes off-diagonal elements, allowing the algorithm to handle various forward models and sensors with little cross-talk. The water vapor profile is resolved by way of empirical orthogonal functions (EOFs) and then summed to get total precipitable water (TPW). Validation of retrieved 10m wind speed, TPW, and sea surface temperature (SST) is performed via comparison with buoys and radiosondes as well as global models and other remotely sensed products. In addition to the validation, sensitivity experiments investigate the impact of ancillary data on the under-constrained retrieval, a concern for climate data records that strive to be independent of model biases. The introduction of model analysis data is found to aid the algorithm most at high frequency channels and affect TPW retrievals, whereas wind and cloud water retrievals show little effect from ingesting further ancillary data.

Microphysical Properties of Frozen Particles Inferred from Global Precipitation Measurement (GPM) Microwave Imager (GMI) Polarimetric Measurements

Science.gov (United States)

Gong, Jie; Wu, Dongliang

2017-01-01

Scattering differences induced by frozen particle microphysical properties are investigated, using the vertically (V) and horizontally (H) polarized radiances from the Global Precipitation Measurement (GPM) Microwave Imager (GMI) 89 and 166GHz channels. It is the first study on global frozen particle microphysical properties that uses the dual-frequency microwave polarimetric signals. From the ice cloud scenes identified by the 183.3 3GHz channel brightness temperature (TB), we find that the scatterings of frozen particles are highly polarized with V-H polarimetric differences (PD) being positive throughout the tropics and the winter hemisphere mid-latitude jet regions, including PDs from the GMI 89 and 166GHz TBs, as well as the PD at 640GHz from the ER-2 Compact Scanning Submillimeter-wave Imaging Radiometer (CoSSIR) during the TC4 campaign. Large polarization dominantly occurs mostly near convective outflow region (i.e., anvils or stratiform precipitation), while the polarization signal is small inside deep convective cores as well as at the remote cirrus region. Neglecting the polarimetric signal would result in as large as 30 error in ice water path retrievals. There is a universal bell-curve in the PD TB relationship, where the PD amplitude peaks at 10K for all three channels in the tropics and increases slightly with latitude. Moreover, the 166GHz PD tends to increase in the case where a melting layer is beneath the frozen particles aloft in the atmosphere, while 89GHz PD is less sensitive than 166GHz to the melting layer. This property creates a unique PD feature for the identification of the melting layer and stratiform rain with passive sensors. Horizontally oriented non-spherical frozen particles are thought to produce the observed PD because of different ice scattering properties in the V and H polarizations. On the other hand, changes in the ice microphysical habitats or orientation due to turbulence mixing can also lead to a reduced PD in the deep

General MACOS Interface for Modeling and Analysis for Controlled Optical Systems

Science.gov (United States)

Sigrist, Norbert; Basinger, Scott A.; Redding, David C.

2012-01-01

The General MACOS Interface (GMI) for Modeling and Analysis for Controlled Optical Systems (MACOS) enables the use of MATLAB as a front-end for JPL s critical optical modeling package, MACOS. MACOS is JPL s in-house optical modeling software, which has proven to be a superb tool for advanced systems engineering of optical systems. GMI, coupled with MACOS, allows for seamless interfacing with modeling tools from other disciplines to make possible integration of dynamics, structures, and thermal models with the addition of control systems for deformable optics and other actuated optics. This software package is designed as a tool for analysts to quickly and easily use MACOS without needing to be an expert at programming MACOS. The strength of MACOS is its ability to interface with various modeling/development platforms, allowing evaluation of system performance with thermal, mechanical, and optical modeling parameter variations. GMI provides an improved means for accessing selected key MACOS functionalities. The main objective of GMI is to marry the vast mathematical and graphical capabilities of MATLAB with the powerful optical analysis engine of MACOS, thereby providing a useful tool to anyone who can program in MATLAB. GMI also improves modeling efficiency by eliminating the need to write an interface function for each task/project, reducing error sources, speeding up user/modeling tasks, and making MACOS well suited for fast prototyping.

The new Cloud Dynamics and Radiation Database algorithms for AMSR2 and GMI: exploitation of the GPM observational database for operational applications

Science.gov (United States)

Cinzia Marra, Anna; Casella, Daniele; Martins Costa do Amaral, Lia; Sanò, Paolo; Dietrich, Stefano; Panegrossi, Giulia

2017-04-01

Two new precipitation retrieval algorithms for the Advanced Microwave Scanning Radiometer 2 (AMSR2) and for the GPM Microwave Imager (GMI) are presented. The algorithms are based on the Cloud Dynamics and Radiation Database (CDRD) Bayesian approach and represent an evolution of the previous version applied to Special Sensor Microwave Imager/Sounder (SSMIS) observations, and used operationally within the EUMETSAT Satellite Application Facility on support to Operational Hydrology and Water Management (H-SAF). These new products present as main innovation the use of an extended database entirely empirical, derived from coincident radar and radiometer observations from the NASA/JAXA Global Precipitation Measurement Core Observatory (GPM-CO) (Dual-frequency Precipitation Radar-DPR and GMI). The other new aspects are: 1) a new rain-no-rain screening approach; 2) the use of Empirical Orthogonal Functions (EOF) and Canonical Correlation Analysis (CCA) both in the screening approach, and in the Bayesian algorithm; 2) the use of new meteorological and environmental ancillary variables to categorize the database and mitigate the problem of non-uniqueness of the retrieval solution; 3) the development and implementations of specific modules for computational time minimization. The CDRD algorithms for AMSR2 and GMI are able to handle an extremely large observational database available from GPM-CO and provide the rainfall estimate with minimum latency, making them suitable for near-real time hydrological and operational applications. As far as CDRD for AMSR2, a verification study over Italy using ground-based radar data and over the MSG full disk area using coincident GPM-CO/AMSR2 observations has been carried out. Results show remarkable AMSR2 capabilities for rainfall rate (RR) retrieval over ocean (for RR > 0.25 mm/h), good capabilities over vegetated land (for RR > 1 mm/h), while for coastal areas the results are less certain. Comparisons with NASA GPM products, and with

Assessment of WRF microphysics schemes to simulate extreme precipitation events from the perspective of GMI radiative signatures

Science.gov (United States)

Choi, Y.; Shin, D. B.; Joh, M.

2015-12-01

Numerical simulations of precipitation depend to a large degree on the assumed cloud microphysics schemes representing the formation, growth and fallout of cloud droplets and ice crystals. Recent studies show that assumed cloud microphysics play a major role not only in forecasting precipitation, especially in cases of extreme precipitation events, but also in the quality of the passive microwave rainfall estimation. Evaluations of the various Weather Research Forecasting (WRF) model microphysics schemes in this study are based on a method that was originally developed to construct the a-priori databases of precipitation profiles and associated brightness temperatures (TBs) for precipitation retrievals. This methodology generates three-dimensional (3D) precipitation fields by matching the GPM dual frequency radar (DPR) reflectivity profiles with those calculated from cloud resolving model (CRM)-derived hydrometeor profiles. The method eventually provides 3D simulated precipitation fields over the DPR scan swaths. That is, atmospheric and hydrometeor profiles can be generated at each DPR pixel based on CRM and DPR reflectivity profiles. The generated raining systems over DPR observation fields can be applied to any radiometers that are unaccompanied with a radar for microwave radiative calculation with consideration of each sensor's channel and field of view. Assessment of the WRF model microphysics schemes for several typhoon cases in terms of emission and scattering signals of GMI will be discussed.

Meningococcal disease in the Asia-Pacific region: Findings and recommendations from the Global Meningococcal Initiative.

Science.gov (United States)

Borrow, Ray; Lee, Jin-Soo; Vázquez, Julio A; Enwere, Godwin; Taha, Muhamed-Kheir; Kamiya, Hajime; Kim, Hwang Min; Jo, Dae Sun

2016-11-21

The Global Meningococcal Initiative (GMI) is a global expert group that includes scientists, clinicians, and public health officials with a wide range of specialties. The purpose of the Initiative is to promote the global prevention of meningococcal disease (MD) through education, research, and cooperation. The first Asia-Pacific regional meeting was held in November 2014. The GMI reviewed the epidemiology of MD, surveillance, and prevention strategies, and outbreak control practices from participating countries in the Asia-Pacific region.Although, in general, MD is underreported in this region, serogroup A disease is most prominent in low-income countries such as India and the Philippines, while Taiwan, Japan, and Korea reported disease from serogroups C, W, and Y. China has a mixed epidemiology of serogroups A, B, C, and W. Perspectives from countries outside of the region were also provided to provide insight into lessons learnt. Based on the available data and meeting discussions, a number of challenges and data gaps were identified and, as a consequence, several recommendations were formulated: strengthen surveillance; improve diagnosis, typing and case reporting; standardize case definitions; develop guidelines for outbreak management; and promote awareness of MD among healthcare professionals, public health officials, and the general public. Copyright © 2016. Published by Elsevier Ltd.

Evaluation of GMI and PMI diffeomorphic‐based demons algorithms for aligning PET and CT Images

Science.gov (United States)

Yang, Juan; Zhang, You; Yin, Yong

2015-01-01

Fusion of anatomic information in computed tomography (CT) and functional information in F18‐FDG positron emission tomography (PET) is crucial for accurate differentiation of tumor from benign masses, designing radiotherapy treatment plan and staging of cancer. Although current PET and CT images can be acquired from combined F18‐FDG PET/CT scanner, the two acquisitions are scanned separately and take a long time, which may induce potential positional errors in global and local caused by respiratory motion or organ peristalsis. So registration (alignment) of whole‐body PET and CT images is a prerequisite for their meaningful fusion. The purpose of this study was to assess the performance of two multimodal registration algorithms for aligning PET and CT images. The proposed gradient of mutual information (GMI)‐based demons algorithm, which incorporated the GMI between two images as an external force to facilitate the alignment, was compared with the point‐wise mutual information (PMI) diffeomorphic‐based demons algorithm whose external force was modified by replacing the image intensity difference in diffeomorphic demons algorithm with the PMI to make it appropriate for multimodal image registration. Eight patients with esophageal cancer(s) were enrolled in this IRB‐approved study. Whole‐body PET and CT images were acquired from a combined F18‐FDG PET/CT scanner for each patient. The modified Hausdorff distance (dMH) was used to evaluate the registration accuracy of the two algorithms. Of all patients, the mean values and standard deviations (SDs) of dMH were 6.65 (± 1.90) voxels and 6.01 (± 1.90) after the GMI‐based demons and the PMI diffeomorphic‐based demons registration algorithms respectively. Preliminary results on oncological patients showed that the respiratory motion and organ peristalsis in PET/CT esophageal images could not be neglected, although a combined F18‐FDG PET/CT scanner was used for image acquisition. The PMI

Evaluating model parameterizations of submicron aerosol scattering and absorption with in situ data from ARCTAS 2008

Directory of Open Access Journals (Sweden)

M. J. Alvarado

2016-07-01

Full Text Available Accurate modeling of the scattering and absorption of ultraviolet and visible radiation by aerosols is essential for accurate simulations of atmospheric chemistry and climate. Closure studies using in situ measurements of aerosol scattering and absorption can be used to evaluate and improve models of aerosol optical properties without interference from model errors in aerosol emissions, transport, chemistry, or deposition rates. Here we evaluate the ability of four externally mixed, fixed size distribution parameterizations used in global models to simulate submicron aerosol scattering and absorption at three wavelengths using in situ data gathered during the 2008 Arctic Research of the Composition of the Troposphere from Aircraft and Satellites (ARCTAS campaign. The four models are the NASA Global Modeling Initiative (GMI Combo model, GEOS-Chem v9-02, the baseline configuration of a version of GEOS-Chem with online radiative transfer calculations (called GC-RT, and the Optical Properties of Aerosol and Clouds (OPAC v3.1 package. We also use the ARCTAS data to perform the first evaluation of the ability of the Aerosol Simulation Program (ASP v2.1 to simulate submicron aerosol scattering and absorption when in situ data on the aerosol size distribution are used, and examine the impact of different mixing rules for black carbon (BC on the results. We find that the GMI model tends to overestimate submicron scattering and absorption at shorter wavelengths by 10–23 %, and that GMI has smaller absolute mean biases for submicron absorption than OPAC v3.1, GEOS-Chem v9-02, or GC-RT. However, the changes to the density and refractive index of BC in GC-RT improve the simulation of submicron aerosol absorption at all wavelengths relative to GEOS-Chem v9-02. Adding a variable size distribution, as in ASP v2.1, improves model performance for scattering but not for absorption, likely due to the assumption in ASP v2.1 that BC is present at a constant mass

Simple sequence repeats and compositional bias in the bipartite Ralstonia solanacearum GMI1000 genome

Directory of Open Access Journals (Sweden)

Vandamme Peter

2003-03-01

Full Text Available Abstract Background Ralstonia solanacearum is an important plant pathogen. The genome of R. solananearum GMI1000 is organised into two replicons (a 3.7-Mb chromosome and a 2.1-Mb megaplasmid and this bipartite genome structure is characteristic for most R. solanacearum strains. To determine whether the megaplasmid was acquired via recent horizontal gene transfer or is part of an ancestral single chromosome, we compared the abundance, distribution and compositon of simple sequence repeats (SSRs between both replicons and also compared the respective compositional biases. Results Our data show that both replicons are very similar in respect to distribution and composition of SSRs and presence of compositional biases. Minor variations in SSR and compositional biases observed may be attributable to minor differences in gene expression and regulation of gene expression or can be attributed to the small sample numbers observed. Conclusions The observed similarities indicate that both replicons have shared a similar evolutionary history and thus suggest that the megaplasmid was not recently acquired from other organisms by lateral gene transfer but is a part of an ancestral R. solanacearum chromosome.

Using beryllium-7 to assess cross-tropopause transport in global models

Energy Technology Data Exchange (ETDEWEB)

Liu, Hongyu [National Institute of Aerospace, Hampton, VA (United States); Considine, David B. [NASA Langley Research Center, Hampton, VA (United States); Horowitz, Larry W. [NOAA Geophysical Fluid and Dynamics Laboratory, Princeton, NJ (United States); and others

2016-07-01

We use the Global Modeling Initiative (GMI) modeling framework to assess the utility of cosmogenic beryllium-7 ({sup 7}Be), a natural aerosol tracer, for evaluating cross-tropopause transport in global models. The GMI chemical transport model (CTM) was used to simulate atmospheric {sup 7}Be distributions using four different meteorological data sets (GEOS1-STRAT DAS, GISS II{sup '} GCM, fvGCM, and GEOS4-DAS), featuring significantly different stratosphere-troposphere exchange (STE) characteristics. The simulations were compared with the upper troposphere and/or lower stratosphere (UT/LS) {sup 7}Be climatology constructed from ∝ 25 years of aircraft and balloon data, as well as climatological records of surface concentrations and deposition fluxes. Comparison of the fraction of surface air of stratospheric origin estimated from the {sup 7}Be simulations with observationally derived estimates indicates excessive cross-tropopause transport at mid-latitudes in simulations using GEOS1-STRAT and at high latitudes using GISS II{sup '} meteorological data. These simulations also overestimate {sup 7}Be deposition fluxes at mid-latitudes (GEOS1-STRAT) and at high latitudes (GISS II{sup '}), respectively. We show that excessive cross-tropopause transport of {sup 7}Be corresponds to overestimated stratospheric contribution to tropospheric ozone. Our perspectives on STE in these meteorological fields based on {sup 7}Be simulations are consistent with previous modeling studies of tropospheric ozone using the same meteorological fields. We conclude that the observational constraints for {sup 7}Be and observed {sup 7}Be total deposition fluxes can be used routinely as a first-order assessment of cross-tropopause transport in global models.

On-road heavy-duty diesel particulate matter emissions modeled using chassis dynamometer data.

Science.gov (United States)

Kear, Tom; Niemeier, D A

2006-12-15

This study presents a model, derived from chassis dynamometer test data, for factors (operational correction factors, or OCFs) that correct (g/mi) heavy-duty diesel particle emission rates measured on standard test cycles for real-world conditions. Using a random effects mixed regression model with data from 531 tests of 34 heavy-duty vehicles from the Coordinating Research Council's E55/E59 research project, we specify a model with covariates that characterize high power transient driving, time spent idling, and average speed. Gram per mile particle emissions rates were negatively correlated with high power transient driving, average speed, and time idling. The new model is capable of predicting relative changes in g/mi on-road heavy-duty diesel particle emission rates for real-world driving conditions that are not reflected in the driving cycles used to test heavy-duty vehicles.

Effect of annealing on the second harmonic amplitude of Giant Magneto-Impedance (GMI) voltage of a Co-Fe-Si-B amorphous wire

Energy Technology Data Exchange (ETDEWEB)

Pal, S.K. [National Metallurgical Laboratory, Jamshedpur 831007 (India)], E-mail: skp@nmlindia.org; Panda, A.K.; Mitra, A. [National Metallurgical Laboratory, Jamshedpur 831007 (India)

2008-02-15

Second harmonic amplitude (V{sub 2f}) of Giant Magneto-Impedance (GMI) voltage of (Fe{sub 6}Co{sub 94}){sub 72.5}Si{sub 12.5}B{sub 15} amorphous wires has been studied systematically for as-cast and Joule-heated states. Joule heating was carried out at current densities (J) of 20-40 A/mm{sup 2} for a period of 1-300 min. The amplitude of the second harmonic voltage (V{sub 2f}) initially increased with J, attained maximum and then decreased. The maximum amplitude of V{sub 2f} was observed for the sample annealed at J=25 A/mm{sup 2} for 5 min. The second harmonic peak shifted towards the higher field side with the increase of annealing current density and annealing period (t{sub p}). Few-fold increase in the amplitude of the second harmonic voltage (V{sub 2f}) was observed due to the presence of a small dc bias current (I{sub b}) of amplitude 1 mA. The asymmetry in V{sub 2f} was also observed in a Joule-heated sample. The observed asymmetry has been correlated with the bias field generated between the surface crystallized layer and the amorphous core. A small bias current of amplitude of 1 mA was applied along the direction of the applied field to minimize the asymmetry.

Meningococcal disease in the Middle East and Africa: Findings and updates from the Global Meningococcal Initiative.

Science.gov (United States)

Borrow, Ray; Caugant, Dominique A; Ceyhan, Mehmet; Christensen, Hannah; Dinleyici, Ener Cagri; Findlow, Jamie; Glennie, Linda; Von Gottberg, Anne; Kechrid, Amel; Vázquez Moreno, Julio; Razki, Aziza; Smith, Vincent; Taha, Muhamed-Kheir; Tali-Maamar, Hassiba; Zerouali, Khalid

2017-07-01

The Global Meningococcal Initiative (GMI) has recently considered current issues in Middle Eastern and African countries, and produced two recommendations: (i) that vaccination of attendees should be considered for some types of mass-gathering events, as some countries mandate for the Hajj, and (ii) vaccination of people with human immunodeficiency virus should be used routinely, because of increased meningococcal disease (MD) risk. Differences exist between Middle Eastern and African countries regarding case and syndrome definitions, surveillance, and epidemiologic data gaps. Sentinel surveillance provides an overview of trends and prevalence of different capsular groups supporting vaccine selection and planning, whereas cost-effectiveness decisions require comprehensive disease burden data, ideally counting every case. Surveillance data showed importance of serogroup B MD in North Africa and serogroup W expansion in Turkey and South Africa. Success of MenAfriVac ® in the African "meningitis belt" was reviewed; the GMI believes similar benefits may follow development of a low-cost meningococcal pentavalent vaccine, currently in phase 1 clinical trial, by 2022. The importance of carriage and herd protection for controlling invasive MD and the importance of advocacy and awareness campaigns were also highlighted. Copyright © 2017 The Authors. Published by Elsevier Ltd.. All rights reserved.

Three dimensional simulation of giant magneto-impedance effect in thin film structures

KAUST Repository

Li, Bodong; Kosel, Jü rgen

2011-01-01

In this paper, a three dimensional model for the giant magneto-impedance (GMI) effect in thin film structures is developed using the finite element method(FEM) with a GMI permeability model embedded. One-layer, three-layer, and five-layer thin film structures are simulated. The GMI effect and the sensitivity are calculated as a function of the external magnetic field, driving frequency, and the thickness of the magnetic layers. The results show that the five-layer structure has the best performance, which is in accordance with experimental results. The GMI ratio and the sensitivity first improve with the increasing thickness of the magnetic layer but reach saturation at a certain value of the thickness. In a five-layer structure,saturation of the GMI effect becomes effective at about 3 μm thickness of the magnetic layers, where a GMI ratio of 1125% was obtained, with a corresponding sensitivity of 0.37%/A/m (29.6%/Oe).

Three dimensional simulation of giant magneto-impedance effect in thin film structures

KAUST Repository

Li, Bodong

2011-04-04

In this paper, a three dimensional model for the giant magneto-impedance (GMI) effect in thin film structures is developed using the finite element method(FEM) with a GMI permeability model embedded. One-layer, three-layer, and five-layer thin film structures are simulated. The GMI effect and the sensitivity are calculated as a function of the external magnetic field, driving frequency, and the thickness of the magnetic layers. The results show that the five-layer structure has the best performance, which is in accordance with experimental results. The GMI ratio and the sensitivity first improve with the increasing thickness of the magnetic layer but reach saturation at a certain value of the thickness. In a five-layer structure,saturation of the GMI effect becomes effective at about 3 μm thickness of the magnetic layers, where a GMI ratio of 1125% was obtained, with a corresponding sensitivity of 0.37%/A/m (29.6%/Oe).

A polar stratospheric cloud parameterization for the global modeling initiative three-dimensional model and its response to stratospheric aircraft

International Nuclear Information System (INIS)

Considine, D. B.; Douglass, A. R.; Connell, P. S.; Kinnison, D. E.; Rotman, D. A.

2000-01-01

We describe a new parameterization of polar stratospheric clouds (PSCs) which was written for and incorporated into the three-dimensional (3-D) chemistry and transport model (CTM) developed for NASA's Atmospheric Effects of Aviation Project (AEAP) by the Global Modeling Initiative (GMI). The parameterization was designed to respond to changes in NO y and H 2 O produced by high-speed civilian transport (HSCT) emissions. The parameterization predicts surface area densities (SADs) of both Type 1 and Type 2 PSCs for use in heterogeneous chemistry calculations. Type 1 PSCs are assumed to have a supercooled ternary sulfate (STS) composition, and Type 2 PSCs are treated as water ice with a coexisting nitric acid trihydrate (NAT) phase. Sedimentation is treated by assuming that the PSC particles obey lognormal size distributions, resulting in a realistic mass flux of condensed phase H 2 O and HNO 3 . We examine a simulation of the Southern Hemisphere high-latitude lower stratosphere winter and spring seasons driven by temperature and wind fields from a modified version of the National Center for Atmospheric Research (NCAR) Middle Atmosphere Community Climate Model Version 2 (MACCM2). Predicted PSC SADs and median radii for both Type 1 and Type 2 PSCs are consistent with observations. Gas phase HNO 3 and H 2 O concentrations in the high-latitude lower stratosphere qualitatively agree with Cryogenic Limb Array Etalon Spectrometer (CLAES) HNO 3 and Microwave Limb Sounder (MLS) H 2 O observations. The residual denitrification and dehydration of the model polar vortex after polar winter compares well with atmospheric trace molecule spectroscopy (ATMOS) observations taken during November 1994. When the NO x and H 2 O emissions of a standard 500-aircraft HSCT fleet with a NO x emission index of 5 are added, NO x and H 2 O concentrations in the Southern Hemisphere polar vortex before winter increase by up to 3%. This results in earlier onset of PSC formation, denitrification, and

Sensitivity of aerosol indirect forcing and autoconversion to cloud droplet parameterization: an assessment with the NASA Global Modeling Initiative.

Science.gov (United States)

Sotiropoulou, R. P.; Meshkhidze, N.; Nenes, A.

2006-12-01

The aerosol indirect forcing is one of the largest sources of uncertainty in assessments of anthropogenic climate change [IPCC, 2001]. Much of this uncertainty arises from the approach used for linking cloud droplet number concentration (CDNC) to precursor aerosol. Global Climate Models (GCM) use a wide range of cloud droplet activation mechanisms ranging from empirical [Boucher and Lohmann, 1995] to detailed physically- based formulations [e.g., Abdul-Razzak and Ghan, 2000; Fountoukis and Nenes, 2005]. The objective of this study is to assess the uncertainties in indirect forcing and autoconversion of cloud water to rain caused by the application of different cloud droplet parameterization mechanisms; this is an important step towards constraining the aerosol indirect effects (AIE). Here we estimate the uncertainty in indirect forcing and autoconversion rate using the NASA Global Model Initiative (GMI). The GMI allows easy interchange of meteorological fields, chemical mechanisms and the aerosol microphysical packages. Therefore, it is an ideal tool for assessing the effect of different parameters on aerosol indirect forcing. The aerosol module includes primary emissions, chemical production of sulfate in clear air and in-cloud aqueous phase, gravitational sedimentation, dry deposition, wet scavenging in and below clouds, and hygroscopic growth. Model inputs include SO2 (fossil fuel and natural), black carbon (BC), organic carbon (OC), mineral dust and sea salt. The meteorological data used in this work were taken from the NASA Data Assimilation Office (DAO) and two different GCMs: the NASA GEOS4 finite volume GCM (FVGCM) and the Goddard Institute for Space Studies version II' (GISS II') GCM. Simulations were carried out for "present day" and "preindustrial" emissions using different meteorological fields (i.e. DAO, FVGCM, GISS II'); cloud droplet number concentration is computed from the correlations of Boucher and Lohmann [1995], Abdul-Razzak and Ghan [2000

Design and Fabrication of a Miniaturized GMI Magnetic Sensor Based on Amorphous Wire by MEMS Technology

Directory of Open Access Journals (Sweden)

Jiawen Chen

2018-03-01

Full Text Available A miniaturized Co-based amorphous wire GMI (Giant magneto-impedance magnetic sensor was designed and fabricated in this paper. The Co-based amorphous wire was used as the sense element due to its high sensitivity to the magnetic field. A three-dimensional micro coil surrounding the Co-based amorphous wire was fabricated by MEMS (Micro-Electro-Mechanical System technology, which was used to extract the electrical signal. The three-dimensional micro pick-up coil was designed and simulated with HFSS (High Frequency Structure Simulator software to determine the key parameters. Surface micro machining MEMS (Micro-Electro-Mechanical System technology was employed to fabricate the three-dimensional coil. The size of the developed amorphous wire magnetic sensor is 5.6 × 1.5 × 1.1 mm3. Helmholtz coil was used to characterize the performance of the device. The test results of the sensor sample show that the voltage change is 130 mV/Oe and the linearity error is 4.83% in the range of 0~45,000 nT. The results indicate that the developed miniaturized magnetic sensor has high sensitivity. By testing the electrical resistance of the samples, the results also showed high uniformity of each device.

Low Ozone over Europe Doesn't Mean the Sky Is Falling, Its Actually Rising

Science.gov (United States)

Strahan, Susan; Newman, Paul; Steenrod, Stephen

2016-01-01

Data Sources: NASA Aura Microwave Limb Sounder (MLS) (O3 profiles and columns), NASA Global Modeling Initiative (GMI) Chemistry and Transport Model (calculated O3depletion), and MERRA Tropopause Heights. Technical Description of Figures: The left graphics show MLS northern hemisphere stratospheric column ozone on Feb. 1, 2016. Very low columns are seen over the UK and Europe (<225 DU, inside dashed circle). The lower graphic shows the GMI-calculated O3 depletion. It's very small, suggesting the low O3 does not indicate significant depletion. The right graphics show how the high tropopause height in this region explains the observed low ozone. The lower panel shows that the high tropopause on Feb. 1 lifts the O3 profile compared to a typical profile found earlier in winter. This motion lifts the profile to lower pressures thus reducing the total column. The GMI Model shows only 4 Dobson Units (DU) of O3 depletion even though the column is more than 100 DU lower than one month earlier. Scientific significant and societal relevance: To quantitatively understand anthropogenic impacts to the stratospheric ozone layer, we must be able to distinguish between low ozone caused by ozone depleting substances and that caused by natural dynamical variability in the atmosphere. Observations and realistic simulations of atmospheric composition are both required in order to separate natural and anthropogenic ozone variability.

Magneto-Impedance behavior of Co-Fe-Nb-Si-B-based ribbons

Energy Technology Data Exchange (ETDEWEB)

Sarkar, Partha; Mohanta, O.; Pal, S.K.; Panda, A.K. [National Metallurgical Laboratory, Council of Scientific and Industrial Research, Jamshedpur 831007 (India); Mitra, A., E-mail: amitra@nmlindia.or [National Metallurgical Laboratory, Council of Scientific and Industrial Research, Jamshedpur 831007 (India)

2010-04-15

The giant magneto-impedance of melt spun Co{sub x}Fe{sub 72-x}Nb{sub 4}Si{sub 4}B{sub 20}(x=10, 20, 36, 50) amorphous and nanostructured ribbons have been investigated. Alloys have been optimized at the driving current amplitude, frequency and found that amorphous ribbon of nominal composition of Co{sub 36}Fe{sub 36}Nb{sub 4}Si{sub 4}B{sub 20} shown maximum GMI ratio of 13%. The behaviour of the driving current amplitude on the GMI behaviour was studied and the sample was optimized for driving current amplitude, I{sub ac}=10 mA. The frequency dependence of the GMI behaviour was studied for the ribbon sample Co{sub 36}Fe{sub 36}Nb{sub 4}Si{sub 4}B{sub 20} at frequency in the range of 100 kHz-1.2 MHz of the optimized driving current amplitude and it was found that the sample showed the maximum GMI behaviour at f=700 kHz. The optimized samples were Joule heated at the current density J=0-35 A/m{sup 2} for a period of 1 min. The GMI ratio initially increased then progressively deteriorated with J, but after a certain range it shows up to 16% of improvement in the magneto-impedance value due the increase of nanocrystalline volume fraction. The asymmetry in the GMI profile was observed for the sample Joule heated at J=1-5 A/m{sup 2} for 1 min.

The spring 2011 final stratospheric warming above Eureka: anomalous dynamics and chemistry

Directory of Open Access Journals (Sweden)

C. Adams

2013-01-01

Full Text Available In spring 2011, the Arctic polar vortex was stronger than in any other year on record. As the polar vortex started to break up in April, ozone and NO₂ columns were measured with UV-visible spectrometers above the Polar Environment Atmospheric Research Laboratory (PEARL in Eureka, Canada (80.05° N, 86.42° W using the differential optical absorption spectroscopy (DOAS technique. These ground-based column measurements were complemented by Ozone Monitoring Instrument (OMI and Optical Spectrograph and Infra-Red Imager System (OSIRIS satellite measurements, Global Modeling Initiative (GMI simulations, and meteorological quantities. On 8 April 2011, NO₂ columns above PEARL from the DOAS, OMI, and GMI datasets were approximately twice as large as in previous years. On this day, temperatures and ozone volume mixing ratios above Eureka were high, suggesting enhanced chemical production of NO₂ from NO. Additionally, GMI NO_x (NO + NO₂ and N₂O fields suggest that downward transport along the vortex edge and horizontal transport from lower latitudes also contributed to the enhanced NO₂. The anticyclone that transported lower-latitude NO_x above PEARL became frozen-in and persisted in dynamical and GMI N₂O fields until the end of the measurement period on 31 May 2011. Ozone isolated within this frozen-in anticyclone (FrIAC in the middle stratosphere was lost due to reactions with the enhanced NO_x. Below the FrIAC (from the tropopause to 700 K, NO_x driven ozone loss above Eureka was larger than in previous years, according to GMI monthly average ozone loss rates. Using the passive tracer technique, with passive ozone profiles from the Lagrangian Chemistry and Transport Model, ATLAS, ozone losses since 1 December 2010 were calculated at 600 K. In the air mass that was above Eureka on 20 May 2011, ozone losses reached 4.2 parts per million by

Impacts of model initialization on an integrated surface water - groundwater model

KAUST Repository

Ajami, Hoori

2015-04-01

Integrated hydrologic models characterize catchment responses by coupling the subsurface flow with land surface processes. One of the major areas of uncertainty in such models is the specification of the initial condition and its influence on subsequent simulations. A key challenge in model initialization is that it requires spatially distributed information on model states, groundwater levels and soil moisture, even when such data are not routinely available. Here, the impact of uncertainty in initial condition was explored across a 208 km2 catchment in Denmark using the ParFlow.CLM model. The initialization impact was assessed under two meteorological conditions (wet vs dry) using five depth to water table and soil moisture distributions obtained from various equilibrium states (thermal, root zone, discharge, saturated and unsaturated zone equilibrium) during the model spin-up. Each of these equilibrium states correspond to varying computation times to achieve stability in a particular aspect of the system state. Results identified particular sensitivity in modelled recharge and stream flow to the different initializations, but reduced sensitivity in modelled energy fluxes. Analysis also suggests that to simulate a year that is wetter than the spin-up period, an initialization based on discharge equilibrium is adequate to capture the direction and magnitude of surface water–groundwater exchanges. For a drier or hydrologically similar year to the spin-up period, an initialization based on groundwater equilibrium is required. Variability of monthly subsurface storage changes and discharge bias at the scale of a hydrological event show that the initialization impacts do not diminish as the simulations progress, highlighting the importance of robust and accurate initialization in capturing surface water–groundwater dynamics.

Correlation between Circulating Fungal Biomarkers and Clinical Outcome in Invasive Aspergillosis.

Directory of Open Access Journals (Sweden)

Dionysios Neofytos

Full Text Available Objective means are needed to predict and assess clinical response in patients treated for invasive aspergillosis (IA. We examined whether early changes in serum galactomannan (GM and/or β-D-glucan (BDG can predict clinical outcomes. Patients with proven or probable IA were prospectively enrolled, and serial GM and BDG levels and GM optical density indices (GMI were calculated twice weekly for 6 weeks following initiation of standard-of-care antifungal therapy. Changes in these biomarkers during the first 2 and 6 weeks of treatment were analyzed for associations with clinical response and survival at weeks 6 and 12. Among 47 patients with IA, 53.2% (25/47 and 65.9% (27/41 had clinical response by weeks 6 and 12, respectively. Changes in biomarkers during the first 2 weeks were associated with clinical response at 6 weeks (GMI, P = 0.03 and 12 weeks (GM+BDG composite, P = 0.05; GM, P = 0.04; GMI, P = 0.02. Changes in biomarkers during the first 6 weeks were also associated with clinical response at 6 weeks (GM, P = 0.05; GMI, P = 0.03 and 12 weeks (BDG+GM, P = 0.02; GM, P = 0.02; GMI, P = 0.01. Overall survival rates at 6 weeks and 12 weeks were 87.2% (41/47 and 79.1% (34/43, respectively. Decreasing biomarkers in the first 2 weeks were associated with survival at 6 weeks (BDG+GM, P = 0.03; BDG, P = 0.01; GM, P = 0.03 and at 12 weeks (BDG+GM, P = 0.01; BDG, P = 0.03; GM, P = 0.01; GMI, P = 0.007. Similar correlations occurred for biomarkers measured over 6 weeks. Patients with negative baseline GMI and/or persistently negative GMI during the first 2 weeks were more likely to have CR and survival. These results suggest that changes of biomarkers may be informative to predict and/or assess response to therapy and survival in patients treated for IA.

77 FR 62623 - 2017 and Later Model Year Light-Duty Vehicle Greenhouse Gas Emissions and Corporate Average Fuel...

Science.gov (United States)

2012-10-15

... changes to the regulations applicable to model years 2012-2016, with respect to air conditioner... standards for emissions of pollutants from new motor vehicles which emissions cause or contribute to air... same improvements in air conditioner efficiency. \\5\\ This is further broken down by 5.0 and 7.2 g/mi...

Green Manufacturing

Energy Technology Data Exchange (ETDEWEB)

Patten, John

2013-12-31

Green Manufacturing Initiative (GMI): The initiative provides a conduit between the university and industry to facilitate cooperative research programs of mutual interest to support green (sustainable) goals and efforts. In addition to the operational savings that greener practices can bring, emerging market demands and governmental regulations are making the move to sustainable manufacturing a necessity for success. The funding supports collaborative activities among universities such as the University of Michigan, Michigan State University and Purdue University and among 40 companies to enhance economic and workforce development and provide the potential of technology transfer. WMU participants in the GMI activities included 20 faculty, over 25 students and many staff from across the College of Engineering and Applied Sciences; the College of Arts and Sciences' departments of Chemistry, Physics, Biology and Geology; the College of Business; the Environmental Research Institute; and the Environmental Studies Program. Many outside organizations also contribute to the GMI's success, including Southwest Michigan First; The Right Place of Grand Rapids, MI; Michigan Department of Environmental Quality; the Michigan Department of Energy, Labor and Economic Growth; and the Michigan Manufacturers Technical Center.

Initiating Events Modeling for On-Line Risk Monitoring Application

International Nuclear Information System (INIS)

Simic, Z.; Mikulicic, V.

1998-01-01

In order to make on-line risk monitoring application of Probabilistic Risk Assessment more complete and realistic, a special attention need to be dedicated to initiating events modeling. Two different issues are of special importance: one is how to model initiating events frequency according to current plant configuration (equipment alignment and out of service status) and operating condition (weather and various activities), and the second is how to preserve dependencies between initiating events model and rest of PRA model. First, the paper will discuss how initiating events can be treated in on-line risk monitoring application. Second, practical example of initiating events modeling in EPRI's Equipment Out of Service on-line monitoring tool will be presented. Gains from application and possible improvements will be discussed in conclusion. (author)

Dynamic crack initiation toughness : experiments and peridynamic modeling.

Energy Technology Data Exchange (ETDEWEB)

Foster, John T.

2009-10-01

This is a dissertation on research conducted studying the dynamic crack initiation toughness of a 4340 steel. Researchers have been conducting experimental testing of dynamic crack initiation toughness, K{sub Ic}, for many years, using many experimental techniques with vastly different trends in the results when reporting K{sub Ic} as a function of loading rate. The dissertation describes a novel experimental technique for measuring K{sub Ic} in metals using the Kolsky bar. The method borrows from improvements made in recent years in traditional Kolsky bar testing by using pulse shaping techniques to ensure a constant loading rate applied to the sample before crack initiation. Dynamic crack initiation measurements were reported on a 4340 steel at two different loading rates. The steel was shown to exhibit a rate dependence, with the recorded values of K{sub Ic} being much higher at the higher loading rate. Using the knowledge of this rate dependence as a motivation in attempting to model the fracture events, a viscoplastic constitutive model was implemented into a peridynamic computational mechanics code. Peridynamics is a newly developed theory in solid mechanics that replaces the classical partial differential equations of motion with integral-differential equations which do not require the existence of spatial derivatives in the displacement field. This allows for the straightforward modeling of unguided crack initiation and growth. To date, peridynamic implementations have used severely restricted constitutive models. This research represents the first implementation of a complex material model and its validation. After showing results comparing deformations to experimental Taylor anvil impact for the viscoplastic material model, a novel failure criterion is introduced to model the dynamic crack initiation toughness experiments. The failure model is based on an energy criterion and uses the K{sub Ic} values recorded experimentally as an input. The failure model

Diurnal Variation of Tropical Ice Cloud Microphysics inferred from Global Precipitation Measurement Microwave Imager (GPM-GMI)'s Polarimetric Measurement

Science.gov (United States)

Gong, J.; Zeng, X.; Wu, D. L.; Li, X.

2017-12-01

Diurnal variation of tropical ice cloud has been well observed and examined in terms of the area of coverage, occurring frequency, and total mass, but rarely on ice microphysical parameters (habit, size, orientation, etc.) because of lack of direct measurements of ice microphysics on a high temporal and spatial resolutions. This accounts for a great portion of the uncertainty in evaluating ice cloud's role on global radiation and hydrological budgets. The design of Global Precipitation Measurement (GPM) mission's procession orbit gives us an unprecedented opportunity to study the diurnal variation of ice microphysics on the global scale for the first time. Dominated by cloud ice scattering, high-frequency microwave polarimetric difference (PD, namely the brightness temperature difference between vertically- and horizontally-polarized paired channel measurements) from the GPM Microwave Imager (GMI) has been proven by our previous study to be very valuable to infer cloud ice microphysical properties. Using one year of PD measurements at 166 GHz, we found that cloud PD exhibits a strong diurnal cycle in the tropics (25S-25N). The peak PD amplitude varies as much as 35% over land, compared to only 6% over ocean. The diurnal cycle of the peak PD value is strongly anti-correlated with local ice cloud occurring frequency and the total ice mass with a leading period of 3 hours for the maximum correlation. The observed PD diurnal cycle can be explained by the change of ice crystal axial ratio. Using a radiative transfer model, we can simulate the observed 166 GHz PD-brightness temperature curve as well as its diurnal variation using different axial ratio values, which can be caused by the diurnal variation of ice microphysical properties including particle size, percentage of horizontally-aligned non-spherical particles, and ice habit. The leading of the change of PD ahead of ice cloud mass and occurring frequency implies the important role microphysics play in the

Modelling the initiation of basal sliding

Science.gov (United States)

Mantelli, E.; Schoof, C.

2017-12-01

The initiation of basal sliding is a thermally-controlled process that affects ice speed, englacial heat transport, and melt water production at the bed, and ultimately influences the large-scale dynamics of ice sheets. From a modelling perspective, describing the onset of sliding in thin-film models suitable for ice sheet scale simulations is problematic. In particular, previous work concluded that, under shallow-ice mechanics, the scenario of a hard switch from frozen to molten bed leads to an infinite vertical velocity at the onset, and higher-order mechanical formulations are needed to describe sliding initiation. An alternative view considers the occurrence of subtemperate sliding, which allows for a smooth sliding velocity across the onset. However, the sliding velocity decreases rapidly as temperature drops below the melting point, thus raising the issue of whether a mechanical model that does not resolve the ice sheet thickness scale is ever appropriate to model the onset of sliding. In this study we first present a boundary layer model for the hard switch scenario. Our analysis, which considers a thermo-mechanically coupled Stokes flow near the onset, shows that the abrupt onset of sliding is never possible. In fact, the acceleration of ice flow deflects the flowlines towards the bed, which freezes again immediately downstream to the onset. This leads to the conclusion that the sliding velocity must change smoothly across the onset, thus the temperature dependence of sliding needs to be taken into account. In this context, we examine a limiting case of standard temperature-dependent sliding laws, where sliding onset takes the form of an extended transition region interposed between fully frozen and temperate bed. In the transition region basal temperature is at the melting point, and the sliding velocity varies smoothly as dictated by the energy budget of the bed. As the extent of this region is not small compared to the ice sheet length scale, we couple

The Disturbing Effect of the Stray Magnetic Fields on Magnetoimpedance Sensors

Directory of Open Access Journals (Sweden)

Tao Wang

2016-10-01

Full Text Available The disturbing effect of the stray magnetic fields of Fe-based amorphous ribbons on the giant magnetoimpedance (GMI sensor has been investigated systematically in this paper. Two simple methods were used for examining the disturbing effect of the stray magnetic fields of ribbons on the GMI sensor. In order to study the influence of the stray magnetic fields on the GMI effect, the square-shaped amorphous ribbons were tested in front, at the back, on the left and on the top of a meander-line GMI sensor made up of soft ferromagnetic films, respectively. Experimental results show that the presence of ribbons in front or at the back of GMI sensor shifts the GMI curve to a lower external magnetic field. On the contrary, the presence of ribbons on the left or on the top of the GMI sensor shifts the GMI curve to a higher external magnetic field, which is related to the coupling effect of the external magnetic field and the stray magnetic fields. The influence of the area and angle of ribbons on GMI was also studied in this work. The GMI sensor exhibits high linearity for detection of the stray magnetic fields, which has made it feasible to construct a sensitive magnetometer for detecting the typical stray magnetic fields of general soft ferromagnetic materials.

Initial conditions and ENSO prediction using a coupled ocean-atmosphere model

Science.gov (United States)

Larow, T. E.; Krishnamurti, T. N.

1998-01-01

A coupled ocean-atmosphere initialization scheme using Newtonian relaxation has been developed for the Florida State University coupled ocean-atmosphere global general circulation model. The initialization scheme is used to initialize the coupled model for seasonal forecasting the boreal summers of 1987 and 1988. The atmosphere model is a modified version of the Florida State University global spectral model, resolution T-42. The ocean general circulation model consists of a slightly modified version of the Hamburg's climate group model described in Latif (1987) and Latif et al. (1993). The coupling is synchronous with information exchanged every two model hours. Using ECMWF atmospheric daily analysis and observed monthly mean SSTs, two, 1-year, time-dependent, Newtonian relaxation were performed using the coupled model prior to conducting the seasonal forecasts. The coupled initializations were conducted from 1 June 1986 to 1 June 1987 and from 1 June 1987 to 1 June 1988. Newtonian relaxation was applied to the prognostic atmospheric vorticity, divergence, temperature and dew point depression equations. In the ocean model the relaxation was applied to the surface temperature. Two, 10-member ensemble integrations were conducted to examine the impact of the coupled initialization on the seasonal forecasts. The initial conditions used for the ensembles are the ocean's final state after the initialization and the atmospheric initial conditions are ECMWF analysis. Examination of the SST root mean square error and anomaly correlations between observed and forecasted SSTs in the Niño-3 and Niño-4 regions for the 2 seasonal forecasts, show closer agreement between the initialized forecast than two, 10-member non-initialized ensemble forecasts. The main conclusion here is that a single forecast with the coupled initialization outperforms, in SST anomaly prediction, against each of the control forecasts (members of the ensemble) which do not include such an initialization

Dynamical initial-state model for relativistic heavy-ion collisions

Science.gov (United States)

Shen, Chun; Schenke, Björn

2018-02-01

We present a fully three-dimensional model providing initial conditions for energy and net-baryon density distributions in heavy-ion collisions at arbitrary collision energy. The model includes the dynamical deceleration of participating nucleons or valence quarks, depending on the implementation. The duration of the deceleration continues until the string spanned between colliding participants is assumed to thermalize, which is either after a fixed proper time, or a fluctuating time depending on sampled final rapidities. Energy is deposited in space time along the string, which in general will span a range of space-time rapidities and proper times. We study various observables obtained directly from the initial-state model, including net-baryon rapidity distributions, two-particle rapidity correlations, as well as the rapidity decorrelation of the transverse geometry. Their dependence on the model implementation and parameter values is investigated. We also present the implementation of the model with 3+1-dimensional hydrodynamics, which involves the addition of source terms that deposit energy and net-baryon densities produced by the initial-state model at proper times greater than the initial time for the hydrodynamic simulation.

Sensitivity of a Simulated Derecho Event to Model Initial Conditions

Science.gov (United States)

Wang, Wei

2014-05-01

Since 2003, the MMM division at NCAR has been experimenting cloud-permitting scale weather forecasting using Weather Research and Forecasting (WRF) model. Over the years, we've tested different model physics, and tried different initial and boundary conditions. Not surprisingly, we found that the model's forecasts are more sensitive to the initial conditions than model physics. In 2012 real-time experiment, WRF-DART (Data Assimilation Research Testbed) at 15 km was employed to produce initial conditions for twice-a-day forecast at 3 km. On June 29, this forecast system captured one of the most destructive derecho event on record. In this presentation, we will examine forecast sensitivity to different model initial conditions, and try to understand the important features that may contribute to the success of the forecast.

New spectrophotometric/chemometric assisted methods for the simultaneous determination of imatinib, gemifloxacin, nalbuphine and naproxen in pharmaceutical formulations and human urine

Science.gov (United States)

Belal, F.; Ibrahim, F.; Sheribah, Z. A.; Alaa, H.

2018-06-01

In this paper, novel univariate and multivariate regression methods along with model-updating technique were developed and validated for the simultaneous determination of quaternary mixture of imatinib (IMB), gemifloxacin (GMI), nalbuphine (NLP) and naproxen (NAP). The univariate method is extended derivative ratio (EDR) which depends on measuring every drug in the quaternary mixture by using a ternary mixture of the other three drugs as divisor. Peak amplitudes were measured at 294 nm, 250 nm, 283 nm and 239 nm within linear concentration ranges of 4.0-17.0, 3.0-15.0, 4.0-80.0 and 1.0-6.0 μg mL-1 for IMB, GMI, NLP and NAB, respectively. Multivariate methods adopted are partial least squares (PLS) in original and derivative mode. These models were constructed for simultaneous determination of the studied drugs in the ranges of 4.0-8.0, 3.0-11.0, 10.0-18.0 and 1.0-3.0 μg mL-1 for IMB, GMI, NLP and NAB, respectively, by using eighteen mixtures as a calibration set and seven mixtures as a validation set. The root mean square error of predication (RMSEP) were 0.09 and 0.06 for IMB, 0.14 and 0.13 for GMI, 0.07 and 0.02 for NLP and 0.64 and 0.27 for NAP by PLS in original and derivative mode, respectively. Both models were successfully applied for analysis of IMB, GMI, NLP and NAP in their dosage forms. Updated PLS in derivative mode and EDR were applied for determination of the studied drugs in spiked human urine. The obtained results were statistically compared with those obtained by the reported methods giving a conclusion that there is no significant difference regarding accuracy and precision.

Impacts of model initialization on an integrated surface water - groundwater model

KAUST Repository

Ajami, Hoori; McCabe, Matthew; Evans, Jason P.

2015-01-01

Integrated hydrologic models characterize catchment responses by coupling the subsurface flow with land surface processes. One of the major areas of uncertainty in such models is the specification of the initial condition and its influence

Inclusion-initiated fracture model for ceramics

International Nuclear Information System (INIS)

Sung, J.; Nicholson, P.S.

1990-01-01

The fracture of ceramics initiating from a typical inclusion is analyzed. The inclusion is considered to have a thermal expansion coefficient and fracture toughness lower than those of the matrix and a Young's modulus higher than that of the matrix. Inclusion-initiated fracture is modeled for a spherical inclusion using a weight function method to compute the residual stress intensity factor for a part-through elliptical crack. The results are applied to an α-Al 2 O 3 inclusion embedded in a tetragonal ZrO 2 ceramic. The strength predictions agree well with experimental data

The initiative on Model Organism Proteomes (iMOP) Session

DEFF Research Database (Denmark)

Schrimpf, Sabine P; Mering, Christian von; Bendixen, Emøke

2012-01-01

iMOP – the Initiative on Model Organism Proteomes – was accepted as a new HUPO initiative at the Ninth HUPO meeting in Sydney in 2010. A goal of iMOP is to integrate research groups working on a great diversity of species into a model organism community. At the Tenth HUPO meeting in Geneva...

Initialization and Predictability of a Coupled ENSO Forecast Model

Science.gov (United States)

Chen, Dake; Zebiak, Stephen E.; Cane, Mark A.; Busalacchi, Antonio J.

1997-01-01

The skill of a coupled ocean-atmosphere model in predicting ENSO has recently been improved using a new initialization procedure in which initial conditions are obtained from the coupled model, nudged toward observations of wind stress. The previous procedure involved direct insertion of wind stress observations, ignoring model feedback from ocean to atmosphere. The success of the new scheme is attributed to its explicit consideration of ocean-atmosphere coupling and the associated reduction of "initialization shock" and random noise. The so-called spring predictability barrier is eliminated, suggesting that such a barrier is not intrinsic to the real climate system. Initial attempts to generalize the nudging procedure to include SST were not successful; possible explanations are offered. In all experiments forecast skill is found to be much higher for the 1980s than for the 1970s and 1990s, suggesting decadal variations in predictability.

The AGU Data Management Maturity Model Initiative

Science.gov (United States)

Bates, J. J.

2015-12-01

In September 2014, the AGU Board of Directors approved two initiatives to help the Earth and space sciences community address the growing challenges accompanying the increasing size and complexity of data. These initiatives are: 1) Data Science Credentialing: development of a continuing education and professional certification program to help scientists in their careers and to meet growing responsibilities and requirements around data science; and 2) Data Management Maturity (DMM) Model: development and implementation of a data management maturity model to assess process maturity against best practices, and to identify opportunities in organizational data management processes. Each of these has been organized within AGU as an Editorial Board and both Boards have held kick off meetings. The DMM model Editorial Board will recommend strategies for adapting and deploying a DMM model to the Earth and space sciences create guidance documents to assist in its implementation, and provide input on a pilot appraisal process. This presentation will provide an overview of progress to date in the DMM model Editorial Board and plans for work to be done over the upcoming year.

Wind laws for shockless initialization. [numerical forecasting model

Science.gov (United States)

Ghil, M.; Shkoller, B.

1976-01-01

A system of diagnostic equations for the velocity field, or wind laws, was derived for each of a number of models of large-scale atmospheric flow. The derivation in each case is mathematically exact and does not involve any physical assumptions not already present in the prognostic equations, such as nondivergence or vanishing of derivatives of the divergence. Therefore, initial states computed by solving these diagnostic equations should be compatible with the type of motion described by the prognostic equations of the model and should not generate initialization shocks when inserted into the model. Numerical solutions of the diagnostic system corresponding to a barotropic model are exhibited. Some problems concerning the possibility of implementing such a system in operational numerical weather prediction are discussed.

Modeling of laser damage initiated by surface contamination

International Nuclear Information System (INIS)

Feit, M.D.; Rubenchik, A.M.; Faux, D.R.; Riddle, R.A.; Shapiro, A.; Eder, D.C.; Penetrante, B.M.; Milam, D.; Genin, F.Y.; Kozlowski, M.R.

1996-11-01

The authors are engaged in a comprehensive effort to understand and model the initiation and growth of laser damage initiated by surface contaminants. This includes, for example, the initial absorption by the contaminant, heating and plasma generation, pressure and thermal loading of the transparent substrate, and subsequent shockwave propagation, 'splashing' of molten material and possible spallation, optical propagation and scattering, and treatment of material fracture. The integration use of large radiation hydrodynamics codes, optical propagation codes and material strength codes enables a comprehensive view of the damage process The following picture of surface contaminant initiated laser damage is emerging from our simulations

Giant magnetoimpedance effect of Co{sub 68.15} Fe{sub 4.35} Si{sub 12.5} B{sub 15} amorphous wire in the presence of magnetite ferrofluid

Energy Technology Data Exchange (ETDEWEB)

Amirabadizadeh, A. [Department of Physics, University of Birjand, P. O. Box 97175-615, Birjand (Iran, Islamic Republic of); Lotfollahi, Z., E-mail: lotfollahi@gmail.com [Department of Physics, University of Birjand, P. O. Box 97175-615, Birjand (Iran, Islamic Republic of); Zelati, A. [Department of Electrical Engineering, Technical Faculty of Ferdows, University of Birjand (Iran, Islamic Republic of)

2016-10-01

Giant magnetoimpedance effect (GMI) in Co{sub 68.15} Fe{sub 4.35} Si{sub 12.5} B{sub 15} amorphous wire was studied in the presence of magnetite ferrofluid and without it. Magnetite nanoparticles for ferrofluid were prepared by the traditional wet chemistry co-precipitation method. GMI was measured in the frequency range of 2 to 6 MHz. The maximum value of GMI value of the ferrofluid covered amorphous wire was increased in all frequency intervals in comparison with GMI response of the wire non-covered by ferrofluid. These results open a new way of increasing magnetoimpedance effect value useful for sensor applications. - Highlights: • Amorphous Co-based wires display GMI effect and this feature is of potential interest for developing small magnetic field sensors and biosensors. • This manuscript is dealing with the improvement of the GMI response of an amorphous Co-based wire/magnetite ferrofluid. • The effect of ferrofluid presence in the sensing element is also analyzed. • The results show that GMI maximum increases in a 100% at 4.5 MHz and the sensitivity also does about a 150%. • Amorphous Co-based wires display giant magneto impedance effect (GMI) and this intrinsic feature is of potential interest for developing small magnetic field sensors and biosensors. • This manuscript is dealing with the improvement of the GMI response of an amorphous Co{sub 68.15}Fe{sub 4.35}Si{sub 12.5}B{sub 15} wire/magnetite ferrofluid. • The effect of ferrofluid presence in the sensing element is also analyzed. • The results show that GMI maximum increases in a 100% at 4.5 MHz and the sensitivity also does about a 150%.

A Gompertz population model with Allee effect and fuzzy initial values

Science.gov (United States)

Amarti, Zenia; Nurkholipah, Nenden Siti; Anggriani, Nursanti; Supriatna, Asep K.

2018-03-01

Growth and population dynamics models are important tools used in preparing a good management for society to predict the future of population or species. This has been done by various known methods, one among them is by developing a mathematical model that describes population growth. Models are usually formed into differential equations or systems of differential equations, depending on the complexity of the underlying properties of the population. One example of biological complexity is Allee effect. It is a phenomenon showing a high correlation between very small population size and the mean individual fitness of the population. In this paper the population growth model used is the Gompertz equation model by considering the Allee effect on the population. We explore the properties of the solution to the model numerically using the Runge-Kutta method. Further exploration is done via fuzzy theoretical approach to accommodate uncertainty of the initial values of the model. It is known that an initial value greater than the Allee threshold will cause the solution rises towards carrying capacity asymptotically. However, an initial value smaller than the Allee threshold will cause the solution decreases towards zero asymptotically, which means the population is eventually extinct. Numerical solutions show that modeling uncertain initial value of the critical point A (the Allee threshold) with a crisp initial value could cause the extinction of population of a certain possibilistic degree, depending on the predetermined membership function of the initial value.

Feedback-type giant magneto-impedance sensor based on longitudinal excitation

International Nuclear Information System (INIS)

Zhao Wen; Bu Xiongzhu; Yu Geliang; Xiang Chao

2012-01-01

In this paper, the characteristics of Fe-based amorphous ribbon based on the longitudinal excitation are investigated with assistance of the theory of the giant magneto-impedance (GMI) effect. A feedback-type GMI micro-magnetic sensor is designed with regard to the design of the sensing element, the excitation circuit, the conditional circuit and the feedback circuit. With the analysis of the dynamic and static characteristics of the feedback-type GMI sensor, it is concluded that the designed feedback-type GMI sensor has higher linearity, stability and dynamic characteristics than non-feedback-type GMI sensor in −2.5 to +2.5 Oe. - Highlights: ► A feedback-type GMI micro-magnetic sensor is designed. ► Excitation coil and feedback coil of the sensor is designed to be in one. ► The feedback-type sensor has higher linearity and stability than non-feedback type. ► The feedback-type sensor has better dynamic characteristics than non-feedback type.

A harmonic transition state theory model for defect initiation in crystals

International Nuclear Information System (INIS)

Delph, T J; Cao, P; Park, H S; Zimmerman, J A

2013-01-01

We outline here a model for the initiation of defects in crystals based upon harmonic transition state theory (hTST). This model combines a previously developed model for zero-temperature defect initiation with a multi-dimensional hTST model that is capable of accurately predicting the effects of temperature and loading rate upon defect initiation. The model has several features that set it apart from previous efforts along these lines, most notably a straightforward method of determining the energy barrier between adjacent equilibrium states that does not depend upon a priori information concerning the nature of the defect. We apply the model to two examples, triaxial stretching of a perfect fcc crystal and nanoindentation of a gold substrate. Very good agreement is found between the predictions of the model and independent molecular dynamics (MD) simulations. Among other things, the model predicts a strong dependence of the defect initiation behavior upon the loading parameter. A very attractive feature of this model is that it is valid for arbitrarily slow loading rates, in particular loading rates achievable in the laboratory, and suffers from none of the limitations in this regard inherent in MD simulations. (paper)

Modeling the outflow of liquid with initial supercritical parameters using the relaxation model for condensation

Directory of Open Access Journals (Sweden)

Lezhnin Sergey

2017-01-01

Full Text Available The two-temperature model of the outflow from a vessel with initial supercritical parameters of medium has been realized. The model uses thermodynamic non-equilibrium relaxation approach to describe phase transitions. Based on a new asymptotic model for computing the relaxation time, the outflow of water with supercritical initial pressure and super- and subcritical temperatures has been calculated.

Evaluation of the reactive nitrogen budget of the remote atmosphere in global models using airborne measurements

Science.gov (United States)

Murray, L. T.; Strode, S. A.; Fiore, A. M.; Lamarque, J. F.; Prather, M. J.; Thompson, C. R.; Peischl, J.; Ryerson, T. B.; Allen, H.; Blake, D. R.; Crounse, J. D.; Brune, W. H.; Elkins, J. W.; Hall, S. R.; Hintsa, E. J.; Huey, L. G.; Kim, M. J.; Moore, F. L.; Ullmann, K.; Wennberg, P. O.; Wofsy, S. C.

2017-12-01

Nitrogen oxides (NOx ≡ NO + NO2) in the background atmosphere are critical precursors for the formation of tropospheric ozone and OH, thereby exerting strong influence on surface air quality, reactive greenhouse gases, and ecosystem health. The impact of NOx on atmospheric composition and climate is sensitive to the relative partitioning of reactive nitrogen between NOx and longer-lived reservoir species of the total reactive nitrogen family (NOy) such as HNO3, HNO4, PAN and organic nitrates (RONO2). Unfortunately, global chemistry-climate models (CCMs) and chemistry-transport models (CTMs) have historically disagreed in their reactive nitrogen budgets outside of polluted continental regions, and we have lacked in situ observations with which to evaluate them. Here, we compare and evaluate the NOy budget of six global models (GEOS-Chem CTM, GFDL AM3 CCM, GISS E2.1 CCM, GMI CTM, NCAR CAM CCM, and UCI CTM) using new observations of total reactive nitrogen and its member species from the NASA Atmospheric Tomography (ATom) mission. ATom has now completed two of its four planned deployments sampling the remote Pacific and Atlantic basins of both hemispheres with a comprehensive suite of measurements for constraining reactive photochemistry. All six models have simulated conditions climatologically similar to the deployments. The GMI and GEOS-Chem CTMs have in addition performed hindcast simulations using the MERRA-2 reanalysis, and have been sampled along the flight tracks. We evaluate the performance of the models relative to the observations, and identify factors contributing to their disparate behavior using known differences in model oxidation mechanisms, heterogeneous loss pathways, lightning and surface emissions, and physical loss processes.

Stochastic Models for Chloride-Initiated Corrosion in Reinforced Concrete

DEFF Research Database (Denmark)

Engelund, Svend; Sørensen, John Dalsgaard

Corrosion of the reinforcement in concrete structures can lead to a substantial decrease of the load-bearing capacity. One mode of corrosion initiation is when the chloride content around the reinforcement exceeds a threshold value. In the present paper a statistical model is developed by which...... the chloride content in a 1reinforced concrete structure can be predicted. The model parameters are estimated on the basis of measurements. The distribution of the time to initiation of corrosion is estimated by FORMISORM-analysis....

Stochastic Models for Chloride-Initiated Corrosion in Reinforced Concrete

DEFF Research Database (Denmark)

Engelund, S.; Sørensen, John Dalsgaard

1996-01-01

Corrosion of the reinforcement in concrete structures can lead to a substantial decrease of the load-bearing capacity. One mode of corrosion initiation is when the chloride content around the reinforcement exceeds a threshold value. In the present paper a statistical model is developed by which...... the chloride content in a reinforced concrete structure can be predicted. The model parameters are estimated on the basis of measurements. The distribution of the time to initiation of corrosion is estimated by FORM/SORM-analysis....

Stochastic modeling of pitting corrosion: A new model for initiation and growth of multiple corrosion pits

International Nuclear Information System (INIS)

Valor, A.; Caleyo, F.; Alfonso, L.; Rivas, D.; Hallen, J.M.

2007-01-01

In this work, a new stochastic model capable of simulating pitting corrosion is developed and validated. Pitting corrosion is modeled as the combination of two stochastic processes: pit initiation and pit growth. Pit generation is modeled as a nonhomogeneous Poisson process, in which induction time for pit initiation is simulated as the realization of a Weibull process. In this way, the exponential and Weibull distributions can be considered as the possible distributions for pit initiation time. Pit growth is simulated using a nonhomogeneous Markov process. Extreme value statistics is used to find the distribution of maximum pit depths resulting from the combination of the initiation and growth processes for multiple pits. The proposed model is validated using several published experiments on pitting corrosion. It is capable of reproducing the experimental observations with higher quality than the stochastic models available in the literature for pitting corrosion

Stochastic modeling of pitting corrosion: A new model for initiation and growth of multiple corrosion pits

Energy Technology Data Exchange (ETDEWEB)

Valor, A. [Facultad de Fisica, Universidad de La Habana, San Lazaro y L, Vedado, 10400 Havana (Cuba); Caleyo, F. [Departamento de Ingenieria, Metalurgica, IPN-ESIQIE, UPALM Edif. 7, Zacatenco, Mexico DF 07738 (Mexico)]. E-mail: fcaleyo@gmail.com; Alfonso, L. [Departamento de Ingenieria, Metalurgica, IPN-ESIQIE, UPALM Edif. 7, Zacatenco, Mexico DF 07738 (Mexico); Rivas, D. [Departamento de Ingenieria, Metalurgica, IPN-ESIQIE, UPALM Edif. 7, Zacatenco, Mexico DF 07738 (Mexico); Hallen, J.M. [Departamento de Ingenieria, Metalurgica, IPN-ESIQIE, UPALM Edif. 7, Zacatenco, Mexico DF 07738 (Mexico)

2007-02-15

In this work, a new stochastic model capable of simulating pitting corrosion is developed and validated. Pitting corrosion is modeled as the combination of two stochastic processes: pit initiation and pit growth. Pit generation is modeled as a nonhomogeneous Poisson process, in which induction time for pit initiation is simulated as the realization of a Weibull process. In this way, the exponential and Weibull distributions can be considered as the possible distributions for pit initiation time. Pit growth is simulated using a nonhomogeneous Markov process. Extreme value statistics is used to find the distribution of maximum pit depths resulting from the combination of the initiation and growth processes for multiple pits. The proposed model is validated using several published experiments on pitting corrosion. It is capable of reproducing the experimental observations with higher quality than the stochastic models available in the literature for pitting corrosion.

Tailoring of magnetic anisotropy of Fe-rich microwires by stress induced anisotropy

International Nuclear Information System (INIS)

Zhukov, A.; Zhukova, V.; Larin, V.; Gonzalez, J.

2006-01-01

We report on tailoring of magnetic properties and GMI of Fe 69 B 12 Si 14 C 5 glass-coated microwires by stress annealing. The induced magnetic anisotropy field depend on temperature and time of annealing and applied stress. At certain conditions considerable GMI effect (up to 65%) has been achieved. Application of the tensile stress drastically affects the shape of the hysteresis loop of stress-annealed sample and its GMI effect. In this way the shape of the hysteresis loop and GMI effect can by tailored by controllable way

On specification of initial conditions in turbulence models

Energy Technology Data Exchange (ETDEWEB)

Rollin, Bertrand [Los Alamos National Laboratory; Andrews, Malcolm J [Los Alamos National Laboratory

2010-12-01

Recent research has shown that initial conditions have a significant influence on the evolution of a flow towards turbulence. This important finding offers a unique opportunity for turbulence control, but also raises the question of how to properly specify initial conditions in turbulence models. We study this problem in the context of the Rayleigh-Taylor instability. The Rayleigh-Taylor instability is an interfacial fluid instability that leads to turbulence and turbulent mixing. It occurs when a light fluid is accelerated in to a heavy fluid because of misalignment between density and pressure gradients. The Rayleigh-Taylor instability plays a key role in a wide variety of natural and man-made flows ranging from supernovae to the implosion phase of Inertial Confinement Fusion (ICF). Our approach consists of providing the turbulence models with a predicted profile of its key variables at the appropriate time in accordance to the initial conditions of the problem.

Human Cancer Models Initiative | Office of Cancer Genomics

Science.gov (United States)

The Human Cancer Models Initiative (HCMI) is an international consortium that is generating novel human tumor-derived culture models, which are annotated with genomic and clinical data. In an effort to advance cancer research and more fully understand how in vitro findings are related to clinical biology, HCMI-developed models and related data will be available as a community resource for cancer research.

Individual Subjective Initiative Merge Model Based on Cellular Automaton

Directory of Open Access Journals (Sweden)

Yin-Jie Xu

2013-01-01

Full Text Available The merge control models proposed for work zones are classified into two types (Hard Control Merge (HCM model and Soft Control Merge (SCM model according to their own control intensity and are compared with a new model, called Individual Subjective Initiative Merge (ISIM model, which is based on the linear lane-changing probability strategy in the merging area. The attention of this paper is paid to the positive impact of the individual subjective initiative for the whole traffic system. Three models (ISIM, HCM, and SCM are established and compared with each other by two order parameters, that is, system output and average vehicle travel time. Finally, numerical results show that both ISIM and SCM perform better than HCM. Compared with SCM, the output of ISIM is 20 vehicles per hour higher under the symmetric input condition and is more stable under the asymmetric input condition. Meanwhile, the average travel time of ISIM is 2000 time steps less under the oversaturated input condition.

Should tsunami models use a nonzero initial condition for horizontal velocity?

Science.gov (United States)

Nava, G.; Lotto, G. C.; Dunham, E. M.

2017-12-01

Tsunami propagation in the open ocean is most commonly modeled by solving the shallow water wave equations. These equations require two initial conditions: one on sea surface height and another on depth-averaged horizontal particle velocity or, equivalently, horizontal momentum. While most modelers assume that initial velocity is zero, Y.T. Song and collaborators have argued for nonzero initial velocity, claiming that horizontal displacement of a sloping seafloor imparts significant horizontal momentum to the ocean. They show examples in which this effect increases the resulting tsunami height by a factor of two or more relative to models in which initial velocity is zero. We test this claim with a "full-physics" integrated dynamic rupture and tsunami model that couples the elastic response of the Earth to the linearized acoustic-gravitational response of a compressible ocean with gravity; the model self-consistently accounts for seismic waves in the solid Earth, acoustic waves in the ocean, and tsunamis (with dispersion at short wavelengths). We run several full-physics simulations of subduction zone megathrust ruptures and tsunamis in geometries with a sloping seafloor, using both idealized structures and a more realistic Tohoku structure. Substantial horizontal momentum is imparted to the ocean, but almost all momentum is carried away in the form of ocean acoustic waves. We compare tsunami propagation in each full-physics simulation to that predicted by an equivalent shallow water wave simulation with varying assumptions regarding initial conditions. We find that the initial horizontal velocity conditions proposed by Song and collaborators consistently overestimate the tsunami amplitude and predict an inconsistent wave profile. Finally, we determine tsunami initial conditions that are rigorously consistent with our full-physics simulations by isolating the tsunami waves (from ocean acoustic and seismic waves) at some final time, and backpropagating the tsunami

Samdrup Jongkhar Initiative : a Model of Integrated Ecologically ...

International Development Research Centre (IDRC) Digital Library (Canada)

Samdrup Jongkhar Initiative : a Model of Integrated Ecologically-friendly ... which endeavors to integrate social, economic, cultural and environmental objectives. ... Brown Cloud penetrates Bhutan : ambient air quality and trans-boundary ...

Development of chipless, wireless current sensor system based on giant magnetoimpedance magnetic sensor and surface acoustic wave transponder.

Science.gov (United States)

Kondalkar, Vijay V; Li, Xiang; Park, Ikmo; Yang, Sang Sik; Lee, Keekeun

2018-02-05

A chipless, wireless current sensor system was developed using a giant magnetoimpedance (GMI) magnetic sensor and one-port surface acoustic wave (SAW) reflective delay line for real-time power monitoring in a current-carrying conductor. The GMI sensor has a high-quality crystalline structure in each layer, which contributes to a high sensitivity and good linearity in a magnetic field of 3-16 Oe. A 400 MHz RF energy generated from the interdigital transducer (IDT)-type reflector on the one-port SAW delay line was used as an activation source for the GMI magnetic sensor. The one-port SAW delay line replaces the presently existing transceiver system, which is composed of thousands of transistors, thus enabling chipless and wireless operation. We confirmed a large variation in the amplitude of the SAW reflection peak with a change in the impedance of the GMI sensor caused by the current flow through the conductor. Good linearity and sensitivity of ~0.691 dB/A were observed for currents in the range 1-12 A. Coupling of Mode (COM) modeling and impedance matching analysis were also performed to predict the device performance in advance and these were compared with the experimental results.

Transcutaneous Intraluminal Impedance Measurement for Minimally Invasive Monitoring of Gastric Motility: Validation in Acute Canine Models

Directory of Open Access Journals (Sweden)

Michael D. Poscente

2014-01-01

Full Text Available Transcutaneous intraluminal impedance measurement (TIIM is a new method to cutaneously measure gastric contractions by assessing the attenuation dynamics of a small oscillating voltage emitted by a battery-powered ingestible capsule retained in the stomach. In the present study, we investigated whether TIIM can reliably assess gastric motility in acute canine models. Methods. Eight mongrel dogs were randomly divided into 2 groups: half received an active TIIM pill and half received an identically sized sham capsule. After 24-hour fasting and transoral administration of the pill (active or sham, two force transducers (FT were sutured onto the antral serosa at laparotomy. After closure, three standard cutaneous electrodes were placed on the abdomen, registering the transluminally emitted voltage. Thirty-minute baseline recordings were followed by pharmacological induction of gastric contractions using neostigmine IV and another 30-minute recording. Normalized one-minute baseline and post-neostigmine gastric motility indices (GMIs were calculated and Pearson correlation coefficients (PCCs between cutaneous and FT GMIs were obtained. Statistically significant GMI PCCs were seen in both baseline and post-neostigmine states. There were no significant GMI PCCs in the sham capsule test. Further chronic animal studies of this novel long-term gastric motility measurement technique are needed before testing it on humans.

Proficiency Testing for Bacterial Whole Genome Sequencing: An End-User Survey of Current Capabilities, Requirements and Priorities

DEFF Research Database (Denmark)

Moran-Gilad, Jacob; Sintchenko, Vitali; Karlsmose Pedersen, Susanne

2015-01-01

The advent of next-generation sequencing (NGS) has revolutionised public health microbiology. Given the potential impact of NGS, it is paramount to ensure standardisation of ‘wet’ laboratory and bioinformatic protocols and promote comparability of methods employed by different laboratories...... and their outputs. Therefore, one of the ambitious goals of the Global Microbial Identifier (GMI) initiative (http://​www.​globalmicrobiali​dentifier.​org/​) has been to establish a mechanism for inter-laboratory NGS proficiency testing (PT). This report presents findings from the survey recently conducted...... by Working Group 4 among GMI members in order to ascertain NGS end-use requirements and attitudes towards NGS PT. The survey identified the high professional diversity of laboratories engaged in NGS-based public health projects and the wide range of capabilities within institutions, at a notable range...

Proficiency testing for bacterial whole genome sequencing: an end-user survey of current capabilities, requirements and priorities

DEFF Research Database (Denmark)

Moran-Gilad, Jacob; Sintchenko, Vitali; Karlsmose Pedersen, Susanne

2015-01-01

The advent of next-generation sequencing (NGS) has revolutionised public health microbiology. Given the potential impact of NGS, it is paramount to ensure standardisation of 'wet' laboratory and bioinformatic protocols and promote comparability of methods employed by different laboratories...... and their outputs. Therefore, one of the ambitious goals of the Global Microbial Identifier (GMI) initiative (http://www.globalmicrobialidentifier.org/) has been to establish a mechanism for inter-laboratory NGS proficiency testing (PT). This report presents findings from the survey recently conducted by Working...... Group 4 among GMI members in order to ascertain NGS end-use requirements and attitudes towards NGS PT. The survey identified the high professional diversity of laboratories engaged in NGS-based public health projects and the wide range of capabilities within institutions, at a notable range of costs...

Fracture initiation associated with chemical degradation: observation and modeling

Energy Technology Data Exchange (ETDEWEB)

Byoungho Choi; Zhenwen Zhou; Chudnovsky, Alexander [Illinois Univ., Dept. of Civil and Materials Engineering (M/C 246), Chicago, IL (United States); Stivala, Salvatore S. [Stevens Inst. of Technology, Dept. of Chemistry and Chemical Biology, Hoboken, NJ (United States); Sehanobish, Kalyan; Bosnyak, Clive P. [Dow Chemical Co., Freeport, TX (United States)

2005-01-01

The fracture initiation in engineering thermoplastics resulting from chemical degradation is usually observed in the form of a microcrack network within a surface layer of degraded polymer exposed to a combined action of mechanical stresses and chemically aggressive environment. Degradation of polymers is usually manifested in a reduction of molecular weight, increase of crystallinity in semi crystalline polymers, increase of material density, a subtle increase in yield strength, and a dramatic reduction in toughness. An increase in material density, i.e., shrinkage of the degraded layer is constrained by adjacent unchanged material results in a buildup of tensile stress within the degraded layer and compressive stress in the adjacent unchanged material due to increasing incompatibility between the two. These stresses are an addition to preexisting manufacturing and service stresses. At a certain level of degradation, a combination of toughness reduction and increase of tensile stress result in fracture initiation. A quantitative model of the described above processes is presented in these work. For specificity, the internally pressurized plastic pipes that transport a fluid containing a chemically aggressive (oxidizing) agent is used as the model of fracture initiation. Experimental observations of material density and toughness dependence on degradation reported elsewhere are employed in the model. An equation for determination of a critical level of degradation corresponding to the offset of fracture is constructed. The critical level of degradation for fracture initiation depends on the rates of toughness deterioration and build-up of the degradation related stresses as well as on the manufacturing and service stresses. A method for evaluation of the time interval prior to fracture initiation is also formulated. (Author)

Learning reliable manipulation strategies without initial physical models

Science.gov (United States)

Christiansen, Alan D.; Mason, Matthew T.; Mitchell, Tom M.

1990-01-01

A description is given of a robot, possessing limited sensory and effectory capabilities but no initial model of the effects of its actions on the world, that acquires such a model through exploration, practice, and observation. By acquiring an increasingly correct model of its actions, it generates increasingly successful plans to achieve its goals. In an apparently nondeterministic world, achieving reliability requires the identification of reliable actions and a preference for using such actions. Furthermore, by selecting its training actions carefully, the robot can significantly improve its learning rate.

Calculation of the Initial Magnetic Field for Mercury's Magnetosphere Hybrid Model

Science.gov (United States)

Alexeev, Igor; Parunakian, David; Dyadechkin, Sergey; Belenkaya, Elena; Khodachenko, Maxim; Kallio, Esa; Alho, Markku

2018-03-01

Several types of numerical models are used to analyze the interactions of the solar wind flow with Mercury's magnetosphere, including kinetic models that determine magnetic and electric fields based on the spatial distribution of charges and currents, magnetohydrodynamic models that describe plasma as a conductive liquid, and hybrid models that describe ions kinetically in collisionless mode and represent electrons as a massless neutralizing liquid. The structure of resulting solutions is determined not only by the chosen set of equations that govern the behavior of plasma, but also by the initial and boundary conditions; i.e., their effects are not limited to the amount of computational work required to achieve a quasi-stationary solution. In this work, we have proposed using the magnetic field computed by the paraboloid model of Mercury's magnetosphere as the initial condition for subsequent hybrid modeling. The results of the model have been compared to measurements performed by the Messenger spacecraft during a single crossing of the magnetosheath and the magnetosphere. The selected orbit lies in the terminator plane, which allows us to observe two crossings of the bow shock and the magnetopause. In our calculations, we have defined the initial parameters of the global magnetospheric current systems in a way that allows us to minimize paraboloid magnetic field deviation along the trajectory of the Messenger from the experimental data. We have shown that the optimal initial field parameters include setting the penetration of a partial interplanetary magnetic field into the magnetosphere with a penetration coefficient of 0.2.

Initiation model for intergranular stress corrosion cracking in BWR pipes

International Nuclear Information System (INIS)

Hishida, Mamoru; Kawakubo, Takashi; Nakagawa, Yuji; Arii, Mitsuru.

1981-01-01

Discussions were made on the keys of intergranular stress corrosion cracking of austenitic stainless steel in high-temperature water in laboratories and stress corrosion cracking incidents in operating plants. Based on these discussions, a model was set up of intergranular stress corrosion cracking initiation in BWR pipes. Regarding the model, it was presumed that the intergranular stress corrosion cracking initiates during start up periods whenever heat-affected zones in welded pipes are highly sensitized and suffer dynamic strain in transient water containing dissolved oxygen. A series of BWR start up simulation tests were made by using a flowing autoclave system with slow strain rate test equipment. Validity of the model was confirmed through the test results. (author)

Chassis dynamometer study of emissions from 21 in-use heavy-duty diesel vehicles

International Nuclear Information System (INIS)

Yanowitz, J.; Graboski, M.S.; Ryan, L.B.A.; Alleman, T.L.; McCormick, R.L.

1999-01-01

Regulated emissions from 21 in-use heavy-duty diesel vehicles were measured on a heavy-duty chassis dynamometer via three driving cycles using a low-sulfur diesel fuel. Emissions of particulate matter (PM), nitrogen oxides (NO x ), carbon monoxide (CO), total hydrocarbon (THC), and PM sulfate fraction were measured. For hot start tests, emissions ranged from 0.30 to 7.43 g/mi (mean 1.96) for PM; 4.15--54.0 g/mi (mean 23.3) for NO x ; 2.09--86.2 g/mi (mean 19.5) for CO; and 0.25--8.25 g/mi (mean 1.70) for THC. When emissions are converted to a g/gal basis, the effect of driving cycle is eliminated for NO x and largely eliminated for PM. Sulfate comprised less than 1% of the emitted PM for all vehicles and test cycles. A strong correlation is observed between emissions of CO and PM. Cold starting at 77 F produced an 11% increase in PM emissions. Multivariate regression analyses indicate that in-use PM emissions have decreased at a slower rate than anticipated based on the stricter engine certification test standards put into effect since 1985. NO x emissions do not decrease with model year for the vehicles tested here. Smoke opacity measurements are not well correlated with mass emissions of regulated pollutants

Crack initiation modeling of a directionally-solidified nickel-base superalloy

Science.gov (United States)

Gordon, Ali Page

crystal plasticity model was used to simulate the material behavior in the L and T orientations. The constitutive model was implemented in ABAQUS and a parameter estimation scheme was developed to obtain the material constants. A physically-based model was developed for correlating crack initiation life based on the experimental life data and predictions are made using the crack initiation model. Assuming a unique relationship between the damage fraction and cycle fraction with respect to cycles to crack initiation for each damage mode, the total crack initiation life has been represented in terms of the individual damage components (fatigue, creep-fatigue, creep, and oxidation-fatigue) observed at the end state of crack initiation.

Impact of GPM Rainrate Data Assimilation on Simulation of Hurricane Harvey (2017)

Science.gov (United States)

Li, Xuanli; Srikishen, Jayanthi; Zavodsky, Bradley; Mecikalski, John

2018-01-01

Built upon Tropical Rainfall Measuring Mission (TRMM) legacy for next-generation global observation of rain and snow. The GPM was launched in February 2014 with Dual-frequency Precipitation Radar (DPR) and GPM Microwave Imager (GMI) onboard. The GPM has a broad global coverage approximately 70deg S -70deg N with a swath of 245/125-km for the Ka (35.5 GHz)/Ku (13.6 GHz) band radar, and 850-km for the 13-channel GMI. GPM also features better retrievals for heavy, moderate, and light rain and snowfall To develop methodology to assimilate GPM surface precipitation data with Grid-point Statistical Interpolation (GSI) data assimilation system and WRF ARW model To investigate the potential and the value of utilizing GPM observation into NWP for operational environment The GPM rain rate data has been successfully assimilated using the GSI rain data assimilation package. Impacts of rain rate data have been found in temperature and moisture fields of initial conditions. 2.Assimilation of either GPM IMERG or GPROF rain product produces significant improvement in precipitation amount and structure for Hurricane Harvey (2017) forecast. Since IMERG data is available half-hourly, further forecast improvement is expected with continuous assimilation of IMERG data

Low-cycle fatigue of welded joints: coupled initiation propagation model

International Nuclear Information System (INIS)

Madi, Yazid; Recho, Naman; Matheron, Philippe

2004-01-01

This paper deals with the low-cycle fatigue (LC) design of welded structures, the aim being the critical analysis of the rule used in the RCC-MR [Design and construction rules for mechanical components of FBR nuclear islands, AFCEN, 1993], for the design and construction of fast breeder reactors. The study takes into account the evolution of the material behavior laws and damage accumulation during the fatigue loading. The adopted model consists of analyzing separately the behavior and the damage evolutions. It allows us to determine the damage ratio corresponding to initiation and propagation of a significant crack in order to determine the life duration. This model suggests the existence of a threshold level of loading, above which micro-cracks initiate. The initiation fatigue life can then be neglected below the threshold level. This work shows also that the RCC-MR rules are valid below this threshold load level

Modeling subsurface stormflow initiation in low-relief landscapes

Science.gov (United States)

Hopp, Luisa; Vaché, Kellie B.; Rhett Jackson, C.; McDonnell, Jeffrey J.

2015-04-01

Shallow lateral subsurface flow as a runoff generating mechanism at the hillslope scale has mostly been studied in steeper terrain with typical hillside angles of 10 - 45 degrees. These studies have shown that subsurface stormflow is often initiated at the interface between a permeable upper soil layer and a lower conductivity impeding layer, e.g. a B horizon or bedrock. Many studies have identified thresholds of event size and soil moisture states that need to be exceeded before subsurface stormflow is initiated. However, subsurface stormflow generation on low-relief hillslopes has been much less studied. Here we present a modeling study that investigates the initiation of subsurface stormflow on low-relief hillslopes in the Upper Coastal Plain of South Carolina, USA. Hillslopes in this region typically have slope angles of 2-5 degrees. Topsoils are sandy, underlain by a low-conductivity sandy clay loam Bt horizon. Subsurface stormflow has only been intercepted occasionally in a 120 m long trench, and often subsurface flow was not well correlated with stream signals, suggesting a disconnect between subsurface flow on the hillslopes and stream flow. We therefore used a hydrologic model to better understand which conditions promote the initiation of subsurface flow in this landscape, addressing following questions: Is there a threshold event size and soil moisture state for producing lateral subsurface flow? What role does the spatial pattern of depth to the impeding clay layer play for subsurface stormflow dynamics? We reproduced a section of a hillslope, for which high-resolution topographic data and depth to clay measurements were available, in the hydrologic model HYDRUS-3D. Soil hydraulic parameters were based on experimentally-derived data. The threshold analysis was first performed using hourly climate data records for 2009-2010 from the study site to drive the simulation. For this period also trench measurements of subsurface flow were available. In addition

Principal-subordinate hierarchical multi-objective programming model of initial water rights allocation

Directory of Open Access Journals (Sweden)

Dan Wu

2009-06-01

Full Text Available The principal-subordinate hierarchical multi-objective programming model of initial water rights allocation was developed based on the principle of coordinated and sustainable development of different regions and water sectors within a basin. With the precondition of strictly controlling maximum emissions rights, initial water rights were allocated between the first and the second levels of the hierarchy in order to promote fair and coordinated development across different regions of the basin and coordinated and efficient water use across different water sectors, realize the maximum comprehensive benefits to the basin, promote the unity of quantity and quality of initial water rights allocation, and eliminate water conflict across different regions and water sectors. According to interactive decision-making theory, a principal-subordinate hierarchical interactive iterative algorithm based on the satisfaction degree was developed and used to solve the initial water rights allocation model. A case study verified the validity of the model.

Graded motor imagery and the impact on pain processing in a case of CRPS.

Science.gov (United States)

Walz, Andrea D; Usichenko, Taras; Moseley, G Lorimer; Lotze, Martin

2013-03-01

Graded motor imagery (GMI) shows promising results for patients with complex regional pain syndrome (CRPS). In a case with chronic unilateral CRPS type I, we applied GMI for 6 weeks and recorded clinical parameters and cerebral activation using functional magnetic resonance imaging (fMRI; pre-GMI, after each GMI block, and after 6 mo). Changes in fMRI activity were mapped during movement execution in areas associated with pain processing. A healthy participant served as a control for habituation effects. Pain intensity decreased over the course of GMI, and relief was maintained at follow-up. fMRI during movement execution revealed marked changes in S1 and S2 (areas of discriminative pain processing), which seemed to be associated with pain reduction, but none in the anterior insula and the anterior cingulate cortex (areas of affective pain processing). After mental rotation training, the activation intensity of the posterior parietal cortex was reduced to one third. Our case report develops a design capable of differentiating cerebral changes associated with behavioral therapy of CRPS type I study.

The role of initial values in nonstationary fractional time series models

DEFF Research Database (Denmark)

Johansen, Søren; Nielsen, Morten Ørregaard

We consider the nonstationary fractional model $\\Delta^{d}X_{t}=\\varepsilon _{t}$ with $\\varepsilon_{t}$ i.i.d.$(0,\\sigma^{2})$ and $d>1/2$. We derive an analytical expression for the main term of the asymptotic bias of the maximum likelihood estimator of $d$ conditional on initial values, and we...... discuss the role of the initial values for the bias. The results are partially extended to other fractional models, and three different applications of the theoretical results are given....

Hindcasting to measure ice sheet model sensitivity to initial states

Directory of Open Access Journals (Sweden)

A. Aschwanden

2013-07-01

Full Text Available Validation is a critical component of model development, yet notoriously challenging in ice sheet modeling. Here we evaluate how an ice sheet system model responds to a given forcing. We show that hindcasting, i.e. forcing a model with known or closely estimated inputs for past events to see how well the output matches observations, is a viable method of assessing model performance. By simulating the recent past of Greenland, and comparing to observations of ice thickness, ice discharge, surface speeds, mass loss and surface elevation changes for validation, we find that the short term model response is strongly influenced by the initial state. We show that the thermal and dynamical states (i.e. the distribution of internal energy and momentum can be misrepresented despite a good agreement with some observations, stressing the importance of using multiple observations. In particular we identify rates of change of spatially dense observations as preferred validation metrics. Hindcasting enables a qualitative assessment of model performance relative to observed rates of change. It thereby reduces the number of admissible initial states more rigorously than validation efforts that do not take advantage of observed rates of change.

Measuring Software Test Verification for Complex Workpieces based on Virtual Gear Measuring Instrument

Directory of Open Access Journals (Sweden)

Yin Peili

2017-08-01

Full Text Available Validity and correctness test verification of the measuring software has been a thorny issue hindering the development of Gear Measuring Instrument (GMI. The main reason is that the software itself is difficult to separate from the rest of the measurement system for independent evaluation. This paper presents a Virtual Gear Measuring Instrument (VGMI to independently validate the measuring software. The triangular patch model with accurately controlled precision was taken as the virtual workpiece and a universal collision detection model was established. The whole process simulation of workpiece measurement is implemented by VGMI replacing GMI and the measuring software is tested in the proposed virtual environment. Taking involute profile measurement procedure as an example, the validity of the software is evaluated based on the simulation results; meanwhile, experiments using the same measuring software are carried out on the involute master in a GMI. The experiment results indicate a consistency of tooth profile deviation and calibration results, thus verifying the accuracy of gear measuring system which includes the measurement procedures. It is shown that the VGMI presented can be applied in the validation of measuring software, providing a new ideal platform for testing of complex workpiece-measuring software without calibrated artifacts.

Exploring the Process of Implementing Healthy Workplace Initiatives: Mapping to Kotter's Leading Change Model.

Science.gov (United States)

Chappell, Stacie; Pescud, Melanie; Waterworth, Pippa; Shilton, Trevor; Roche, Dee; Ledger, Melissa; Slevin, Terry; Rosenberg, Michael

2016-10-01

The aim of this study was to use Kotter's leading change model to explore the implementation of workplace health and wellbeing initiatives. Qualitative interviews were conducted with 31 workplace representatives with a healthy workplace initiative. None of the workplaces used a formal change management model when implementing their healthy workplace initiatives. Not all of the steps in Kotter model were considered necessary and the order of the steps was challenged. For example, interviewees perceived that communicating the vision, developing the vision, and creating a guiding coalition were integral parts of the process, although there was less emphasis on the importance of creating a sense of urgency and consolidating change. Although none of the workplaces reported using a formal organizational change model when implementing their healthy workplace initiatives, there did appear to be perceived merit in using the steps in Kotter's model.

Giant magnetoimpedance-based microchannel system for quick and parallel genotyping of human papilloma virus type 16/18

Science.gov (United States)

Yang, Hao; Chen, Lei; Lei, Chong; Zhang, Ju; Li, Ding; Zhou, Zhi-Min; Bao, Chen-Chen; Hu, Heng-Yao; Chen, Xiang; Cui, Feng; Zhang, Shuang-Xi; Zhou, Yong; Cui, Da-Xiang

2010-07-01

Quick and parallel genotyping of human papilloma virus (HPV) type 16/18 is carried out by a specially designed giant magnetoimpedance (GMI) based microchannel system. Micropatterned soft magnetic ribbon exhibiting large GMI ratio serves as the biosensor element. HPV genotyping can be determined by the changes in GMI ratio in corresponding detection region after hybridization. The result shows that this system has great potential in future clinical diagnostics and can be easily extended to other biomedical applications based on molecular recognition.

Kapten haaras General Motorsis tüüri / Peeter Teder

Index Scriptorium Estoniae

Teder, Peeter

2005-01-01

General Motors'i tegevjuht Rick Wagoner võtab isiklikult vastutuse firma kahjumisse sattunud Põhja-Ameerika üksuses toimuva eest ning asub seda juhtima. Diagramm: GM-i aktsia. Lisa: GMi võlakirjad mõjutavad kogu finantsturgu

Multi-scale modelling of fatigue microcrack initiation

International Nuclear Information System (INIS)

Liu, Jia

2013-01-01

The thesis aims to improve the understanding and simulation of microcrack initiation induced by thermal fatigue and the induced crack network formation. The polycrystalline simulations allow the prediction of both macroscopic cyclic behavior and mean grain distributions of stress, plastic strain and number of cycles to microcrack initiation. Various aggregate meshes have been used, from the simplest ones using cubic grains up to a real 3D aggregate built thanks to many re-polishing and EBSD measurement sequences (Institut P', Poitiers). Tension-compression, cyclic shear and equi-biaxial loadings, with and without mean strain, have been considered. All the predictions are in qualitative agreement with many experimental observations obtained at various scales. The single crystal simulations allow us to predict the effect of slip localization in thin persistent slip bands (PSBs). Inside PSBs, vacancies are produced and annihilated because of cyclic dislocation interactions and may diffuse towards the surrounding matrix. This induces extrusion growth at the free surface of PSBs. Microcracking is modelled by cohesive zones located along the PSB - matrix interfaces. The predicted extrusion rates and numbers of cycles to microcrack initiation are in fair agreement with numerous experimental data concerning single and polycrystals, copper and 316L(N), under either air or inert environment. (author) [fr

Initial and final estimates of the Bilinear seasonal time series model ...

African Journals Online (AJOL)

In getting the estimates of the parameters of this model special attention was paid to the problem of having good initial estimates as it is proposed that with good initial values of the parameters the estimates obtaining by the Newton-Raphson iterative technique usually not only converge but also are good estimates.

Numerical modeling of the initial fluctuation condensation stage with charge drops

Science.gov (United States)

Averina, T. A.; Zmievskaya, G. I.

2016-11-01

This paper deals with a mathematical model of the phase transition of the first kind at the initial stage of forming drops in a liquid or in melted state in a volume of steam with a fixed charge on drops. The model of the process is represented by superposition of random diffusion and jump stochastic processes. The algorithms for solving stochastic differential equations (SDEs) of the model of processes, which form the cluster size, allow one to calculate a distribution function of drops according to their size. The kinetic approach makes possible evaluate the role of the Rayleigh capillary instability at the initial condensation stage and to employ the analysis of electrodispersion mechanisms in the production of metal and semiconductor powders.

Safeguards First Principle Initiative (SFPI) Cost Model

International Nuclear Information System (INIS)

Price, Mary Alice

2010-01-01

The Nevada Test Site (NTS) began operating Material Control and Accountability (MC and A) under the Safeguards First Principle Initiative (SFPI), a risk-based and cost-effective program, in December 2006. The NTS SFPI Comprehensive Assessment of Safeguards Systems (COMPASS) Model is made up of specific elements (MC and A plan, graded safeguards, accounting systems, measurements, containment, surveillance, physical inventories, shipper/receiver differences, assessments/performance tests) and various sub-elements, which are each assigned effectiveness and contribution factors that when weighted and rated reflect the health of the MC and A program. The MC and A Cost Model, using an Excel workbook, calculates budget and/or actual costs using these same elements/sub-elements resulting in total costs and effectiveness costs per element/sub-element. These calculations allow management to identify how costs are distributed for each element/sub-element. The Cost Model, as part of the SFPI program review process, enables management to determine if spending is appropriate for each element/sub-element.

The Swarm Initial Field Model for the 2014 Geomagnetic Field

Science.gov (United States)

Olsen, Nils; Hulot, Gauthier; Lesur, Vincent; Finlay, Christopher C.; Beggan, Ciaran; Chulliat, Arnaud; Sabaka, Terence J.; Floberghagen, Rune; Friis-Christensen, Eigil; Haagmans, Roger

2015-01-01

Data from the first year of ESA's Swarm constellation mission are used to derive the Swarm Initial Field Model (SIFM), a new model of the Earth's magnetic field and its time variation. In addition to the conventional magnetic field observations provided by each of the three Swarm satellites, explicit advantage is taken of the constellation aspect by including east-west magnetic intensity gradient information from the lower satellite pair. Along-track differences in magnetic intensity provide further information concerning the north-south gradient. The SIFM static field shows excellent agreement (up to at least degree 60) with recent field models derived from CHAMP data, providing an initial validation of the quality of the Swarm magnetic measurements. Use of gradient data improves the determination of both the static field and its secular variation, with the mean misfit for east-west intensity differences between the lower satellite pair being only 0.12 nT.

Robust method for determining steady state initial values for MSS plant models

International Nuclear Information System (INIS)

Ringham, M.R.; Carlson, J.R.

1987-01-01

Results of an EPRI sponsored project (RP 2504-3 amend i) demonstrated that the methodology embodied in the existing System Performance and Analysis Code (SPANC) can be employed to provide initial values for MSS plant models. An EASY5 version of the TMI plant two loop approximation with primary coolant flow recirculation through a failed pump was selected for demonstration purposes. The project entailed replacing the 1967 ASME steam properties in SPANC with the simplified MSS functions. The MSS component models were then recast into equivalent steady state models compatible with the SPANC executive system. A special input routine was written to modify the MSS data to the SPANC data format. The accuracy of the obtained initial values was approximately four significant figures, sufficient to converge on the EASY5 steady state algorithms. Convergence is relatively insensitive to the initial guess in SPANC and are obtained at a computer cost of approximately two minutes on the UNIVAC 1100/60. Since plant configuration is established by data input in SPANC, it can easily be altered to provide initial values for an MMS simulation of all TMI type plants

Deterministic integer multiple firing depending on initial state in Wang model

Energy Technology Data Exchange (ETDEWEB)

Xie Yong [Institute of Nonlinear Dynamics, MSSV, Department of Engineering Mechanics, Xi' an Jiaotong University, Xi' an 710049 (China)]. E-mail: yxie@mail.xjtu.edu.cn; Xu Jianxue [Institute of Nonlinear Dynamics, MSSV, Department of Engineering Mechanics, Xi' an Jiaotong University, Xi' an 710049 (China); Jiang Jun [Institute of Nonlinear Dynamics, MSSV, Department of Engineering Mechanics, Xi' an Jiaotong University, Xi' an 710049 (China)

2006-12-15

We investigate numerically dynamical behaviour of the Wang model, which describes the rhythmic activities of thalamic relay neurons. The model neuron exhibits Type I excitability from a global view, but Type II excitability from a local view. There exists a narrow range of bistability, in which a subthreshold oscillation and a suprathreshold firing behaviour coexist. A special firing pattern, integer multiple firing can be found in the certain part of the bistable range. The characteristic feature of such firing pattern is that the histogram of interspike intervals has a multipeaked structure, and the peaks are located at about integer multiples of a basic interspike interval. Since the Wang model is noise-free, the integer multiple firing is a deterministic firing pattern. The existence of bistability leads to the deterministic integer multiple firing depending on the initial state of the model neuron, i.e., the initial values of the state variables.

Deterministic integer multiple firing depending on initial state in Wang model

International Nuclear Information System (INIS)

Xie Yong; Xu Jianxue; Jiang Jun

2006-01-01

We investigate numerically dynamical behaviour of the Wang model, which describes the rhythmic activities of thalamic relay neurons. The model neuron exhibits Type I excitability from a global view, but Type II excitability from a local view. There exists a narrow range of bistability, in which a subthreshold oscillation and a suprathreshold firing behaviour coexist. A special firing pattern, integer multiple firing can be found in the certain part of the bistable range. The characteristic feature of such firing pattern is that the histogram of interspike intervals has a multipeaked structure, and the peaks are located at about integer multiples of a basic interspike interval. Since the Wang model is noise-free, the integer multiple firing is a deterministic firing pattern. The existence of bistability leads to the deterministic integer multiple firing depending on the initial state of the model neuron, i.e., the initial values of the state variables

Model Forecast Skill and Sensitivity to Initial Conditions in the Seasonal Sea Ice Outlook

Science.gov (United States)

Blanchard-Wrigglesworth, E.; Cullather, R. I.; Wang, W.; Zhang, J.; Bitz, C. M.

2015-01-01

We explore the skill of predictions of September Arctic sea ice extent from dynamical models participating in the Sea Ice Outlook (SIO). Forecasts submitted in August, at roughly 2 month lead times, are skillful. However, skill is lower in forecasts submitted to SIO, which began in 2008, than in hindcasts (retrospective forecasts) of the last few decades. The multimodel mean SIO predictions offer slightly higher skill than the single-model SIO predictions, but neither beats a damped persistence forecast at longer than 2 month lead times. The models are largely unsuccessful at predicting each other, indicating a large difference in model physics and/or initial conditions. Motivated by this, we perform an initial condition sensitivity experiment with four SIO models, applying a fixed -1 m perturbation to the initial sea ice thickness. The significant range of the response among the models suggests that different model physics make a significant contribution to forecast uncertainty.

European initiatives for modeling emissions from transport

DEFF Research Database (Denmark)

Joumard, Robert; Hickman, A. John; Samaras, Zissis

1998-01-01

In Europe there have been many cooperative studies into transport emission inventories since the late 80s. These cover the scope of CORINAIR program involving experts from seven European Community laboratories addressing only road transport emissions at national level. These also include the latest...... covered are the composition of the vehicle fleets, emission factors, driving statistics and the modeling approach. Many of the European initiatives aim also at promoting further cooperation between national laboratories and at defining future research needs. An assessment of these future needs...... is presented from a European point of view....

THE DEVELOPMENT OF A MODEL INITIATION OF PROJECT IN A FORM OF MARKOV CHAIN

Directory of Open Access Journals (Sweden)

Катерина Вікторівна КОЛЕСНІКОВА

2017-03-01

Full Text Available The model of the initiation of projects which reproduces a fragment of the general scheme of interaction between the main entities in the project initiation phase is created. Determined that the project initiation through communication links between the four main entities: projects team, environment, the project itself and the customer. The result of the initiation of projects in the emerging communications referred to objects in the design phase through consistency requirements of stakeholders and the adoption of the basic concepts of projects, goal-projects, project planning, evaluation requirements of specialization and competence required for the formation of the project team. This Markov chain is part of the control circuit that includes elements such as the temporary organizational structure of the project design, project team, customer, and environment project. It is shown that the Markov model of interaction between project participants in their initiation phase, taking into account the role of a key player in the project ‑ the customer can determine changes of state and generate recommendations for initiating projects. Results of the study can serve as a basis for creating models of control objects that contain its organizational structure and reflect the parametric properties of the system to obtain information needed for decision making to initiate projects

Preliminary Results of a U.S. Deep South Warm Season Deep Convective Initiation Modeling Experiment using NASA SPoRT Initialization Datasets for Operational National Weather Service Local Model Runs

Science.gov (United States)

Medlin, Jeffrey M.; Wood, Lance; Zavodsky, Brad; Case, Jon; Molthan, Andrew

2012-01-01

The initiation of deep convection during the warm season is a forecast challenge in the relative high instability and low wind shear environment of the U.S. Deep South. Despite improved knowledge of the character of well known mesoscale features such as local sea-, bay- and land-breezes, observations show the evolution of these features fall well short in fully describing the location of first initiates. A joint collaborative modeling effort among the NWS offices in Mobile, AL, and Houston, TX, and NASA s Short-term Prediction Research and Transition (SPoRT) Center was undertaken during the 2012 warm season to examine the impact of certain NASA produced products on the Weather Research and Forecasting Environmental Modeling System. The NASA products were: a 4-km Land Information System data, a 1-km sea surface temperature analysis, and a 4-km greenness vegetation fraction analysis. Similar domains were established over the southeast Texas and Alabama coastlines, each with a 9 km outer grid spacing and a 3 km inner nest spacing. The model was run at each NWS office once per day out to 24 hours from 0600 UTC, using the NCEP Global Forecast System for initial and boundary conditions. Control runs without the NASA products were made at the NASA SPoRT Center. The NCAR Model Evaluation Tools verification package was used to evaluate both the forecast timing and location of the first initiates, with a focus on the impacts of the NASA products on the model forecasts. Select case studies will be presented to highlight the influence of the products.

The chain rule implies Tsirelson's bound: an approach from generalized mutual information

International Nuclear Information System (INIS)

Wakakuwa, Eyuri; Murao, Mio

2012-01-01

In order to analyze an information theoretical derivation of Tsirelson's bound based on information causality, we introduce a generalized mutual information (GMI), defined as the optimal coding rate of a channel with classical inputs and general probabilistic outputs. In the case where the outputs are quantum, the GMI coincides with the quantum mutual information. In general, the GMI does not necessarily satisfy the chain rule. We prove that Tsirelson's bound can be derived by imposing the chain rule on the GMI. We formulate a principle, which we call the no-supersignaling condition, which states that the assistance of nonlocal correlations does not increase the capability of classical communication. We prove that this condition is equivalent to the no-signaling condition. As a result, we show that Tsirelson's bound is implied by the nonpositivity of the quantitative difference between information causality and no-supersignaling. (paper)

A new funding model for nursing education through business development initiatives.

Science.gov (United States)

Broome, Marion E; Bowersox, Dave; Relf, Michael

Public and private higher education funding models are shifting from traditional funding of schools and departments to a model in which schools increasingly rely on revenue other than tuition to fulfill and supplement activities related to their core missions. In this paper we discuss what nursing deans need to know about non tuition funding in this contemporary paradigm. We focus on how the Duke University School of Nursing created a Business Development Initiative (BDI) that provides additional revenue to help meets the financial needs of its' programs while nurturing the entrepreneurial spirit of faculty and staff. This BDI holds promise as a model that can be adapted by other schools seeking to support education, research and professional development initiatives without relying solely on tuition, tax dollars, endowments and/or grants. Copyright © 2017 Elsevier Inc. All rights reserved.

Do low-income Cypriots experience food stress? The cost of a healthy food basket relative to guaranteed minimum income in Nicosia, Cyprus.

Science.gov (United States)

Chrysostomou, Stavri; Andreou, Sofia

2017-04-01

The aim of the present study was to assess the cost, acceptability and affordability of the healthy food basket (HFB) among low-income families in Cyprus. HFBs were constructed based on the National Guidelines for Nutrition and Exercise for six different types of households. Acceptability was tested through focus groups. Affordability was defined as the cost of the HFB as a percentage of the guaranteed minimum income (GMI). The value of the GMI is set to be equal to €480 for a single individual and increases with the size of the recipient unit in accordance with the Organization for Economic Co-operation and Development equivalence scales. The Ministry of Labour estimates that, on average, nearly 50% of the GMI is required for food. The total monthly budget for HFB is 0.80, 1.11, 1.27, 1.28, 1.44 and 1.48 times higher than the GMI budget for food among different types of households in Cyprus (a single woman, a single man, a couple, a single woman with two children, a single man with two children and a couple with two children, respectively). In particular, a family with two children on GMI would need to spend a large proportion of their income on the HFB (71.68%). The GMI scheme appears not to consider the cost of healthy food, and thus, families on welfare payments in Cyprus are at a high risk of experiencing food stress. Therefore, additional research is required to measure the cost of the six HFBs in various settings. © 2016 Dietitians Association of Australia.

The environmental vegetation index: A tool potentially useful for arid land management. [Texas and Mexico, plant growth stress due to water deficits

Science.gov (United States)

Gray, T. I., Jr.; Mccrary, D. G. (Principal Investigator)

1981-01-01

The NOAA-6 AVHRR data sets acquired over South Texas and Mexico during the spring of 1980 and after Hurricane Allen passed inland are analyzed. These data were processed to produce the Gray-McCrary Index (GMI's) for each pixel location over the selected area, which area contained rangeland and cropland, both irrigated and nonirrigated. The variations in the GMI's appear to reflect well the availability of water for vegetation. The GMI area maps are shown to delineate and to aid in defining the duration of drought; suggesting the possibility that time changes over a selected area could be useful for irrigation management.

Magnetoimpedance Effect in CoFeMoSiB As-Quenched and Surface Modified Amorphous Ribbons in the Presence of Igon Oxide Nanoparticles of Water-Based Ferrofluid

Directory of Open Access Journals (Sweden)

Zahra Lotfollahi

2017-01-01

Full Text Available Giant magnetoimpedance (GMI has been proposed as a powerful technique for biosensing. In GMI biosensors based on the magnetic label detection the change of the impedance of sensitive element under the application of an external magnetic field was analyzed in the presence of magnetic nanoparticles in a test solution. Amorphous ribbon-based GMI biodetectors have an advantage of low operation frequency and low cost. In this work, magnetic and GMI properties of amorphous Co68.6Fe3.9Mo3.0Si12.0B12.5 ribbons were studied in as-quenched and surface modified states both without and in the presence of maghemite ferrofluid. After the surface modification the coercivity was slightly increased and saturation magnetization decreased in good agreement with increase of the surface roughness, a decrease of magnetic elements concentrations in the surface layer, and formation of a surface protective oxide layer. The GMI difference for as-quenched ribbons in absence and in the presence of ferrofluid was measurable for the frequency range of 2 to 10 MHz and the current intensities of 1 to 20 mA. Although the proposed surface modification by the ultrasound treatment did not improve the sensitivity limit for ferrofluid detection, it did not decrease it either.

Initiating the judicial review in the European model of constitutional justice

OpenAIRE

Stojanović Dragan

2014-01-01

Judicial review is the core competence of the constitutional judicature in Europe, which is largely shaped by the Austrian and German models of constitutional justice. In that context, the issue of initiating the constitutional review of legislation is extremely important. Depending on the subject who is authorized to initiate this proceeding, the constitutional review may be twofold: the abstract control and the incidental control. The former type of constitutional review is generally initia...

Effects of video modeling on social initiations by children with autism.

Science.gov (United States)

Nikopoulos, Christos K; Keenan, Michael

2004-01-01

We examined the effects of a video modeling intervention on social initiation and play behaviors with 3 children with autism using a multiple baseline across subjects design. Each child watched a videotape showing a typically developing peer, and the experimenter engaged in a simple social interactive play using one toy. For all children, social initiation and reciprocal play skills were enhanced, and these effects were maintained at 1- and 3-month follow-up periods.

Study of n-Butyl Acrylate Self-Initiation Reaction Experimentally and via Macroscopic Mechanistic Modeling

Directory of Open Access Journals (Sweden)

Ahmad Arabi Shamsabadi

2016-04-01

Full Text Available This paper presents an experimental study of the self-initiation reaction of n-butyl acrylate (n-BA in free-radical polymerization. For the first time, the frequency factor and activation energy of the monomer self-initiation reaction are estimated from measurements of n-BA conversion in free-radical homo-polymerization initiated only by the monomer. The estimation was carried out using a macroscopic mechanistic mathematical model of the reactor. In addition to already-known reactions that contribute to the polymerization, the model considers a n-BA self-initiation reaction mechanism that is based on our previous electronic-level first-principles theoretical study of the self-initiation reaction. Reaction rate equations are derived using the method of moments. The reaction-rate parameter estimates obtained from conversion measurements agree well with estimates obtained via our purely-theoretical quantum chemical calculations.

Consistent initial conditions for the Saint-Venant equations in river network modeling

Directory of Open Access Journals (Sweden)

C.-W. Yu

2017-09-01

Full Text Available Initial conditions for flows and depths (cross-sectional areas throughout a river network are required for any time-marching (unsteady solution of the one-dimensional (1-D hydrodynamic Saint-Venant equations. For a river network modeled with several Strahler orders of tributaries, comprehensive and consistent synoptic data are typically lacking and synthetic starting conditions are needed. Because of underlying nonlinearity, poorly defined or inconsistent initial conditions can lead to convergence problems and long spin-up times in an unsteady solver. Two new approaches are defined and demonstrated herein for computing flows and cross-sectional areas (or depths. These methods can produce an initial condition data set that is consistent with modeled landscape runoff and river geometry boundary conditions at the initial time. These new methods are (1 the pseudo time-marching method (PTM that iterates toward a steady-state initial condition using an unsteady Saint-Venant solver and (2 the steady-solution method (SSM that makes use of graph theory for initial flow rates and solution of a steady-state 1-D momentum equation for the channel cross-sectional areas. The PTM is shown to be adequate for short river reaches but is significantly slower and has occasional non-convergent behavior for large river networks. The SSM approach is shown to provide a rapid solution of consistent initial conditions for both small and large networks, albeit with the requirement that additional code must be written rather than applying an existing unsteady Saint-Venant solver.

Tailoring giant magnetoimpedance effect of Co-based microwires for optimum efficiency by self-designed square-wave pulse current annealing

Energy Technology Data Exchange (ETDEWEB)

Liu, Jingshun, E-mail: jingshun_liu@163.com [School of Materials Science and Engineering, Inner Mongolia University of Technology, Hohhot 010051 (China); Du, Zhaoxin [School of Materials Science and Engineering, Inner Mongolia University of Technology, Hohhot 010051 (China); Jiang, Sida; Shen, Hongxian [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); Li, Ze [School of Materials Science and Engineering, Inner Mongolia University of Technology, Hohhot 010051 (China); Xing, Dawei [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China); Ma, Wen [School of Materials Science and Engineering, Inner Mongolia University of Technology, Hohhot 010051 (China); Sun, Jianfei [School of Materials Science and Engineering, Harbin Institute of Technology, Harbin 150001 (China)

2015-07-01

Herein, we systematically studied the effect of a novel square-wave pulse current annealing (SPCA) on the magnetic properties and microstructure of Co-based melt-extracted amorphous wires, and efficiently tailored the related experimental parameters by using numerical calculation of transient temperature rise during SPCA process. We obtained the optimal SPCA treatment (at 50 Hz, with amplitude of 90 mA for 480 s) can remarkably enhance the GMI property of as-prepared wires. At 10 MHz, the maximum GMI ratio [ΔZ/Z{sub 0}]{sub max} and maxima response sensitivity ξ{sub max} of SPCA-treated wire increases to 202.60% and 305.74%/Oe, which is nearly two times and 1.5 times of 104.80% and 208.14%/Oe for as-cast wire, respectively. Especially, at 5 MHz, [ΔZ/Z{sub 0}]{sub max} of SPCA-treated wire increases to 185.81%, which is 2.5 times of 73.69% for as-cast wire, and ξ{sub max} of SPCA-treated wire increases to 346.65%/Oe by less than two times of 190.16%/Oe for as-cast wire. From mictrostructural perspective, the notably observed role of atomic order orientation regimes and circular magnetic domain during stress releasing or structural relaxation by the co-action of high-density pulse magnetic field energy and thermal activation energy determines the optimum efficiency of SPCA, further to enhance circumferential permeability. In conclusion, SPCA treatment is expected to effectively improve GMI property of microwires, which can be used as sensitive materials for potential sensor application in detecting weak magnetic field. - Highlights: • Annealing parameters are optimized by transient temperature rising calculation. • SPCA as a novel annealing treatment has larger GMI ratio and field sensitivity. • GMI effect is generally related to annealed microstructures identified by XRD. • Domain observed by MFM to explain the enhanced GMI property for SPCA-ed wires. • Results indicate SPCA-ed wires are useful for potential GMI sensor applications.

Modeling of Future Initial Teacher of Foreign Language Training, Using Situation Analysis

Directory of Open Access Journals (Sweden)

Maryana М. Sidun

2012-12-01

Full Text Available The article discloses the content of modeling of future initial teacher of foreign language, using situation analysis, defines the stages of modeling during the professional competence formation of future teacher of foreign language: preparatory, analytical and executive.

Reduction of initial shock in decadal predictions using a new initialization strategy

Science.gov (United States)

He, Yujun; Wang, Bin; Liu, Mimi; Liu, Li; Yu, Yongqiang; Liu, Juanjuan; Li, Ruizhe; Zhang, Cheng; Xu, Shiming; Huang, Wenyu; Liu, Qun; Wang, Yong; Li, Feifei

2017-08-01

A novel full-field initialization strategy based on the dimension-reduced projection four-dimensional variational data assimilation (DRP-4DVar) is proposed to alleviate the well-known initial shock occurring in the early years of decadal predictions. It generates consistent initial conditions, which best fit the monthly mean oceanic analysis data along the coupled model trajectory in 1 month windows. Three indices to measure the initial shock intensity are also proposed. Results indicate that this method does reduce the initial shock in decadal predictions by Flexible Global Ocean-Atmosphere-Land System model, Grid-point version 2 (FGOALS-g2) compared with the three-dimensional variational data assimilation-based nudging full-field initialization for the same model and is comparable to or even better than the different initialization strategies for other fifth phase of the Coupled Model Intercomparison Project (CMIP5) models. Better hindcasts of global mean surface air temperature anomalies can be obtained than in other FGOALS-g2 experiments. Due to the good model response to external forcing and the reduction of initial shock, higher decadal prediction skill is achieved than in other CMIP5 models.

Application of the cognitive therapy model to initial crisis assessment.

Science.gov (United States)

Calvert, Patricia; Palmer, Christine

2003-03-01

This article provides a background to the development of cognitive therapy and cognitive therapeutic skills with a specific focus on the treatment of a depressive episode. It discusses the utility of cognitive therapeutic strategies to the model of crisis theory and initial crisis assessment currently used by the Community Assessment & Treatment Team of Waitemata District Health Board on the North Shore of Auckland, New Zealand. A brief background to cognitive therapy is provided, followed by a comprehensive example of the use of the Socratic questioning method in guiding collaborative assessment and treatment of suicidality by nurses during the initial crisis assessment.

Frequency and Magnetic Field Dependence of the Skin Depth in Co-rich Soft Magnetic Microwires

Directory of Open Access Journals (Sweden)

A. Zhukov

2016-11-01

Full Text Available We studied giant magnetoimpedance (GMI effect in magnetically soft amorphous Co-rich microwires in the extended frequency range. From obtained experimentally dependences of GMI ratio on magnetic field and different frequencies we estimated the penetration depth and its dependence on applied magnetic field and frequency

Chemical and Dynamical Impacts of Stratospheric Sudden Warmings on Arctic Ozone Variability

Science.gov (United States)

Strahan, S. E.; Douglass, A. R.; Steenrod, S. D.

2016-01-01

We use the Global Modeling Initiative (GMI) chemistry and transport model with Modern-Era Retrospective Analysis for Research and Applications (MERRA) meteorological fields to quantify heterogeneous chemical ozone loss in Arctic winters 2005-2015. Comparisons to Aura Microwave Limb Sounder N2O and O3 observations show the GMI simulation credibly represents the transport processes and net heterogeneous chemical loss necessary to simulate Arctic ozone. We find that the maximum seasonal ozone depletion varies linearly with the number of cold days and with wave driving (eddy heat flux) calculated from MERRA fields. We use this relationship and MERRA temperatures to estimate seasonal ozone loss from 1993 to 2004 when inorganic chlorine levels were in the same range as during the Aura period. Using these loss estimates and the observed March mean 63-90N column O3, we quantify the sensitivity of the ozone dynamical resupply to wave driving, separating it from the sensitivity of ozone depletion to wave driving. The results show that about 2/3 of the deviation of the observed March Arctic O3 from an assumed climatological mean is due to variations in O3 resupply and 13 is due to depletion. Winters with a stratospheric sudden warming (SSW) before mid-February have about 1/3 the depletion of winters without one and export less depletion to the midlatitudes. However, a larger effect on the spring midlatitude ozone comes from dynamical differences between warm and cold Arctic winters, which can mask or add to the impact of exported depletion.

Prediction model for initial point of net vapor generation for low-flow boiling

International Nuclear Information System (INIS)

Sun Qi; Zhao Hua; Yang Ruichang

2003-01-01

The prediction of the initial point of net vapor generation is significant for the calculation of phase distribution in sub-cooled boiling. However, most of the investigations were developed in high-flow boiling, and there is no common model that could be successfully applied for the low-flow boiling. A predictive model for the initial point of net vapor generation for low-flow forced convection and natural circulation is established here, by the analysis of evaporation and condensation heat transfer. The comparison between experimental data and calculated results shows that this model can predict the net vapor generation point successfully in low-flow sub-cooled boiling

Generalized mutual information and Tsirelson's bound

Energy Technology Data Exchange (ETDEWEB)

Wakakuwa, Eyuri [Department of Physics, Graduate School of Science, The University of Tokyo, Tokyo 113-0033 (Japan); Murao, Mio [Institute for Nano Quantum Information Electronics, The University of Tokyo, Tokyo 113-0033, Japan and Department of Physics, Graduate School of Science, The University of Tokyo, Tokyo 113-0033 (Japan)

2014-12-04

We introduce a generalization of the quantum mutual information between a classical system and a quantum system into the mutual information between a classical system and a system described by general probabilistic theories. We apply this generalized mutual information (GMI) to a derivation of Tsirelson's bound from information causality, and prove that Tsirelson's bound can be derived from the chain rule of the GMI. By using the GMI, we formulate the 'no-supersignalling condition' (NSS), that the assistance of correlations does not enhance the capability of classical communication. We prove that NSS is never violated in any no-signalling theory.

Integration of thin film giant magnetoimpedance sensor and surface acoustic wave transponder

KAUST Repository

Li, Bodong

2012-03-09

Passive and remote sensing technology has many potential applications in implantable devices, automation, or structural monitoring. In this paper, a tri-layer thin film giant magnetoimpedance (GMI) sensor with the maximum sensitivity of 16%/Oe and GMI ratio of 44% was combined with a two-port surface acoustic wave(SAW) transponder on a common substrate using standard microfabrication technology resulting in a fully integrated sensor for passive and remote operation. The implementation of the two devices has been optimized by on-chip matching circuits. The measurement results clearly show a magnetic field response at the input port of the SAW transponder that reflects the impedance change of the GMI sensor.

Integration of thin film giant magnetoimpedance sensor and surface acoustic wave transponder

KAUST Repository

Li, Bodong; Salem, Nedime Pelin M. H.; Giouroudi, Ioanna; Kosel, Jü rgen

2012-01-01

Passive and remote sensing technology has many potential applications in implantable devices, automation, or structural monitoring. In this paper, a tri-layer thin film giant magnetoimpedance (GMI) sensor with the maximum sensitivity of 16%/Oe and GMI ratio of 44% was combined with a two-port surface acoustic wave(SAW) transponder on a common substrate using standard microfabrication technology resulting in a fully integrated sensor for passive and remote operation. The implementation of the two devices has been optimized by on-chip matching circuits. The measurement results clearly show a magnetic field response at the input port of the SAW transponder that reflects the impedance change of the GMI sensor.

The Swarm Initial Field Model for the 2014 geomagnetic field

DEFF Research Database (Denmark)

Olsen, Nils; Hulot, Gauthier; Lesur, Vincent

2015-01-01

agreement (up to at least degree 60) with recent field models derived from CHAMP data, providing an initial validation of the quality of the Swarm magnetic measurements. Use of gradient data improves the determination of both the static field and its secular variation, with the mean misfit for East...

A new Method for the Estimation of Initial Condition Uncertainty Structures in Mesoscale Models

Science.gov (United States)

Keller, J. D.; Bach, L.; Hense, A.

2012-12-01

The estimation of fast growing error modes of a system is a key interest of ensemble data assimilation when assessing uncertainty in initial conditions. Over the last two decades three methods (and variations of these methods) have evolved for global numerical weather prediction models: ensemble Kalman filter, singular vectors and breeding of growing modes (or now ensemble transform). While the former incorporates a priori model error information and observation error estimates to determine ensemble initial conditions, the latter two techniques directly address the error structures associated with Lyapunov vectors. However, in global models these structures are mainly associated with transient global wave patterns. When assessing initial condition uncertainty in mesoscale limited area models, several problems regarding the aforementioned techniques arise: (a) additional sources of uncertainty on the smaller scales contribute to the error and (b) error structures from the global scale may quickly move through the model domain (depending on the size of the domain). To address the latter problem, perturbation structures from global models are often included in the mesoscale predictions as perturbed boundary conditions. However, the initial perturbations (when used) are often generated with a variant of an ensemble Kalman filter which does not necessarily focus on the large scale error patterns. In the framework of the European regional reanalysis project of the Hans-Ertel-Center for Weather Research we use a mesoscale model with an implemented nudging data assimilation scheme which does not support ensemble data assimilation at all. In preparation of an ensemble-based regional reanalysis and for the estimation of three-dimensional atmospheric covariance structures, we implemented a new method for the assessment of fast growing error modes for mesoscale limited area models. The so-called self-breeding is development based on the breeding of growing modes technique

Role of the Co-based microwires/polymer matrix interface on giant magneto impedance response

International Nuclear Information System (INIS)

Estévez, Diana; Li, Jiawei; Liu, Gang; Man, Qikui; Chang, Chuntao; Wang, Xinmin; Li, Run-Wei

2015-01-01

Highlights: • Co-based microwires-epoxy interface was modified with silane and GMI was evaluated. • XPS confirmed the adhesion of silane onto the wires by Si–O–Si and Fe–O–Si bonds. • GMI curves for treated samples exhibited two-peak behavior and higher GMI ratio. • GMI variation was explained by the change of the surface magnetic anisotropy. • GMI could potentially be used as a surface scanning technique. - Abstract: The interface of Co-based microwires-epoxy composites was modified by applying silane treatment on the surface of the wires and their magneto impedance (MI) response was evaluated. The aim of the surface treatment was to modify the residual stresses that coexist at the microwires/polymer matrix interface and hence the magnetic anisotropy. X-ray Photoelectron Spectroscopy confirmed the covalent attachment of silane molecule onto the wires surface by the presence of Si–O–Si and Fe–O–Si. The MI curve changed from single peak for untreated samples to double peak behavior for treated samples with a significant improvement of MI ratio. Additionally, the magnitude of the anisotropy field increased with the frequency, which may imply a strongly non-uniform stress distribution towards the surface. The MI variation was explained by the change of the surface magnetic anisotropy owing to the modification of the microwires/polymer matrix interface

Models for ductile crack initiation and tearing resistance under mode 1 loading in pressure vessel steels

International Nuclear Information System (INIS)

Jones, M.R.

1988-06-01

Micromechanistic models are presented which aim to predict plane strain ductile initiation toughness, tearing resistance and notched bar fracture strains in pressure vessel steels under monotonically increasing tensile (mode 1) loading. The models for initiation toughness and tearing resistance recognize that ductile fracture proceeds by the growth and linkage of voids with the crack-tip. The models are shown to predict the trend of initiation toughness with inclusion spacing/size ratio and can bound the available experimental data. The model for crack growth can reproduce the tearing resistance of a pressure vessel steel up to and just beyond crack growth initiation. The fracture strains of notched bars pulled in tension are shown to correspond to the achievement of a critical volume fraction of voids. This criterion is combined with the true stress - true strain history of a material point ahead of a blunting crack-tip to predict the initiation toughness. An attempt was made to predict the fracture strains of notched tensile bars by adopting a model which predicts the onset of a shear localization phenomenon. Fracture strains of the correct order are computed only if a ''secondary'' void nucleation event at carbide precipitates is taken into account. (author)

Model of unplanned smoking initiation of children and adolescents: an integrated stage model of smoking behavior.

Science.gov (United States)

Kremers, S P J; Mudde, A N; De Vries, H

2004-05-01

Two lines of psychological research have attempted to spell out the stages of adolescent smoking initiation. The first has focused on behavioral stages of smoking initiation, while the second line emphasized motivational stages. A large international sample of European adolescents (N = 10,170, mean age = 13.3 years) was followed longitudinally. Self-reported motivational and behavioral stages of smoking initiation were integrated, leading to the development of the Model of Unplanned Smoking Initiation of Children and Adolescents (MUSICA). The MUSICA postulates that youngsters experiment with smoking while they are in an unmotivated state as regards their plans for smoking regularly in the future. More than 95% of the total population resided in one of the seven stages distinguished by MUSICA. The probability of starting to smoke regularly during the 12 months follow-up period increased with advanced stage assignment at baseline. Unique social cognitive predictors of stage progression from the various stages were identified, but effect sizes of predictors of transitions were small. The integration of motivational and behavioral dimensions improves our understanding of the process of smoking initiation. In contrast to current theories of smoking initiation, adolescent uptake of smoking behavior was found to be an unplanned action.

Centrifuge model tests of rainfall-induced slope failures for the investigation of the initiation conditions

Science.gov (United States)

Matziaris, Vasileios; Marshall, Alec; Yu, Hai-Sui

2015-04-01

Rainfall-induced landslides are very common natural disasters which cause damage to properties and infrastructure and may result in the loss of human lives. These phenomena often take place in unsaturated soil slopes and are triggered by the saturation of the soil profile, due to rain infiltration, which leads to a loss of shear strength. The aim of this study is to determine rainfall thresholds for the initiation of landslides under different initial conditions. Model tests of rainfall-induced landslides are conducted in the Nottingham Centre for Geomechanics 50g-T geotechnical centrifuge. Initially unsaturated plane-strain slope models made with fine silica sand are prepared at varying densities at 1g and accommodated within a climatic chamber which provides controlled environmental conditions. During the centrifuge flight at 60g, rainfall events of varying intensity and duration are applied to the slope models causing the initiation of slope failure. The impact of soil state properties and rainfall characteristics on the landslide initiation process are discussed. The variation of pore water pressures within the slope before, during and after simulated rainfall events is recorded using miniature pore pressure transducers buried in the soil model. Slope deformation is determined by using a high-speed camera and digital image analysis techniques.

Corrosion Engineering.

Science.gov (United States)

White, Charles V.

A description is provided for a Corrosion and Corrosion Control course offered in the Continuing Engineering Education Program at the General Motors Institute (GMI). GMI is a small cooperative engineering school of approximately 2,000 students who alternate between six-week periods of academic study and six weeks of related work experience in…

Supplementary data:

Indian Academy of Sciences (India)

Plant Pathology

Supplementary data: Table 1. Identification of various virulence factors in R. solanacearum: Rs-09-161, Rs-10-244, GMI1000. Gene name Rs-09-161 locus tag*. Accession no. Rs-10-244 locus tag*. Accesion no. GMI1000 locus tag. Location. Gene description. Exopolysacharide. epsA. RALSO161_m00209880 KY661391 ...

From explicit to implicit normal mode initialization of a limited-area model

Energy Technology Data Exchange (ETDEWEB)

Bijlsma, S.J.

2013-02-15

In this note the implicit normal mode initialization of a limited-area model is discussed from a different point of view. To that end it is shown that the equations describing the explicit normal mode initialization applied to the shallow water equations in differentiated form on the sphere can readily be derived in normal mode space if the model equations are separable, but only in the case of stationary Rossby modes can be transformed into the implicit equations in physical space. This is a consequence of the simple relations between the components of the different modes in that case. In addition a simple eigenvalue problem is given for the frequencies of the gravity waves. (orig.)

Computational modelling and analysis of the molecular network regulating sporulation initiation in Bacillus subtilis.

Science.gov (United States)

Ihekwaba, Adaoha E C; Mura, Ivan; Barker, Gary C

2014-10-24

Bacterial spores are important contaminants in food, and the spore forming bacteria are often implicated in food safety and food quality considerations. Spore formation is a complex developmental process involving the expression of more than 500 genes over the course of 6 to 8 hrs. The process culminates in the formation of resting cells capable of resisting environmental extremes and remaining dormant for long periods of time, germinating when conditions promote further vegetative growth. Experimental observations of sporulation and germination are problematic and time consuming so that reliable models are an invaluable asset in terms of prediction and risk assessment. In this report we develop a model which assists in the interpretation of sporulation dynamics. This paper defines and analyses a mathematical model for the network regulating Bacillus subtilis sporulation initiation, from sensing of sporulation signals down to the activation of the early genes under control of the master regulator Spo0A. Our model summarises and extends other published modelling studies, by allowing the user to execute sporulation initiation in a scenario where Isopropyl β-D-1-thiogalactopyranoside (IPTG) is used as an artificial sporulation initiator as well as in modelling the induction of sporulation in wild-type cells. The analysis of the model results and the comparison with experimental data indicate that the model is good at predicting inducible responses to sporulation signals. However, the model is unable to reproduce experimentally observed accumulation of phosphorelay sporulation proteins in wild type B. subtilis. This model also highlights that the phosphorelay sub-component, which relays the signals detected by the sensor kinases to the master regulator Spo0A, is crucial in determining the response dynamics of the system. We show that there is a complex connectivity between the phosphorelay features and the master regulatory Spo0A. Additional we discovered that the

Magnetic properties and magnetoimpedance of FeCoNi/CuBe electroplated tubes with different features of field-annealing induced magnetic anisotropy

Energy Technology Data Exchange (ETDEWEB)

El Kammouni, R.; Chlenova, A.A.; Volchkov, S.O. [Ural Federal University, Laboratory of Magnetic Sensors, Lenin Ave. 51, 620000 Ekaterinburg (Russian Federation); Kurlyandskaya, G.V., E-mail: galina@we.lc.ehu.es [Ural Federal University, Laboratory of Magnetic Sensors, Lenin Ave. 51, 620000 Ekaterinburg (Russian Federation); Departamento de Electricidad y Electrónica, Universidad del País Vasco BCMaterials (UPV/EHU), 48940 Leioa (Spain)

2017-02-01

The effect of field annealing (in direct (DC) or alternating current (AC) field) on the structure, magnetic properties and giant magnetoimpedance (GMI) of CuBe/ Fe{sub 19}Co{sub 17}Ni{sub 64} electroplated tubes was studied. The field and frequency dependences of total impedance and its real part were comparatively analyzed together with magnetization processes features. The GMI sensitivity with respect to an applied field was the subject of special attention in view of possible applications of these materials in small magnetic field sensors. The maximum GMI ratio depends strongly on the heat treatments. The DC field annealing leads to the highest total impedance GMI ratio (ΔZ/Z=250%) and real part of the total impedance GMI ratio (ΔR/R=640%), compared to as-cast and AC field annealed samples. The external field response of DC annealed samples presented a single peak GMI response as a consequence of a strong contribution of the longitudinal effective anisotropy. At the same time, the maximum obtained sensitivity of 13.5%/Oe for DC case is much lower compared to the highest sensitivity values obtained for as-prepared (28.6%/Oe) and DC field annealed (22.0%/Oe) tubes for the low frequency of 2.5 MHz. The weak dependence of ΔZ/Z ratio in the case of AC field annealed samples in the high frequency range is an important advantage for particular sensor applications. - Highlights: • CuBe/FeCoNi tubes were fabricated by electroplating. • The effect of field annealing on the structure, magnetic properties and magnetoimpedance was studied. • The maximum magnetoimpedance ( MI) ratio depends strongly on the heat treatments. • The DC field annealing leads to the highest total impedance MI ratio. • Transformation from one- to two-peaks MI curves was observed in the DC field annealed tubes.

Thickness dependence of magnetic properties and giant magneto-impedance effect in amorphous Co{sub 73}Si{sub 12}B{sub 15} thin films prepared by Dual-Ion beam assisted deposition

Energy Technology Data Exchange (ETDEWEB)

Zhang, Yu [School of Physics and Nuclear Energy Engineering, Beihang University, Beijing 100191 (China); BISSE/BUAA-SPNEE joint Laboratory Magnetism and Sperconducting technology on Spacecraft, Beihang University, Beijing 100191 (China); Wang, San-sheng, E-mail: wangssh@buaa.edu.cn [School of Physics and Nuclear Energy Engineering, Beihang University, Beijing 100191 (China); BISSE/BUAA-SPNEE joint Laboratory Magnetism and Sperconducting technology on Spacecraft, Beihang University, Beijing 100191 (China); Hu, Teng [School of Physics and Nuclear Energy Engineering, Beihang University, Beijing 100191 (China); He, Tong-fu [School of Instrumentation Science and Opto-electronics Engineering, Beihang University, Beijing 100191 (China); Chen, Zi-yu [School of Physics and Nuclear Energy Engineering, Beihang University, Beijing 100191 (China); Yi, Zhong; Meng, Li-Fei [Science and Technology on Reliability and Environmental Engineering Laboratory, Beijing Institute of Spacecraft Environment Engineering, Beijing 100094 (China); BISSE/BUAA-SPNEE joint Laboratory Magnetism and Sperconducting technology on Spacecraft, Beihang University, Beijing 100191 (China)

2017-03-15

Dual-Ion Beam Assisted Deposition is a suitable method for the preparation of giant magneto-impedance (GMI) materials. In this paper, Co{sub 73}Si{sub 12}B{sub 15} thin films with different thicknesses were prepared by Dual-Ion Beam Assisted Deposition, and the influences of film thickness on magnetic properties and GMI effect were investigated. It was found that the asymmetric magnetic hysteresis loop in the prepared Co{sub 73}Si{sub 12}B{sub 15} thin films occurs at ambient temperature, and the shift behavior of hysteresis loop associated with film thickness. With the film thickness increasing, the values of shift field and coercive field and other parameters such as remanence and shift ratio appeared complex variation. At a certain frequency, the large GMI effect is only observed in some films, which have good magnetic properties including low coercivity, low remanence ratio and high shift ratio. The results indicated that the thickness dependence of magnetic properties nonlinearly determined the GMI effect in Co{sub 73}Si{sub 12}B{sub 15} thin films. - Highlights: • The relationship between film thickness and ΔZ/Z, ΔR/R, ΔX/X ratio of CoSiB film exhibits a complex behavior as the film thickness increases from 1.33 to 7.34 µm. The maximum value of GMI ratio is observed when the film thickness was 1.56, 2.48, 3.81 or 7.34 µm. • With the increase of film thickness, the peak frequency shifts to lower frequency, but does not decrease following the t-power law. • The above thickness phenomenon is due to the different magnetic properties of thin films. • The Dual-Ion Beam Assisted Deposition is introduced to prepare the GMI materials.

Giant magneto-impedance and stress-impedance effects of microwire composites for sensing applications

Science.gov (United States)

Qin, F. X.; Peng, H. X.; Popov, V. V.; Phan, M. H.

2011-02-01

Composites consisting of glass-coated amorphous microwire Co 68.59Fe 4.84Si 12.41B 14.16 and 913 E-glass prepregs were designed and fabricated. The influences of tensile stress, annealing and number of composite layers on the giant magneto-impedance (GMI) and giant stress-impedance (GSI) effects in these composites were investigated systematically. It was found that the application of tensile stress along the microwire axis or an increase in the number of composite layers reduced the GMI effect and increased the circular anisotropy field, while the annealing treatment had a reverse effect. The value of matrix-wire interfacial stress calculated via the GMI profiles coincided with the value of the applied effective tensile stress to yield similar GMI profiles. Enhancement of the GSI effect was achieved in the composites relative to their single microwire inclusion. These findings are important for the development of functional microwire-based composites for magnetic- and stress-sensing applications. They also open up a new route for probing the interfacial stress in fibre-reinforced polymer (FRP) composites.

Modelling vacuum arcs : from plasma initiation to surface interactions

International Nuclear Information System (INIS)

Timko, H.

2011-01-01

A better understanding of vacuum arcs is desirable in many of today's 'big science' projects including linear colliders, fusion devices, and satellite systems. For the Compact Linear Collider (CLIC) design, radio-frequency (RF) breakdowns occurring in accelerating cavities influence efficiency optimisation and cost reduction issues. Studying vacuum arcs both theoretically as well as experimentally under well-defined and reproducible direct-current (DC) conditions is the first step towards exploring RF breakdowns. In this thesis, we have studied Cu DC vacuum arcs with a combination of experiments, a particle-in-cell (PIC) model of the arc plasma, and molecular dynamics (MD) simulations of the subsequent surface damaging mechanism. We have also developed the 2D Arc-PIC code and the physics model incorporated in it, especially for the purpose of modelling the plasma initiation in vacuum arcs. Assuming the presence of a field emitter at the cathode initially, we have identified the conditions for plasma formation and have studied the transitions from field emission stage to a fully developed arc. The 'footing' of the plasma is the cathode spot that supplies the arc continuously with particles; the high-density core of the plasma is located above this cathode spot. Our results have shown that once an arc plasma is initiated, and as long as energy is available, the arc is self-maintaining due to the plasma sheath that ensures enhanced field emission and sputtering.The plasma model can already give an estimate on how the time-to-breakdown changes with the neutral evaporation rate, which is yet to be determined by atomistic simulations. Due to the non-linearity of the problem, we have also performed a code-to-code comparison. The reproducibility of plasma behaviour and time-to-breakdown with independent codes increased confidence in the results presented here. Our MD simulations identified high-flux, high-energy ion bombardment as a possible mechanism forming the early

Droplet number uncertainties associated with CCN: an assessment using observations and a global model adjoint

Directory of Open Access Journals (Sweden)

R. H. Moore

2013-04-01

Full Text Available We use the Global Modelling Initiative (GMI chemical transport model with a cloud droplet parameterisation adjoint to quantify the sensitivity of cloud droplet number concentration to uncertainties in predicting CCN concentrations. Published CCN closure uncertainties for six different sets of simplifying compositional and mixing state assumptions are used as proxies for modelled CCN uncertainty arising from application of those scenarios. It is found that cloud droplet number concentrations (Nd are fairly insensitive to the number concentration (Na of aerosol which act as CCN over the continents (∂lnNd/∂lnNa ~10–30%, but the sensitivities exceed 70% in pristine regions such as the Alaskan Arctic and remote oceans. This means that CCN concentration uncertainties of 4–71% translate into only 1–23% uncertainty in cloud droplet number, on average. Since most of the anthropogenic indirect forcing is concentrated over the continents, this work shows that the application of Köhler theory and attendant simplifying assumptions in models is not a major source of uncertainty in predicting cloud droplet number or anthropogenic aerosol indirect forcing for the liquid, stratiform clouds simulated in these models. However, it does highlight the sensitivity of some remote areas to pollution brought into the region via long-range transport (e.g., biomass burning or from seasonal biogenic sources (e.g., phytoplankton as a source of dimethylsulfide in the southern oceans. Since these transient processes are not captured well by the climatological emissions inventories employed by current large-scale models, the uncertainties in aerosol-cloud interactions during these events could be much larger than those uncovered here. This finding motivates additional measurements in these pristine regions, for which few observations exist, to quantify the impact (and associated uncertainty of transient aerosol processes on cloud properties.

STUDY CONCERNING THE ELABORATION OF CERTAIN ORIENTATION MODELS AND THE INITIAL SELECTION FOR SPEED SKATING

Directory of Open Access Journals (Sweden)

Vaida Marius

2009-12-01

Full Text Available In realizing this study I started from the premise that, by elaborating certain orientation models and initial selection for the speed skating and their application will appear superior results, necessary results, taking into account the actual evolution of the high performance sport in general and of the speed skating, in special.The target of this study has been the identification of an orientation model and a complete initial selection that should be based on the favorable aptitudes of the speed skating. On the basis of the made researched orientation models and initial selection has been made, things that have been demonstrated experimental that are not viable, the study starting from the data of the 120 copies, the complete experiment being made by 32 subjects separated in two groups, one using the proposed model and the other formed fromsubjects randomly selected.These models can serve as common working instruments both for the orientation process and for the initial selection one, being able to integrate in the proper practical activity, these being used easily both by coaches that are in charge with the proper selection of the athletes but also by the physical education teachers orschool teachers that are in contact with children of an early age.

Three-peak behavior in giant magnetoimpedance effect in Fe73.5-x Cr x Nb3Cu1Si13.5B9 amorphous ribbons

International Nuclear Information System (INIS)

Rosales-Rivera, A.; Valencia, V.H.; Pineda-Gomez, P.

2007-01-01

A systematic study of the giant magnetoimpedance (GMI) effect in Fe 73.5- x Cr x Nb 3 Cu 1 Si 13.5 B 9 amorphous ribbons with x=0, 2, 4, 6, 8 and 10 is presented. The complex impedance in these compounds was measured for applied fields from -80 to 80 Oe at room temperature, via the so-called four-probe technique. Depending on the frequency, the experimentally observed GMI curves usually exhibit two types of behavior, namely single-peak (SP), and two-peak (TP). In this work, we emphasize the presence of a 'three-peak behavior' in GMI curves. It occurs between SP and TP behaviors. The mechanisms leading to the three-peak behavior are discussed

Giant magnetoimpedance effect in sputtered single layered NiFe film and meander NiFe/Cu/NiFe film

International Nuclear Information System (INIS)

Chen, L.; Zhou, Y.; Lei, C.; Zhou, Z.M.; Ding, W.

2010-01-01

Giant magnetoimpedance (GMI) effect on NiFe thin film is very promising due to its application in developing the magnetic field sensors with highly sensitivity and low cost. In this paper, the single layered NiFe thin film and NiFe/Cu/NiFe thin film with a meander structure are prepared by the MEMS technology. The influences of sputtering parameters, film structure and conductor layer width on GMI effect in NiFe single layer and meander NiFe/Cu/NiFe film are investigated. Maximum of the GMI ratio in single layer and sandwich film is 5% and 64%, respectively. The results obtained are useful for developing the high-performance magnetic sensors based on NiFe thin film.

Full-field and anomaly initialization using a low-order climate model: a comparison and proposals for advanced formulations

Science.gov (United States)

Carrassi, A.; Weber, R. J. T.; Guemas, V.; Doblas-Reyes, F. J.; Asif, M.; Volpi, D.

2014-04-01

Initialization techniques for seasonal-to-decadal climate predictions fall into two main categories; namely full-field initialization (FFI) and anomaly initialization (AI). In the FFI case the initial model state is replaced by the best possible available estimate of the real state. By doing so the initial error is efficiently reduced but, due to the unavoidable presence of model deficiencies, once the model is let free to run a prediction, its trajectory drifts away from the observations no matter how small the initial error is. This problem is partly overcome with AI where the aim is to forecast future anomalies by assimilating observed anomalies on an estimate of the model climate. The large variety of experimental setups, models and observational networks adopted worldwide make it difficult to draw firm conclusions on the respective advantages and drawbacks of FFI and AI, or to identify distinctive lines for improvement. The lack of a unified mathematical framework adds an additional difficulty toward the design of adequate initialization strategies that fit the desired forecast horizon, observational network and model at hand. Here we compare FFI and AI using a low-order climate model of nine ordinary differential equations and use the notation and concepts of data assimilation theory to highlight their error scaling properties. This analysis suggests better performances using FFI when a good observational network is available and reveals the direct relation of its skill with the observational accuracy. The skill of AI appears, however, mostly related to the model quality and clear increases of skill can only be expected in coincidence with model upgrades. We have compared FFI and AI in experiments in which either the full system or the atmosphere and ocean were independently initialized. In the former case FFI shows better and longer-lasting improvements, with skillful predictions until month 30. In the initialization of single compartments, the best

Multi-model assessment of the impact of soil moisture initialization on mid-latitude summer predictability

Science.gov (United States)

Ardilouze, Constantin; Batté, L.; Bunzel, F.; Decremer, D.; Déqué, M.; Doblas-Reyes, F. J.; Douville, H.; Fereday, D.; Guemas, V.; MacLachlan, C.; Müller, W.; Prodhomme, C.

2017-12-01

Land surface initial conditions have been recognized as a potential source of predictability in sub-seasonal to seasonal forecast systems, at least for near-surface air temperature prediction over the mid-latitude continents. Yet, few studies have systematically explored such an influence over a sufficient hindcast period and in a multi-model framework to produce a robust quantitative assessment. Here, a dedicated set of twin experiments has been carried out with boreal summer retrospective forecasts over the 1992-2010 period performed by five different global coupled ocean-atmosphere models. The impact of a realistic versus climatological soil moisture initialization is assessed in two regions with high potential previously identified as hotspots of land-atmosphere coupling, namely the North American Great Plains and South-Eastern Europe. Over the latter region, temperature predictions show a significant improvement, especially over the Balkans. Forecast systems better simulate the warmest summers if they follow pronounced dry initial anomalies. It is hypothesized that models manage to capture a positive feedback between high temperature and low soil moisture content prone to dominate over other processes during the warmest summers in this region. Over the Great Plains, however, improving the soil moisture initialization does not lead to any robust gain of forecast quality for near-surface temperature. It is suggested that models biases prevent the forecast systems from making the most of the improved initial conditions.

Agent-based model of angiogenesis simulates capillary sprout initiation in multicellular networks.

Science.gov (United States)

Walpole, J; Chappell, J C; Cluceru, J G; Mac Gabhann, F; Bautch, V L; Peirce, S M

2015-09-01

Many biological processes are controlled by both deterministic and stochastic influences. However, efforts to model these systems often rely on either purely stochastic or purely rule-based methods. To better understand the balance between stochasticity and determinism in biological processes a computational approach that incorporates both influences may afford additional insight into underlying biological mechanisms that give rise to emergent system properties. We apply a combined approach to the simulation and study of angiogenesis, the growth of new blood vessels from existing networks. This complex multicellular process begins with selection of an initiating endothelial cell, or tip cell, which sprouts from the parent vessels in response to stimulation by exogenous cues. We have constructed an agent-based model of sprouting angiogenesis to evaluate endothelial cell sprout initiation frequency and location, and we have experimentally validated it using high-resolution time-lapse confocal microscopy. ABM simulations were then compared to a Monte Carlo model, revealing that purely stochastic simulations could not generate sprout locations as accurately as the rule-informed agent-based model. These findings support the use of rule-based approaches for modeling the complex mechanisms underlying sprouting angiogenesis over purely stochastic methods.

NAIRAS aircraft radiation model development, dose climatology, and initial validation.

Science.gov (United States)

Mertens, Christopher J; Meier, Matthias M; Brown, Steven; Norman, Ryan B; Xu, Xiaojing

2013-10-01

[1] The Nowcast of Atmospheric Ionizing Radiation for Aviation Safety (NAIRAS) is a real-time, global, physics-based model used to assess radiation exposure to commercial aircrews and passengers. The model is a free-running physics-based model in the sense that there are no adjustment factors applied to nudge the model into agreement with measurements. The model predicts dosimetric quantities in the atmosphere from both galactic cosmic rays (GCR) and solar energetic particles, including the response of the geomagnetic field to interplanetary dynamical processes and its subsequent influence on atmospheric dose. The focus of this paper is on atmospheric GCR exposure during geomagnetically quiet conditions, with three main objectives. First, provide detailed descriptions of the NAIRAS GCR transport and dosimetry methodologies. Second, present a climatology of effective dose and ambient dose equivalent rates at typical commercial airline altitudes representative of solar cycle maximum and solar cycle minimum conditions and spanning the full range of geomagnetic cutoff rigidities. Third, conduct an initial validation of the NAIRAS model by comparing predictions of ambient dose equivalent rates with tabulated reference measurement data and recent aircraft radiation measurements taken in 2008 during the minimum between solar cycle 23 and solar cycle 24. By applying the criterion of the International Commission on Radiation Units and Measurements (ICRU) on acceptable levels of aircraft radiation dose uncertainty for ambient dose equivalent greater than or equal to an annual dose of 1 mSv, the NAIRAS model is within 25% of the measured data, which fall within the ICRU acceptable uncertainty limit of 30%. The NAIRAS model predictions of ambient dose equivalent rate are generally within 50% of the measured data for any single-point comparison. The largest differences occur at low latitudes and high cutoffs, where the radiation dose level is low. Nevertheless, analysis

NAIRAS aircraft radiation model development, dose climatology, and initial validation

Science.gov (United States)

Mertens, Christopher J.; Meier, Matthias M.; Brown, Steven; Norman, Ryan B.; Xu, Xiaojing

2013-10-01

The Nowcast of Atmospheric Ionizing Radiation for Aviation Safety (NAIRAS) is a real-time, global, physics-based model used to assess radiation exposure to commercial aircrews and passengers. The model is a free-running physics-based model in the sense that there are no adjustment factors applied to nudge the model into agreement with measurements. The model predicts dosimetric quantities in the atmosphere from both galactic cosmic rays (GCR) and solar energetic particles, including the response of the geomagnetic field to interplanetary dynamical processes and its subsequent influence on atmospheric dose. The focus of this paper is on atmospheric GCR exposure during geomagnetically quiet conditions, with three main objectives. First, provide detailed descriptions of the NAIRAS GCR transport and dosimetry methodologies. Second, present a climatology of effective dose and ambient dose equivalent rates at typical commercial airline altitudes representative of solar cycle maximum and solar cycle minimum conditions and spanning the full range of geomagnetic cutoff rigidities. Third, conduct an initial validation of the NAIRAS model by comparing predictions of ambient dose equivalent rates with tabulated reference measurement data and recent aircraft radiation measurements taken in 2008 during the minimum between solar cycle 23 and solar cycle 24. By applying the criterion of the International Commission on Radiation Units and Measurements (ICRU) on acceptable levels of aircraft radiation dose uncertainty for ambient dose equivalent greater than or equal to an annual dose of 1 mSv, the NAIRAS model is within 25% of the measured data, which fall within the ICRU acceptable uncertainty limit of 30%. The NAIRAS model predictions of ambient dose equivalent rate are generally within 50% of the measured data for any single-point comparison. The largest differences occur at low latitudes and high cutoffs, where the radiation dose level is low. Nevertheless, analysis suggests

Initial CGE Model Results Summary Exogenous and Endogenous Variables Tests

Energy Technology Data Exchange (ETDEWEB)

Edwards, Brian Keith [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Boero, Riccardo [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Rivera, Michael Kelly [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2017-08-07

The following discussion presents initial results of tests of the most recent version of the National Infrastructure Simulation and Analysis Center Dynamic Computable General Equilibrium (CGE) model developed by Los Alamos National Laboratory (LANL). The intent of this is to test and assess the model’s behavioral properties. The test evaluated whether the predicted impacts are reasonable from a qualitative perspective. This issue is whether the predicted change, be it an increase or decrease in other model variables, is consistent with prior economic intuition and expectations about the predicted change. One of the purposes of this effort is to determine whether model changes are needed in order to improve its behavior qualitatively and quantitatively.

Incremental change or initial differences? Testing two models of marital deterioration.

Science.gov (United States)

Lavner, Justin A; Bradbury, Thomas N; Karney, Benjamin R

2012-08-01

Most couples begin marriage intent on maintaining a fulfilling relationship, but some newlyweds soon struggle, and others continue to experience high levels of satisfaction. Do these diverse outcomes result from an incremental process that unfolds over time, as prevailing models suggest, or are they a manifestation of initial differences that are largely evident at the start of the marriage? Using 8 waves of data collected over the first 4 years of marriage (N = 502 spouses, or 251 newlywed marriages), we tested these competing perspectives first by identifying 3 qualitatively distinct relationship satisfaction trajectory groups and then by determining the extent to which spouses in these groups were differentiated on the basis of (a) initial scores and (b) 4-year changes in a set of established predictor variables, including relationship problems, aggression, attributions, stress, and self-esteem. The majority of spouses exhibited high, stable satisfaction over the first 4 years of marriage, whereas declining satisfaction was isolated among couples with relatively low initial satisfaction. Across all predictor variables, initial values afforded stronger discrimination of outcome groups than did rates of change in these variables. Thus, readily measured initial differences are potent antecedents of relationship deterioration, and studies are now needed to clarify the specific ways in which initial indices of risk come to influence changes in spouses' judgments of relationship satisfaction. PsycINFO Database Record (c) 2012 APA, all rights reserved.

Structural and Giant Magneto-impedance properties of Cr-incorporated Co-Fe-Si-B amorphous microwires

Energy Technology Data Exchange (ETDEWEB)

Sarkar, Partha [NDE and Magnetic Materials Group, CSIR-National Metallurgical Laboratory, Jamshedpur 831007 (India); Basu Mallick, A. [Department of Metallurgy and Materials Engineering, Bengal Engineering and Science University, Shibpur, Howrah 711103 (India); Roy, R.K. [NDE and Magnetic Materials Group, CSIR-National Metallurgical Laboratory, Jamshedpur 831007 (India); Panda, A.K., E-mail: akpanda@nmlindia.org [NDE and Magnetic Materials Group, CSIR-National Metallurgical Laboratory, Jamshedpur 831007 (India); Mitra, A. [NDE and Magnetic Materials Group, CSIR-National Metallurgical Laboratory, Jamshedpur 831007 (India)

2012-04-15

The investigation is focused on the effect of Cr incorporation for Co/Fe in (Co{sub 0.5}Fe{sub 0.5}){sub 78-x}Cr{sub x}Si{sub 8}B{sub 14} (x=0-12) amorphous microwires of 110 {mu}m diameter prepared by in-water quenching technique. The rise in crystallization onset T{sub X1} with Cr addition revealed the elemental contribution against devitrification and a consequent thermal stability. Cr is unfavorable towards ferromagnetic ordering leading to a linear drop in Curie temperature T{sub ca} with its rise in concentration. The presence of low Cr content upto Cr-4 at.% has been effective in drastically improving the Giant magneto-impedance (GMI) property. Cr content in the range of 4{<=}X{<=}10 has low magnetostriction and maximum field sensitivity in the as-quenched state. The GMI properties are further improved after annealing treatment. High content of Cr>10 is found to be deleterious towards GMI behavior and its consequent application as sensor material. - Highlights: Black-Right-Pointing-Pointer Cr incorporation in CoFeSiB alloy enhanced thermal stability against devitrification. Black-Right-Pointing-Pointer Optimal Cr content induced low magnetostriction in the rapidly quenched microwires. Black-Right-Pointing-Pointer High GMI ratio and field sensitivity was obtained with optimum Cr in the microwires. Black-Right-Pointing-Pointer Annealing treatment at 725 K for 15 min improved the GMI response of microwires.

EARLY DYNAMICAL EVOLUTION OF THE SOLAR SYSTEM: PINNING DOWN THE INITIAL CONDITIONS OF THE NICE MODEL

International Nuclear Information System (INIS)

Batygin, Konstantin; Brown, Michael E.

2010-01-01

In the recent years, the 'Nice' model of solar system formation has attained an unprecedented level of success in reproducing much of the observed orbital architecture of the solar system by evolving the planets to their current locations from a more compact configuration. Within the context of this model, the formation of the classical Kuiper Belt requires a phase during which the ice giants have a high eccentricity. An outstanding question of this model is the initial configuration from which the solar system started out. Recent work has shown that multi-resonant initial conditions can serve as good candidates, as they naturally prevent vigorous type-II migration. In this paper, we use analytical arguments, as well as self-consistent numerical N-body simulations to identify fully resonant initial conditions, whose dynamical evolution is characterized by an eccentric phase of the ice giants, as well as planetary scattering. We find a total of eight such initial conditions. Four of these primordial states are compatible with the canonical 'Nice' model, while the others imply slightly different evolutions. The results presented here should prove useful in further development of a comprehensive model for solar system formation.

Modulation of Soil Initial State on WRF Model Performance Over China

Science.gov (United States)

Xue, Haile; Jin, Qinjian; Yi, Bingqi; Mullendore, Gretchen L.; Zheng, Xiaohui; Jin, Hongchun

2017-11-01

The soil state (e.g., temperature and moisture) in a mesoscale numerical prediction model is typically initialized by reanalysis or analysis data that may be subject to large bias. Such bias may lead to unrealistic land-atmosphere interactions. This study shows that the Climate Forecast System Reanalysis (CFSR) dramatically underestimates soil temperature and overestimates soil moisture over most parts of China in the first (0-10 cm) and second (10-25 cm) soil layers compared to in situ observations in July 2013. A correction based on the global optimal dual kriging is employed to correct CFSR bias in soil temperature and moisture using in situ observations. To investigate the impacts of the corrected soil state on model forecasts, two numerical model simulations—a control run with CFSR soil state and a disturbed run with the corrected soil state—were conducted using the Weather Research and Forecasting model. All the simulations are initiated 4 times per day and run 48 h. Model results show that the corrected soil state, for example, warmer and drier surface over the most parts of China, can enhance evaporation over wet regions, which changes the overlying atmospheric temperature and moisture. The changes of the lifting condensation level, level of free convection, and water transport due to corrected soil state favor precipitation over wet regions, while prohibiting precipitation over dry regions. Moreover, diagnoses indicate that the remote moisture flux convergence plays a dominant role in the precipitation changes over the wet regions.

Impacts of Using Distributed Energy Resources to Reduce Peak Loads in Vermont

Energy Technology Data Exchange (ETDEWEB)

Ruth, Mark F. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Lunacek, Monte S. [National Renewable Energy Lab. (NREL), Golden, CO (United States); Jones, Birk [Univ. of New Mexico, Albuquerque, NM (United States); Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

2017-11-28

To help the United States develop a modern electricity grid that provides reliable power from multiple resources as well as resiliency under extreme conditions, the U.S. Department of Energy (DOE) is leading the Grid Modernization Initiative (GMI) to help shape the future of the nation's grid. Under the GMI, DOE funded the Vermont Regional Initiative project to provide the technical support and analysis to utilities that need to mitigate possible impacts of increasing renewable generation required by statewide goals. Advanced control of distributed energy resources (DER) can both support higher penetrations of renewable energy by balancing controllable loads to wind and photovoltaic (PV) solar generation and reduce peak demand by shedding noncritical loads. This work focuses on the latter. This document reports on an experiment that evaluated and quantified the potential benefits and impacts of reducing the peak load through demand response (DR) using centrally controllable electric water heaters (EWHs) and batteries on two Green Mountain Power (GMP) feeders. The experiment simulated various hypothetical scenarios that varied the number of controllable EWHs, the amount of distributed PV systems, and the number of distributed residential batteries. The control schemes were designed with several objectives. For the first objective, the primary simulations focused on reducing the load during the independent system operator (ISO) peak when capacity charges were the primary concern. The second objective was to mitigate DR rebound to avoid new peak loads and high ramp rates. The final objective was to minimize customers' discomfort, which is defined by the lack of hot water when it is needed. We performed the simulations using the National Renewable Energy Laboratory's (NREL's) Integrated Energy System Model (IESM) because it can simulate both electric power distribution feeder and appliance end use performance and it includes the ability to simulate

Enhancement of Giant Magneto-Impedance in Series Co-Rich Microwires for Low-Field Sensing Applications

Science.gov (United States)

Jiang, S. D.; Eggers, T.; Thiabgoh, O.; Xing, D. W.; Fang, W. B.; Sun, J. F.; Srikanth, H.; Phan, M. H.

2018-02-01

Two soft ferromagnetic Co68.25Fe4.25Si12.25B15.25 microwires with the same diameter of 50 ± 1 μm but different fabrication processes were placed in series and in parallel circuit configurations to investigate their giant magneto-impedance (GMI) responses in a frequency range of 1-100 MHz for low-field sensing applications. We show that, while the low-field GMI response is significantly reduced in the parallel configuration, it is greatly enhanced in the series connection. These results suggest that a highly sensitive GMI sensor can be designed by arranging multi-wires in a saw-shaped fashion to optimize the sensing area, and soldered together in series connection to maintain the excellent magnetic field sensitivity.

Expert initial review of Columbia River Basin salmonid management models: Summary report

International Nuclear Information System (INIS)

Barnthouse, L.W.

1993-10-01

Over the past years, several fish passage models have been developed to examine the downstream survival of salmon during their annual migration through the Columbia River reservoir system to below Bonneville Dam. More recently, models have been created to simulate the survival of salmon throughout the entire life cycle. The models are used by various regional agencies and native American tribes to assess impacts of dam operation, harvesting, and predation on salmonid abundance. These models are now also being used to assess extinction probabilities and evaluate restoration alternatives for threatened and endangered salmonid stocks. Oak Ridge National Laboratory (ORNL) coordinated an initial evaluation of the principal models by a panel of outside, expert reviewers. None of the models were unequivocally endorsed by any reviewer. Significant strengths and weaknesses were noted for each with respect to reasonability of assumptions and equations, adequacy of documentation, adequacy of supporting data, and calibration procedures. Although the models reviewed differ in some important respects, all reflect a common conceptual basis in classical population dynamic theory and a common empirical basis consisting of the available time series of salmonid stock data, hydrographic records, experimental studies of dam passage parameters, and measurements of reservoir mortality. The results of this initial review are not to be construed as a comprehensive scientific peer review of existing Columbia River Basin (CRB) salmon population models and data. The peer review process can be enhanced further by a dynamic exchange regional modelers and scientific panel experts involving interaction and feedback

Global O3-CO correlations in a chemistry and transport model during July-August: evaluation with TES satellite observations and sensitivity to input meteorological data and emissions

Science.gov (United States)

Choi, Hyun-Deok; Liu, Hongyu; Crawford, James H.; Considine, David B.; Allen, Dale J.; Duncan, Bryan N.; Horowitz, Larry W.; Rodriguez, Jose M.; Strahan, Susan E.; Zhang, Lin; Liu, Xiong; Damon, Megan R.; Steenrod, Stephen D.

2017-07-01

We examine the capability of the Global Modeling Initiative (GMI) chemistry and transport model to reproduce global mid-tropospheric (618 hPa) ozone-carbon monoxide (O3-CO) correlations determined by the measurements from the Tropospheric Emission Spectrometer (TES) aboard NASA's Aura satellite during boreal summer (July-August). The model is driven by three meteorological data sets (finite-volume General Circulation Model (fvGCM) with sea surface temperature for 1995, Goddard Earth Observing System Data Assimilation System Version 4 (GEOS-4 DAS) for 2005, and Modern-Era Retrospective Analysis for Research and Applications (MERRA) for 2005), allowing us to examine the sensitivity of model O3-CO correlations to input meteorological data. Model simulations of radionuclide tracers (222Rn, 210Pb, and 7Be) are used to illustrate the differences in transport-related processes among the meteorological data sets. Simulated O3 values are evaluated with climatological profiles from ozonesonde measurements and satellite tropospheric O3 columns. Despite the fact that the three simulations show significantly different global and regional distributions of O3 and CO concentrations, they show similar patterns of O3-CO correlations on a global scale. All model simulations sampled along the TES orbit track capture the observed positive O3-CO correlations in the Northern Hemisphere midlatitude continental outflow and the Southern Hemisphere subtropics. While all simulations show strong negative correlations over the Tibetan Plateau, northern Africa, the subtropical eastern North Pacific, and the Caribbean, TES O3 and CO concentrations at 618 hPa only show weak negative correlations over much narrower areas (i.e., the Tibetan Plateau and northern Africa). Discrepancies in regional O3-CO correlation patterns in the three simulations may be attributed to differences in convective transport, stratospheric influence, and subsidence, among other processes. To understand how various

Vaping as a Catalyst for Smoking? An Initial Model on the Initiation of Electronic Cigarette Use and the Transition to Tobacco Smoking Among Adolescents.

Science.gov (United States)

Schneider, Sven; Diehl, Katharina

2016-05-01

The popularity of electronic cigarettes (e-cigarettes) among adolescents is growing worldwide. A more accurate model than the much discussed but inadequate Gateway Hypothesis is needed to explain some adolescents' initial preference for e-cigarettes over tobacco cigarettes, as well as any transition from e-cigarettes to tobacco smoking. Our aim was to summarize the diffuse fear that adolescents will be indirectly encouraged to begin smoking tobacco via the use of e-cigarettes and to systematize the disparate causal hypotheses used thus far in relevant literature. We summarized the vague and fragmented hypotheses formulated thus far in literature on both trajectories from abstinence to e-cigarette use and from there to tobacco smoking into a set of empirically testable hypotheses and organized them into a comprehensive model. Our results indicate that the perceived health risks, specific product characteristics (such as taste, price and inconspicuous use), and higher levels of acceptance among peers and others potentially make e-cigarettes initially more attractive to adolescents than tobacco cigarettes. Later, increasing familiarity with nicotine could lead to the reevaluation of both electronic and tobacco cigarettes and subsequently to a potential transition to tobacco smoking. The suggested "catalyst model" takes variations in the nicotine content of e-cigarettes as well as the dual use of different substances into account. Our model provides causal hypotheses for the initiation of e-cigarette use and for the potential transition to tobacco smoking which, after being tested in empirical studies, could lead to the formulation of concrete recommendations for healthcare intervention and prevention measures. We developed a model that provides causal hypotheses for the initiation of e-cigarette use and for the potential transition to tobacco smoking. © The Author 2015. Published by Oxford University Press on behalf of the Society for Research on Nicotine and Tobacco

Modeling the downward transport of 210Pb in Peatlands: Initial Penetration‐Constant Rate of Supply (IP-CRS) model

International Nuclear Information System (INIS)

Olid, Carolina; Diego, David; Garcia-Orellana, Jordi; Cortizas, Antonio Martínez; Klaminder, Jonatan

2016-01-01

The vertical distribution of 210 Pb is commonly used to date peat deposits accumulated over the last 100–150 years. However, several studies have questioned this method because of an apparent post-depositional mobility of 210 Pb within some peat profiles. In this study, we introduce the Initial Penetration–Constant Rate of Supply (IP-CRS) model for calculating ages derived from 210 Pb profiles that are altered by an initial migration of the radionuclide. This new, two-phased, model describes the distribution of atmospheric-derived 210 Pb ( 210 Pb xs ) in peat taking into account both incorporation of 210 Pb into the accumulating peat matrix as well as an initial flushing of 210 Pb through the uppermost peat layers. The validity of the IP-CRS model is tested in four anomalous 210 Pb peat records that showed some deviations from the typical exponential decay profile not explained by variations in peat accumulation rates. Unlike the most commonly used 210 Pb-dating model (Constant Rate of Supply (CRS)), the IP-CRS model estimates peat accumulation rates consistent with typical growth rates for peatlands from the same areas. Confidence in the IP-CRS chronology is also provided by the good agreement with independent chronological markers (i.e. 241 Am and 137 Cs). Our results showed that the IP-CRS can provide chronologies from peat records where 210 Pb mobility is evident, being a valuable tool for studies reconstructing past environmental changes using peat archives during the Anthropocene. - Highlights: • Accurate age dating of peat and sediment cores is critical for evaluating change. • A new 210 Pb dating model that includes vertical transport of 210 Pb was developed. • The IP-CRS model provided consistent peat accumulation rates. • The IP-CRS ages were consistent with independent chronological markers. • The IP-CRS model derives peat ages where downward 210 Pb transport is evidenced.

Global O3–CO correlations in a chemistry and transport model during July–August: evaluation with TES satellite observations and sensitivity to input meteorological data and emissions

Directory of Open Access Journals (Sweden)

H.-D. Choi

2017-07-01

Full Text Available We examine the capability of the Global Modeling Initiative (GMI chemistry and transport model to reproduce global mid-tropospheric (618 hPa ozone–carbon monoxide (O3–CO correlations determined by the measurements from the Tropospheric Emission Spectrometer (TES aboard NASA's Aura satellite during boreal summer (July–August. The model is driven by three meteorological data sets (finite-volume General Circulation Model (fvGCM with sea surface temperature for 1995, Goddard Earth Observing System Data Assimilation System Version 4 (GEOS-4 DAS for 2005, and Modern-Era Retrospective Analysis for Research and Applications (MERRA for 2005, allowing us to examine the sensitivity of model O3–CO correlations to input meteorological data. Model simulations of radionuclide tracers (222Rn, 210Pb, and 7Be are used to illustrate the differences in transport-related processes among the meteorological data sets. Simulated O3 values are evaluated with climatological profiles from ozonesonde measurements and satellite tropospheric O3 columns. Despite the fact that the three simulations show significantly different global and regional distributions of O3 and CO concentrations, they show similar patterns of O3–CO correlations on a global scale. All model simulations sampled along the TES orbit track capture the observed positive O3–CO correlations in the Northern Hemisphere midlatitude continental outflow and the Southern Hemisphere subtropics. While all simulations show strong negative correlations over the Tibetan Plateau, northern Africa, the subtropical eastern North Pacific, and the Caribbean, TES O3 and CO concentrations at 618 hPa only show weak negative correlations over much narrower areas (i.e., the Tibetan Plateau and northern Africa. Discrepancies in regional O3–CO correlation patterns in the three simulations may be attributed to differences in convective transport, stratospheric influence, and subsidence, among other processes. To

Experimental model of biofilm implant-related osteomyelitis to test combination biomaterials using biofilms as initial inocula.

Science.gov (United States)

Williams, Dustin L; Haymond, Bryan S; Woodbury, Kassie L; Beck, J Peter; Moore, David E; Epperson, R Tyler; Bloebaum, Roy D

2012-07-01

Currently, the majority of animal models that are used to study biofilm-related infections use planktonic bacterial cells as initial inocula to produce positive signals of infection in biomaterials studies. However, the use of planktonic cells has potentially led to inconsistent results in infection outcomes. In this study, well-established biofilms of methicillin-resistant Staphylococcus aureus were grown and used as initial inocula in an animal model of a Type IIIB open fracture. The goal of the work was to establish, for the first time, a repeatable model of biofilm implant-related osteomyelitis, wherein biofilms were used as initial inocula to test combination biomaterials. Results showed that 100% of animals that were treated with biofilms developed osteomyelitis, whereas 0% of animals not treated with biofilm developed infection. The development of this experimental model may lead to an important shift in biofilm and biomaterials research by showing that when biofilms are used as initial inocula, they may provide additional insights into how biofilm-related infections in the clinic develop and how they can be treated with combination biomaterials to eradicate and/or prevent biofilm formation. Copyright © 2012 Wiley Periodicals, Inc.

Initializing a Mesoscale Boundary-Layer Model with Radiosonde Observations

Science.gov (United States)

Berri, Guillermo J.; Bertossa, Germán

2018-01-01

A mesoscale boundary-layer model is used to simulate low-level regional wind fields over the La Plata River of South America, a region characterized by a strong daily cycle of land-river surface-temperature contrast and low-level circulations of sea-land breeze type. The initial and boundary conditions are defined from a limited number of local observations and the upper boundary condition is taken from the only radiosonde observations available in the region. The study considers 14 different upper boundary conditions defined from the radiosonde data at standard levels, significant levels, level of the inversion base and interpolated levels at fixed heights, all of them within the first 1500 m. The period of analysis is 1994-2008 during which eight daily observations from 13 weather stations of the region are used to validate the 24-h surface-wind forecast. The model errors are defined as the root-mean-square of relative error in wind-direction frequency distribution and mean wind speed per wind sector. Wind-direction errors are greater than wind-speed errors and show significant dispersion among the different upper boundary conditions, not present in wind speed, revealing a sensitivity to the initialization method. The wind-direction errors show a well-defined daily cycle, not evident in wind speed, with the minimum at noon and the maximum at dusk, but no systematic deterioration with time. The errors grow with the height of the upper boundary condition level, in particular wind direction, and double the errors obtained when the upper boundary condition is defined from the lower levels. The conclusion is that defining the model upper boundary condition from radiosonde data closer to the ground minimizes the low-level wind-field errors throughout the region.

Vertical distribution and sources of tropospheric ozone over South China in spring 2004: Ozonesonde measurements and modeling analysis

Science.gov (United States)

Zhang, Y.; Liu, H.; Crawford, J. H.; Considine, D. B.; Chan, C.; Scientific Team Of Tapto

2010-12-01

The Transport of Air Pollutant and Tropospheric Ozone over China (TAPTO-China) science initiative is a two-year (TAPTO 2004 and 2005) field measurement campaign to help improve our understanding of the physical and chemical processes that control the tropospheric ozone budget over the Chinese subcontinent (including the Asian Pacific rim) and its surrounding SE Asia. In this paper, we use two state-of-the-art 3-D global chemical transport models (GEOS-Chem and Global Modeling Initiative or GMI) to examine the characteristics of vertical distribution and quantify the sources of tropospheric ozone by analysis of TAPTO in-situ ozonesonde data obtained at five stations in South China during spring (April and May) 2004: Lin’an (30.30N, 119.75E), Tengchong (25.01N, 98.30E), Taipei (25.0N, 121.3E), Hong Kong (22.21N, 114.30E) and Sanya (18.21N, 110.31E). The observed tropospheric ozone concentrations show strong spatial and temporal variability, which is largely captured by the models. The models simulate well the observed vertical gradients of tropospheric ozone at higher latitudes but are too low at lower latitudes. Model tagged ozone simulations suggest that stratosphere has a large impact on the upper and middle troposphere (UT/MT) at Lin’an and Tengchong. Continental SE Asian biomass burning emissions are maximum in March but still contribute significantly to the photochemical production of tropopheric ozone in South China in early April. Asian anthropogenic emissions are the major contribution to lower tropospheric ozone at all stations. On the other hand, there are episodes of influence from European/North American anthropogenic emissions. For example, model tagged ozone simulations show that over Lin’an in April 2004, stratosphere contributes 20% (13 ppbv) at 5 km, Asian boundary layer contributes 70% (46 ppbv) to ozone in the boundary layer, European boundary layer contributes 5% (3-4 ppbv) at 1.2 km, and North American boundary layer contributes 4.5% (3

Effect of Endurance Training on The Lactate and Glucose Minimum Intensities

Directory of Open Access Journals (Sweden)

Pedro B. Junior, Vitor L. de Andrade, Eduardo Z. Campos, Carlos A. Kalva-Filho, Alessandro M. Zagatto, Gustavo G. de Araújo, Marcelo Papoti

2018-03-01

Full Text Available Due to the controversy about the sensitive of lactate minimum intensity (LMI to training and the need to develop other tool for aerobic fitness evaluation, the purpose of this study was to analyze the sensitivity of glucose minimum intensity (GMI and LMI to endurance training. Eight trained male cyclists (21.4 ± 1.9 years, 67.6 ± 7.5 kg and 1.72 ± 0.10 m were evaluated twice, before and after 12 weeks of training. GMI and LMI were calculated, respectively, by the lowest blood glucose and lactate values attained during an incremental test performed after a hyperlactemia induction, and VO2max was determined during standard incremental effort. The training was prescribed in three different zones and controlled by heart rate (HR. The training distribution was equivalent to 59.7%, 25.0% and 15.3% below, at and above anaerobic threshold HR respectively. The anaerobic threshold evaluated by GMI and LMI improvement 9.89 ± 4.35% and 10.28 ± 9.89 respectively, after training, but the VO2max 2.52 ± 1.81%. No differences were found between GMI and LMI in pre (218.2 ± 22.1 vs 215.0 ± 18.6 W and post (240.6 ± 22.9 vs 237.5 ± 18.8 W training situations. LMI and GMI were sensitive to 12-week aerobic training in cyclist; thus, both protocols can be used to assess aerobic adaptation, athletes diagnostic and prescribe training.

Experimental and modeling study on pyrolysis of n-decane initiated by nitromethane

KAUST Repository

Jia, Zhenjian

2016-01-15

Initiator could accelerate the rate of hydrocarbon pyrolysis and reduce the required material temperatures for a hypersonic aircraft heat exchanger/reactor. Nitroalkanes were proposed as the effective initiator because of the lower CN bond dissociation energy. In order to investigate the initiation mechanism of nitroalkanes on hydrocarbon pyrolysis, the pyrolysis of n-decane, nitromethane and their binary mixture were carried out at 30, 150 and 760 Torr in a flow reactor with synchrotron vacuum ultraviolet photoionization mass spectrometry (SVUV-PIMS). The identified and quantified pyrolysis species include C1C2 alkanes, C2C10 alkenes, C3C6 dialkenes, C2C3 alkynes, nitrogen oxides such as NO and NO2, benzene, and radicals including CH3, C3H3, and C3H5, which shed light on the mechanism of n-decane and nitromethane pyrolysis, as well as the interactions of these two fuels. The experimental results indicate that the addition of nitromethane decreases the initial decomposition temperature of n-decane, and a stronger promotion effect could be obtained as the experimental pressure increases. The distributions of alkanes, alkenes, dialkenes, alkynes and benzene are also influenced by the addition of nitromethane. A detailed kinetic model with 266 species and 1648 reactions was developed and validated against the mole fraction profiles of reactants, major products and important intermediates during the pyrolysis of each fuel and their binary mixture. The satisfactory model prediction to the experimental measurements permits the analysis of the kinetic effect of nitromethane initiation on the pyrolysis of n-decane. So that, the increase of the conversion rate at a lower temperature, the selectivity of decomposition products, and reduction of benzene formation are better understood.

Impact of particle density and initial volume on mathematical compression models

DEFF Research Database (Denmark)

Sonnergaard, Jørn

2000-01-01

In the calculation of the coefficients of compression models for powders either the initial volume or the particle density is introduced as a normalising factor. The influence of these normalising factors is, however, widely different on coefficients derived from the Kawakita, Walker and Heckel...... equations. The problems are illustrated by investigations on compaction profiles of 17 materials with different molecular structures and particle densities. It is shown that the particle density of materials with covalent bonds in the Heckel model acts as a key parameter with a dominating influence...

Building a good initial model for full-waveform inversion using frequency shift filter

Science.gov (United States)

Wang, Guanchao; Wang, Shangxu; Yuan, Sanyi; Lian, Shijie

2018-05-01

Accurate initial model or available low-frequency data is an important factor in the success of full waveform inversion (FWI). The low-frequency helps determine the kinematical relevant components, low-wavenumber of the velocity model, which are in turn needed to avoid FWI trap in local minima or cycle-skipping. However, in the field, acquiring data that common point of low- and high-frequency signal, then utilize the high-frequency data to obtain the low-wavenumber velocity model. It is well known that the instantaneous amplitude envelope of a wavelet is invariant under frequency shift. This means that resolution is constant for a given frequency bandwidth, and independent of the actual values of the frequencies. Based on this property, we develop a frequency shift filter (FSF) to build the relationship between low- and high-frequency information with a constant frequency bandwidth. After that, we can use the high-frequency information to get a plausible recovery of the low-wavenumber velocity model. Numerical results using synthetic data from the Marmousi and layer model demonstrate that our proposed envelope misfit function based on the frequency shift filter can build an initial model with more accurate long-wavelength components, when low-frequency signals are absent in recorded data.

Assessment of initial soil moisture conditions for event-based rainfall-runoff modelling

OpenAIRE

Tramblay, Yves; Bouvier, Christophe; Martin, C.; Didon-Lescot, J. F.; Todorovik, D.; Domergue, J. M.

2010-01-01

Flash floods are the most destructive natural hazards that occur in the Mediterranean region. Rainfall-runoff models can be very useful for flash flood forecasting and prediction. Event-based models are very popular for operational purposes, but there is a need to reduce the uncertainties related to the initial moisture conditions estimation prior to a flood event. This paper aims to compare several soil moisture indicators: local Time Domain Reflectometry (TDR) measurements of soil moisture,...

Initiative-taking, Improvisational Capability and Business Model Innovation in Emerging Market

DEFF Research Database (Denmark)

Cao, Yangfeng

Business model innovation plays a very important role in developing competitive advantage when multinational small and medium-sized enterprises (SMEs) from developed country enter into emerging markets because of the large contextual distances or gaps between the emerging and developed economies....... Many prior researches have shown that the foreign subsidiaries play important role in shaping the overall strategy of the parent company. However, little is known about how subsidiary specifically facilitates business model innovation (BMI) in emerging markets. Adopting the method of comparative...... innovation in emerging markets. We find that high initiative-taking and strong improvisational capability can accelerate the business model innovation. Our research contributes to the literatures on international and strategic entrepreneurship....

Full-field initialized decadal predictions with the MPI earth system model: an initial shock in the North Atlantic

Science.gov (United States)

Kröger, Jürgen; Pohlmann, Holger; Sienz, Frank; Marotzke, Jochem; Baehr, Johanna; Köhl, Armin; Modali, Kameswarrao; Polkova, Iuliia; Stammer, Detlef; Vamborg, Freja S. E.; Müller, Wolfgang A.

2017-12-01

Our decadal climate prediction system, which is based on the Max-Planck-Institute Earth System Model, is initialized from a coupled assimilation run that utilizes nudging to selected state parameters from reanalyses. We apply full-field nudging in the atmosphere and either full-field or anomaly nudging in the ocean. Full fields from two different ocean reanalyses are considered. This comparison of initialization strategies focuses on the North Atlantic Subpolar Gyre (SPG) region, where the transition from anomaly to full-field nudging reveals large differences in prediction skill for sea surface temperature and ocean heat content (OHC). We show that nudging of temperature and salinity in the ocean modifies OHC and also induces changes in mass and heat transports associated with the ocean flow. In the SPG region, the assimilated OHC signal resembles well OHC from observations, regardless of using full fields or anomalies. The resulting ocean transport, on the other hand, reveals considerable differences between full-field and anomaly nudging. In all assimilation runs, ocean heat transport together with net heat exchange at the surface does not correspond to OHC tendencies, the SPG heat budget is not closed. Discrepancies in the budget in the cases of full-field nudging exceed those in the case of anomaly nudging by a factor of 2-3. The nudging-induced changes in ocean transport continue to be present in the free running hindcasts for up to 5 years, a clear expression of memory in our coupled system. In hindcast mode, on annual to inter-annual scales, ocean heat transport is the dominant driver of SPG OHC. Thus, we ascribe a significant reduction in OHC prediction skill when using full-field instead of anomaly initialization to an initialization shock resulting from the poor initialization of the ocean flow.

Modelling of the initial stage of the surface discharge development

International Nuclear Information System (INIS)

Gibalov, V.; Pietsch, G.

1998-01-01

Computer modelling of the initial stage of the surface discharge was performed by solving numerically the coupled continuity, the Poisson and Townsend ionization equations and taking into account the ionization, attachment and detachment processes. The potential distribution at the dielectric surface and at the boundaries which surround the integration region have been calculated with the charge-image method in a 3D approach. In order to eliminate numerical diffusion effects, the solution of the continuity equation was corrected using a flux correction transport routine. At the positive voltage the development of the discharge channel is determined mainly by the shape of the electrode tip. At the negative voltage the following phases of the discharge may be distinguished: the initial phase, the cathode directed streamer phase resulting in the cathode layer formation, and the propagating phase. The physical processes governing each discharge phase are described in detail. (J.U.)

Tropospheric jet response to Antarctic ozone depletion: An update with Chemistry-Climate Model Initiative (CCMI) models

Science.gov (United States)

Son, Seok-Woo; Han, Bo-Reum; Garfinkel, Chaim I.; Kim, Seo-Yeon; Park, Rokjin; Abraham, N. Luke; Akiyoshi, Hideharu; Archibald, Alexander T.; Butchart, N.; Chipperfield, Martyn P.; Dameris, Martin; Deushi, Makoto; Dhomse, Sandip S.; Hardiman, Steven C.; Jöckel, Patrick; Kinnison, Douglas; Michou, Martine; Morgenstern, Olaf; O’Connor, Fiona M.; Oman, Luke D.; Plummer, David A.; Pozzer, Andrea; Revell, Laura E.; Rozanov, Eugene; Stenke, Andrea; Stone, Kane; Tilmes, Simone; Yamashita, Yousuke; Zeng, Guang

2018-05-01

The Southern Hemisphere (SH) zonal-mean circulation change in response to Antarctic ozone depletion is re-visited by examining a set of the latest model simulations archived for the Chemistry-Climate Model Initiative (CCMI) project. All models reasonably well reproduce Antarctic ozone depletion in the late 20th century. The related SH-summer circulation changes, such as a poleward intensification of westerly jet and a poleward expansion of the Hadley cell, are also well captured. All experiments exhibit quantitatively the same multi-model mean trend, irrespective of whether the ocean is coupled or prescribed. Results are also quantitatively similar to those derived from the Coupled Model Intercomparison Project phase 5 (CMIP5) high-top model simulations in which the stratospheric ozone is mostly prescribed with monthly- and zonally-averaged values. These results suggest that the ozone-hole-induced SH-summer circulation changes are robust across the models irrespective of the specific chemistry-atmosphere-ocean coupling.

Effect of Initial Hydraulic Conditions on Capillary Rise in a Porous Medium: Pore-Network Modeling

KAUST Repository

Joekar-Niasar, V.

2012-01-01

The dynamics of capillary rise in a porous medium have been mostly studied in initially dry systems. As initial saturation and initial hydraulic conditions in many natural and industrial porous media can be variable, it is important to investigate the influence of initial conditions on the dynamics of the process. In this study, using dynamic pore-network modeling, we simulated capillary rise in a porous medium for different initial saturations (and consequently initial capillary pressures). Furthermore, the effect of hydraulic connectivity of the wetting phase in corners on the height and velocity of the wetting front was studied. Our simulation results show that there is a trade-off between capillary forces and trapping due to snap-off, which leads to a nonlinear dependence of wetting front velocity on initial saturation at the pore scale. This analysis may provide a possible answer to the experimental observations in the literature showing a non-monotonic dependency between initial saturation and the macroscopic front velocity. © Soil Science Society of America.

Model of cap-dependent translation initiation in sea urchin: a step towards the eukaryotic translation regulation network.

Science.gov (United States)

Bellé, Robert; Prigent, Sylvain; Siegel, Anne; Cormier, Patrick

2010-03-01

The large and rapid increase in the rate of protein synthesis following fertilization of the sea urchin egg has long been a paradigm of translational control, an important component of the regulation of gene expression in cells. This translational up-regulation is linked to physiological changes that occur upon fertilization and is necessary for entry into first cell division cycle. Accumulated knowledge on cap-dependent initiation of translation makes it suited and timely to start integrating the data into a system view of biological functions. Using a programming environment for system biology coupled with model validation (named Biocham), we have built an integrative model for cap-dependent initiation of translation. The model is described by abstract rules. It contains 51 reactions involved in 74 molecular complexes. The model proved to be coherent with existing knowledge by using queries based on computational tree logic (CTL) as well as Boolean simulations. The model could simulate the change in translation occurring at fertilization in the sea urchin model. It could also be coupled with an existing model designed for cell-cycle control. Therefore, the cap-dependent translation initiation model can be considered a first step towards the eukaryotic translation regulation network.

Modeling the downward transport of {sup 210}Pb in Peatlands: Initial Penetration‐Constant Rate of Supply (IP-CRS) model

Energy Technology Data Exchange (ETDEWEB)

Olid, Carolina, E-mail: olid.carolina@gmail.com [Department of Ecology and Environmental Science, Umeå University, SE-90187, Umeå (Sweden); Diego, David [Department of Earth Science, University of Bergen, NO-5020 Bergen (Norway); Garcia-Orellana, Jordi [Departament de Física, Universitat Autònoma de Barcelona, E-08193 Bellaterra (Spain); Institut de Ciència i Tecnologia Ambientals (ICTA), Universitat Autònoma de Barcelona, E-08193 Bellaterra (Spain); Cortizas, Antonio Martínez [Departamento de Edafoloxía e Química Agrícola, Universidade de Santiago de Compostela, E-15782 Santiago de Compostela (Spain); Klaminder, Jonatan [Department of Ecology and Environmental Science, Umeå University, SE-90187, Umeå (Sweden)

2016-01-15

The vertical distribution of {sup 210}Pb is commonly used to date peat deposits accumulated over the last 100–150 years. However, several studies have questioned this method because of an apparent post-depositional mobility of {sup 210}Pb within some peat profiles. In this study, we introduce the Initial Penetration–Constant Rate of Supply (IP-CRS) model for calculating ages derived from {sup 210}Pb profiles that are altered by an initial migration of the radionuclide. This new, two-phased, model describes the distribution of atmospheric-derived {sup 210}Pb ({sup 210}Pb{sub xs}) in peat taking into account both incorporation of {sup 210}Pb into the accumulating peat matrix as well as an initial flushing of {sup 210}Pb through the uppermost peat layers. The validity of the IP-CRS model is tested in four anomalous {sup 210}Pb peat records that showed some deviations from the typical exponential decay profile not explained by variations in peat accumulation rates. Unlike the most commonly used {sup 210}Pb-dating model (Constant Rate of Supply (CRS)), the IP-CRS model estimates peat accumulation rates consistent with typical growth rates for peatlands from the same areas. Confidence in the IP-CRS chronology is also provided by the good agreement with independent chronological markers (i.e. {sup 241}Am and {sup 137}Cs). Our results showed that the IP-CRS can provide chronologies from peat records where {sup 210}Pb mobility is evident, being a valuable tool for studies reconstructing past environmental changes using peat archives during the Anthropocene. - Highlights: • Accurate age dating of peat and sediment cores is critical for evaluating change. • A new {sup 210}Pb dating model that includes vertical transport of {sup 210}Pb was developed. • The IP-CRS model provided consistent peat accumulation rates. • The IP-CRS ages were consistent with independent chronological markers. • The IP-CRS model derives peat ages where downward {sup 210}Pb transport is

Developing an A Priori Database for Passive Microwave Snow Water Retrievals Over Ocean

Science.gov (United States)

Yin, Mengtao; Liu, Guosheng

2017-12-01

A physically optimized a priori database is developed for Global Precipitation Measurement Microwave Imager (GMI) snow water retrievals over ocean. The initial snow water content profiles are derived from CloudSat Cloud Profiling Radar (CPR) measurements. A radiative transfer model in which the single-scattering properties of nonspherical snowflakes are based on the discrete dipole approximate results is employed to simulate brightness temperatures and their gradients. Snow water content profiles are then optimized through a one-dimensional variational (1D-Var) method. The standard deviations of the difference between observed and simulated brightness temperatures are in a similar magnitude to the observation errors defined for observation error covariance matrix after the 1D-Var optimization, indicating that this variational method is successful. This optimized database is applied in a Bayesian retrieval snow water algorithm. The retrieval results indicated that the 1D-Var approach has a positive impact on the GMI retrieved snow water content profiles by improving the physical consistency between snow water content profiles and observed brightness temperatures. Global distribution of snow water contents retrieved from the a priori database is compared with CloudSat CPR estimates. Results showed that the two estimates have a similar pattern of global distribution, and the difference of their global means is small. In addition, we investigate the impact of using physical parameters to subset the database on snow water retrievals. It is shown that using total precipitable water to subset the database with 1D-Var optimization is beneficial for snow water retrievals.

Giant magnetoimpedance intrinsic impedance and voltage sensitivity of rapidly solidified Co{sub 66}Fe{sub 2}Cr{sub 4}Si{sub 13}B{sub 15} amorphous wire for highly sensitive sensors applications

Energy Technology Data Exchange (ETDEWEB)

Das, Tarun K.; Mandal, Sushil K. [CSIR - National Metallurgical Laboratory, NDE and Magnetic Materials Group, MST Division, Jamshedpur (India); Banerji, Pallab [Indian Institute of Technology, Kharagpur, Materials Science Centre, Kharagpur (India)

2016-11-15

We report a systematic study of the influence of wire length, L, dependence of giant magneto-impedance (GMI) sensitivity of Co{sub 66}Fe{sub 2}Cr{sub 4}Si{sub 13}B{sub 15} soft magnetic amorphous wire of diameter ∝ 100 μm developed by in-water quenching technique. The magnetization behaviour (hysteresis loops) of the wire with different length (L = 1, 2, 3, 5, 8 and 10 cm) has been evaluated by fuxmetric induction method. It was observed that the behaviour of the hysteresis loops change drastically with the wire length, being attributed to the existence of a critical length, L{sub C}, found to be around 3 cm. GMI measurements have been taken using automated GMI measurement system and the GMI sensitivities in terms of intrinsic impedance sensitivity (S{sub Ω/Am}{sup -1}) and voltage sensitivity (S{sub V/Am}{sup -1}) of the wire have been evaluated under optimal bias field and excitation current. It was found that the maximum (S{sub Ω/Am}{sup -1}){sub max} ∼ 0.63 Ω/kAm{sup -1}/cm and (S{sub V/Am}{sup -1}){sub max} ∼ 3.10 V/kAm{sup -1}/cm were achieved at a critical length L{sub C} ∝ 3 cm of the wire for an AC current of 5 mA and a frequency of 5 MHz. These findings provide crucial insights for optimization of the geometrical dimensions of magnetic sensing elements and important practical guidance for designing high sensitive GMI sensors. The relevant combinations of magnetic material parameters and operating conditions that optimize the sensitivity are highlighted. (orig.)

Effect of Fe addition on the magnetic and giant magneto-impedance behaviour of CoCrSiB rapidly solidified alloys

Energy Technology Data Exchange (ETDEWEB)

Kumari, Seema; Chattoraj, I; Panda, A K; Mitra, A; Pal, S K [National Metallurgical Laboratory, Jamshedpur 831 007 (India)

2006-05-21

Thermal electrical resistivity, magnetic hysteresis and magneto-impedance behaviour of melt spun and annealed Co{sub 71-X}Fe{sub X}Cr{sub 7}Si{sub 8}B{sub 14} (X = 0, 2, 3.2, 4, 6, 8 and 12 at.%) were investigated. The addition of Fe in the system changed crystallization as well as the magnetic properties of the materials. The alloy containing 6 at.% Fe showed an increase in resistivity during the first crystallization process. A TEM micrograph indicated the formation of nanostructure during the crystallization process. The GMI properties of the alloys are evaluated at a driving current amplitude of 5 mA and a frequency of 4 MHz. The two-peak behaviour in the GMI profile was observed for all the samples. It is found that the alloy with 4 at.% Fe has the maximum GMI ratio because of the nearly zero magnetostriction value of the sample. About 62% change in the GMI ratio was observed in the alloy with 4 at.% Fe when annealed at 673 K. The anisotropy field was also minimum for the annealed alloy. The results were explained by the formation of directional ordering and the reduction of the magnetostriction constant of the alloy due to nanocrystallization during the annealing process.

One carbon cycle: Impacts of model integration, ecosystem process detail, model resolution, and initialization data, on projections of future climate mitigation strategies

Science.gov (United States)

Fisk, J.; Hurtt, G. C.; le page, Y.; Patel, P. L.; Chini, L. P.; Sahajpal, R.; Dubayah, R.; Thomson, A. M.; Edmonds, J.; Janetos, A. C.

2013-12-01

Integrated assessment models (IAMs) simulate the interactions between human and natural systems at a global scale, representing a broad suite of phenomena across the global economy, energy system, land-use, and carbon cycling. Most proposed climate mitigation strategies rely on maintaining or enhancing the terrestrial carbon sink as a substantial contribution to restrain the concentration of greenhouse gases in the atmosphere, however most IAMs rely on simplified regional representations of terrestrial carbon dynamics. Our research aims to reduce uncertainties associated with forest modeling within integrated assessments, and to quantify the impacts of climate change on forest growth and productivity for integrated assessments of terrestrial carbon management. We developed the new Integrated Ecosystem Demography (iED) to increase terrestrial ecosystem process detail, resolution, and the utilization of remote sensing in integrated assessments. iED brings together state-of-the-art models of human society (GCAM), spatial land-use patterns (GLM) and terrestrial ecosystems (ED) in a fully coupled framework. The major innovative feature of iED is a consistent, process-based representation of ecosystem dynamics and carbon cycle throughout the human, terrestrial, land-use, and atmospheric components. One of the most challenging aspects of ecosystem modeling is to provide accurate initialization of land surface conditions to reflect non-equilibrium conditions, i.e., the actual successional state of the forest. As all plants in ED have an explicit height, it is one of the few ecosystem models that can be initialized directly with vegetation height data. Previous work has demonstrated that ecosystem model resolution and initialization data quality have a large effect on flux predictions at continental scales. Here we use a factorial modeling experiment to quantify the impacts of model integration, process detail, model resolution, and initialization data on projections of

Eosinophilic esophagitis: dilate or medicate? A cost analysis model of the choice of initial therapy.

Science.gov (United States)

Kavitt, R T; Penson, D F; Vaezi, M F

2014-07-01

Eosinophilic esophagitis (EoE) is an increasingly recognized clinical entity. The optimal initial treatment strategy in adults with EoE remains controversial. The aim of this study was to employ a decision analysis model to determine the less costly option between the two most commonly employed treatment strategies in EoE. We constructed a model for an index case of a patient with biopsy-proven EoE who continues to be symptomatic despite proton-pump inhibitor therapy. The following treatment strategies were included: (i) swallowed fluticasone inhaler (followed by esophagogastroduodenoscopy [EGD] with dilation if ineffective); and (ii) EGD with dilation (followed by swallowed fluticasone inhaler if ineffective). The time horizon was 1 year. The model focused on cost analysis of initial treatment strategies. The perspective of the healthcare payer was used. Sensitivity analyses were performed to assess the robustness of the model. For every patient whose symptoms improved or resolved with the strategy of fluticasone first followed by EGD, if necessary, it cost an average of $1078. Similarly, it cost an average of $1171 per patient if EGD with dilation was employed first. Sensitivity analyses indicated that initial treatment with fluticasone was the less costly strategy to improve dysphagia symptoms as long as the effectiveness of fluticasone remains at or above 0.62. Swallowed fluticasone inhaler (followed by EGD with dilation if necessary) is the more economical initial strategy when compared with EGD with dilation first. © 2012 Copyright the Authors. Journal compilation © 2012, Wiley Periodicals, Inc. and the International Society for Diseases of the Esophagus.

Theoretical modeling and experimental study on fatigue initiation life of 16MnR notched components

International Nuclear Information System (INIS)

Wang Xiaogui; Gao Zengliang; Qiu Baoxiang; Jiang Yanrao

2010-01-01

In order to investigate the effects of notch geometry and loading conditions on the fatigue initiation life and fatigue fracture life of 16MnR material, fatigue experiments were conducted for both smooth rod specimens and notched rod specimens. The detailed elastic-plastic stress and strain responses were computed by the finite element software (ABAQUS) incorporating a robust cyclic plasticity model via a user subroutine UMAT. The obtained stresses and strains were applied to the multiaxial fatigue damage criterion to compute the fatigue damage induced by a loading cycle on the critical material plane. The fatigue initiation life was then obtained by the proposed theoretical model. The well agreement between the predicted results and the experiment data indicated that the fatigue initiation of notched components in the multiaxial stress state related to all the nonzero stress and strain quantities. (authors)

Investigation of surface effect on giant magnetoimpedance in microwires

International Nuclear Information System (INIS)

Tousignant, M.; Zabeida, O.; Rudkowska, G.; Yelon, A.

2014-01-01

Previous work from our group suggested that the giant magnetoimpedance (GMI) response of soft ferromagnetic microwires could be improved by removing a hypothetical hard magnetic shell on the surface of the cylindrical conductors. Therefore, we have been trying to increase the sensitivity of our samples by exposing them to a mild plasma etching treatment. Although we measured a reduction in diameter of the microwires and ensured that their bulk magnetic properties remained unchanged, it was found that the surface treatment did not improve the GMI behavior of the samples. We thus conclude that the sensitivity of ferromagnetic microwires must be limited by bulk inhomogeneities, yet to be investigated. - Highlights: • We have been trying to increase the sensitivity of our samples by exposing them to a mild plasma etching treatment. • Surface treatment did not improve the GMI behavior of the samples

Updated global soil map for the Weather Research and Forecasting model and soil moisture initialization for the Noah land surface model

Science.gov (United States)

DY, C. Y.; Fung, J. C. H.

2016-08-01

A meteorological model requires accurate initial conditions and boundary conditions to obtain realistic numerical weather predictions. The land surface controls the surface heat and moisture exchanges, which can be determined by the physical properties of the soil and soil state variables, subsequently exerting an effect on the boundary layer meteorology. The initial and boundary conditions of soil moisture are currently obtained via National Centers for Environmental Prediction FNL (Final) Operational Global Analysis data, which are collected operationally in 1° by 1° resolutions every 6 h. Another input to the model is the soil map generated by the Food and Agriculture Organization of the United Nations - United Nations Educational, Scientific and Cultural Organization (FAO-UNESCO) soil database, which combines several soil surveys from around the world. Both soil moisture from the FNL analysis data and the default soil map lack accuracy and feature coarse resolutions, particularly for certain areas of China. In this study, we update the global soil map with data from Beijing Normal University in 1 km by 1 km grids and propose an alternative method of soil moisture initialization. Simulations of the Weather Research and Forecasting model show that spinning-up the soil moisture improves near-surface temperature and relative humidity prediction using different types of soil moisture initialization. Explanations of that improvement and improvement of the planetary boundary layer height in performing process analysis are provided.

Primordial non-Gaussianities in single field inflationary models with non-trivial initial states

Energy Technology Data Exchange (ETDEWEB)

Bahrami, Sina; Flanagan, Éanna É., E-mail: sb933@cornell.edu, E-mail: eef3@cornell.edu [Department of Physics, Cornell University, Ithaca, NY 14853 (United States)

2014-10-01

We compute the non-Gaussianities that arise in single field, slow roll inflationary models arising from arbitrary homogeneous initial states, as well as subleading contributions to the power spectrum. Non Bunch-Davies vacuum initial states can arise if the transition to the single field, slow roll inflation phase occurs only shortly before observable modes left the horizon. They can also arise from new physics at high energies that has been integrated out. Our general result for the bispectrum exhibits several features that were previously seen in special cases.

Role of the atmospheric mean state on the initiation of the Madden-Julian oscillation in a tropical channel model

Energy Technology Data Exchange (ETDEWEB)

Ray, Pallav; Zhang, Chidong [University of Miami, RSMAS/MPO, Miami, FL (United States); Moncrieff, Mitchell W.; Dudhia, Jim; Caron, Julie M.; Bruyere, Cindy [National Center for Atmospheric Research, Boulder, CO (United States); Ruby Leung, L. [Pacific Northwest National Laboratory, Richland, WA (United States)

2011-01-15

Tropical channel models, defined as models that are global in the zonal direction but bounded in the meridional direction, are particularly useful for simulating the Madden-Julian oscillation (MJO) and understanding its physical and dynamical basis. Influences from the extratropics through the lateral boundaries have been found to be essential to the reproduction of the initiation of certain MJO events. This led to a hypothesis that multi-year simulations using a tropical channel model would reproduce reasonable MJO statistics under the influence of prescribed lateral boundary conditions derived from global reanalyses. Interestingly, the MJO statistics in such a multi-year simulation by a high-resolution tropical channel model are not better than those from global climate models. The error in the atmospheric mean state is found to be a possible reason for the poor MJO statistics in the simulation. Nevertheless, even with a large error in the mean state, the multi-year simulation captures two MJO events previously found to be initiated by extratropical influences. However, the model does not reproduce a third event, whose initiation is not directly influenced by the extratropics. This implies that in the absence of dynamical interactions between the MJO and the lateral boundary conditions, the error in the mean state could be sufficient to prevent the MJO initiation. To explore this third MJO event further, a series of sensitivity tests are conducted. These tests show that the simulation of this event is neither critically influenced by the cumulus parameterization employed, nor the initial conditions when the model is integrated 2 weeks prior to the MJO initiation. The model captures this event when the MJO signal is already present in the initial conditions. The use of high-resolution sea surface temperature does not improve the simulation of the third MJO event. A higher-resolution nested domain covering the Indo-Pacific warm pool region and including a cloud

A methodological framework to support the initiation, design and institutionalization of participatory modeling processes in water resources management

Science.gov (United States)

Halbe, Johannes; Pahl-Wostl, Claudia; Adamowski, Jan

2018-01-01

Multiple barriers constrain the widespread application of participatory methods in water management, including the more technical focus of most water agencies, additional cost and time requirements for stakeholder involvement, as well as institutional structures that impede collaborative management. This paper presents a stepwise methodological framework that addresses the challenges of context-sensitive initiation, design and institutionalization of participatory modeling processes. The methodological framework consists of five successive stages: (1) problem framing and stakeholder analysis, (2) process design, (3) individual modeling, (4) group model building, and (5) institutionalized participatory modeling. The Management and Transition Framework is used for problem diagnosis (Stage One), context-sensitive process design (Stage Two) and analysis of requirements for the institutionalization of participatory water management (Stage Five). Conceptual modeling is used to initiate participatory modeling processes (Stage Three) and ensure a high compatibility with quantitative modeling approaches (Stage Four). This paper describes the proposed participatory model building (PMB) framework and provides a case study of its application in Québec, Canada. The results of the Québec study demonstrate the applicability of the PMB framework for initiating and designing participatory model building processes and analyzing barriers towards institutionalization.

A mesoscopic reaction rate model for shock initiation of multi-component PBX explosives.

Science.gov (United States)

Liu, Y R; Duan, Z P; Zhang, Z Y; Ou, Z C; Huang, F L

2016-11-05

The primary goal of this research is to develop a three-term mesoscopic reaction rate model that consists of a hot-spot ignition, a low-pressure slow burning and a high-pressure fast reaction terms for shock initiation of multi-component Plastic Bonded Explosives (PBX). Thereinto, based on the DZK hot-spot model for a single-component PBX explosive, the hot-spot ignition term as well as its reaction rate is obtained through a "mixing rule" of the explosive components; new expressions for both the low-pressure slow burning term and the high-pressure fast reaction term are also obtained by establishing the relationships between the reaction rate of the multi-component PBX explosive and that of its explosive components, based on the low-pressure slow burning term and the high-pressure fast reaction term of a mesoscopic reaction rate model. Furthermore, for verification, the new reaction rate model is incorporated into the DYNA2D code to simulate numerically the shock initiation process of the PBXC03 and the PBXC10 multi-component PBX explosives, and the numerical results of the pressure histories at different Lagrange locations in explosive are found to be in good agreements with previous experimental data. Copyright © 2016 Elsevier B.V. All rights reserved.

What it takes to get proactive: An integrative multilevel model of the antecedents of personal initiative.

Science.gov (United States)

Hong, Ying; Liao, Hui; Raub, Steffen; Han, Joo Hun

2016-05-01

Building upon and extending Parker, Bindl, and Strauss's (2010) theory of proactive motivation, we develop an integrated, multilevel model to examine how contextual factors shape employees' proactive motivational states and, through these proactive motivational states, influence their personal initiative behavior. Using data from a sample of hotels collected from 3 sources and over 2 time periods, we show that establishment-level initiative-enhancing human resource management (HRM) systems were positively related to departmental initiative climate, which was positively related to employee personal initiative through employee role-breadth self-efficacy. Further, department-level empowering leadership was positively related to initiative climate only when initiative-enhancing HRM systems were low. These findings offer interesting implications for research on personal initiative and for the management of employee proactivity in organizations. (PsycINFO Database Record (c) 2016 APA, all rights reserved).

Revivals and entanglement from initially entangled mixed states of a damped Jaynes-Cummings model

International Nuclear Information System (INIS)

Rendell, R.W.; Rajagopal, A.K.

2003-01-01

An exact density matrix of a phase-damped Jaynes-Cummings model (JCM) with entangled Bell-like initial states formed from a model two-state atom and sets of adjacent photon number states of a single-mode radiation field is presented. The entanglement of the initial states and the subsequent time evolution is assured by finding a positive lower bound on the concurrence of local 2x2 projections of the full 2x∞ JCM density matrix. It is found that the time evolution of the lower bound of the concurrence systematically captures the corresponding collapse and revival features in atomic inversion, relative entropies of atomic and radiation, mutual entropy, and quantum deficit. The atom and radiation subsystems exhibit alternating sets of collapses and revivals in a complementary fashion due to the initially mixed states of the atom and radiation employed here. This is in contrast with the result obtained when the initial state of the dissipationless system is a factored pure state of the atom and radiation, where the atomic and radiation entropies are necessarily the same. The magnitudes of the entanglement lower bound and the atomic and radiation revivals become larger as both the magnitude and phase of the Bell-like initial state contribution increase. The time evolution of the entropy difference of the total system and that of the radiation subsystem exhibit negative regions called 'supercorrelated' states which do not appear in the atomic subsystem. Entangled initial states are found to enhance this supercorrelated feature. Finally, the effect of phase damping is to randomize both the subsystems for asymptotically long times. It may be feasible to experimentally investigate the results presented here using the Rabi oscillation methods of microwave and optical cavity quantum electrodynamics since pure photon number states have recently been produced and observed

Structure-Function Model for Kissing Loop Interactions That Initiate Dimerization of Ty1 RNA

Directory of Open Access Journals (Sweden)

Eric R. Gamache

2017-04-01

Full Text Available The genomic RNA of the retrotransposon Ty1 is packaged as a dimer into virus-like particles. The 5′ terminus of Ty1 RNA harbors cis-acting sequences required for translation initiation, packaging and initiation of reverse transcription (TIPIRT. To identify RNA motifs involved in dimerization and packaging, a structural model of the TIPIRT domain in vitro was developed from single-nucleotide resolution RNA structural data. In general agreement with previous models, the first 326 nucleotides of Ty1 RNA form a pseudoknot with a 7-bp stem (S1, a 1-nucleotide interhelical loop and an 8-bp stem (S2 that delineate two long, structured loops. Nucleotide substitutions that disrupt either pseudoknot stem greatly reduced helper-Ty1-mediated retrotransposition of a mini-Ty1, but only mutations in S2 destabilized mini-Ty1 RNA in cis and helper-Ty1 RNA in trans. Nested in different loops of the pseudoknot are two hairpins with complementary 7-nucleotide motifs at their apices. Nucleotide substitutions in either motif also reduced retrotransposition and destabilized mini- and helper-Ty1 RNA. Compensatory mutations that restore base-pairing in the S2 stem or between the hairpins rescued retrotransposition and RNA stability in cis and trans. These data inform a model whereby a Ty1 RNA kissing complex with two intermolecular kissing-loop interactions initiates dimerization and packaging.

A strategy for multimodal deformable image registration to integrate PET/MR into radiotherapy treatment planning

International Nuclear Information System (INIS)

Leibfarth, Sara; Moennich, David; Thorwarth, Daniela; Welz, Stefan; Siegel, Christine; Zips, Daniel; Schwenzer, Nina; Holger Schmidt, Holger

2013-01-01

Background: Combined positron emission tomography (PET)/magnetic resonance imaging (MRI) is highly promising for biologically individualized radiotherapy (RT). Hence, the purpose of this work was to develop an accurate and robust registration strategy to integrate combined PET/MR data into RT treatment planning. Material and methods: Eight patient datasets consisting of an FDG PET/computed tomography (CT) and a subsequently acquired PET/MR of the head and neck (HN) region were available. Registration strategies were developed based on CT and MR data only, whereas the PET components were fused with the resulting deformation field. Following a rigid registration, deformable registration was performed with a transform parametrized by B-splines. Three different optimization metrics were investigated: global mutual information (GMI), GMI combined with a bending energy penalty (BEP) for regularization (GMI + BEP) and localized mutual information with BEP (LMI + BEP). Different quantitative registration quality measures were developed, including volumetric overlap and mean distance measures for structures segmented on CT and MR as well as anatomical landmark distances. Moreover, the local registration quality in the tumor region was assessed by the normalized cross correlation (NCC) of the two PET datasets. Results: LMI + BEP yielded the most robust and accurate registration results. For GMI, GMI + BEP and LMI + BEP, mean landmark distances (standard deviations) were 23.9 mm (15.5 mm), 4.8 mm (4.0 mm) and 3.0 mm (1.0 mm), and mean NCC values (standard deviations) were 0.29 (0.29), 0.84 (0.14) and 0.88 (0.06), respectively. Conclusion: Accurate and robust multimodal deformable image registration of CT and MR in the HN region can be performed using a B-spline parametrized transform and LMI + BEP as optimization metric. With this strategy, biologically individualized RT based on combined PET/MRI in terms of dose painting is possible

Using Green's Functions to initialize and adjust a global, eddying ocean biogeochemistry general circulation model

Science.gov (United States)

Brix, H.; Menemenlis, D.; Hill, C.; Dutkiewicz, S.; Jahn, O.; Wang, D.; Bowman, K.; Zhang, H.

2015-11-01

The NASA Carbon Monitoring System (CMS) Flux Project aims to attribute changes in the atmospheric accumulation of carbon dioxide to spatially resolved fluxes by utilizing the full suite of NASA data, models, and assimilation capabilities. For the oceanic part of this project, we introduce ECCO2-Darwin, a new ocean biogeochemistry general circulation model based on combining the following pre-existing components: (i) a full-depth, eddying, global-ocean configuration of the Massachusetts Institute of Technology general circulation model (MITgcm), (ii) an adjoint-method-based estimate of ocean circulation from the Estimating the Circulation and Climate of the Ocean, Phase II (ECCO2) project, (iii) the MIT ecosystem model "Darwin", and (iv) a marine carbon chemistry model. Air-sea gas exchange coefficients and initial conditions of dissolved inorganic carbon, alkalinity, and oxygen are adjusted using a Green's Functions approach in order to optimize modeled air-sea CO2 fluxes. Data constraints include observations of carbon dioxide partial pressure (pCO2) for 2009-2010, global air-sea CO2 flux estimates, and the seasonal cycle of the Takahashi et al. (2009) Atlas. The model sensitivity experiments (or Green's Functions) include simulations that start from different initial conditions as well as experiments that perturb air-sea gas exchange parameters and the ratio of particulate inorganic to organic carbon. The Green's Functions approach yields a linear combination of these sensitivity experiments that minimizes model-data differences. The resulting initial conditions and gas exchange coefficients are then used to integrate the ECCO2-Darwin model forward. Despite the small number (six) of control parameters, the adjusted simulation is significantly closer to the data constraints (37% cost function reduction, i.e., reduction in the model-data difference, relative to the baseline simulation) and to independent observations (e.g., alkalinity). The adjusted air-sea gas

Modeling regional initiation of rainfall-induced shallow landslides in the eastern Umbria Region of central Italy

Science.gov (United States)

Salciarini, D.; Godt, J.W.; Savage, W.Z.; Conversini, P.; Baum, R.L.; Michael, J.A.

2006-01-01

We model the rainfall-induced initiation of shallow landslides over a broad region using a deterministic approach, the Transient Rainfall Infiltration and Grid-based Slope-stability (TRIGRS) model that couples an infinite-slope stability analysis with a one-dimensional analytical solution for transient pore pressure response to rainfall infiltration. This model permits the evaluation of regional shallow landslide susceptibility in a Geographic Information System framework, and we use it to analyze susceptibility to shallow landslides in an area in the eastern Umbria Region of central Italy. As shown on a landslide inventory map produced by the Italian National Research Council, the area has been affected in the past by shallow landslides, many of which have transformed into debris flows. Input data for the TRIGRS model include time-varying rainfall, topographic slope, colluvial thickness, initial water table depth, and material strength and hydraulic properties. Because of a paucity of input data, we focus on parametric analyses to calibrate and test the model and show the effect of variation in material properties and initial water table conditions on the distribution of simulated instability in the study area in response to realistic rainfall. Comparing the results with the shallow landslide inventory map, we find more than 80% agreement between predicted shallow landslide susceptibility and the inventory, despite the paucity of input data.

Influence of torsion and tensile stress on magnetoimpedance effect in Fe-rich amorphous microwires at high frequencies

Energy Technology Data Exchange (ETDEWEB)

Garcia, C. [Dpto. Fisica de Materiales, Fac. Quimicas, UPV/EHU, 20018 San Sebastian (Spain)]. E-mail: wubgagac@sc.ehu.es; Chizhik, A. [Dpto. Fisica de Materiales, Fac. Quimicas, UPV/EHU, 20018 San Sebastian (Spain); Zhukov, A. [Dpto. Fisica de Materiales, Fac. Quimicas, UPV/EHU, 20018 San Sebastian (Spain); Zhukova, V. [TAMAG Iberica S. L. Parque Tecnologico de Miramon, Paseo Mikeletegi 56, 1a Planta, 20009 San Sebastian (Spain); Gonzalez, J. [Dpto. Fisica de Materiales, Fac. Quimicas, UPV/EHU, 20018 San Sebastian (Spain); Blanco, J.M. [Dpto. Fisica Aplicada I. EUPDS, UPV/EHU, Plaza Europa 1, 20018 San Sebastian (Spain); Panina, L.V. [University of Plymouth, Drakes Circus, Plymouth (United Kingdom)

2007-09-15

In this work, we study the magnetoimpedance response under tensile and torsional stress of Fe{sub 76}B{sub 13}Si{sub 11} glass-coated amorphous microwires (with the metallic nucleus diameter of 17 {mu}m) prepared by Taylor-Ulitovski method. The impedance was evaluated using a Network Analyser in the frequency range of 10-500 MHz. In order to induce a helical magnetic anisotropy that modifies the magnetic domain structure and the magnetic response of the sample, the torsion stresses have been applied. The effect of such torsion on giant magnetoimpedance (GMI) has been studied in a Fe-rich amorphous microwire as a function of the driving current frequency. Unusual behaviour of the GMI with torsion has been observed up to 500 MHz: at this frequency, the change from double-peak to single-peak behaviour has been observed. It could be ascribed to changes on domain structures and surface anisotropy induced by applied torsion. For this frequency range, an abrupt decrease of the impedance with torsion has been observed. We have also studied the tensile-induced changes of GMI effect in a Fe-rich amorphous microwire. The GMI effect increases with applied tensile stress and with the frequency of AC current. Observed dependences could be attributed to the change of the overall magnetic anisotropy under applied torsion.

Thermodynamic and structural models compared with the initial dissolution rates of SON glass samples

International Nuclear Information System (INIS)

Tovena, I.; Advocat, T.; Ghaleb, D.; Vernaz, E.

1993-01-01

The experimentally determined initial dissolution rate R 0 of nuclear glass was correlated with thermodynamic parameters and structural parameters. The initial corrosion rates of six ''R7T7'' glass samples measured at 100 deg C in a Soxhlet device were correlated with the glass free hydration energy and the glass formation enthalpy. These correlations were then tested with a group of 26 SON glasses selected for their wide diversity of compositions. The thermodynamic models provided a satisfactory approximation of the initial dissolution rate determined under Soxhlet conditions for SON glass samples that include up to 15 wt% of boron and some alumina. Conversely, these models are inaccurate if the boron concentration exceeds 15 wt% and the glass contains no alumina. Possible correlations between R 0 and structural parameters, such as the boron coordination number and the number of nonbridging oxygen atoms, were also investigated. The authors show that R 0 varies inversely with the number of 4-coordinate boron atoms; conversely, the results do not substantiate published reports of a correlation between R 0 and the number of nonbridging oxygen atoms. (authors). 13 refs., 2 figs., 4 tabs

Optimization approach of background value and initial item for improving prediction precision of GM(1,1) model

Institute of Scientific and Technical Information of China (English)

Yuhong Wang; Qin Liu; Jianrong Tang; Wenbin Cao; Xiaozhong Li

2014-01-01

A combination method of optimization of the back-ground value and optimization of the initial item is proposed. The sequences of the unbiased exponential distribution are simulated and predicted through the optimization of the background value in grey differential equations. The principle of the new information priority in the grey system theory and the rationality of the initial item in the original GM(1,1) model are ful y expressed through the improvement of the initial item in the proposed time response function. A numerical example is employed to il ustrate that the proposed method is able to simulate and predict sequences of raw data with the unbiased exponential distribution and has better simulation performance and prediction precision than the original GM(1,1) model relatively.

High-Resolution Mesoscale Simulations of the 6-7 May 2000 Missouri Flash Flood: Impact of Model Initialization and Land Surface Treatment

Science.gov (United States)

Baker, R. David; Wang, Yansen; Tao, Wei-Kuo; Wetzel, Peter; Belcher, Larry R.

2004-01-01

High-resolution mesoscale model simulations of the 6-7 May 2000 Missouri flash flood event were performed to test the impact of model initialization and land surface treatment on timing, intensity, and location of extreme precipitation. In this flash flood event, a mesoscale convective system (MCS) produced over 340 mm of rain in roughly 9 hours in some locations. Two different types of model initialization were employed: 1) NCEP global reanalysis with 2.5-degree grid spacing and 12-hour temporal resolution, and 2) Eta reanalysis with 40- km grid spacing and $hour temporal resolution. In addition, two different land surface treatments were considered. A simple land scheme. (SLAB) keeps soil moisture fixed at initial values throughout the simulation, while a more sophisticated land model (PLACE) allows for r interactive feedback. Simulations with high-resolution Eta model initialization show considerable improvement in the intensity of precipitation due to the presence in the initialization of a residual mesoscale convective vortex (hlCV) from a previous MCS. Simulations with the PLACE land model show improved location of heavy precipitation. Since soil moisture can vary over time in the PLACE model, surface energy fluxes exhibit strong spatial gradients. These surface energy flux gradients help produce a strong low-level jet (LLJ) in the correct location. The LLJ then interacts with the cold outflow boundary of the MCS to produce new convective cells. The simulation with both high-resolution model initialization and time-varying soil moisture test reproduces the intensity and location of observed rainfall.

Models of Disease Vector Control: When Can Aggressive Initial Intervention Lower Long-Term Cost?

Science.gov (United States)

Oduro, Bismark; Grijalva, Mario J; Just, Winfried

2018-04-01

Insecticide spraying of housing units is an important control measure for vector-borne infections such as Chagas disease. As vectors may invade both from other infested houses and sylvatic areas and as the effectiveness of insecticide wears off over time, the dynamics of (re)infestations can be approximated by [Formula: see text]-type models with a reservoir, where housing units are treated as hosts, and insecticide spraying corresponds to removal of hosts. Here, we investigate three ODE-based models of this type. We describe a dual-rate effect where an initially very high spraying rate can push the system into a region of the state space with low endemic levels of infestation that can be maintained in the long run at relatively moderate cost, while in the absence of an aggressive initial intervention the same average cost would only allow a much less significant reduction in long-term infestation levels. We determine some sufficient and some necessary conditions under which this effect occurs and show that it is robust in models that incorporate some heterogeneity in the relevant properties of housing units.

Topology in two dimensions. IV - CDM models with non-Gaussian initial conditions

Science.gov (United States)

Coles, Peter; Moscardini, Lauro; Plionis, Manolis; Lucchin, Francesco; Matarrese, Sabino; Messina, Antonio

1993-02-01

The results of N-body simulations with both Gaussian and non-Gaussian initial conditions are used here to generate projected galaxy catalogs with the same selection criteria as the Shane-Wirtanen counts of galaxies. The Euler-Poincare characteristic is used to compare the statistical nature of the projected galaxy clustering in these simulated data sets with that of the observed galaxy catalog. All the models produce a topology dominated by a meatball shift when normalized to the known small-scale clustering properties of galaxies. Models characterized by a positive skewness of the distribution of primordial density perturbations are inconsistent with the Lick data, suggesting problems in reconciling models based on cosmic textures with observations. Gaussian CDM models fit the distribution of cell counts only if they have a rather high normalization but possess too low a coherence length compared with the Lick counts. This suggests that a CDM model with extra large scale power would probably fit the available data.

Inflation with generalized initial conditions

International Nuclear Information System (INIS)

Albrecht, A.; Brandenberger, R.; Matzner, R.

1987-01-01

In many current models of the early Universe a scalar field phi which is only very weakly coupled to other quantum fields is used to generate inflation. In such models there are no forces which could thermalize the scalar field, and previous assumptions about its preinflation ''initial'' conditions must be abandoned. In this paper the onset of inflation is studied classically for more general initial conditions of the scalar field configuration. In particular, initial conditions with a nonvanishing spatial average of phi, with phi chosen at random in each initial horizon volume, and with random initial momenta are considered. We identify and discuss several mechanisms that can drive these more general initial conditions toward an inflationary state. The analysis is done in one spatial dimension

Modeling, simulation, and optimal initiation planning for needle insertion into the liver.

Science.gov (United States)

Sharifi Sedeh, R; Ahmadian, M T; Janabi-Sharifi, F

2010-04-01

Needle insertion simulation and planning systems (SPSs) will play an important role in diminishing inappropriate insertions into soft tissues and resultant complications. Difficulties in SPS development are due in large part to the computational requirements of the extensive calculations in finite element (FE) models of tissue. For clinical feasibility, the computational speed of SPSs must be improved. At the same time, a realistic model of tissue properties that reflects large and velocity-dependent deformations must be employed. The purpose of this study is to address the aforementioned difficulties by presenting a cost-effective SPS platform for needle insertions into the liver. The study was constrained to planar (2D) cases, but can be extended to 3D insertions. To accommodate large and velocity-dependent deformations, a hyperviscoelastic model was devised to produce an FE model of liver tissue. Material constants were identified by a genetic algorithm applied to the experimental results of unconfined compressions of bovine liver. The approach for SPS involves B-spline interpolations of sample data generated from the FE model of liver. Two interpolation-based models are introduced to approximate puncture times and to approximate the coordinates of FE model nodes interacting with the needle tip as a function of the needle initiation pose; the latter was also a function of postpuncture time. A real-time simulation framework is provided, and its computational benefit is highlighted by comparing its performance with the FE method. A planning algorithm for optimal needle initiation was designed, and its effectiveness was evaluated by analyzing its accuracy in reaching a random set of targets at different resolutions of sampled data using the FE model. The proposed simulation framework can easily surpass haptic rates (>500 Hz), even with a high pose resolution level ( approximately 30). The computational time required to update the coordinates of the node at the

Comment on ‘Initial states of qubit–environment models leading to conserved quantities’

International Nuclear Information System (INIS)

Lo, C F

2014-01-01

Recently, Gardas and Dajka (2013 J. Phys. A: Math. Theor. 46 235301) proposed a theoretical scheme on how to prepare a proper initial state of a composite qubit–boson system which could assure no energy exchange between the two subsystems. For illustration, they applied the proposed scheme to both the Jaynes–Cummings model and the multi-photon Rabi model. However, it has already been rigorously proven that the k-photon Rabi model for k > 2 does not have eigenstates in the Hilbert space spanned by the eigenstates of the corresponding k-photon Jaynes–Cummings model and that the two-photon Rabi model has a discrete eigenenergy spectrum with normalizable eigenstates only if the coupling strength is smaller than a critical value. Hence, the proposed theoretical scheme is not applicable to the multi-photon Rabi model. (comment)

Numerical modelling of crack initiation and propagation in concrete structure under hydro-mechanical loading

International Nuclear Information System (INIS)

Bian, H.B.; Jia, Y.; Shao, J.F.

2012-01-01

Document available in extended abstract form only. This subject is devoted to numerical analysis of crack initiation and propagation in concrete structures due to hydro-mechanical coupling processes. When the structures subjected to the variation in hydraulic conditions, fractures occur as a consequence of coalescence of diffuse damage. Consequently, the mechanical behaviour of concrete is described by an isotropic damage model. Once the damage reaches a critical value, a macroscopic crack is initiated. In the framework of extended Finite Element Method (XFEM), the propagation of localized crack is studied in this paper. Each crack is then considered as a discontinuity surface of displacement. According to the determination of crack propagation orientations, a tensile stress-based criterion is used. Furthermore, spatial variations of mechanical properties of concrete are also taken into account using the Weibull distribution function. Finally, the proposed model is applied to numerical analysis of a concrete liner in the context of feasibility studies for geological storage of radioactive wastes. The numerical results show that the proposed approach is capable to reproduce correctly the initiation and propagation crack process until the complete failure of concrete structures during hydro-mechanical loading. The concrete is most widely used construction material in many engineering applications. It is generally submitted to various environmental loading: such as the mechanical loading, the variation of relative humidity and the exposure to chemical risk, etc. In order to evaluate the safety and durability of concrete structures, it is necessary to get a good knowledge on the influence of loading path on the concrete behaviour. The objective of this paper is to study numerically the crack propagation in concrete structure under hydro-mechanical loading,.i.e. the mechanical behaviour of concrete subjected to drying process. The drying process leads to desiccation

Toward a theory of the initiation of cancer by alpha, beta, and x radiation: the twin doublet model

International Nuclear Information System (INIS)

Marshall, J.H.; Pagnamenta, A.

1979-01-01

Information concerning the basic mechanics of interaction of radiation with matter at both the cellular and the molecular levels may now be sufficient to allow an extension of the cellular model of cancer induction to the level of individual particle tracks, ionizations, and particular bonds in the DNA molecule. The Doublet model appears promising as a candidate for the initial damage to DNA involved in cell killing, mutation, and a single cancer initiation

A Process Model of Partnership Evolution Around New IT Initiatives

Science.gov (United States)

Kestilä, Timo; Salmivalli, Lauri; Salmela, Hannu; Vahtera, Annukka

Prior research on inter-organizational information systems has focused primarily on dyadic network relationships, where agreements about information exchange are made between two organizations. The focus of this research is on the processes through which IT decisions are made within larger inter-organizational networks with several network parties. The research draws from network theories in organization science to identify three alternative mechanisms for making network level commitments: contracts, rules and values. In addition, theoretical concepts are searched from dynamic network models, which identify different cycles and stages in network evolution. The empirical research was conducted in two networks. The first one comprises of four municipalities which began collaboration in the deployment of IT in early childhood education (ECE). The second network involves a case where several organizations, both private and public, initiated a joint effort to implement a national level electronic prescription system (EPS). The frameworks and concepts drawn from organizational theories are used to explain success of the first case and the failure of the latter case. The paper contributes to prior IOS research by providing a new theory-based framework for the analysis of early stages of building organizational networks around innovative IT initiatives.

Highly Adoptable Improvement: A Practical Model and Toolkit to Address Adoptability and Sustainability of Quality Improvement Initiatives.

Science.gov (United States)

Hayes, Christopher William; Goldmann, Don

2018-03-01

Failure to consider the impact of change on health care providers is a barrier to success. Initiatives that increase workload and have low perceived value are less likely to be adopted. A practical model and supporting tools were developed on the basis of existing theories to help quality improvement (QI) programs design more adoptable approaches. Models and theories from the diffusion of innovation and work stress literature were reviewed, and key-informant interviews and site visits were conducted to develop a draft Highly Adoptable Improvement (HAI) Model. A list of candidate factors considered for inclusion in the draft model was presented to an expert panel. A modified Delphi process was used to narrow the list of factors into main themes and refine the model. The resulting model and supporting tools were pilot tested by 16 improvement advisors for face validity and usability. The HAI Model depicts how workload and perceived value influence adoptability of QI initiatives. The supporting tools include an assessment guide and suggested actions that QI programs can use to help design interventions that are likely to be adopted. Improvement advisors reported good face validity and usability and found that the model and the supporting tools helped address key issues related to adoption and reported that they would continue to use them. The HAI Model addresses important issues regarding workload and perceived value of improvement initiatives. Pilot testing suggests that the model and supporting tools are helpful and practical in guiding design and implementation of adoptable and sustainable QI interventions. Copyright © 2017 The Joint Commission. Published by Elsevier Inc. All rights reserved.

Thrust initiation and its control on tectonic wedge geometry: An insight from physical and numerical models

Science.gov (United States)

Bose, Santanu; Mandal, Nibir; Saha, Puspendu; Sarkar, Shamik; Lithgow-Bertelloni, Carolina

2014-10-01

We performed a series of sandbox experiments to investigate the initiation of thrust ramping in tectonic wedges on a mechanically continuous basal decollement. The experiments show that the decollement slope (β) is the key factor in controlling the location of thrust initiation with respect to the backstop (i.e. tectonic suture line). For β = 0, the ramping begins right at the backstop, followed by sequential thrusting in the frontal direction, leading to a typical mono-vergent wedge. In contrast, the ramp initiates away from the backstop as β > 0. Under this boundary condition an event of sequential back thrusting takes place prior to the onset of frontal thrust progression. These two-coupled processes eventually give rise to a bi-vergent geometry of the thrust wedge. Using the Drucker-Prager failure criterion in finite element (FE) models, we show the location of stress intensification to render a mechanical basis for the thrust initiation away from the backstop if β > 0. Our physical and FE model results explain why the Main Central Thrust (MCT) is located far away from the Indo-Tibetan plate contact (ITSZ) in the Himalayan fold-and-thrust belts.

Runoff-generated debris flows: observations and modeling of surge initiation, magnitude, and frequency

Science.gov (United States)

Kean, Jason W.; McCoy, Scott W.; Tucker, Gregory E.; Staley, Dennis M.; Coe, Jeffrey A.

2013-01-01

Runoff during intense rainstorms plays a major role in generating debris flows in many alpine areas and burned steeplands. Yet compared to debris flow initiation from shallow landslides, the mechanics by which runoff generates a debris flow are less understood. To better understand debris flow initiation by surface water runoff, we monitored flow stage and rainfall associated with debris flows in the headwaters of two small catchments: a bedrock-dominated alpine basin in central Colorado (0.06 km2) and a recently burned area in southern California (0.01 km2). We also obtained video footage of debris flow initiation and flow dynamics from three cameras at the Colorado site. Stage observations at both sites display distinct patterns in debris flow surge characteristics relative to rainfall intensity (I). We observe small, quasiperiodic surges at low I; large, quasiperiodic surges at intermediate I; and a single large surge followed by small-amplitude fluctuations about a more steady high flow at high I. Video observations of surge formation lead us to the hypothesis that these flow patterns are controlled by upstream variations in channel slope, in which low-gradient sections act as “sediment capacitors,” temporarily storing incoming bed load transported by water flow and periodically releasing the accumulated sediment as a debris flow surge. To explore this hypothesis, we develop a simple one-dimensional morphodynamic model of a sediment capacitor that consists of a system of coupled equations for water flow, bed load transport, slope stability, and mass flow. This model reproduces the essential patterns in surge magnitude and frequency with rainfall intensity observed at the two field sites and provides a new framework for predicting the runoff threshold for debris flow initiation in a burned or alpine setting.

Initial computer modeling of WIPP [Waste Isolation Pilot Plant] underground ventilation system, September 1985--March 1986

International Nuclear Information System (INIS)

Sethi, S.

1986-11-01

Provision of a good ventilation system has been and continues to be a major priority here of those responsible for its design, management, and operation. As an ongoing effort in this direction, development of computer simulated models for the system was initiated in September, 1985. It was decided to utilize Dravo's 'MINEVENT' computer program for this purpose. Accordingly, initial computer models of the mine's ventilation system have been developed for various modes of operation. Specifically, they include: Simulation of the current ventilation system, and Simulation of the designed ventilation system for modes: mine construction mode/shift, waste storage mode/shift, and air reversal mode. 5 figs

Probabilistic sensitivity analysis for the 'initial defect in the canister' reference model

International Nuclear Information System (INIS)

Cormenzana, J. L.

2013-08-01

In Posiva Oy's Safety Case 'TURVA-2012' the repository system scenarios leading to radionuclide releases have been identified in Formulation of Radionuclide Release Scenarios. Three potential causes of canister failure and radionuclide release are considered: (i) the presence of an initial defect in the copper shell of one canister that penetrates the shell completely, (ii) corrosion of the copper overpack, that occurs more rapidly if buffer density is reduced, e.g. by erosion, (iii) shear movement on fractures intersecting the deposition hole. All three failure modes are analysed deterministically in Assessment of Radionuclide Release Scenarios, and for the 'initial defect in the canister' reference model a probabilistic sensitivity analysis (PSA) has been carried out. The main steps of the PSA have been: quantification of the uncertainties in the model input parameters through the creation of probability density distributions (PDFs), Monte Carlo simulations of the evolution of the system up to 106 years using parameters values sampled from the previous PDFs. Monte Carlo simulations with 10,000 individual calculations (realisations) have been used in the PSA, quantification of the uncertainty in the model outputs due to uncertainty in the input parameters (uncertainty analysis), and identification of the parameters whose uncertainty have the greatest effect on the uncertainty in the model outputs (sensitivity analysis) Since the biosphere is not included in the Monte Carlo simulations of the system, the model outputs studied are not doses, but total and radionuclide-specific normalised release rates from the near-field and to the biosphere. These outputs are calculated dividing the activity release rates by the constraints on the activity fluxes to the environment set out by the Finnish regulator. Two different cases are analysed in the PSA: (i) the 'hole forever' case, in which the small hole through the copper overpack remains unchanged during the assessment

An effort to improve track and intensity prediction of tropical cyclones through vortex initialization in NCUM-global model

Science.gov (United States)

Singh, Vivek; Routray, A.; Mallick, Swapan; George, John P.; Rajagopal, E. N.

2016-05-01

Tropical cyclones (TCs) have strong impact on socio-economic conditions of the countries like India, Bangladesh and Myanmar owing to its awful devastating power. This brings in the need of precise forecasting system to predict the tracks and intensities of TCs accurately well in advance. However, it has been a great challenge for major operational meteorological centers over the years. Genesis of TCs over data sparse warm Tropical Ocean adds more difficulty to this. Weak and misplaced vortices at initial time are one of the prime sources of track and intensity errors in the Numerical Weather Prediction (NWP) models. Many previous studies have reported the forecast skill of track and intensity of TC improved due to the assimilation of satellite data along with vortex initialization (VI). Keeping this in mind, an attempt has been made to investigate the impact of vortex initialization for simulation of TC using UK-Met office global model, operational at NCMRWF (NCUM). This assessment is carried out by taking the case of a extremely severe cyclonic storm "Chapala" that occurred over Arabian Sea (AS) from 28th October to 3rd November 2015. Two numerical experiments viz. Vort-GTS (Assimilation of GTS observations with VI) and Vort-RAD (Same as Vort-GTS with assimilation of satellite data) are carried out. This vortex initialization study in NCUM model is first of its type over North Indian Ocean (NIO). The model simulation of TC is carried out with five different initial conditions through 24 hour cycles for both the experiments. The results indicate that the vortex initialization with assimilation of satellite data has a positive impact on the track and intensity forecast, landfall time and position error of the TCs.

U.S. Light-duty Vehicle Air Conditioning Fuel Use and the Impact of Four Solar/Thermal Control Technologies

Energy Technology Data Exchange (ETDEWEB)

Rugh, John P [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kekelia, Bidzina [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kreutzer, Cory J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Titov, Eugene V [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

2017-11-28

The U.S. uses 7.6 billion gallons of fuel per year for vehicle air conditioning (A/C), equivalent to 5.7 percent of the total national light-duty vehicle (LDV) fuel use. This equates to 30 gallons/year per vehicle, or 23.5 grams (g) of carbon dioxide (CO2) per mile, for an average U.S. vehicle. A/C is a significant contribution to national fuel use; therefore, technologies that reduce A/C loads may reduce operational costs, A/C fuel use, and CO2 emissions. Since A/C is not operated during standard EPA fuel economy testing protocols, EPA provides off-cycle credits to encourage OEMs to implement advanced A/C technologies that reduce fuel use in the real world. NREL researchers assessed thermal/solar off-cycle credits available in the U.S. Environmental Protection Agency's (EPA's) Final Rule for Model Year 2017 and Later Light-Duty Vehicle Greenhouse Gas Emissions and Corporate Average Fuel Economy. Credits include glazings, solar reflective paint, and passive and active cabin ventilation. Implementing solar control glass reduced CO2 emissions by 2.0 g/mi, and solar reflective paint resulted in a reduction of 0.8 g/mi. Active and passive ventilation strategies only reduced emissions by 0.1 and 0.2 g/mi, respectively. The national-level analysis process is powerful and general; it can be used to determine the impact of a wide range of new vehicle thermal technologies on fuel use, EV range, and CO2 emissions.

Short pulse duration shock initiation experiments plus ignition and growth modeling on Composition B

International Nuclear Information System (INIS)

May, Chadd M; Tarver, Craig M

2014-01-01

Composition B (63% RDX, 36% TNT, 1% wax) is still a widely used energetic material whose shock initiation characteristics are necessary to understand. It is now possible to shock initiate Composition B and other secondary explosives at diameters well below their characteristic failure diameters for unconfined self-sustaining detonation. This is done using very high velocity, very thin, small diameter flyer plates accelerated by electric or laser power sources. Recently experimental detonation versus failure to detonate threshold flyer velocity curves for Composition B using several Kapton TM flyer thicknesses and diameters were measured. Flyer plates with diameters of 2 mm successfully detonated Composition B, which has a nominal failure diameter of 4.3 mm. The shock pressures required for these initiations are greater than the Chapman-Jouguet (C-J) pressure in self-sustaining Composition B detonation waves. The initiation process is two-dimensional, because both rear and side rarefactions can affect the shocked Composition B reaction rates. The Ignition and Growth reactive flow model for Composition B is extended to yield accurate simulations of this new threshold velocity data for various flyer thicknesses.

Next generation initiation techniques

Science.gov (United States)

Warner, Tom; Derber, John; Zupanski, Milija; Cohn, Steve; Verlinde, Hans

1993-01-01

Four-dimensional data assimilation strategies can generally be classified as either current or next generation, depending upon whether they are used operationally or not. Current-generation data-assimilation techniques are those that are presently used routinely in operational-forecasting or research applications. They can be classified into the following categories: intermittent assimilation, Newtonian relaxation, and physical initialization. It should be noted that these techniques are the subject of continued research, and their improvement will parallel the development of next generation techniques described by the other speakers. Next generation assimilation techniques are those that are under development but are not yet used operationally. Most of these procedures are derived from control theory or variational methods and primarily represent continuous assimilation approaches, in which the data and model dynamics are 'fitted' to each other in an optimal way. Another 'next generation' category is the initialization of convective-scale models. Intermittent assimilation systems use an objective analysis to combine all observations within a time window that is centered on the analysis time. Continuous first-generation assimilation systems are usually based on the Newtonian-relaxation or 'nudging' techniques. Physical initialization procedures generally involve the use of standard or nonstandard data to force some physical process in the model during an assimilation period. Under the topic of next-generation assimilation techniques, variational approaches are currently being actively developed. Variational approaches seek to minimize a cost or penalty function which measures a model's fit to observations, background fields and other imposed constraints. Alternatively, the Kalman filter technique, which is also under investigation as a data assimilation procedure for numerical weather prediction, can yield acceptable initial conditions for mesoscale models. The

Modeling of asphalt by means of discrete element method – an initial study

DEFF Research Database (Denmark)

Feng, Huan; Hededal, Ole; Stang, Henrik

of conducting time-consuming and lab-costly procedures. The use of numerical models, capable of reducing greatly the testing cost, has shown great potential in characterizing asphalt-aggregate mixtures for both material evaluation and structural design purposes, [1],[2]. Discrete element method (DEM) is one...... – will be applied. The work presented here will focus on the discrete element method as a tool for modelling composite materials, i.e. determination of a representative volume; boundary conditions; characterisation of the components mastic (binder + filler) and aggregates; and establishment of virtual test samples....... Results from initial tests will be presented and the future development of the model towards characterising asphalt from its composition will be outlined....

Modelling Reactivity-Initiated-Accident Experiments With Falcon And SCANAIR: A Comparison Exercise

International Nuclear Information System (INIS)

Romano, A.; Wallin, H.; Zimmermann, M.A.

2005-01-01

A critical assessment is made of the state-of-the-art fuel performance code FALCON in the context of selected Reactivity Initiated Accident (RIA) experiments from the CABRI REP Na series, and contrasts its predictions against those of the extensively benchmarked SCANAIR (Version 3.2) code. The thermal fields in the fuel and cladding, the clad mechanical deformation, and the Fission Gas Release (FGR) are adopted as 'Figures of Merit' by which to judge code performance. Particular attention is paid to the importance of fission-gas-induced clad deformation (which is modelled in SCANAIR, but not in FALCON), relative to that driven by the fuel thermal expansion (which is modelled by both codes). The thermal fields calculated by the codes are in good agreement with each other, especially during the initial stages of the transients --- the adiabatic phase. Larger discrepancies are observed at later times, and are due to the different models applied to calculate the gap conductance. FALCON predicts clad permanent deformations at the end of the transients with a maximum deviation from the experimental measurements of about 20%. Generally, the code always tends to underpredict the measurements. SCANAIR performs similarly, but grossly overpredicts the permanent clad strain for the case involving a very energetic pulse. The fission-gas-driven clad deformation is only relevant for very fast pulse energy injection cases, which are not prototypical of the RIA transients expected in PWRs. The FGR models in FALCON do not capture the mechanism of 'burst-release' in the RIA transients, having been developed for steady-state irradiation conditions. This also explains why they performed poorly when applied to the fast-transient cases analyzed here. In contrast, the FGR results from SCANAIR are in satisfactory agreement with the experimental results. (author)

Using a hybrid model to predict solute transfer from initially saturated soil into surface runoff with controlled drainage water.

Science.gov (United States)

Tong, Juxiu; Hu, Bill X; Yang, Jinzhong; Zhu, Yan

2016-06-01

The mixing layer theory is not suitable for predicting solute transfer from initially saturated soil to surface runoff water under controlled drainage conditions. By coupling the mixing layer theory model with the numerical model Hydrus-1D, a hybrid solute transfer model has been proposed to predict soil solute transfer from an initially saturated soil into surface water, under controlled drainage water conditions. The model can also consider the increasing ponding water conditions on soil surface before surface runoff. The data of solute concentration in surface runoff and drainage water from a sand experiment is used as the reference experiment. The parameters for the water flow and solute transfer model and mixing layer depth under controlled drainage water condition are identified. Based on these identified parameters, the model is applied to another initially saturated sand experiment with constant and time-increasing mixing layer depth after surface runoff, under the controlled drainage water condition with lower drainage height at the bottom. The simulation results agree well with the observed data. Study results suggest that the hybrid model can accurately simulate the solute transfer from initially saturated soil into surface runoff under controlled drainage water condition. And it has been found that the prediction with increasing mixing layer depth is better than that with the constant one in the experiment with lower drainage condition. Since lower drainage condition and deeper ponded water depth result in later runoff start time, more solute sources in the mixing layer are needed for the surface water, and larger change rate results in the increasing mixing layer depth.

Comparison of investigator-delineated gross tumour volumes and quality assurance in pancreatic cancer: Analysis of the on-trial cases for the SCALOP trial.

Science.gov (United States)

Fokas, Emmanouil; Spezi, Emiliano; Patel, Neel; Hurt, Chris; Nixon, Lisette; Chu, Kwun-Ye; Staffurth, John; Abrams, Ross; Mukherjee, Somnath

2016-08-01

We performed a retrospective central review of tumour outlines in patients undergoing radiotherapy in the SCALOP trial. The planning CT scans were reviewed retrospectively by a central review team, and the accuracy of investigators' GTV (iGTV) and PTV (iPTV) was compared to the trials team-defined gold standard (gsGTV and gsPTV) using the Jaccard Conformity Index (JCI) and Geographical Miss Index (GMI). The prognostic value of JCI and GMI was also assessed. The RT plans were also reviewed against protocol-defined constraints. 60 patients with diagnostic-quality planning scans were included. The median whole volume JCI for GTV was 0.64 (IQR: 0.43-0.82), and the median GMI was 0.11 (IQR: 0.05-0.22). For PTVs, the median JCI and GMI were 0.80 (IQR: 0.71-0.88) and 0.04 (IQR: 0.02-0.12) respectively. Tumour was completely missed in 1 patient, and⩾50% of the tumour was missed in 3. Patients with JCI for GTV⩾0.7 had 7.12 (95% CIs: 1.83-27.67, p=0.005) higher odds of progressing by 9months in multivariate analysis. Major deviations in RT planning were noted in 4.5% of cases. Radiotherapy workshops and real-time central review of contours are required in RT trials of pancreatic cancer. Copyright © 2016 The Authors. Published by Elsevier Ireland Ltd.. All rights reserved.

SEMI-EMPIRICAL WHITE DWARF INITIAL-FINAL MASS RELATIONSHIPS: A THOROUGH ANALYSIS OF SYSTEMATIC UNCERTAINTIES DUE TO STELLAR EVOLUTION MODELS

International Nuclear Information System (INIS)

Salaris, Maurizio; Serenelli, Aldo; Weiss, Achim; Miller Bertolami, Marcelo

2009-01-01

Using the most recent results about white dwarfs (WDs) in ten open clusters, we revisit semiempirical estimates of the initial-final mass relation (IFMR) in star clusters, with emphasis on the use of stellar evolution models. We discuss the influence of these models on each step of the derivation. One intention of our work is to use consistent sets of calculations both for the isochrones and the WD cooling tracks. The second one is to derive the range of systematic errors arising from stellar evolution theory. This is achieved by using different sources for the stellar models and by varying physical assumptions and input data. We find that systematic errors, including the determination of the cluster age, are dominating the initial mass values, while observational uncertainties influence the final mass primarily. After having determined the systematic errors, the initial-final mass relation allows us finally to draw conclusions about the physics of the stellar models, in particular about convective overshooting.

The Yekaterinburg headache initiative

DEFF Research Database (Denmark)

Lebedeva, Elena R; Olesen, Jes; Osipova, Vera V

2013-01-01

for a demonstrational interventional project in Russia, undertaken within the Global Campaign against Headache. The initiative proposes three actions: 1) raise awareness of need for improvement; 2) design and implement a three-tier model (from primary care to a single highly specialized centre with academic affiliation......) for efficient and equitable delivery of headache-related health care; 3) develop a range of educational initiatives aimed at primary-care physicians, non-specialist neurologists, pharmacists and the general public to support the second action. RESULTS AND CONCLUSION: We set these proposals in a context...... of a health-care needs assessment, and as a model for all Russia. We present and discuss early progress of the initiative, justify the investment of resources required for implementation and call for the political support that full implementation requires. The more that the Yekaterinburg headache initiative...

Engineering of giant magnetoimpedance effect of amorphous and nanocrystalline microwires

Directory of Open Access Journals (Sweden)

V. Zhukova

2016-12-01

Full Text Available We present our studies of the factors affecting soft magnetic properties and giant magnetoimpedance effect in thin amorphous and nanocrystalline microwires. We showed that the magnetoelastic anisotropy is one of the most important parameters that determine magnetic softness and GMI effect of glass-coated microwires  and annealing can be very effective for manipulation the magnetic properties of amorphous ferromagnetic glass-coated microwires. Considerable magnetic softening and increasing of the GMI effect is observed in Fe-rich nanocrystalline FINEMET-type glass-coated microwires after the nanocrystallization.

Transitioning Enhanced Land Surface Initialization and Model Verification Capabilities to the Kenya Meteorological Department (KMD)

Science.gov (United States)

Case, Jonathan L.; Mungai, John; Sakwa, Vincent; Zavodsky, Bradley T.; Srikishen, Jayanthi; Limaye, Ashutosh; Blankenship, Clay B.

2016-01-01

Flooding, severe weather, and drought are key forecasting challenges for the Kenya Meteorological Department (KMD), based in Nairobi, Kenya. Atmospheric processes leading to convection, excessive precipitation and/or prolonged drought can be strongly influenced by land cover, vegetation, and soil moisture content, especially during anomalous conditions and dry/wet seasonal transitions. It is thus important to represent accurately land surface state variables (green vegetation fraction, soil moisture, and soil temperature) in Numerical Weather Prediction (NWP) models. The NASA SERVIR and the Short-term Prediction Research and Transition (SPoRT) programs in Huntsville, AL have established a working partnership with KMD to enhance its regional modeling capabilities. SPoRT and SERVIR are providing experimental land surface initialization datasets and model verification capabilities for capacity building at KMD. To support its forecasting operations, KMD is running experimental configurations of the Weather Research and Forecasting (WRF; Skamarock et al. 2008) model on a 12-km/4-km nested regional domain over eastern Africa, incorporating the land surface datasets provided by NASA SPoRT and SERVIR. SPoRT, SERVIR, and KMD participated in two training sessions in March 2014 and June 2015 to foster the collaboration and use of unique land surface datasets and model verification capabilities. Enhanced regional modeling capabilities have the potential to improve guidance in support of daily operations and high-impact weather and climate outlooks over Eastern Africa. For enhanced land-surface initialization, the NASA Land Information System (LIS) is run over Eastern Africa at 3-km resolution, providing real-time land surface initialization data in place of interpolated global model soil moisture and temperature data available at coarser resolutions. Additionally, real-time green vegetation fraction (GVF) composites from the Suomi-NPP VIIRS instrument is being incorporated

Initialization of a fractional order identification algorithm applied for Lithium-ion battery modeling in time domain

Science.gov (United States)

Nasser Eddine, Achraf; Huard, Benoît; Gabano, Jean-Denis; Poinot, Thierry

2018-06-01

This paper deals with the initialization of a non linear identification algorithm used to accurately estimate the physical parameters of Lithium-ion battery. A Randles electric equivalent circuit is used to describe the internal impedance of the battery. The diffusion phenomenon related to this modeling is presented using a fractional order method. The battery model is thus reformulated into a transfer function which can be identified through Levenberg-Marquardt algorithm to ensure the algorithm's convergence to the physical parameters. An initialization method is proposed in this paper by taking into account previously acquired information about the static and dynamic system behavior. The method is validated using noisy voltage response, while precision of the final identification results is evaluated using Monte-Carlo method.

Where does subduction initiate and die? Insights from global convection models with continental drift

Science.gov (United States)

Ulvrova, Martina; Williams, Simon; Coltice, Nicolas; Tackley, Paul

2017-04-01

Plate tectonics is a prominent feature on Earth. Together with the underlying convecting mantle, plates form a self-organized system. In order to understand the dynamics of the coupled system, subduction of the lithospheric plates plays the key role since it links the exterior with the interior of the planet. In this work we study subduction initiation and death with respect to the position of the continental rafts. Using thermo-mechanical numerical calculations we investigate global convection models featuring self-consistent plate tectonics and continental drifting employing a pseudo-plastic rheology and testing the effect of a free surface. We consider uncompressible mantle convection in Boussinesq approximation that is basaly and internaly heated. Our calculations indicate that the presence of the continents alterns stress distribution within a certain distance from the margins. Intra-oceanic subudction initiation is favorable during super-continent cycles while the initiation at passive continental margin prevails when continents are dispersed. The location of subduction initiation is additionally controlled by the lithospheric strength. Very weak lithosphere results in domination of intra-oceanic subduction initiation. The subduction zones die more easily in the vicinity of the continent due to the strong rheological contrast between the oceanic and continental lithosphere. In order to compare our findings with subduction positions through time recorded on Earth, we analyse subduction birth in global plate reconstruction back to 410 My.

Turbulence modeling with fractional derivatives: Derivation from first principles and initial results

Science.gov (United States)

Epps, Brenden; Cushman-Roisin, Benoit

2017-11-01

Fluid turbulence is an outstanding unsolved problem in classical physics, despite 120+ years of sustained effort. Given this history, we assert that a new mathematical framework is needed to make a transformative breakthrough. This talk offers one such framework, based upon kinetic theory tied to the statistics of turbulent transport. Starting from the Boltzmann equation and ``Lévy α-stable distributions'', we derive a turbulence model that expresses the turbulent stresses in the form of a fractional derivative, where the fractional order is tied to the transport behavior of the flow. Initial results are presented herein, for the cases of Couette-Poiseuille flow and 2D boundary layers. Among other results, our model is able to reproduce the logarithmic Law of the Wall in shear turbulence.

ATMOSPHERIC CIRCULATION OF HOT JUPITERS: INSENSITIVITY TO INITIAL CONDITIONS

International Nuclear Information System (INIS)

Liu Beibei; Showman, Adam P.

2013-01-01

The ongoing characterization of hot Jupiters has motivated a variety of circulation models of their atmospheres. Such models must be integrated starting from an assumed initial state, which is typically taken to be a wind-free, rest state. Here, we investigate the sensitivity of hot-Jupiter atmospheric circulation to initial conditions with shallow-water models and full three-dimensional models. Those models are initialized with zonal jets, and we explore a variety of different initial jet profiles. We demonstrate that, in both classes of models, the final, equilibrated state is independent of initial condition—as long as frictional drag near the bottom of the domain and/or interaction with a specified planetary interior are included so that the atmosphere can adjust angular momentum over time relative to the interior. When such mechanisms are included, otherwise identical models initialized with vastly different initial conditions all converge to the same statistical steady state. In some cases, the models exhibit modest time variability; this variability results in random fluctuations about the statistical steady state, but we emphasize that, even in these cases, the statistical steady state itself does not depend on initial conditions. Although the outcome of hot-Jupiter circulation models depend on details of the radiative forcing and frictional drag, aspects of which remain uncertain, we conclude that the specification of initial conditions is not a source of uncertainty, at least over the parameter range explored in most current models.

Some Convex Functions Based Measures of Independence and Their Application to Strange Attractor Reconstruction

Directory of Open Access Journals (Sweden)

Kazuyuki Aihara

2011-04-01

Full Text Available The classical information-theoretic measures such as the entropy and the mutual information (MI are widely applicable to many areas in science and engineering. Csiszar generalized the entropy and the MI by using the convex functions. Recently, we proposed the grid occupancy (GO and the quasientropy (QE as measures of independence. The QE explicitly includes a convex function in its definition, while the expectation of GO is a subclass of QE. In this paper, we study the effect of different convex functions on GO, QE, and Csiszar’s generalized mutual information (GMI. A quality factor (QF is proposed to quantify the sharpness of their minima. Using the QF, it is shown that these measures can have sharper minima than the classical MI. Besides, a recursive algorithm for computing GMI, which is a generalization of Fraser and Swinney’s algorithm for computing MI, is proposed. Moreover, we apply GO, QE, and GMI to chaotic time series analysis. It is shown that these measures are good criteria for determining the optimum delay in strange attractor reconstruction.

Effects of ocean initial perturbation on developing phase of ENSO in a coupled seasonal prediction model

Science.gov (United States)

Lee, Hyun-Chul; Kumar, Arun; Wang, Wanqiu

2018-03-01

Coupled prediction systems for seasonal and inter-annual variability in the tropical Pacific are initialized from ocean analyses. In ocean initial states, small scale perturbations are inevitably smoothed or distorted by the observational limits and data assimilation procedures, which tends to induce potential ocean initial errors for the El Nino-Southern Oscillation (ENSO) prediction. Here, the evolution and effects of ocean initial errors from the small scale perturbation on the developing phase of ENSO are investigated by an ensemble of coupled model predictions. Results show that the ocean initial errors at the thermocline in the western tropical Pacific grow rapidly to project on the first mode of equatorial Kelvin wave and propagate to the east along the thermocline. In boreal spring when the surface buoyancy flux weakens in the eastern tropical Pacific, the subsurface errors influence sea surface temperature variability and would account for the seasonal dependence of prediction skill in the NINO3 region. It is concluded that the ENSO prediction in the eastern tropical Pacific after boreal spring can be improved by increasing the observational accuracy of subsurface ocean initial states in the western tropical Pacific.

Citizen participation and citizen initiatives

International Nuclear Information System (INIS)

Matthoefer, H.

1977-01-01

Contents: Social conditions for citizen initiatives - technical change and employment - crisis behaviour - socio-psychological analysis of political planning; legitimation - presentation and criticism - conditions for citizen initiatives coming into being within the field of tension citizen : administration - legal problems of citizen initiatives - environmental protection in the energy discussion; participation; models. (HP) [de

MAGI: many-component galaxy initializer

Science.gov (United States)

Miki, Yohei; Umemura, Masayuki

2018-04-01

Providing initial conditions is an essential procedure for numerical simulations of galaxies. The initial conditions for idealized individual galaxies in N-body simulations should resemble observed galaxies and be dynamically stable for time-scales much longer than their characteristic dynamical times. However, generating a galaxy model ab initio as a system in dynamical equilibrium is a difficult task, since a galaxy contains several components, including a bulge, disc, and halo. Moreover, it is desirable that the initial-condition generator be fast and easy to use. We have now developed an initial-condition generator for galactic N-body simulations that satisfies these requirements. The developed generator adopts a distribution-function-based method, and it supports various kinds of density models, including custom-tabulated inputs and the presence of more than one disc. We tested the dynamical stability of systems generated by our code, representing early- and late-type galaxies, with N = 2097 152 and 8388 608 particles, respectively, and we found that the model galaxies maintain their initial distributions for at least 1 Gyr. The execution times required to generate the two models were 8.5 and 221.7 seconds, respectively, which is negligible compared to typical execution times for N-body simulations. The code is provided as open-source software and is publicly and freely available at https://bitbucket.org/ymiki/magi.

Thermal chemical-mechanical reactive flow model of shock initiation in solid explosives

International Nuclear Information System (INIS)

Nicholls, A.L. III; Tarver, C.M.

1998-01-01

The three dimensional Arbitrary Lagrange Eulerian hydrodynamic computer code ALE3D with fully coupled thermal-chemical-mechanical material models provides the framework for the development of a physically realistic model of shock initiation and detonation of solid explosives. The processes of hot spot formation during shock compression, subsequent ignition of reaction or failure to react, growth of reaction in individual hot spots, and coalescence of reacting hot spots during the transition to detonation can now be modeled using Arrhenius chemical kinetic rate laws and heat transfer to propagate the reactive flow. This paper discusses the growth rates of reacting hot spots in HMX and TATB and their coalescence during shock to detonation transition. Hot spot deflagration rates are found to be fast enough to consume explosive particles less than 10 mm in diameter during typical shock duration times, but larger particles must fragment and create more reactive surface area in order to be rapidly consumed

Initial VHTR accident scenario classification: models and data.

Energy Technology Data Exchange (ETDEWEB)

Vilim, R. B.; Feldman, E. E.; Pointer, W. D.; Wei, T. Y. C.; Nuclear Engineering Division

2005-09-30

Nuclear systems codes are being prepared for use as computational tools for conducting performance/safety analyses of the Very High Temperature Reactor. The thermal-hydraulic codes are RELAP5/ATHENA for one-dimensional systems modeling and FLUENT and/or Star-CD for three-dimensional modeling. We describe a formal qualification framework, the development of Phenomena Identification and Ranking Tables (PIRTs), the initial filtering of the experiment databases, and a preliminary screening of these codes for use in the performance/safety analyses. In the second year of this project we focused on development of PIRTS. Two events that result in maximum fuel and vessel temperatures, the Pressurized Conduction Cooldown (PCC) event and the Depressurized Conduction Cooldown (DCC) event, were selected for PIRT generation. A third event that may result in significant thermal stresses, the Load Change event, is also selected for PIRT generation. Gas reactor design experience and engineering judgment were used to identify the important phenomena in the primary system for these events. Sensitivity calculations performed with the RELAP5 code were used as an aid to rank the phenomena in order of importance with respect to the approach of plant response to safety limits. The overall code qualification methodology was illustrated by focusing on the Reactor Cavity Cooling System (RCCS). The mixed convection mode of heat transfer and pressure drop is identified as an important phenomenon for Reactor Cavity Cooling System (RCCS) operation. Scaling studies showed that the mixed convection mode is likely to occur in the RCCS air duct during normal operation and during conduction cooldown events. The RELAP5/ATHENA code was found to not adequately treat the mixed convection regime. Readying the code will require adding models for the turbulent mixed convection regime while possibly performing new experiments for the laminar mixed convection regime. Candidate correlations for the turbulent

Determination of the Support Level of Local Organizations in a Model Forest Initiative: Do Local Stakeholders Have Willingness to Be Involved in the Model Forest Development?

Directory of Open Access Journals (Sweden)

Ahmet Tolunay

2014-10-01

Full Text Available Voluntary cooperation and the support of stakeholders carry a major importance in the development of Model Forests. The identification of the support level of local organizations as stakeholders in the Bucak Model Forest initiative, located in the Mediterranean region of Turkey, constitutes the theme of this study. Within this scope, the views of the stakeholders comprising local government units (LGUs, non-governmental organizations (NGOs, village councils (VCs, professional organizations (POs and forest products enterprises (FPEs located in the district of Bucak were collected by utilizing a survey technique. The data were analysed by using non-parametric statistical analyses due to the absence of a normal distribution. The results show that the information provided about the Model Forest concept to the stakeholders located in the district on the Bucak Model Forest initiative was identified as a factor impacting the support level. Moreover, it was also observed that the stakeholders were more willing to provide advisory support rather than financial support. NGOs and VCs were identified as stakeholders who could not provide financial support due to their restricted budgets. We discuss the benefits for a Model Forest initiative of establishing international cooperation to strengthen the local and regional sustainable development process.

Fundamental study of crack initiation and propagation

International Nuclear Information System (INIS)

Norris, D.M. Jr.; Reaugh, J.E.; Moran, B.; Quinones, D.F.; Wilkins, M.L.

1977-01-01

Objective is to determine the fracture toughness of A533B-1 steel by computer modeling Charpy V-notch tests. A computer model of ductile fracture was developed that predicts fracture initiation. The model contains a set of material-dependent parameters obtained by computer simulations of small specimen tests. The computer calculations give detailed stress and strain histories up to the time of fracture, which are used to determine the model parameter values. The calibrated fracture model, that correctly predicts fracture initiation (and initiation energy) in the Charpy specimen, may then be used to simulate tests of accepted fracture-toughness specimens and hence obtain fracture toughness. The model parameters were calibrated to predict fracture in four different test specimens: two different notched-tension specimens, a simple tension specimen, and a precracked compact-tension specimen. The model was then used in a computer simulation of the Charpy V-notch specimen to initiate and advance a flat fracture. Results were compared with interrupted Charpy tests. Calibration of the model for two additional heat treatments of A533B-1 steel is in progress

Decadal predictions of Southern Ocean sea ice : testing different initialization methods with an Earth-system Model of Intermediate Complexity

Science.gov (United States)

Zunz, Violette; Goosse, Hugues; Dubinkina, Svetlana

2013-04-01

The sea ice extent in the Southern Ocean has increased since 1979 but the causes of this expansion have not been firmly identified. In particular, the contribution of internal variability and external forcing to this positive trend has not been fully established. In this region, the lack of observations and the overestimation of internal variability of the sea ice by contemporary General Circulation Models (GCMs) make it difficult to understand the behaviour of the sea ice. Nevertheless, if its evolution is governed by the internal variability of the system and if this internal variability is in some way predictable, a suitable initialization method should lead to simulations results that better fit the reality. Current GCMs decadal predictions are generally initialized through a nudging towards some observed fields. This relatively simple method does not seem to be appropriated to the initialization of sea ice in the Southern Ocean. The present study aims at identifying an initialization method that could improve the quality of the predictions of Southern Ocean sea ice at decadal timescales. We use LOVECLIM, an Earth-system Model of Intermediate Complexity that allows us to perform, within a reasonable computational time, the large amount of simulations required to test systematically different initialization procedures. These involve three data assimilation methods: a nudging, a particle filter and an efficient particle filter. In a first step, simulations are performed in an idealized framework, i.e. data from a reference simulation of LOVECLIM are used instead of observations, herein after called pseudo-observations. In this configuration, the internal variability of the model obviously agrees with the one of the pseudo-observations. This allows us to get rid of the issues related to the overestimation of the internal variability by models compared to the observed one. This way, we can work out a suitable methodology to assess the efficiency of the

A model of frontal polymerization using complex initiation

Directory of Open Access Journals (Sweden)

P. M. Goldfeder

1999-01-01

Full Text Available Frontal polymerization is a process in which a spatially localized reaction zone propagates into a monomer, converting it into a polymer. In the simplest case of free-radical polymerization, a mixture of monomer and initiator is placed in a test tube. A reaction is then initiated at one end of the tube. Over time, a self-sustained thermal wave, in which chemical conversion occurs, is produced. This phenomenon is possible because of the highly exothermic nature of the polymerization reactions.

Ørsted Initial Field Model

DEFF Research Database (Denmark)

Olsen, Nils; Holme, R.; Hulot, G.

2000-01-01

Magnetic measurements taken by the Orsted satellite during geomagnetic quiet conditions around January 1, 2000 have been used to derive a spherical harmonic model of the Earth's magnetic field for epoch 2000.0. The maximum degree and order of the model is 19 for internal, and 2 for external, source...... fields; however, coefficients above degree 14 may not be robust. Such a detailed model exists for only one previous epoch, 1980. Achieved rms misfit is ... to the Orsted mission, this model supercedes IGRF 2000....

Genetic Algorithms for Models Optimization for Recognition of Translation Initiation Sites

KAUST Repository

Mora, Arturo Magana

2011-06-01

This work uses genetic algorithms (GA) to reduce the complexity of the artificial neural networks (ANNs) and decision trees (DTs) for the accurate recognition of translation initiation sites (TISs) in Arabidopsis Thaliana. The Arabidopsis data was extracted directly from genomic DNA sequences. Methods derived in this work resulted in both reduced complexity of the predictors, as well as in improvement in prediction accuracy (generalization). Optimization through use of GA is generally a computationally intensive task. One of the approaches to overcome this problem is to use parallelization of code that implements GA, thus allowing computation on multiprocessing infrastructure. However, further improvement in performance GA implementation could be achieved through modification done to GA basic operations such as selection, crossover and mutation. In this work we explored two such improvements, namely evolutive mutation and GA-Simplex crossover operation. In this thesis we studied the benefit of these modifications on the problem of TISs recognition. Compared to the non-modified GA approach, we reduced the number of weights in the resulting model\\'s neural network component by 51% and the number of nodes in the model\\'s DTs component by 97% whilst improving the model\\'s accuracy at the same time. Separately, we developed another methodology for reducing the complexity of prediction models by optimizing the composition of training data subsets in bootstrap aggregation (bagging) methodology. This optimization is achieved by applying a new GA-based bagging methodology in order to optimize the composition of each of the training data subsets. This approach has shown in our test cases to considerably enhance the accuracy of the TIS prediction model compared to the original bagging methodology. Although these methods are applied to the problem of accurate prediction of TISs we believe that these methodologies have a potential for wider scope of application.

Comparison of different initiation protocols in the resistant hepatocyte model

International Nuclear Information System (INIS)

Espandiari, Parvaneh; Robertson, Larry W.; Srinivasan, Cidambi; Glauert, Howard P.

2005-01-01

Several models in rat liver have been developed to study multistage carcinogenesis, including the Solt-Farber resistant hepatocyte model. In this model, initiation consists of either a necrogenic dose of a hepatocarcinogen or a non-necrogenic dose in conjunction with partial hepatectomy (PH). As an alternative to PH, we investigated two different procedures: fasting for 96 h followed by refeeding, or the use of one-day-old neonates. Male Fisher 344 rats were injected p.o. with diethylnitrosamine (DEN) (0, 20, or 100 mg/kg) 24 h after refeeding or PH (controls received DEN alone with no proliferative stimulus). For the neonatal group, male and female Fisher 344 rats were treated with DEN (0 or 20 mg/kg, i.p.) at one day of age. All initiated animals were treated at the same age (11 weeks) with the following selection agents: three daily doses of 2-acetylaminofluorene (AAF) (30 mg/kg), followed by a single dose of carbon tetrachloride (2 ml/kg), followed by three additional daily treatments of AAF (30 mg/kg). Rats were euthanized 2 weeks after the last AAF injection. The PH, neonatal male, and neonatal female groups receiving DEN developed more γ-glutamyl transpeptidase (GGT)-positive foci per cubic centimeter and foci per liver as compared to untreated rats receiving the same proliferative stimulus, whereas the fasting/refeeding group and the group receiving no proliferative stimulus did not. All DEN-treated groups receiving one of the proliferative stimuli had more foci per cubic centimeter than the DEN-treated group receiving no proliferative stimulus. The volume fractions of GGT-positive foci in the PH/DEN and neonatal male/DEN groups were higher than those of both the DEN-treated group receiving no proliferative stimulus and the groups receiving the same proliferative stimulus without DEN. In neonatal females-receiving DEN, the volume fraction was not different from either neonatal females not receiving DEN or DEN-treated rats receiving no proliferative

Ensemble-based flash-flood modelling: Taking into account hydrodynamic parameters and initial soil moisture uncertainties

Science.gov (United States)

Edouard, Simon; Vincendon, Béatrice; Ducrocq, Véronique

2018-05-01

Intense precipitation events in the Mediterranean often lead to devastating flash floods (FF). FF modelling is affected by several kinds of uncertainties and Hydrological Ensemble Prediction Systems (HEPS) are designed to take those uncertainties into account. The major source of uncertainty comes from rainfall forcing and convective-scale meteorological ensemble prediction systems can manage it for forecasting purpose. But other sources are related to the hydrological modelling part of the HEPS. This study focuses on the uncertainties arising from the hydrological model parameters and initial soil moisture with aim to design an ensemble-based version of an hydrological model dedicated to Mediterranean fast responding rivers simulations, the ISBA-TOP coupled system. The first step consists in identifying the parameters that have the strongest influence on FF simulations by assuming perfect precipitation. A sensitivity study is carried out first using a synthetic framework and then for several real events and several catchments. Perturbation methods varying the most sensitive parameters as well as initial soil moisture allow designing an ensemble-based version of ISBA-TOP. The first results of this system on some real events are presented. The direct perspective of this work will be to drive this ensemble-based version with the members of a convective-scale meteorological ensemble prediction system to design a complete HEPS for FF forecasting.

Molecular dynamics modeling on the role of initial void geometry in a thin aluminum film under uniaxial tension

International Nuclear Information System (INIS)

Cui, Yi; Chen, Zengtao

2015-01-01

The effect of initial void geometry on damage progression in a thin aluminum film under uniaxial load is studied via molecular dynamics (MD) method. The embedded voids are with different initial geometries regarding shape, porosity and intervoid ligament distance (ILD). Major simulations are run upon twelve MD geometries with each containing 8–27 million atoms. The corresponding stress–strain relation is monitored during the microstructure evolution of the specimens. The critical stress to trigger the dislocation emission is found in line with the prediction of the Lubarda model. The simulation results reveal that the initial void geometry has substantial impact on the stress–strain relation especially for a specimen with larger initial porosity. (paper)

Predictors of initial weight loss among women with abdominal obesity: a path model using self-efficacy and health-promoting behaviour.

Science.gov (United States)

Choo, Jina; Kang, Hyuncheol

2015-05-01

To identify predictors of initial weight loss among women with abdominal obesity by using a path model. Successful weight loss in the initial stages of long-term weight management may promote weight loss maintenance. A longitudinal study design. Study participants were 75 women with abdominal obesity, who were enrolled in a 12-month Community-based Heart and Weight Management Trial and followed until a 6-month assessment. The Weight Efficacy Lifestyle, Exercise Self-Efficacy and Health Promoting Lifestyle Profile-II measured diet self-efficacy, exercise self-efficacy and health-promoting behaviour respectively. All endogenous and exogenous variables used in our path model were change variables from baseline to 6 months. Data were collected between May 2011-May 2012. Based on the path model, increases in both diet and exercise self-efficacy had significant effects on increases in health-promoting behaviour. Increases in diet self-efficacy had a significant indirect effect on initial weight loss via increases in health-promoting behaviour. Increases in health-promoting behaviour had a significant effect on initial weight loss. Among women with abdominal obesity, increased diet self-efficacy and health-promoting behaviour were predictors of initial weight loss. A mechanism by which increased diet self-efficacy predicts initial weight loss may be partially attributable to health-promoting behavioural change. However, more work is still needed to verify causality. Based on the current findings, intensive nursing strategies for increasing self-efficacy for weight control and health-promoting behaviour may be essential components for better weight loss in the initial stage of a weight management intervention. © 2015 John Wiley & Sons Ltd.

Toward verifying fossil fuel CO2 emissions with the CMAQ model: motivation, model description and initial simulation.

Science.gov (United States)

Liu, Zhen; Bambha, Ray P; Pinto, Joseph P; Zeng, Tao; Boylan, Jim; Huang, Maoyi; Lei, Huimin; Zhao, Chun; Liu, Shishi; Mao, Jiafu; Schwalm, Christopher R; Shi, Xiaoying; Wei, Yaxing; Michelsen, Hope A

2014-04-01

Motivated by the question of whether and how a state-of-the-art regional chemical transport model (CTM) can facilitate characterization of CO2 spatiotemporal variability and verify CO2 fossil-fuel emissions, we for the first time applied the Community Multiscale Air Quality (CMAQ) model to simulate CO2. This paper presents methods, input data, and initial results for CO2 simulation using CMAQ over the contiguous United States in October 2007. Modeling experiments have been performed to understand the roles of fossil-fuel emissions, biosphere-atmosphere exchange, and meteorology in regulating the spatial distribution of CO2 near the surface over the contiguous United States. Three sets of net ecosystem exchange (NEE) fluxes were used as input to assess the impact of uncertainty of NEE on CO2 concentrations simulated by CMAQ. Observational data from six tall tower sites across the country were used to evaluate model performance. In particular, at the Boulder Atmospheric Observatory (BAO), a tall tower site that receives urban emissions from Denver CO, the CMAQ model using hourly varying, high-resolution CO2 fossil-fuel emissions from the Vulcan inventory and Carbon Tracker optimized NEE reproduced the observed diurnal profile of CO2 reasonably well but with a low bias in the early morning. The spatial distribution of CO2 was found to correlate with NO(x), SO2, and CO, because of their similar fossil-fuel emission sources and common transport processes. These initial results from CMAQ demonstrate the potential of using a regional CTM to help interpret CO2 observations and understand CO2 variability in space and time. The ability to simulate a full suite of air pollutants in CMAQ will also facilitate investigations of their use as tracers for CO2 source attribution. This work serves as a proof of concept and the foundation for more comprehensive examinations of CO2 spatiotemporal variability and various uncertainties in the future. Atmospheric CO2 has long been modeled

Solutions to the Cosmic Initial Entropy Problem without Equilibrium Initial Conditions

Directory of Open Access Journals (Sweden)

Vihan M. Patel

2017-08-01

Full Text Available The entropy of the observable universe is increasing. Thus, at earlier times the entropy was lower. However, the cosmic microwave background radiation reveals an apparently high entropy universe close to thermal and chemical equilibrium. A two-part solution to this cosmic initial entropy problem is proposed. Following Penrose, we argue that the evenly distributed matter of the early universe is equivalent to low gravitational entropy. There are two competing explanations for how this initial low gravitational entropy comes about. (1 Inflation and baryogenesis produce a virtually homogeneous distribution of matter with a low gravitational entropy. (2 Dissatisfied with explaining a low gravitational entropy as the product of a ‘special’ scalar field, some theorists argue (following Boltzmann for a “more natural” initial condition in which the entire universe is in an initial equilibrium state of maximum entropy. In this equilibrium model, our observable universe is an unusual low entropy fluctuation embedded in a high entropy universe. The anthropic principle and the fluctuation theorem suggest that this low entropy region should be as small as possible and have as large an entropy as possible, consistent with our existence. However, our low entropy universe is much larger than needed to produce observers, and we see no evidence for an embedding in a higher entropy background. The initial conditions of inflationary models are as natural as the equilibrium background favored by many theorists.

The Virtual Physiological Human - a European initiative for in silico human modelling -.

Science.gov (United States)

Viceconti, Marco; Clapworthy, Gordon; Van Sint Jan, Serge

2008-12-01

The Virtual Physiological Human (VPH) is an initiative, strongly supported by the European Commission (EC), that seeks to develop an integrated model of human physiology at multiple scales from the whole body through the organ, tissue, cell and molecular levels to the genomic level. VPH had its beginnings in 2005 with informal discussions amongst like-minded scientists which led to the STEP project, a Coordination Action funded by the EC that began in early 2006. The STEP project greatly accelerated the progress of the VPH and proved to be a catalyst for wide-ranging discussions within Europe and for outreach activities designed to develop a broad international approach to the huge scientific and technological challenges involved in this area. This paper provides an overview of the VPH and the developments it has engendered in the rapidly expanding worldwide activities associated with the physiome. It then uses one particular project, the Living Human Project, to illustrate the type of advances that are taking place to further the aims of the VPH and similar initiatives worldwide.

Work information and emotional support of self-initiated expatriates: multilevel mediation model

DEFF Research Database (Denmark)

Kubovcikova, Annamária; van Bakel, Marian

of the network members with the type and amount of support they provide. The dataset consisted of 165 expatriates who rated 575 of their network members on the following learned characteristics: host country knowledge, employment status, and host country origin. The ego-centered network that consists...... of the rated ties is the context in which expatriates are embedded. It was therefore analyzed utilizing a multilevel mediation model. We have hypothesized that all learned characteristics will be determining the frequency of interaction and thus the level and type of support received. Host country knowledge......This article explores the immediate network context of self-initiated expatriates and how it influences their work information and emotional support. Building on the information seeking theory and the theory of weak and strong ties, we have created a model connecting specific characteristics...

A simulation model to estimate the cost and effectiveness of alternative dialysis initiation strategies.

Science.gov (United States)

Lee, Chris P; Chertow, Glenn M; Zenios, Stefanos A

2006-01-01

Patients with end-stage renal disease (ESRD) require dialysis to maintain survival. The optimal timing of dialysis initiation in terms of cost-effectiveness has not been established. We developed a simulation model of individuals progressing towards ESRD and requiring dialysis. It can be used to analyze dialysis strategies and scenarios. It was embedded in an optimization frame worked to derive improved strategies. Actual (historical) and simulated survival curves and hospitalization rates were virtually indistinguishable. The model overestimated transplantation costs (10%) but it was related to confounding by Medicare coverage. To assess the model's robustness, we examined several dialysis strategies while input parameters were perturbed. Under all 38 scenarios, relative rankings remained unchanged. An improved policy for a hypothetical patient was derived using an optimization algorithm. The model produces reliable results and is robust. It enables the cost-effectiveness analysis of dialysis strategies.

Investigation of magnetoimpedance effect on electrodeposited NiFe/Cu wire using inductance spectroscopy

International Nuclear Information System (INIS)

Mishra, Amaresh Chandra; Sahoo, Trilochan; Srinivas, V.; Thakur, Awalendra K.

2011-01-01

In this report, inductance spectroscopy (IS) has been used as a tool to investigate the thickness dependence of magnetoimpedance (MI) on electrodeposited NiFe thin films. An MI value as high as 140% has been observed under an applied magnetic field of 76 Oe at 300 kHz frequency for a film thickness of 6.8 μm. This result is in sharp contrast to earlier reports in literature showing monotonous increase in MI as a function of thickness. Maximum of MI was found at an optimum film thickness whose position varies with frequency. These reports exhibiting strong frequency dependence of MI prompted us to investigate the underlying physics using IS. The origin of MI lies in the combined effect of domain wall motion and spin rotation, which contributes to permeability. A parallel inductance and resistance (LR) circuit in series with series LR circuit model has been proposed as an equivalent electrical model to describe the property of these coated wires. The circuit elements have been linked with the phenomenon of domain wall motion and spin rotation. The experimental results obtained appear to be consistent with the proposed equivalent circuit model. -- Research Highlights: →GMI study on electrodeposited NiFe/Cu wire has been done to resolve the existing controversies. →Inductance spectroscopy has been used to evaluate the magnetic character. →The sample has been modeled as an equivalent electrical circuit. →A correlation between circuit parameters and GMI has been achieved.

Robust Initial Wetness Condition Framework of an Event-Based Rainfall–Runoff Model Using Remotely Sensed Soil Moisture

OpenAIRE

Wooyeon Sunwoo; Minha Choi

2017-01-01

Runoff prediction in limited-data areas is vital for hydrological applications, such as the design of infrastructure and flood defenses, runoff forecasting, and water management. Rainfall–runoff models may be useful for simulation of runoff generation, particularly event-based models, which offer a practical modeling scheme because of their simplicity. However, there is a need to reduce the uncertainties related to the estimation of the initial wetness condition (IWC) prior to a rainfall even...

A structural model of the E. coli PhoB Dimer in the transcription initiation complex

Directory of Open Access Journals (Sweden)

Tung Chang-Shung

2012-03-01

Full Text Available Abstract Background There exist > 78,000 proteins and/or nucleic acids structures that were determined experimentally. Only a small portion of these structures corresponds to those of protein complexes. While homology modeling is able to exploit knowledge-based potentials of side-chain rotomers and backbone motifs to infer structures for new proteins, no such general method exists to extend our understanding of protein interaction motifs to novel protein complexes. Results We use a Motif Binding Geometries (MBG approach, to infer the structure of a protein complex from the database of complexes of homologous proteins taken from other contexts (such as the helix-turn-helix motif binding double stranded DNA, and demonstrate its utility on one of the more important regulatory complexes in biology, that of the RNA polymerase initiating transcription under conditions of phosphate starvation. The modeled PhoB/RNAP/σ-factor/DNA complex is stereo-chemically reasonable, has sufficient interfacial Solvent Excluded Surface Areas (SESAs to provide adequate binding strength, is physically meaningful for transcription regulation, and is consistent with a variety of known experimental constraints. Conclusions Based on a straightforward and easy to comprehend concept, "proteins and protein domains that fold similarly could interact similarly", a structural model of the PhoB dimer in the transcription initiation complex has been developed. This approach could be extended to enable structural modeling and prediction of other bio-molecular complexes. Just as models of individual proteins provide insight into molecular recognition, catalytic mechanism, and substrate specificity, models of protein complexes will provide understanding into the combinatorial rules of cellular regulation and signaling.

Self-Consistent Model of Magnetospheric Electric Field, Ring Current, Plasmasphere, and Electromagnetic Ion Cyclotron Waves: Initial Results

Science.gov (United States)

Gamayunov, K. V.; Khazanov, G. V.; Liemohn, M. W.; Fok, M.-C.; Ridley, A. J.

2009-01-01

Further development of our self-consistent model of interacting ring current (RC) ions and electromagnetic ion cyclotron (EMIC) waves is presented. This model incorporates large scale magnetosphere-ionosphere coupling and treats self-consistently not only EMIC waves and RC ions, but also the magnetospheric electric field, RC, and plasmasphere. Initial simulations indicate that the region beyond geostationary orbit should be included in the simulation of the magnetosphere-ionosphere coupling. Additionally, a self-consistent description, based on first principles, of the ionospheric conductance is required. These initial simulations further show that in order to model the EMIC wave distribution and wave spectral properties accurately, the plasmasphere should also be simulated self-consistently, since its fine structure requires as much care as that of the RC. Finally, an effect of the finite time needed to reestablish a new potential pattern throughout the ionosphere and to communicate between the ionosphere and the equatorial magnetosphere cannot be ignored.

Adherence of private health system hospitals to dissemination of outcomes according to the Global Reporting Initiative (GRI) model.

Science.gov (United States)

Machado, Celso; César, Robson Danúbio da Silva; Souza, Maria Tereza Saraiva de

2017-01-01

To verify if there is an analogy between the indicators of the Global Reporting Initiative adopted by hospitals in the private healthcare system. Documentary research supported by reports that are electronically available on the website of the companies surveyed. The organizations surveyed had a significant adherence of their economic, social and environmental indicators of the model proposed by the Global Reporting Initiative, showing an analogous field of common indicators between them. There is similarity between the indicators adopted by companies, but one of the hospitals analyzed had a greater number of converging indicators to Global Reporting Initiative.

Modeling initial contact dynamics during ambulation with dynamic simulation.

Science.gov (United States)

Meyer, Andrew R; Wang, Mei; Smith, Peter A; Harris, Gerald F

2007-04-01

Ankle-foot orthoses are frequently used interventions to correct pathological gait. Their effects on the kinematics and kinetics of the proximal joints are of great interest when prescribing ankle-foot orthoses to specific patient groups. Mathematical Dynamic Model (MADYMO) is developed to simulate motor vehicle crash situations and analyze tissue injuries of the occupants based multibody dynamic theories. Joint kinetics output from an inverse model were perturbed and input to the forward model to examine the effects of changes in the internal sagittal ankle moment on knee and hip kinematics following heel strike. Increasing the internal ankle moment (augmentation, equivalent to gastroc-soleus contraction) produced less pronounced changes in kinematic results at the hip, knee and ankle than decreasing the moment (attenuation, equivalent to gastroc-soleus relaxation). Altering the internal ankle moment produced two distinctly different kinematic curve morphologies at the hip. Decreased internal ankle moments increased hip flexion, peaking at roughly 8% of the gait cycle. Increasing internal ankle moments decreased hip flexion to a lesser degree, and approached normal at the same point in the gait cycle. Increasing the internal ankle moment produced relatively small, well-behaved extension-biased kinematic results at the knee. Decreasing the internal ankle moment produced more substantial changes in knee kinematics towards flexion that increased with perturbation magnitude. Curve morphologies were similar to those at the hip. Immediately following heel strike, kinematic results at the ankle showed movement in the direction of the internal moment perturbation. Increased internal moments resulted in kinematic patterns that rapidly approach normal after initial differences. When the internal ankle moment was decreased, differences from normal were much greater and did not rapidly decrease. This study shows that MADYMO can be successfully applied to accomplish forward

AN INITIAL DESIGN OF ISO 19152:2012 LADM BASED VALUATION AND TAXATION DATA MODEL

DEFF Research Database (Denmark)

Cagdas, Volkan; Kara, A.; van Oosterom, P.

2016-01-01

standard that defines the semantics of fiscal databases. The ISO 19152:2012 Land Administration Domain Model (LADM), as an international land administration standard focuses on legal requirements, but considers out of scope specifications of external information systems including valuation and taxation...... databases. However, it provides a formalism which allows for an extension that responds to the fiscal requirements. This paper introduces an initial version of a LADM – Fiscal Extension Module for the specification of databases used in immovable property valuation and taxation. The extension module....... It is expected that the initial version will be refined through further activities held by a possible joint working group under FIG Commission 7 (Cadastre and Land Management) and FIG Commission 9 (Valuation and the Management of Real Estate) in collaboration with other relevant international bodies....

The Trilateral Initiative: The Legal Framework

International Nuclear Information System (INIS)

Rockwood, L.

2015-01-01

The Trilateral Initiative was a six-year effort undertaken by the IAEA, the United States and the Russian Federation between 1996 to 2002 to identify verification arrangements and technologies for IAEA verification of classified forms of Pu and HEU from nuclear warheads or components. As part of that Initiative, between 1999 and 2001, the parties succeeded in negotiating a model agreement for such verification (the Model Agreement). Although the Trilateral Initiative ended in 2002, the Model Agreement produced as a result of those negotiations could still serve as the basis for bilateral agreements between the IAEA and nuclear-weapon States wishing to demonstrate, in a verifiable manner, the release of weapon origin and other fissile material from defence programmes. This presentation will describe the legal framework for the Model Agreement and the major issues addressed during its negotiation

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ERASE ... PROTEIN [Ralstonia solanacearum GMI1000] ... Length = 202 ... Query: 2 ... PDSTLTLISHPLCP...FVQRAAIVLLEKGVPFERINVDLAAKPDWFLALSPTGKVPLLKVVR 61 ... PDSTLTLISHPLCPFVQRAA...IVLLEKGVPFERINVDLAAKPDWFLALSPTGKVPLLKVVR Sbjct: 1 ... PDSTLTLISHPLCPFVQRAAIVLLEKGVPFERINVDLAAKPDWFLALSPTGKVPLL

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available TEIN ... [Ralstonia solanacearum GMI1000] ... Length = 101 ... Query: 1 ... MIPGELLPQDGDLELNAGRPTLTVTVANT...GDRPVQIGSHYHFHEVNDALRFDREATRGYR 60 ... MIPGELLPQDGDLELNAGRPTLTVTVANT...GDRPVQIGSHYHFHEVNDALRFDREATRGYR Sbjct: 1 ... MIPGELLPQDGDLELNAGRPTLTVTVANTGDRPVQIGSHYHFHEVNDALRFDREATRGYR 60 ...

Keeping it real--building an ROI model for an ambulatory EMR initiative that the physician practices espouse.

Science.gov (United States)

Mullen, Rńee; Donnelly, John T

2006-01-01

The ambulatory electronic medical record initiative at Magic Valley Regional Medical Center (MVRMC) in South Central Idaho underwent a rigorous product evaluation process that resulted in one of the market-leading EMR products being selected for implementation. MVRMC includes four business entities, including a 213-bed regional hospital and a 19-practice management services organization. Early in the process, the organization viewed buy-in from its physicians as a critical success factor. The physicians had been integral to product selection, and it was equally important for them to trust the economic model for its acquisition-especially because it was likely that they would be asked to put "some skin in the game." To make this initiative economically feasible, MVRMC received a grant from Agency for Healthcare Research and Quality based on the potential impact of the endeavor on healthcare delivery in the region. However, because the functional analysis did not result in the selection of the least expensive product, the AHRQ grant would only help defray the startup expenses, but not ongoing support and maintenance expenses after implementation; these costs would be borne by anticipated increases in the practice's revenue or reduction in its operating expenses. The ROI model would need to explain how each practice, from the single physician specialist to an almost 20-physician family practice, could pay for the desirable outcomes discussed during the selection phase of the project. The physicians, who had participated in technology initiatives in the past, were skeptical that cost-justifying an IT system was realistic, even though they recognized the potential benefits it could have on the quality and consistency of the care. Because some process standardization within and between practices would be needed to use electronic charting effectively, it was important that the ROI model did not outweigh the benefits of an as-yet untested operational workflow that

Initial layer theory and model equations of Volterra type

International Nuclear Information System (INIS)

Bijura, Angelina M.

2003-10-01

It is demonstrated here that there exist initial layers to singularly perturbed Volterra equations whose thicknesses are not of order of magnitude of 0(ε), ε → 0. It is also shown that the initial layer theory is extremely useful because it allows one to construct the approximate solution to an equation, which is almost identical to the exact solution. (author)

Adherence of private health system hospitals to dissemination of outcomes according to the Global Reporting Initiative (GRI) model

OpenAIRE

Machado Junior, Celso; César, Robson Danúbio da Silva; Souza, Maria Tereza Saraiva de

2017-01-01

ABSTRACT Objective To verify if there is an analogy between the indicators of the Global Reporting Initiative adopted by hospitals in the private healthcare system. Methods Documentary research supported by reports that are electronically available on the website of the companies surveyed. Results The organizations surveyed had a significant adherence of their economic, social and environmental indicators of the model proposed by the Global Reporting Initiative, showing an analogous fie...

Adherence of private health system hospitals to dissemination of outcomes according to the Global Reporting Initiative (GRI) model

OpenAIRE

Machado, Celso; César, Robson Danúbio da Silva; de Souza, Maria Tereza Saraiva

2017-01-01

ABSTRACT Objective To verify if there is an analogy between the indicators of the Global Reporting Initiative adopted by hospitals in the private healthcare system. Methods Documentary research supported by reports that are electronically available on the website of the companies surveyed. Results The organizations surveyed had a significant adherence of their economic, social and environmental indicators of the model proposed by the Global Reporting Initiative, showing an analogous field of ...

Initiation of a Marinoan Snowball Earth in a state-of-the-art atmosphere-ocean general circulation model

Directory of Open Access Journals (Sweden)

A. Voigt

2011-03-01

Full Text Available We study the initiation of a Marinoan Snowball Earth (~635 million years before present with the state-of-the-art atmosphere-ocean general circulation model ECHAM5/MPI-OM. This is the most sophisticated model ever applied to Snowball initiation. A comparison with a pre-industrial control climate shows that the change of surface boundary conditions from present-day to Marinoan, including a shift of continents to low latitudes, induces a global-mean cooling of 4.6 K. Two thirds of this cooling can be attributed to increased planetary albedo, the remaining one third to a weaker greenhouse effect. The Marinoan Snowball Earth bifurcation point for pre-industrial atmospheric carbon dioxide is between 95.5 and 96% of the present-day total solar irradiance (TSI, whereas a previous study with the same model found that it was between 91 and 94% for present-day surface boundary conditions. A Snowball Earth for TSI set to its Marinoan value (94% of the present-day TSI is prevented by doubling carbon dioxide with respect to its pre-industrial level. A zero-dimensional energy balance model is used to predict the Snowball Earth bifurcation point from only the equilibrium global-mean ocean potential temperature for present-day TSI. We do not find stable states with sea-ice cover above 55%, and land conditions are such that glaciers could not grow with sea-ice cover of 55%. Therefore, none of our simulations qualifies as a "slushball" solution. While uncertainties in important processes and parameters such as clouds and sea-ice albedo suggest that the Snowball Earth bifurcation point differs between climate models, our results contradict previous findings that Snowball Earth initiation would require much stronger forcings.

Detection of Galactomannan Antigenemia in Patients Receiving Piperacillin-Tazobactam and Correlations between In Vitro, In Vivo, and Clinical Properties of the Drug-Antigen Interaction

Science.gov (United States)

Walsh, Thomas J.; Shoham, Shmuel; Petraitiene, Ruta; Sein, Tin; Schaufele, Robert; Kelaher, Amy; Murray, Heidi; Mya-San, Christine; Bacher, John; Petraitis, Vidmantas

2004-01-01

Recent case reports describe patients receiving piperacillin-tazobactam who were found to have circulating galactomannan detected by the double sandwich enzyme-linked immunosorbent assay (ELISA) system, leading to the false presumption of invasive aspergillosis. Since this property of piperacillin-tazobactam and galactomannan ELISA is not well understood, we investigated the in vitro, in vivo, and clinical properties of this interaction. Among the 12 reconstituted antibiotics representing four classes of antibacterial compounds that are commonly used in immunocompromised patients, piperacillin-tazobactam expressed a distinctively high level of galactomannan antigen in vitro (P = 0.001). After intravenous infusion of piperacillin-tazobactam into rabbits, the serum galactomannan index (GMI) in vivo changed significantly (P = 0.0007) from a preinfusion mean baseline value of 0.27 to a mean GMI of 0.83 by 30 min to slowly decline to a mean GMI of 0.44 24 h later. Repeated administration of piperacillin-tazobactam over 7 days resulted in accumulation of circulating galactomannan to a mean peak GMI of 1.31 and a nadir of 0.53. Further studies revealed that the antigen reached a steady state by the third day of administration of piperacillin-tazobactam. Twenty-six hospitalized patients with no evidence of invasive aspergillosis who were receiving antibiotics and ten healthy blood bank donors were studied for expression of circulating galactomannan. Patients (n = 13) receiving piperacillin-tazobactam had significantly greater mean serum GMI values (0.74 ± 0.14) compared to patients (n = 13) receiving other antibiotics (0.14 ± 0.08) and compared to healthy blood bank donors (0.14 ± 0.06) (P 0.5 compared to none of thirteen subjects receiving other antibiotics (P = 0.039) and to none of ten healthy blood bank donors (P = 0.046). These data demonstrate that among antibiotics that are commonly used in immunocompromised patients, only piperacillin-tazobactam contains

Improvement of a mesoscale atmospheric dynamic model PHYSIC. Utilization of output from synoptic numerical prediction model for initial and boundary condition

International Nuclear Information System (INIS)

Nagai, Haruyasu; Yamazawa, Hiromi

1995-03-01

This report describes the improvement of the mesoscale atmospheric dynamic model which is a part of the atmospheric dispersion calculation model PHYSIC. To introduce large-scale meteorological changes into the mesoscale atmospheric dynamic model, it is necessary to make the initial and boundary conditions of the model by using GPV (Grid Point Value) which is the output of the numerical weather prediction model of JMA (Japan Meteorological Agency). Therefore, the program which preprocesses the GPV data to make a input file to PHYSIC was developed and the input process and the methods of spatial and temporal interpolation were improved to correspond to the file. Moreover, the methods of calculating the cloud amount and ground surface moisture from GPV data were developed and added to the model code. As the example of calculation by the improved model, the wind field simulations of a north-west monsoon in winter and a sea breeze in summer in the Tokai area were also presented. (author)

Prediction of infarct volume in patients undergoing reperfusion therapy by Tc-99m antimyosin SPECT

International Nuclear Information System (INIS)

Yasuda, T.; Leinbach, R.C.; Khaw, B.A.; Gold, H.K.; Strauss, H.W.

1984-01-01

The predictability of infarct volume by Tc-99m antimyosin SPECT was evaluated within 24 hours of chest pain and this was compared to the length of akinesis (AK) from the pre-discharge left ventriculogram (LVgram). Ten patients (pts) with acute myocardial infarction who underwent streptokinase thrombolytic therapy (success 8, failure 2) were subjects of this investigation. None had previous infarction. Average reperfusion time was within 4.5 hours and 20mCi of Tc-99m antimyosin was given intravenously within 8 hours after chest pain; SPECT imaging was performed within 18 hours after injection. Infarct volume was calculated from SPECT and expressed as grams of myocardial infarction (GMI). Ten days later, a 30 0 RAO contrast LVgram was recorded and the length of AK (corrected for magnification) was measured along the LV border at the end-diastolic phase and expressed as cm of AK. GMI and AK were measured independently without knowledge of each other. Results are given. The data demonstrate a good correlation of GMI and AK. Infarct volume can be measured by antimyosin SPECT within 24 hours of chest pain and predict residual LV dysfunction in pts undergoing reperfusion therapy

A Detailed Examination of the GPM Core Satellite Gridded Text Product

Science.gov (United States)

Stocker, Erich Franz; Kelley, Owen A.; Kummerow, C.; Huffman, George; Olson, William S.; Kwiatowski, John M.

2015-01-01

The Global Precipitation Measurement (GPM) mission quarter-degree gridded-text product has a similar file format and a similar purpose as the Tropical Rainfall Measuring Mission (TRMM) 3G68 quarter-degree product. The GPM text-grid format is an hourly summary of surface precipitation retrievals from various GPM instruments and combinations of GPM instruments. The GMI Goddard Profiling (GPROF) retrieval provides the widest swath (800 km) and does the retrieval using the GPM Microwave Imager (GMI). The Ku radar provides the widest radar swath (250 km swath) and also provides continuity with the TRMM Ku Precipitation Radar. GPM's Ku+Ka band matched swath (125 km swath) provides a dual-frequency precipitation retrieval. The "combined" retrieval (125 km swath) provides a multi-instrument precipitation retrieval based on the GMI, the DPR Ku radar, and the DPR Ka radar. While the data are reported in hourly grids, all hours for a day are packaged into a single text file that is g-zipped to reduce file size and to speed up downloading. The data are reported on a 0.25deg x 0.25 deg grid.

76 FR 61365 - Bundled Payments for Care Improvement Initiative

Science.gov (United States)

2011-10-04

...] Bundled Payments for Care Improvement Initiative AGENCY: Centers for Medicare & Medicaid Services (CMS...: Letter of Intent Submission Deadline: For Model 1 of this initiative, interested organizations must...-improvement.html . Application Submission Deadline: For Model 1 of this initiative, applications must be...

Thermodynamic and structural models compared with the initial dissolution rates of open-quotes SONclose quotes glass samples

International Nuclear Information System (INIS)

Tovena, I.; Advocat, T.; Ghaleb, D.; Vernaz, E.; Larche, F.

1994-01-01

The experimentally determined initial dissolution rate R 0 of nuclear glass was correlated with thermodynamic parameters and structural parameters. The initial corrosion rates of six open-quotes R7T7close quotes glass samples measured at 100 degrees C in a Soxhlet device were correlated with the glass free hydration energy and the glass formation enthalpy. These correlations were then tested with a group of 26 SON glasses selected for their wide diversity of compositions. The thermodynamic models provided a satisfactory approximation of the initial dissolution rate determined under Soxhlet conditions for SON glass samples that include up to 15 wt% of boron and some alumina. Conversely, these models are inaccurate if the boron concentration exceeds 15 wt% and the glass contains no alumina. Possible correlations between R 0 and structural parameters, such as the boron coordination number and the number of nonbridging oxygen atoms, were also investigated. The authors show that R 0 varies inversely with the number of 4-coordinate boron atoms; conversely, the results do not substantiate published reports of a correlation between R 0 and the number of nonbridging oxygen atoms

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... solanacearum GMI1000] ... Length = 190 ... Query: 9 ... LTPQNCQLIFIDHQPQMAFGVQSIDRQVLKNNTVGLAKAARIFDIPT...TITTVETEGFSGY 68 ... LTPQNCQLIFIDHQPQMAFGVQSIDRQVLKNNTVGLAKAARIFDIPTTITTVE...TEGFSGY Sbjct: 1 ... LTPQNCQLIFIDHQPQMAFGVQSIDRQVLKNNTVGLAKAARIFDIPTTITTVETEGFSGY 60 ... Query: 129 EGGYEIYMVADAS

Probabilistic modeling of material resistance to crack initiation due to hydrided region overloads in CANDU Zr-2.5%Nb pressure tubes

International Nuclear Information System (INIS)

Gutkin, L.; Scarth, D.A.

2014-01-01

Zr-2.5%Nb pressure tubes in CANDU nuclear reactors are susceptible to hydride-assisted cracking at the locations of stress concentration, such as in-service flaws. Probabilistic methodology is being developed to evaluate such flaws for crack initiation due to hydrided region overloads, which occur when the applied stress acting on a flaw with an existing hydrided region at its tip exceeds the stress at which the hydrided region is formed. As part of this development, probabilistic modeling of pressure tube material resistance to overload crack initiation has been performed on the basis of a set of test data specifically designed to study the effects of non-ratcheting hydride formation conditions and load reduction prior to hydride formation. In the modeling framework, the overload resistance is represented as a power-law function of the material resistance to initiation of delayed hydride cracking under constant loading, where both the overload crack initiation coefficient and the overload crack initiation exponent vary with the flaw geometry. In addition, the overload crack initiation coefficient varies with the extent of load reduction prior to hydride formation as well as the number of non-ratcheting hydride formation thermal cycles. (author)

Probabilistic modeling of material resistance to crack initiation due to hydrided region overloads in CANDU Zr-2.5%Nb pressure tubes

Energy Technology Data Exchange (ETDEWEB)

Gutkin, L.; Scarth, D.A. [Kinectrics Inc., Toronto, ON (Canada)

2014-07-01

Zr-2.5%Nb pressure tubes in CANDU nuclear reactors are susceptible to hydride-assisted cracking at the locations of stress concentration, such as in-service flaws. Probabilistic methodology is being developed to evaluate such flaws for crack initiation due to hydrided region overloads, which occur when the applied stress acting on a flaw with an existing hydrided region at its tip exceeds the stress at which the hydrided region is formed. As part of this development, probabilistic modeling of pressure tube material resistance to overload crack initiation has been performed on the basis of a set of test data specifically designed to study the effects of non-ratcheting hydride formation conditions and load reduction prior to hydride formation. In the modeling framework, the overload resistance is represented as a power-law function of the material resistance to initiation of delayed hydride cracking under constant loading, where both the overload crack initiation coefficient and the overload crack initiation exponent vary with the flaw geometry. In addition, the overload crack initiation coefficient varies with the extent of load reduction prior to hydride formation as well as the number of non-ratcheting hydride formation thermal cycles. (author)

A model for crack initiation in the Li-ion battery electrodes

Energy Technology Data Exchange (ETDEWEB)

Panat, Rahul, E-mail: rahul.panat@wsu.edu

2015-12-01

The development of high energy density Lithium-ion batteries is of intense interest due to their application in the electric car and consumer electronics industry. The primary limiter in using high energy density battery electrodes is the cracking of the electrode material due to the severe strain caused by the charging–discharging cycles. In this paper, a linear perturbation model is used to describe the evolution of the electrode surface under stress. The driving force for the surface undulation formation is the reduction in the electrode strain energy. The kinetics of mass transport is described by the surface and volume diffusion. The model predicts that the Si electrode will develop surface undulations of the order of sub-1 μm length scale on the electrode surface, showing a reasonable agreement with experimental results reported in literature. Such surface undulations roughen the anode surface and can form notches that can act as crack initiation sites. It is also shown that this model is applicable when the temperature of the system is not constant and the system is not isolated. The limitations of the model are also discussed. - Highlights: • This work presents a theoretical formulation that predicts crack formation at an electrode surface under a lithiation cycle. • The research provides the critical parameters required to improve the life of the Li-ion batteries. • These research findings can be used to modify the surface structure to minimize crack formation. • The predictions from the model show a reasonable agreement with the experiments. • None of the theoretical literature so far has addressed the crack formation problem addressed in this paper.

Integrated modeling of natural and human systems - problems and initiatives

Science.gov (United States)

Kessler, H.; Giles, J.; Gunnink, J.; Hughes, A.; Moore, R. V.; Peach, D.

2009-12-01

's system, e.g. the flow of groundwater to an abstraction borehole or the availability of water for irrigation. Particular problems arise when model data from two or more disciplines are incompatible in terms of data formats, scientific concepts or language. Other barriers include the cultural segregation within and between science disciplines as well as impediments to data exchange due to ownership and copyright restrictions. OpenMI and GeoSciML are initiatives that are trying to overcome these barriers by building international communities that share vocabularies and data formats. This paper will give examples of the successful merging of geological and hydrological models from the UK and the Netherlands and will introduce the vision of an open Environmental Modelling Platform which aims to link data, knowledge and concepts seamlessly to numerical process models. Last but not least there is an urgent need to create a Subsurface Management System akin to a Geographic Information System in which all results of subsurface modelling can be visualised and analysed in an integrated manner.

Micromachined silicon cantilevers with integrated high-frequency magnetoimpedance sensors for simultaneous strain and magnetic field detection

Science.gov (United States)

Buettel, G.; Joppich, J.; Hartmann, U.

2017-12-01

Giant magnetoimpedance (GMI) measurements in the high-frequency regime utilizing a coplanar waveguide with an integrated Permalloy multilayer and micromachined on a silicon cantilever are reported. The fabrication process is described in detail. The aspect ratio of the magnetic multilayer in the magnetoresistive and magnetostrictive device was varied. Tensile strain and compressive strain were applied. Vector network analyzer measurements in the range from the skin effect to ferromagnetic resonance confirm the technological potential of GMI-based micro-electro-mechanical devices for strain and magnetic field sensing applications. The strain-impedance gauge factor was quantified by finite element strain calculations and reaches a maximum value of almost 200.

Stochastic dynamics of an inflationary model and initial distribution of universes

International Nuclear Information System (INIS)

Nambu, Yasusada.

1989-01-01

We investigate the stationary solution of the modified Fokker-Planck equation which governs the global dynamics of the inflation. Contrary to the original FP equation which is for a Hubble horizon size region, we found that the normalizable stationary solution can exist for modified Fokker-Planck equation which is for many Hubble horizon size regions. For a chaotic inflationary model with the potential λψ 2n , we get initial distribution of classical universes using this solution, and discussed the physical meaning of it. Especially for n = 2, this distribution obeys power-law and classical universes which created from the Planck energy region make the fractal structure. Other cases n ≠ 2, creation of large classical universes are strongly suppressed. (author)

Initial stability of a highly porous titanium cup in an acetabular bone defect model.

Science.gov (United States)

Yoshimoto, Kensei; Nakashima, Yasuharu; Wakiyama, Miyo; Hara, Daisuke; Nakamura, Akihiro; Iwamoto, Mikio

2018-04-12

The purpose of this study was to quantify the initial stability of a highly porous titanium cup using an acetabular bone defect model. The maximum torque of a highly porous titanium cup, with a pore size of 640 μm and porosity of 60%, was measured using rotational and lever-out torque testing and compared to that of a titanium-sprayed cup. The bone models were prepared using a polyurethane foam block and had three levels of bone coverage: 100, 70, and 50%. The highly porous titanium cup demonstrated significantly higher maximum torque than the titanium-sprayed cups in the three levels of bone defects. On rotational torque testing, it was found to be 1.5, 1.3, and 1.3 times stronger than the titanium-sprayed cups with 100, 70 and 50% bone coverage, respectively. Furthermore, it was found to be 2.2, 2.3, and 1.5 times stronger on lever-out testing than the titanium-sprayed cup. No breakage in the porous layers was noted during the testing. This study provides additional evidence of the initial stability of highly porous titanium cup, even in the presence of acetabular bone defects. Copyright © 2018. Published by Elsevier B.V.

Magnetohydrodynamic Modeling of Solar Coronal Dynamics with an Initial Non-force-free Magnetic Field

Energy Technology Data Exchange (ETDEWEB)

Prasad, A.; Bhattacharyya, R.; Kumar, Sanjay [Udaipur Solar Observatory, Physical Research Laboratory, Dewali, Bari Road, Udaipur-313001 (India)

2017-05-01

The magnetic fields in the solar corona are generally neither force-free nor axisymmetric and have complex dynamics that are difficult to characterize. Here we simulate the topological evolution of solar coronal magnetic field lines (MFLs) using a magnetohydrodynamic model. The simulation is initialized with a non-axisymmetric non-force-free magnetic field that best correlates with the observed vector magnetograms of solar active regions (ARs). To focus on these ideas, simulations are performed for the flaring AR 11283 noted for its complexity and well-documented dynamics. The simulated dynamics develops as the initial Lorentz force pushes the plasma and facilitates successive magnetic reconnections at the two X-type null lines present in the initial field. Importantly, the simulation allows for the spontaneous development of mass flow, unique among contemporary works, that preferentially reconnects field lines at one of the X-type null lines. Consequently, a flux rope consisting of low-lying twisted MFLs, which approximately traces the major polarity inversion line, undergoes an asymmetric monotonic rise. The rise is attributed to a reduction in the magnetic tension force at the region overlying the rope, resulting from the reconnection. A monotonic rise of the rope is in conformity with the standard scenario of flares. Importantly, the simulated dynamics leads to bifurcations of the flux rope, which, being akin to the observed filament bifurcation in AR 11283, establishes the appropriateness of the initial field in describing ARs.

Recent Upgrades to NASA SPoRT Initialization Datasets for the Environmental Modeling System

Science.gov (United States)

Case, Jonathan L.; Lafontaine, Frank J.; Molthan, Andrew L.; Zavodsky, Bradley T.; Rozumalski, Robert A.

2012-01-01

The NASA Short-term Prediction Research and Transition (SPoRT) Center has developed several products for its NOAA/National Weather Service (NWS) partners that can initialize specific fields for local model runs within the NOAA/NWS Science and Training Resource Center Environmental Modeling System (EMS). The suite of SPoRT products for use in the EMS consists of a Sea Surface Temperature (SST) composite that includes a Lake Surface Temperature (LST) analysis over the Great Lakes, a Great Lakes sea-ice extent within the SST composite, a real-time Green Vegetation Fraction (GVF) composite, and NASA Land Information System (LIS) gridded output. This paper and companion poster describe each dataset and provide recent upgrades made to the SST, Great Lakes LST, GVF composites, and the real-time LIS runs.

Energetic neutral atom imaging with the Polar CEPPAD/IPS instrument: Initial forward modeling results

International Nuclear Information System (INIS)

Henderson, M.G.; Reeves, G.D.; Moore, K.R.; Spence, H.E.; Jorgensen, A.M.; Roelof, E.C.

1997-01-01

Although the primary function of the CEP-PAD/IPS instrument on Polar is the measurement of energetic ions in-situ, it has also proven to be a very capable Energetic neutral Atom (ENA) imager. Raw ENA images are currently being constructed on a routine basis with a temporal resolution of minutes during both active and quiet times. However, while analyses of these images by themselves provide much information on the spatial distribution and dynamics of the energetic ion population in the ring current, detailed modeling is required to extract the actual ion distributions. In this paper, the authors present the initial results of forward modeling an IPS ENA image obtained during a small geo-magnetic storm on June 9, 1997. The equatorial ion distribution inferred with this technique reproduces the expected large noon/midnight and dawn/dusk asymmetries. The limitations of the model are discussed and a number of modifications to the basic forward modeling technique are proposed which should significantly improve its performance in future studies

The version 3 OMI NO2 standard product

Directory of Open Access Journals (Sweden)

N. A. Krotkov

2017-09-01

Full Text Available We describe the new version 3.0 NASA Ozone Monitoring Instrument (OMI standard nitrogen dioxide (NO2 products (SPv3. The products and documentation are publicly available from the NASA Goddard Earth Sciences Data and Information Services Center (https://disc.gsfc.nasa.gov/datasets/OMNO2_V003/summary/. The major improvements include (1 a new spectral fitting algorithm for NO2 slant column density (SCD retrieval and (2 higher-resolution (1° latitude and 1.25° longitude a priori NO2 and temperature profiles from the Global Modeling Initiative (GMI chemistry–transport model with yearly varying emissions to calculate air mass factors (AMFs required to convert SCDs into vertical column densities (VCDs. The new SCDs are systematically lower (by ∼ 10–40 % than previous, version 2, estimates. Most of this reduction in SCDs is propagated into stratospheric VCDs. Tropospheric NO2 VCDs are also reduced over polluted areas, especially over western Europe, the eastern US, and eastern China. Initial evaluation over unpolluted areas shows that the new SPv3 products agree better with independent satellite- and ground-based Fourier transform infrared (FTIR measurements. However, further evaluation of tropospheric VCDs is needed over polluted areas, where the increased spatial resolution and more refined AMF estimates may lead to better characterization of pollution hot spots.

NASA SPoRT Initialization Datasets for Local Model Runs in the Environmental Modeling System

Science.gov (United States)

Case, Jonathan L.; LaFontaine, Frank J.; Molthan, Andrew L.; Carcione, Brian; Wood, Lance; Maloney, Joseph; Estupinan, Jeral; Medlin, Jeffrey M.; Blottman, Peter; Rozumalski, Robert A.

2011-01-01

The NASA Short-term Prediction Research and Transition (SPoRT) Center has developed several products for its National Weather Service (NWS) partners that can be used to initialize local model runs within the Weather Research and Forecasting (WRF) Environmental Modeling System (EMS). These real-time datasets consist of surface-based information updated at least once per day, and produced in a composite or gridded product that is easily incorporated into the WRF EMS. The primary goal for making these NASA datasets available to the WRF EMS community is to provide timely and high-quality information at a spatial resolution comparable to that used in the local model configurations (i.e., convection-allowing scales). The current suite of SPoRT products supported in the WRF EMS include a Sea Surface Temperature (SST) composite, a Great Lakes sea-ice extent, a Greenness Vegetation Fraction (GVF) composite, and Land Information System (LIS) gridded output. The SPoRT SST composite is a blend of primarily the Moderate Resolution Imaging Spectroradiometer (MODIS) infrared and Advanced Microwave Scanning Radiometer for Earth Observing System data for non-precipitation coverage over the oceans at 2-km resolution. The composite includes a special lake surface temperature analysis over the Great Lakes using contributions from the Remote Sensing Systems temperature data. The Great Lakes Environmental Research Laboratory Ice Percentage product is used to create a sea-ice mask in the SPoRT SST composite. The sea-ice mask is produced daily (in-season) at 1.8-km resolution and identifies ice percentage from 0 100% in 10% increments, with values above 90% flagged as ice.

Impact of the Pharmacy Practice Model Initiative on Clinical Pharmacy Specialist Practice.

Science.gov (United States)

Jacobi, Judith; Ray, Shaunta'; Danelich, Ilya; Dodds Ashley, Elizabeth; Eckel, Stephen; Guharoy, Roy; Militello, Michael; O'Donnell, Paul; Sam, Teena; Crist, Stephanie M; Smidt, Danielle

2016-05-01

This paper describes the goals of the American Society of Health-System Pharmacists' Pharmacy Practice Model Initiative (PPMI) and its recommendations for health-system pharmacy practice transformation to meet future patient care needs and elevate the role of pharmacists as patient care providers. PPMI envisions a future in which pharmacists have greater responsibility for medication-related outcomes and technicians assume greater responsibility for product-related activities. Although the PPMI recommendations have elevated the level of practice in many settings, they also potentially affect existing clinical pharmacists, in general, and clinical pharmacy specialists, in particular. Moreover, although more consistent patient care can be achieved with an expanded team of pharmacist providers, the role of clinical pharmacy specialists must not be diminished, especially in the care of complex patients and populations. Specialist practitioners with advanced training and credentials must be available to model and train pharmacists in generalist positions, residents, and students. Indeed, specialist practitioners are often the innovators and practice leaders. Negotiation between hospitals and pharmacy schools is needed to ensure a continuing role for academic clinical pharmacists and their contributions as educators and researchers. Lessons can be applied from disciplines such as nursing and medicine, which have developed new models of care involving effective collaboration between generalists and specialists. Several different pharmacy practice models have been described to meet the PPMI goals, based on available personnel and local goals. Studies measuring the impact of these new practice models are needed. © 2016 Pharmacotherapy Publications, Inc.

Solutions Stability of Initial Boundary Problem, Modeling of Dynamics of Some Discrete Continuum Mechanical System

Directory of Open Access Journals (Sweden)

D. A. Eliseev

2015-01-01

Full Text Available The solution stability of an initial boundary problem for a linear hybrid system of differential equations, which models the rotation of a rigid body with two elastic rods located in the same plane is studied in the paper. To an axis passing through the mass center of the rigid body perpendicularly to the rods location plane is applied the stabilizing moment proportional to the angle of the system rotation, derivative of the angle, integral of the angle. The external moment provides a feedback. A method of studying the behavior of solutions of the initial boundary problem is proposed. This method allows to exclude from the hybrid system of differential equations partial differential equations, which describe the dynamics of distributed elements of a mechanical system. It allows us to build one equation for an angle of the system rotation. Its characteristic equation defines the stability of solutions of all the system. In the space of feedback-coefficients the areas that provide the asymptotic stability of solutions of the initial boundary problem are built up.

Economic consequences of the Swiss 'Strom ohne Atom' and 'Moratorium Plus' popular initiatives - Analysis using a balanced model

International Nuclear Information System (INIS)

Mueller, A.; Wickart, M.; Van Nieuwkoop, R.

2001-01-01

This report for the Swiss Federal Office of Energy (SFOE) presents the results of a study made to assess the economic consequences of two models for the opting out of nuclear energy in Switzerland, as proposed in two popular initiatives. The 'Strom ohne Atom' (electricity without atomic power) initiative calls for the shutting down of the existing nuclear power stations and the 'Moratorium Plus' initiative calls for a stop on the building of new atomic power stations for 10 years. The method used for assessing the costs and benefits resulting if the initiatives were accepted in a public vote is described. Basic assumptions made on further factors concerning the electricity and energy markets are discussed. Results of analyses made for various scenarios with respect to CO 2 emissions are presented and include discussions on risk costs, effects on employment and welfare aspects

A new method for determination of most likely landslide initiation points and the evaluation of digital terrain model scale in terrain stability mapping

Directory of Open Access Journals (Sweden)

P. Tarolli

2006-01-01

Full Text Available This paper introduces a new approach for determining the most likely initiation points for landslides from potential instability mapped using a terrain stability model. This approach identifies the location with critical stability index from a terrain stability model on each downslope path from ridge to valley. Any measure of terrain stability may be used with this approach, which here is illustrated using results from SINMAP, and from simply taking slope as an index of potential instability. The relative density of most likely landslide initiation points within and outside mapped landslide scars provides a way to evaluate the effectiveness of a terrain stability measure, even when mapped landslide scars include run out zones, rather than just initiation locations. This relative density was used to evaluate the utility of high resolution terrain data derived from airborne laser altimetry (LIDAR for a small basin located in the Northeastern Region of Italy. Digital Terrain Models were derived from the LIDAR data for a range of grid cell sizes (from 2 to 50 m. We found appreciable differences between the density of most likely landslide initiation points within and outside mapped landslides with ratios as large as three or more with the highest ratios for a digital terrain model grid cell size of 10 m. This leads to two conclusions: (1 The relative density from a most likely landslide initiation point approach is useful for quantifying the effectiveness of a terrain stability map when mapped landslides do not or can not differentiate between initiation, runout, and depositional areas; and (2 in this study area, where landslides occurred in complexes that were sometimes more than 100 m wide, a digital terrain model scale of 10 m is optimal. Digital terrain model scales larger than 10 m result in loss of resolution that degrades the results, while for digital terrain model scales smaller than 10 m the physical processes responsible for triggering

Entrainment to periodic initiation and transition rates in a computational model for gene translation.

Directory of Open Access Journals (Sweden)

Michael Margaliot

Full Text Available Periodic oscillations play an important role in many biomedical systems. Proper functioning of biological systems that respond to periodic signals requires the ability to synchronize with the periodic excitation. For example, the sleep/wake cycle is a manifestation of an internal timing system that synchronizes to the solar day. In the terminology of systems theory, the biological system must entrain or phase-lock to the periodic excitation. Entrainment is also important in synthetic biology. For example, connecting several artificial biological systems that entrain to a common clock may lead to a well-functioning modular system. The cell-cycle is a periodic program that regulates DNA synthesis and cell division. Recent biological studies suggest that cell-cycle related genes entrain to this periodic program at the gene translation level, leading to periodically-varying protein levels of these genes. The ribosome flow model (RFM is a deterministic model obtained via a mean-field approximation of a stochastic model from statistical physics that has been used to model numerous processes including ribosome flow along the mRNA. Here we analyze the RFM under the assumption that the initiation and/or transition rates vary periodically with a common period T. We show that the ribosome distribution profile in the RFM entrains to this periodic excitation. In particular, the protein synthesis pattern converges to a unique periodic solution with period T. To the best of our knowledge, this is the first proof of entrainment in a mathematical model for translation that encapsulates aspects such as initiation and termination rates, ribosomal movement and interactions, and non-homogeneous elongation speeds along the mRNA. Our results support the conjecture that periodic oscillations in tRNA levels and other factors related to the translation process can induce periodic oscillations in protein levels, and may suggest a new approach for re-engineering genetic

Model development of SAS4A and investigation on the initiating phase consequences in LMFRs related with material motion

International Nuclear Information System (INIS)

Niwa, H.

1994-01-01

This paper focuses on an analytical aspect of the initiating phase scenario and consequences of postulated core disruptive accident in liquid-metal-cooled fast breeder reactors. An analytical code, SAS4A, has been developed at Argonne National Laboratory, and introduced to PNC. Improvement and validation effort have been performed for the mixed-oxide version of SAS4A at PNC. This paper describes firstly recent development of SAS4A's material motion related models briefly. A fission gas mass transfer model and solid fuel chunk jamming model are developed and introduced to SAS4A, and validated using CABRI-2 E13 experimental data. Secondly, an investigation of the mechanism of energetics in the initiating phase of an unprotected loss-of-flow accident has identified major control parameters which are intimately related to core design parameters and material motion phenomena. (author)

A STUDY ON LIMITATION OF GOVERNMENT INITIATIVE MODEL FOR ALTERNATIVE FUEL VEHICLE (AFV PROMOTION IN CHINA

Directory of Open Access Journals (Sweden)

Byunghun Choi

2016-04-01

Full Text Available Chinese responsibility for reducing Greenhouse Gas or carbon dioxide emission increases continuously. Chinese government suggested two targets; Alternative Fuel Vehicle output volume 500 thousand and AFV market share 5% by the end of 2011. However any of two targets did not come true. Therefore this study accessed the question, ‘why Chinese government initiative model for AFV promotion has been so poor?’ This study reviewed the transition process for AFV policies in China and made a structural analysis for three key policies since 2009. As a result the number of articles for related industries or factor endowments was relatively more than firm strategy or demand conditions. Also this study accessed the AFV strategy of Six SOEs from the perspective of social responsibility. Six SOEs have more concentrated on electric vehicle rather than hybrid vehicle with following the government leadership. However major EV or HEV models of them mostly were made by Joint Ventures being under control of foreign makers and the JVs have actually controlled over AFV business. So the limitation of Chinese government initiative model resulted from supplier-centric approach with targeting for public transportation and institution consumer, and it caused a failure to create the demand conditions of general customers.

Coupling model of aerobic waste degradation considering temperature, initial moisture content and air injection volume.

Science.gov (United States)

Ma, Jun; Liu, Lei; Ge, Sai; Xue, Qiang; Li, Jiangshan; Wan, Yong; Hui, Xinminnan

2018-03-01

A quantitative description of aerobic waste degradation is important in evaluating landfill waste stability and economic management. This research aimed to develop a coupling model to predict the degree of aerobic waste degradation. On the basis of the first-order kinetic equation and the law of conservation of mass, we first developed the coupling model of aerobic waste degradation that considered temperature, initial moisture content and air injection volume to simulate and predict the chemical oxygen demand in the leachate. Three different laboratory experiments on aerobic waste degradation were simulated to test the model applicability. Parameter sensitivity analyses were conducted to evaluate the reliability of parameters. The coupling model can simulate aerobic waste degradation, and the obtained simulation agreed with the corresponding results of the experiment. Comparison of the experiment and simulation demonstrated that the coupling model is a new approach to predict aerobic waste degradation and can be considered as the basis for selecting the economic air injection volume and appropriate management in the future.

Application of micromechanical models of ductile fracture initiation to reactor pressure vessel materials

International Nuclear Information System (INIS)

Chaouadi, R.; Walle, E. van; Fabry, A.; Velde, J. van de; Meester, P. de

1996-01-01

The aim of the current study is the application of local micromechanical models to predict crack initiation in ductile materials. Two reactor pressure vessel materials have been selected for this study: JRQ IAEA monitor base metal (A533B Cl.1) and Doel-IV weld material. Charpy impact tests have been performed in both un-irradiated and irradiated conditions. In addition to standard tensile tests, notched tensile specimens have been tested. The upper shelf energy of the weld material remains almost un-affected by irradiation, whereas a decrease of 20% is detected for the base metal. Accordingly, the tensile properties of the weld material do not reveal a clear irradiation effect on the yield and ultimate stresses, this in contrast to the base material flow properties. The tensile tests have been analyzed in terms of micromechanical models. A good correlation is found between the standard tests and the micromechanical models, that are able to predict the ductile damage evolution in these materials. Additional information on the ductility behavior of these materials is revealed by this micromechanical analysis

Initiation of CMEs by Magnetic Flux Emergence

Indian Academy of Sciences (India)

The initiation of solar Coronal Mass Ejections (CMEs) is studied in the framework of numerical magnetohydrodynamics (MHD). The initial CME model includes a magnetic flux rope in spherical, axisymmetric geometry. The initial configuration consists of a magnetic flux rope embedded in a gravitationally stratified solar ...

Comparative Transcriptome Analysis Reveals Cool Virulence Factors of Ralstonia solanacearum Race 3 Biovar 2.

Science.gov (United States)

Meng, Fanhong; Babujee, Lavanya; Jacobs, Jonathan M; Allen, Caitilyn

2015-01-01

While most strains of the plant pathogenic bacterium Ralstonia solanacearum are tropical, the race 3 biovar 2 (R3bv2) subgroup attacks plants in cooler climates. To identify mechanisms underlying this trait, we compared the transcriptional profiles of R. solanacearum R3bv2 strain UW551 and tropical strain GMI1000 at 20°C and 28°C, both in culture and during tomato pathogenesis. 4.2% of the ORFs in the UW551 genome and 7.9% of the GMI1000 ORFs were differentially expressed by temperature in planta. The two strains had distinct transcriptional responses to temperature change. GMI1000 up-regulated several stress response genes at 20°C, apparently struggling to cope with plant defenses. At the cooler temperature, R3bv2 strain UW551 up-regulated a cluster encoding a mannose-fucose binding lectin, LecM; a quorum sensing-dependent protein, AidA; and a related hypothetical protein, AidC. The last two genes are absent from the GMI1000 genome. In UW551, all three genes were positively regulated by the adjacent SolI/R quorum sensing system. These temperature-responsive genes were required for full virulence in R3bv2. Mutants lacking lecM, aidA, or aidC were each significantly more reduced in virulence on tomato at 20°C than at 28°C in both a naturalistic soil soak inoculation assay and when they were inoculated directly into tomato stems. The lecM and aidC mutants also survived poorly in potato tubers at the seed tuber storage temperature of 4°C, and the lecM mutant was defective in biofilm formation in vitro. Together, these results suggest novel mechanisms, including a lectin, are involved in the unique temperate epidemiology of R3bv2.

Comparative Transcriptome Analysis Reveals Cool Virulence Factors of Ralstonia solanacearum Race 3 Biovar 2.

Directory of Open Access Journals (Sweden)

Fanhong Meng

Full Text Available While most strains of the plant pathogenic bacterium Ralstonia solanacearum are tropical, the race 3 biovar 2 (R3bv2 subgroup attacks plants in cooler climates. To identify mechanisms underlying this trait, we compared the transcriptional profiles of R. solanacearum R3bv2 strain UW551 and tropical strain GMI1000 at 20°C and 28°C, both in culture and during tomato pathogenesis. 4.2% of the ORFs in the UW551 genome and 7.9% of the GMI1000 ORFs were differentially expressed by temperature in planta. The two strains had distinct transcriptional responses to temperature change. GMI1000 up-regulated several stress response genes at 20°C, apparently struggling to cope with plant defenses. At the cooler temperature, R3bv2 strain UW551 up-regulated a cluster encoding a mannose-fucose binding lectin, LecM; a quorum sensing-dependent protein, AidA; and a related hypothetical protein, AidC. The last two genes are absent from the GMI1000 genome. In UW551, all three genes were positively regulated by the adjacent SolI/R quorum sensing system. These temperature-responsive genes were required for full virulence in R3bv2. Mutants lacking lecM, aidA, or aidC were each significantly more reduced in virulence on tomato at 20°C than at 28°C in both a naturalistic soil soak inoculation assay and when they were inoculated directly into tomato stems. The lecM and aidC mutants also survived poorly in potato tubers at the seed tuber storage temperature of 4°C, and the lecM mutant was defective in biofilm formation in vitro. Together, these results suggest novel mechanisms, including a lectin, are involved in the unique temperate epidemiology of R3bv2.

Instrumental record of debris flow initiation during natural rainfall: Implications for modeling slope stability

Science.gov (United States)

Montgomery, D.R.; Schmidt, K.M.; Dietrich, W.E.; McKean, J.

2009-01-01

The middle of a hillslope hollow in the Oregon Coast Range failed and mobilized as a debris flow during heavy rainfall in November 1996. Automated pressure transducers recorded high spatial variability of pore water pressure within the area that mobilized as a debris flow, which initiated where local upward flow from bedrock developed into overlying colluvium. Postfailure observations of the bedrock surface exposed in the debris flow scar reveal a strong spatial correspondence between elevated piezometric response and water discharging from bedrock fractures. Measurements of apparent root cohesion on the basal (Cb) and lateral (Cl) scarp demonstrate substantial local variability, with areally weighted values of Cb = 0.1 and Cl = 4.6 kPa. Using measured soil properties and basal root strength, the widely used infinite slope model, employed assuming slope parallel groundwater flow, provides a poor prediction of hydrologie conditions at failure. In contrast, a model including lateral root strength (but neglecting lateral frictional strength) gave a predicted critical value of relative soil saturation that fell within the range defined by the arithmetic and geometric mean values at the time of failure. The 3-D slope stability model CLARA-W, used with locally observed pore water pressure, predicted small areas with lower factors of safety within the overall slide mass at sites consistent with field observations of where the failure initiated. This highly variable and localized nature of small areas of high pore pressure that can trigger slope failure means, however, that substantial uncertainty appears inevitable for estimating hydrologie conditions within incipient debris flows under natural conditions. Copyright 2009 by the American Geophysical Union.

Initial conditions for chaotic inflation

International Nuclear Information System (INIS)

Brandenberger, R.; Kung, J.; Feldman, H.

1991-01-01

In contrast to many other inflationary Universe models, chaotic inflation does not depend on fine tuning initial conditions. Within the context of linear perturbation theory, it is shown that chaotic inflation is stable towards both metric and matter perturbations. Neglecting gravitational perturbations, it is shown that chaotic inflation is an attractor in initial condition space. (orig.)

Motivation and Training Initiation: Evidence from Poland

Science.gov (United States)

Mielniczuk, Emilia; Laguna, Mariola

2017-01-01

Purpose: Based on the self-determination theory and the model of action phases, the present study aims to provide insight into motivational factors that are important for training initiation. It investigates the relations between three types of motivation (intrinsic, extrinsic and amotivation) and training initiation: intention to initiate new…

Large-scale tropospheric transport in the Chemistry-Climate Model Initiative (CCMI) simulations

Science.gov (United States)

Orbe, Clara; Yang, Huang; Waugh, Darryn W.; Zeng, Guang; Morgenstern, Olaf; Kinnison, Douglas E.; Lamarque, Jean-Francois; Tilmes, Simone; Plummer, David A.; Scinocca, John F.; Josse, Beatrice; Marecal, Virginie; Jöckel, Patrick; Oman, Luke D.; Strahan, Susan E.; Deushi, Makoto; Tanaka, Taichu Y.; Yoshida, Kohei; Akiyoshi, Hideharu; Yamashita, Yousuke; Stenke, Andreas; Revell, Laura; Sukhodolov, Timofei; Rozanov, Eugene; Pitari, Giovanni; Visioni, Daniele; Stone, Kane A.; Schofield, Robyn; Banerjee, Antara

2018-05-01

Understanding and modeling the large-scale transport of trace gases and aerosols is important for interpreting past (and projecting future) changes in atmospheric composition. Here we show that there are large differences in the global-scale atmospheric transport properties among the models participating in the IGAC SPARC Chemistry-Climate Model Initiative (CCMI). Specifically, we find up to 40 % differences in the transport timescales connecting the Northern Hemisphere (NH) midlatitude surface to the Arctic and to Southern Hemisphere high latitudes, where the mean age ranges between 1.7 and 2.6 years. We show that these differences are related to large differences in vertical transport among the simulations, in particular to differences in parameterized convection over the oceans. While stronger convection over NH midlatitudes is associated with slower transport to the Arctic, stronger convection in the tropics and subtropics is associated with faster interhemispheric transport. We also show that the differences among simulations constrained with fields derived from the same reanalysis products are as large as (and in some cases larger than) the differences among free-running simulations, most likely due to larger differences in parameterized convection. Our results indicate that care must be taken when using simulations constrained with analyzed winds to interpret the influence of meteorology on tropospheric composition.

Large-scale tropospheric transport in the Chemistry–Climate Model Initiative (CCMI simulations

Directory of Open Access Journals (Sweden)

C. Orbe

2018-05-01

Full Text Available Understanding and modeling the large-scale transport of trace gases and aerosols is important for interpreting past (and projecting future changes in atmospheric composition. Here we show that there are large differences in the global-scale atmospheric transport properties among the models participating in the IGAC SPARC Chemistry–Climate Model Initiative (CCMI. Specifically, we find up to 40 % differences in the transport timescales connecting the Northern Hemisphere (NH midlatitude surface to the Arctic and to Southern Hemisphere high latitudes, where the mean age ranges between 1.7 and 2.6 years. We show that these differences are related to large differences in vertical transport among the simulations, in particular to differences in parameterized convection over the oceans. While stronger convection over NH midlatitudes is associated with slower transport to the Arctic, stronger convection in the tropics and subtropics is associated with faster interhemispheric transport. We also show that the differences among simulations constrained with fields derived from the same reanalysis products are as large as (and in some cases larger than the differences among free-running simulations, most likely due to larger differences in parameterized convection. Our results indicate that care must be taken when using simulations constrained with analyzed winds to interpret the influence of meteorology on tropospheric composition.

Augmenting Probabilistic Risk Assesment with Malevolent Initiators

International Nuclear Information System (INIS)

Smith, Curtis; Schwieder, David

2011-01-01

As commonly practiced, the use of probabilistic risk assessment (PRA) in nuclear power plants only considers accident initiators such as natural hazards, equipment failures, and human error. Malevolent initiators are ignored in PRA, but are considered the domain of physical security, which uses vulnerability assessment based on an officially specified threat (design basis threat). This paper explores the implications of augmenting and extending existing PRA models by considering new and modified scenarios resulting from malevolent initiators. Teaming the augmented PRA models with conventional vulnerability assessments can cost-effectively enhance security of a nuclear power plant. This methodology is useful for operating plants, as well as in the design of new plants. For the methodology, we have proposed an approach that builds on and extends the practice of PRA for nuclear power plants for security-related issues. Rather than only considering 'random' failures, we demonstrated a framework that is able to represent and model malevolent initiating events and associated plant impacts.

How space design and technology can support the Pharmacy Practice Model Initiative through interprofessional collaboration

Directory of Open Access Journals (Sweden)

Lindsay Hahn

2014-01-01

Full Text Available Purpose: The Pharmacy Practice Model Initiative (PPMI calls pharmacists to more direct patient care and increased responsibility for medication-related outcomes, as a means of achieving greater safety, improving outcomes and reducing costs. This article acknowledges the value of interprofessional collaboration to the PPMI and identifies the implications of the Initiative for space design and technology, both of which stand to help the Initiative gather additional support. Summary: The profession of pharmacy has for some time now become increasingly vocal about its desire to take on greater responsibility for patient outcomes. With drug costs representing the largest portion of a hospital's pharmacy budget and reimbursements becoming more contingent on readmission avoidance, the pharmacy's influence on a hospital's bottom line is significant. More importantly, study after study is showing that with greater pharmacist intervention, patient outcomes improve. This article addresses the ways in which developments in the fields of technology and facility design can assist in the deployment of the PPMI. Conclusion: As the PPMI achieves a critical level of support from inside and outside the pharmacy, and more empirical research emerges regarding the improved outcomes and cost savings of increasing the roles of both clinical pharmacists and pharmacy technicians, the industry sectors of healthcare technology and healthcare design stand ready to assist in the execution of this new model. By encouraging pharmacists, doctors and nurses to work together - and all caregivers to work with facility designers, biomedical engineers and IT specialists, there is the increased likelihood of these fields turning to each other to problem-solve together, all for the ultimate benefit to patients and their families.   Type: Commentary

Revision of Fontes & Garnier's model for the initial 14C content of dissolved inorganic carbon used in groundwater dating

Science.gov (United States)

Han, Liang-Feng; Plummer, Niel

2013-01-01

The widely applied model for groundwater dating using 14C proposed by Fontes and Garnier (F&G) (Fontes and Garnier, 1979) estimates the initial 14C content in waters from carbonate-rock aquifers affected by isotopic exchange. Usually, the model of F&G is applied in one of two ways: (1) using a single 13C fractionation factor of gaseous CO2 with respect to a solid carbonate mineral, εg/s, regardless of whether the carbon isotopic exchange is controlled by soil CO2 in the unsaturated zone, or by solid carbonate mineral in the saturated zone; or (2) using different fractionation factors if the exchange process is dominated by soil CO2 gas as opposed to solid carbonate mineral (typically calcite). An analysis of the F&G model shows an inadequate conceptualization, resulting in underestimation of the initial 14C values (14C0) for groundwater systems that have undergone isotopic exchange. The degree to which the 14C0 is underestimated increases with the extent of isotopic exchange. Examples show that in extreme cases, the error in calculated adjusted initial 14C values can be more than 20% modern carbon (pmc). A model is derived that revises the mass balance method of F&G by using a modified model conceptualization. The derivation yields a “global” model both for carbon isotopic exchange dominated by gaseous CO2 in the unsaturated zone, and for carbon isotopic exchange dominated by solid carbonate mineral in the saturated zone. However, the revised model requires different parameters for exchange dominated by gaseous CO2 as opposed to exchange dominated by solid carbonate minerals. The revised model for exchange dominated by gaseous CO2 is shown to be identical to the model of Mook (Mook, 1976). For groundwater systems where exchange occurs both in the unsaturated zone and saturated zone, the revised model can still be used; however, 14C0 will be slightly underestimated. Finally, in carbonate systems undergoing complex geochemical reactions, such as oxidation of

Unravelling the influence of smoking initiation and cessation on premature mortality using a common latent factor model

OpenAIRE

Silvia Balia; Andrew M. Jones

2007-01-01

Duration models for lifespan and smoking, that focus on the socio-economic gradient in smoking durations and length of life, are estimated controlling for individual-specific unobservable heterogeneity by means of a latent factor model. The latent factor influences the risk of starting and quitting smoking as well as the hazard of mortality. Frailty could in°uence smoking behaviour through two mechanisms: the effect of life expectancy on initiation of smok- ing and the impact of adverse healt...

The Dynamics of Initiative in Communication Networks.

Directory of Open Access Journals (Sweden)

Anders Mollgaard

Full Text Available Human social interaction is often intermittent. Two acquainted persons can have extended periods without social interaction punctuated by periods of repeated interaction. In this case, the repeated interaction can be characterized by a seed initiative by either of the persons and a number of follow-up interactions. The tendency to initiate social interaction plays an important role in the formation of social networks and is in general not symmetric between persons. In this paper, we study the dynamics of initiative by analysing and modeling a detailed call and text message network sampled from a group of 700 individuals. We show that in an average relationship between two individuals, one part is almost twice as likely to initiate communication compared to the other part. The asymmetry has social consequences and ultimately might lead to the discontinuation of a relationship. We explain the observed asymmetry by a positive feedback mechanism where individuals already taking initiative are more likely to take initiative in the future. In general, people with many initiatives receive attention from a broader spectrum of friends than people with few initiatives. Lastly, we compare the likelihood of taking initiative with the basic personality traits of the five factor model.

Should tsunami simulations include a nonzero initial horizontal velocity?

Science.gov (United States)

Lotto, Gabriel C.; Nava, Gabriel; Dunham, Eric M.

2017-08-01

Tsunami propagation in the open ocean is most commonly modeled by solving the shallow water wave equations. These equations require initial conditions on sea surface height and depth-averaged horizontal particle velocity or, equivalently, horizontal momentum. While most modelers assume that initial velocity is zero, Y.T. Song and collaborators have argued for nonzero initial velocity, claiming that horizontal displacement of a sloping seafloor imparts significant horizontal momentum to the ocean. They show examples in which this effect increases the resulting tsunami height by a factor of two or more relative to models in which initial velocity is zero. We test this claim with a "full-physics" integrated dynamic rupture and tsunami model that couples the elastic response of the Earth to the linearized acoustic-gravitational response of a compressible ocean with gravity; the model self-consistently accounts for seismic waves in the solid Earth, acoustic waves in the ocean, and tsunamis (with dispersion at short wavelengths). Full-physics simulations of subduction zone megathrust ruptures and tsunamis in geometries with a sloping seafloor confirm that substantial horizontal momentum is imparted to the ocean. However, almost all of that initial momentum is carried away by ocean acoustic waves, with negligible momentum imparted to the tsunami. We also compare tsunami propagation in each simulation to that predicted by an equivalent shallow water wave simulation with varying assumptions regarding initial velocity. We find that the initial horizontal velocity conditions proposed by Song and collaborators consistently overestimate the tsunami amplitude and predict an inconsistent wave profile. Finally, we determine tsunami initial conditions that are rigorously consistent with our full-physics simulations by isolating the tsunami waves from ocean acoustic and seismic waves at some final time, and backpropagating the tsunami waves to their initial state by solving the

Deduction of initial strategy distributions of agents in mix-game models

Science.gov (United States)

Gou, Chengling

2006-11-01

This paper reports the effort of deducing the initial strategy distributions (ISDs) of agents in mix-game models that is used to predict a real financial time series generated from a target financial market. Using mix-games to predict Shanghai Index, we find that the time series of prediction accurate rates is sensitive to the ISDs of agents in group 2 who play a minority game, but less sensitive to the ISDs of agents in group 1 who play a majority game. And agents in group 2 tend to cluster in full strategy space (FSS) if the real financial time series has obvious tendency (upward or downward), otherwise they tend to scatter in FSS. We also find that the ISDs and the number of agents in group 1 influence the level of prediction accurate rates. Finally, this paper gives suggestion about further research.

Economic consequences of the Swiss 'Strom ohne Atom' and 'Moratorium Plus' popular initiatives - Analysis using a balanced model

International Nuclear Information System (INIS)

Mueller, A.; Wickart, M.; Van Nieuwkoop, R.

2001-01-01

This article is a short version of the ENET number 210359. This report for the Swiss Federal Office of Energy (SFOE) presents the results of a study made to assess the economic consequences of two models for the opting out of nuclear energy in Switzerland, as proposed in two popular initiatives. The 'Strom ohne Atom' (electricity without atomic power) initiative calls for the shutting down of the existing nuclear power stations and the 'Moratorium Plus' initiative calls for a stop on the building of new atomic power stations for 10 years. The method used for assessing the costs and benefits resulting if the initiatives were accepted in a public vote is described. Basic assumptions made on further factors concerning the electricity and energy markets are discussed. Results of analyses made for various scenarios with respect to CO 2 emissions are presented and include discussions on risk costs, effects on employment and welfare aspects

Economic consequences of the Swiss 'Sortir du nucleaire' and 'Moratoire-plus' popular initiatives - Analysis using a balanced model

International Nuclear Information System (INIS)

Mueller, A.; Wickart, M.; Van Nieuwkoop, R.

2001-01-01

This article is a short version of the ENET number 210359. This report for the Swiss Federal Office of Energy (SFOE) presents the results of a study made to assess the economic consequences of two models for the opting out of nuclear energy in Switzerland, as proposed in two popular initiatives. The 'Sortir du nucleaire' (electricity without atomic power) initiative calls for the shutting down of the existing nuclear power stations and the 'Moratoire-plus' initiative calls for a stop on the building of new atomic power stations for 10 years. The method used for assessing the costs and benefits resulting if the initiatives were accepted in a public vote is described. Basic assumptions made on further factors concerning the electricity and energy markets are discussed. Results of analyses made for various scenarios with respect to CO 2 emissions are presented and include discussions on risk costs, effects on employment and welfare aspects

Modeling time to recovery and initiating event frequency for loss of off-site power incidents at nuclear power plants

International Nuclear Information System (INIS)

Iman, R.L.; Hora, S.C.

1988-01-01

Industry data representing the time to recovery of loss of off-site power at nuclear power plants for 63 incidents caused by plant-centered losses, grid losses, or severe weather losses are fit with exponential, lognormal, gamma and Weibull probability models. A Bayesian analysis is used to compare the adequacy of each of these models and to provide uncertainty bounds on each of the fitted models. A composite model that combines the probability models fitted to each of the three sources of data is presented as a method for predicting the time to recovery of loss of off-site power. The composite model is very general and can be made site specific by making adjustments on the models used, such as might occur due to the type of switchyard configuration or type of grid, and by adjusting the weights on the individual models, such as might occur with weather conditions existing at a particular plant. Adjustments in the composite model are shown for different models used for switchyard configuration and for different weights due to weather. Bayesian approaches are also presented for modeling the frequency of initiating events leading to loss of off-site power. One Bayesian model assumes that all plants share a common incidence rate for loss of off-site power, while the other Bayesian approach models the incidence rate for each plant relative to the incidence rates of all other plants. Combining the Bayesian models for the frequency of the initiating events with the composite Bayesian model for recovery provides the necessary vehicle for a complete model that incorporates uncertainty into a probabilistic risk assessment

Porting Initiation and Failure into Linked CHEETAH

Science.gov (United States)

Souers, Clark; Vitello, Peter

2007-06-01

Linked CHEETAH is a thermo-chemical code coupled to a 2-D hydrocode. Initially, a quadratic-pressure dependent kinetic rate was used, which worked well in modeling prompt detonation of explosives of large size, but does not work on other aspects of explosive behavior. The variable-pressure Tarantula reactive flow rate model was developed with JWL++ in order to also describe failure and initiation, and we have moved this model into Linked CHEETAH. The model works by turning on only above a pressure threshold, where a slow turn-on creates initiation. At a higher pressure, the rate suddenly leaps to a large value over a small pressure range. A slowly failing cylinder will see a rapidly declining rate, which pushes it quickly into failure. At a high pressure, the detonation rate is constant. A sequential validation procedure is used, which includes metal-confined cylinders, rate-sticks, corner-turning, initiation and threshold, gap tests and air gaps. The size (diameter) effect is central to the calibration. This work was performed under the auspices of the U.S. Department of Energy by the University of California Lawrence Livermore National Laboratory under contract No. W-7405-Eng-48.

About the RAS Initiative

Science.gov (United States)

The RAS Initiative, a "hub and spoke" model, connects researchers to better understand and target the more than 30% of cancers driven by mutations in RAS genes. Includes oversight and contact information.

A model to determine the initial phase space of a clinical electron beam from measured beam data.

NARCIS (Netherlands)

Janssen, J.J.M.; Korevaar, E.W.; Battum, L.J. van; Storchi, P.R.; Huizenga, H.

2001-01-01

Advanced electron beam dose calculation models for radiation oncology require as input an initial phase space (IPS) that describes a clinical electron beam. The IPS is a distribution in position, energy and direction of electrons and photons in a plane in front of the patient. A method is presented

A Survey: Time Travel in Deep Learning Space: An Introduction to Deep Learning Models and How Deep Learning Models Evolved from the Initial Ideas

OpenAIRE

Wang, Haohan; Raj, Bhiksha

2015-01-01

This report will show the history of deep learning evolves. It will trace back as far as the initial belief of connectionism modelling of brain, and come back to look at its early stage realization: neural networks. With the background of neural network, we will gradually introduce how convolutional neural network, as a representative of deep discriminative models, is developed from neural networks, together with many practical techniques that can help in optimization of neural networks. On t...

Magnetoimpedance effect of the Ni80Fe20/Cu composite wires: The influence of DC current imposed on the Cu base

Directory of Open Access Journals (Sweden)

Delu Chen

2014-06-01

Full Text Available In this paper, the copper composite wires of 75 μm in diameter with a sputtered layer of Ni80Fe20 permalloy were prepared, with a DC current applied to the basal Cu terminals during the fabrication process. The influence of the DC current on the magnetic configuration and Magneto-Impedance (MI effect was studied. The results indicate that both the current amplitude and actuation duration have significant effect on the magnetic properties of the Ni80Fe20 layer. With appropriate current applied, the induced magnetic field leads to a circumferential magnetic domain structure and reduces significantly the equivalent anisotropy field of Ni80Fe20 layer. Then, the GMI ratio of the composite wires was significantly increased. A maximum GMI of 194.8% can be reached when the current was fixed at 100 mA and the Ni80Fe20 thickness is 780 nm. If the Ni80Fe20 thickness is above 780 nm, the coercivity of the coating layer increases while the GMI ratio of the composite wire reduces, since the magnetic anisotropy of the Ni80Fe20 layer varies from circumferential to longitudinal. The results were explained combining the thermal and magnetic effects of current.

Ultrasensitive detection and quantification of E. coli O157:H7 using a giant magneto impedance sensor in an open-surface micro fluidic cavity covered with an antibody-modified gold surface

International Nuclear Information System (INIS)

Yang, Zhen; Liu, Yan; Lei, Chong; Sun, Xue-cheng; Zhou, Yong

2016-01-01

We report on a method for ultrasensitive detection and quantification of the pathogen Escherichia coli (E. coli), type O157:H7. It is using a tortuous-shaped giant magneto impedance (GMI) sensor in combination with an open-surface micro fluidic system coated with a gold film for performing the sandwich immuno binding on its surface. Streptavidin-coated super magnetic Dynabeads were loaded with biotinylated polyclonal antibody to capture E. coli O157:H7. The E. coli-loaded Dynabeads are then injected into the microfluidics system where it comes into contact with the surface of gold nanofilm carrying the monoclonal antibody to form the immuno complex. As a result, the GMI ratio is strongly reduced at high frequencies if E. coli O157:H7 is present. The sensor has a linear response in the 50 to 500 cfu·mL"−"1 concentration range, and the detection limit is 50 cfu·mL"−"1 at a working frequency of 2.2 MHz. In our perception, this method provides a valuable tool for developing GMI-based micro fluidic sensors systems for ultrasensitive and quantitative analysis of pathogenic bacteria. The method may also be extended to other sensing applications by employing respective immuno reagents. (author)

School staff, parent and student perceptions of a Breakfast in the Classroom model during initial implementation.

Science.gov (United States)

Folta, Sara C; Carmichael Djang, Holly; Halmo, Megan; Metayer, Nesly; Blondin, Stacy A; Smith, Kathleen S; Economos, Christina D

2016-06-01

To understand perspectives of stakeholders during initial district-wide implementation of a Breakfast in the Classroom (BIC) model of the School Breakfast Program. Qualitative data were collected from twenty-nine focus groups and twenty interviews with stakeholders in a school district early in the process of implementing a BIC model of the School Breakfast Program. Ten elementary schools within a large, urban school district in the USA that served predominantly low-income, racial/ethnic minority students. Purposively selected stakeholders in elementary schools that had implemented BIC for 3-6 months: students (n 85), parents/guardians (n 86), classroom teachers (n 44), cafeteria managers (n 10) and principals (n 10). Four primary themes emerged, which were interpreted based on the Diffusion of Innovations model. School staff had changed their perceptions of both the relative disadvantages and costs related to time and effort of BIC over time; the majority of each stakeholder group expressed an appreciation for BIC; student breakfast consumption varied from day to day, related to compatibility of foods with child preferences; and stakeholders held mixed and various impressions of BIC's potential impacts. The study underscores the importance of engaging school staff and parents in discussions of BIC programming prior to its initiation to pre-emptively address concerns related to cost, relative disadvantages and compatibility with child preferences and school routines/workflow. Effectively communicating with stakeholders about positive impacts and nutritional value of the meals may improve support for BIC. These findings provide new information to policy makers, districts and practitioners that can be used to improve implementation efforts, model delivery and outcomes.

Modeling the initiation of Primary Water Stress Corrosion Cracking in nickel base alloys 182 and 82 of Pressurized Water Reactors

International Nuclear Information System (INIS)

Wehbi, Mickael

2014-01-01

Nickel base welds are widely used to assemble components of the primary circuit of Pressurized Water Reactors (PWR) plants. International experience shows an increasing number of Stress Corrosion Cracks (SCC) in nickel base welds 182 and 82 which motivates the development of models predicting the time to SCC initiation for these materials. SCC involves several parameters such as materials, mechanics or environment interacting together. The goal of this study is to have a better understanding of the physical mechanisms occurring at grains boundaries involved in SCC. In-situ tensile test carried out on oxidized alloy 182 evidenced dispersion in the susceptibility to corrosion of grain boundaries. Moreover, the correlation between oxidation and cracking coupled with micro-mechanical simulations on synthetic polycrystalline aggregate, allowed to propose a cracking criterion of oxidized grain boundaries which is defined by both critical oxidation depth and local stress level. Due to the key role of intergranular oxidation in SCC and since significant dispersion is observed between grain boundaries, oxidation tests were performed on alloys 182 and 82 in order to model the intergranular oxidation kinetics as a function of chromium carbides precipitation, temperature and dissolved hydrogen content. The model allows statistical analyses and is embedded in a local initiation model. In this model, SCC initiation is defined by the cracking of the intergranular oxide and is followed by slow and fast crack growth until the crack depth reaches a given value. Simplifying assumptions were necessary to identify laws used in the SCC model. However, these laws will be useful to determine experimental conditions of future investigations carried out to improve the calibration used parameters. (author)

Effect of the Initial Vortex Size on Intensity Change in the WRF-ROMS Coupled Model

Science.gov (United States)

Zhao, Xiaohui; Chan, Johnny C. L.

2017-12-01

Numerous studies have demonstrated that the tropical cyclone (TC) induced sea surface temperature (SST) cooling strongly depends on the preexisting oceanic condition and TC characteristics. However, very few focused on the correlation of SST cooling and the subsequent intensity with TC size. Therefore, a series of idealized numerical experiments are conducted using the Weather Research Forecasting (WRF) model coupled with the Regional Ocean Model System (ROMS) model to understand how the vortex size is related to SST cooling and subsequent intensity changes of a stationary TC-like vortex. In the uncoupled experiments, the radius of maximum wind (RMW) and size (radius of gale-force wind (R17)) both depend on the initial size within the 72 h simulation. The initially small vortex is smaller than the medium and large vortices throughout its life cycle and is the weakest. In other words, thermodynamic processes do not contribute as much to the R17 change as the dynamic processes proposed (e.g., angular momentum transport) in previous studies. In the coupled experiments, the area-averaged SST cooling induced by medium and large TCs within the inner-core region is comparable due to the similar surface winds and thus mixing in the ocean. Although a stronger SST cooling averaged within a larger region outside the inner-core is induced by the larger TC, the intensity of the larger TC is more intense. This is because that the enthalpy flux in the inner-core region is higher in the larger TC than that in the medium and small TCs.

ORF Alignment: NC_003295 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available ... solanacearum GMI1000] ... Length = 136 ... Query: 11 ... LRSKGCLYEVIRHPHTHTSTETAQSAHVPGDRLAKTLLL...EDKYGYVAAVLPSTYHLHLSE 70 ... LRSKGCLYEVIRHPHTHTSTETAQSAHVPGDRLAKTLLLEDKYGY...VAAVLPSTYHLHLSE Sbjct: 1 ... LRSKGCLYEVIRHPHTHTSTETAQSAHVPGDRLAKTLLLEDKYGYVAAVLPSTYHLHLSE 60 ... Query: 131 ENLVHMDMDQFMALMR 146 ... ENLVHMDMDQFMALMR Sbjct: 121 ENLVHMDMDQFMALMR 136

On the appropriate definition of soil profile configuration and initial conditions for land surface-hydrology models in cold regions

Science.gov (United States)

Sapriza-Azuri, Gonzalo; Gamazo, Pablo; Razavi, Saman; Wheater, Howard S.

2018-06-01

Arctic and subarctic regions are amongst the most susceptible regions on Earth to global warming and climate change. Understanding and predicting the impact of climate change in these regions require a proper process representation of the interactions between climate, carbon cycle, and hydrology in Earth system models. This study focuses on land surface models (LSMs) that represent the lower boundary condition of general circulation models (GCMs) and regional climate models (RCMs), which simulate climate change evolution at the global and regional scales, respectively. LSMs typically utilize a standard soil configuration with a depth of no more than 4 m, whereas for cold, permafrost regions, field experiments show that attention to deep soil profiles is needed to understand and close the water and energy balances, which are tightly coupled through the phase change. To address this gap, we design and run a series of model experiments with a one-dimensional LSM, called CLASS (Canadian Land Surface Scheme), as embedded in the MESH (Modélisation Environmentale Communautaire - Surface and Hydrology) modelling system, to (1) characterize the effect of soil profile depth under different climate conditions and in the presence of parameter uncertainty; (2) assess the effect of including or excluding the geothermal flux in the LSM at the bottom of the soil column; and (3) develop a methodology for temperature profile initialization in permafrost regions, where the system has an extended memory, by the use of paleo-records and bootstrapping. Our study area is in Norman Wells, Northwest Territories of Canada, where measurements of soil temperature profiles and historical reconstructed climate data are available. Our results demonstrate a dominant role for parameter uncertainty, that is often neglected in LSMs. Considering such high sensitivity to parameter values and dependency on the climate condition, we show that a minimum depth of 20 m is essential to adequately represent

Initiation devices, initiation systems including initiation devices and related methods

Energy Technology Data Exchange (ETDEWEB)

Daniels, Michael A.; Condit, Reston A.; Rasmussen, Nikki; Wallace, Ronald S.

2018-04-10

Initiation devices may include at least one substrate, an initiation element positioned on a first side of the at least one substrate, and a spark gap electrically coupled to the initiation element and positioned on a second side of the at least one substrate. Initiation devices may include a plurality of substrates where at least one substrate of the plurality of substrates is electrically connected to at least one adjacent substrate of the plurality of substrates with at least one via extending through the at least one substrate. Initiation systems may include such initiation devices. Methods of igniting energetic materials include passing a current through a spark gap formed on at least one substrate of the initiation device, passing the current through at least one via formed through the at least one substrate, and passing the current through an explosive bridge wire of the initiation device.

Core Mediator structure at 3.4 Å extends model of transcription initiation complex.

Science.gov (United States)

Nozawa, Kayo; Schneider, Thomas R; Cramer, Patrick

2017-05-11

Mediator is a multiprotein co-activator that binds the transcription pre-initiation complex (PIC) and regulates RNA polymerase (Pol) II. The Mediator head and middle modules form the essential core Mediator (cMed), whereas the tail and kinase modules play regulatory roles. The architecture of Mediator and its position on the PIC are known, but atomic details are limited to Mediator subcomplexes. Here we report the crystal structure of the 15-subunit cMed from Schizosaccharomyces pombe at 3.4 Å resolution. The structure shows an unaltered head module, and reveals the intricate middle module, which we show is globally required for transcription. Sites of known Mediator mutations cluster at the interface between the head and middle modules, and in terminal regions of the head subunits Med6 (ref. 16) and Med17 (ref. 17) that tether the middle module. The structure led to a model for Saccharomyces cerevisiae cMed that could be combined with the 3.6 Å cryo-electron microscopy structure of the core PIC (cPIC). The resulting atomic model of the cPIC-cMed complex informs on interactions of the submodules forming the middle module, called beam, knob, plank, connector, and hook. The hook is flexibly linked to Mediator by a conserved hinge and contacts the transcription initiation factor IIH (TFIIH) kinase that phosphorylates the carboxy (C)-terminal domain (CTD) of Pol II and was recently positioned on the PIC. The hook also contains residues that crosslink to the CTD and reside in a previously described cradle. These results provide a framework for understanding Mediator function, including its role in stimulating CTD phosphorylation by TFIIH.

Impact of high resolution land surface initialization in Indian summer ...

Indian Academy of Sciences (India)

The direct impact of high resolution land surface initialization on the forecast bias in a regional climate model in recent years ... surface initialization using a regional climate model. ...... ization of the snow field in a cloud model; J. Clim. Appl.

Escalation scenarios initiated by gas explosions on offshore installations. Probabilistic cause and consequence modelling

Energy Technology Data Exchange (ETDEWEB)

Eknes, Monika Loeland

1996-12-31

This Dr. ing. thesis deals with escalation scenarios initiated by gas explosions on offshore installations. Gas explosions is one of the major hazards to such installations. The objectives were to estimate the probability of ignition and frequency of gas explosions for gas leaks on top sides of offshore installations, and to estimate the response and resistance of components that could result in escalation if they failed. Main fields considered cover risk analysis methodology, gas explosions, simplified escalation models, evaluation of structural consequences, case studies, and guidelines. 107 refs., 33 figs., 33 tabs.

Initial kinetics of the direct sulfation of limestone

DEFF Research Database (Denmark)

Hu, Guilin; Shang, Lei; Dam-Johansen, Kim

2008-01-01

The initial kinetics of direct sulfation of Faxe Bryozo, a porous bryozoan limestone was studied in the temperature interval from 873 to 973 K in a pilot entrained flow reactor with very short reaction times (between 0.1 and 0.6 s). The initial conversion rate of the limestone - for conversions...... less than 0.3% - was observed to be significantly promoted by higher SO2 concentrations and lower CO2 concentrations, whereas 02 showed negligible influence. A mathematical model for the sulfation of limestone involving chemical reaction at calcite grain surfaces and solid-state diffusion of carbonate...... ions in calcite grains is established. The validity of the model is limited to the initial sulfation period, in which nucleation of the solid product calcium sulphate is not started. This theoretical reaction-diffusion model gives a good simulation of the initial kinetics of the direct sulfation...

ProvenCare: Geisinger's Model for Care Transformation through Innovative Clinical Initiatives and Value Creation.

Science.gov (United States)

2009-04-01

Geisinger's system of care can be seen as a microcosm of the national delivery of healthcare, with implications for decision makers in other health plans. In this interview, Dr Ronald A. Paulus focuses on Geisinger's unique approach to patient care. In its core, this approach represents a system of quality and value initiatives based on 3 major programs-Proven Health Navigation (medical home); the ProvenCare model; and transitions of care. The goal of such an approach is to optimize disease management by using a rational reimbursement paradigm for appropriate interventions, providing innovative incentives, and engaging patients in their own care as part of any intervention. Dr Paulus explains the reasons why, unlike Geisinger, other stakeholders, including payers, providers, patients, and employers, have no intrinsic reasons to be concerned with quality and value initiatives. In addition, he says, an electronic infrastructure that could be modified as management paradigms evolve is a necessary tool to ensure the healthcare delivery system's ability to adapt to new clinical realities quickly to ensure the continuation of delivering best value for all stakeholders.

Initial state with shear in peripheral heavy ion collisions

Science.gov (United States)

Magas, V. K.; Gordillo, J.; Strottman, D.; Xie, Y. L.; Csernai, L. P.

2018-06-01

In the present work we propose a new way of constructing the initial state for further hydrodynamic simulation of relativistic heavy ion collisions based on Bjorken-like solution applied streak by streak in the transverse plane. Previous fluid dynamical calculations in Cartesian coordinates with an initial state based on a streak by streak Yang-Mills field led for peripheral higher energy collisions to large angular momentum, initial shear flow and significant local vorticity. Recent experiments verified the existence of this vorticity via the resulting polarization of emitted Λ and Λ ¯ particles. At the same time parton cascade models indicated the existence of more compact initial state configurations, which we are going to simulate in our approach. The proposed model satisfies all the conservation laws, including conservation of a strong initial angular momentum, which is present in noncentral collisions. As a consequence of this large initial angular momentum we observe the rotation of the whole system as well as the fluid shear in the initial state, which leads to large flow vorticity. Another advantage of the proposed model is that the initial state can be given in both [t,x,y,z] and [τ ,x ,y ,η ] coordinates and thus can be tested by all 3+1D hydrodynamical codes which exist in the field.

Modeling of the chemistry in oxidation flow reactors with high initial NO

Science.gov (United States)

Peng, Zhe; Jimenez, Jose L.

2017-10-01

Oxidation flow reactors (OFRs) are increasingly employed in atmospheric chemistry research because of their high efficiency of OH radical production from low-pressure Hg lamp emissions at both 185 and 254 nm (OFR185) or 254 nm only (OFR254). OFRs have been thought to be limited to studying low-NO chemistry (in which peroxy radicals (RO2) react preferentially with HO2) because NO is very rapidly oxidized by the high concentrations of O3, HO2, and OH in OFRs. However, many groups are performing experiments by aging combustion exhaust with high NO levels or adding NO in the hopes of simulating high-NO chemistry (in which RO2 + NO dominates). This work systematically explores the chemistry in OFRs with high initial NO. Using box modeling, we investigate the interconversion of N-containing species and the uncertainties due to kinetic parameters. Simple initial injection of NO in OFR185 can result in more RO2 reacted with NO than with HO2 and minor non-tropospheric photolysis, but only under a very narrow set of conditions (high water mixing ratio, low UV intensity, low external OH reactivity (OHRext), and initial NO concentration (NOin) of tens to hundreds of ppb) that account for a very small fraction of the input parameter space. These conditions are generally far away from experimental conditions of published OFR studies with high initial NO. In particular, studies of aerosol formation from vehicle emissions in OFRs often used OHRext and NOin several orders of magnitude higher. Due to extremely high OHRext and NOin, some studies may have resulted in substantial non-tropospheric photolysis, strong delay to RO2 chemistry due to peroxynitrate formation, VOC reactions with NO3 dominating over those with OH, and faster reactions of OH-aromatic adducts with NO2 than those with O2, all of which are irrelevant to ambient VOC photooxidation chemistry. Some of the negative effects are the worst for alkene and aromatic precursors. To avoid undesired chemistry, vehicle emissions

Personality Traits and Training Initiation Process: Intention, Planning, and Action Initiation.

Science.gov (United States)

Laguna, Mariola; Purc, Ewelina

2016-01-01

The article aims at investigating the role of personality traits in relation to training initiation. Training initiation is conceptualized as a goal realization process, and explained using goal theories. There are three stages of the process analyzed: intention to undertake training, plan formulation, and actual training undertaking. Two studies tested the relationships between five personality traits, defined according to the five factor model, and the stages of the goal realization process. In Study 1, which explains training intention and training plans' formulation, 155 employees participated. In Study 2, which was time-lagged with two measurement points, and which explains intention, plans, and training actions undertaken, the data from 176 employees was collected at 3 month intervals. The results of these studies show that personality traits, mainly openness to experience, predict the training initiation process to some degree: intention, plans, and actual action initiation. The findings allow us to provide recommendations for practitioners responsible for human resource development. The assessment of openness to experience in employees helps predict their motivation to participate in training activities. To increase training motivation it is vital to strengthen intentions to undertake training, and to encourage training action planning.

Model Comparison in Subsurface Science: The DECOVALEX and Sim-SEQ Initiatives (Invited)

Science.gov (United States)

Birkholzer, J. T.; Mukhopadhyay, S.; Rutqvist, J.; Tsang, C.

2013-12-01

, the DECOVALEX project has played a major role in improving our understanding of coupled THM processes in fractured rock and buffer/backfill materials, a subject of importance to performance assessment of a radioactive waste geologic repository. The second example is the Sim-SEQ project, a relatively recent model comparison initiative addressing multi-phase processes relevant in geologic carbon sequestration. Like DECOVALEX, Sim-SEQ is not about benchmarking, but rather about evaluating model building efforts in a broad and comprehensive sense. In Sim-SEQ, sixteen international modeling teams are building their own models for a specific carbon sequestration site referred to as the Sim-SEQ Study site (the S-3 site). The S-3 site is patterned after the ongoing SECARB Phase III Early Test site in southwestern Mississippi, where CO2 is injected into a fluvial sandstone unit with high vertical and lateral heterogeneity. The complex geology of the S-3 site, its location in the water leg of a CO2-EOR field with a strong water drive, and the presence of methane in the reservoir brine make this a challenging task, requiring the modelers to use their best judgment in making a large number of choices about how to model various processes and properties of the system.

The importance of stakeholder-initiatives for business models in short food supply chains: the case of the Netherlands

NARCIS (Netherlands)

Wubben, E.F.M.; Fondse, M.; Pascucci, S.

2013-01-01

While the interest in Short Food Supply Chains (SFSCs) is growing, we still await management studies that explore the impact of stakeholders of SFSCs in substantial numbers. This article investigates the differences in the business models of SFSCs that may be attributed to the initiator-stakeholder,

New Models for Initial Teacher Education in Scotland

Science.gov (United States)

Kibble, Bob

2012-01-01

In this article, the author responds to the recent article by Lynne Bianchi commenting on the Donaldson report, "Teaching Scotland's future" (Donaldson, 2011). He agrees that the Donaldson report has indeed been a catalyst to drive change across the entire landscape of initial teacher education (ITE) in Scotland. In fact, not only ITE:…

Mixed-Initiative Clustering

Science.gov (United States)

Huang, Yifen

2010-01-01

Mixed-initiative clustering is a task where a user and a machine work collaboratively to analyze a large set of documents. We hypothesize that a user and a machine can both learn better clustering models through enriched communication and interactive learning from each other. The first contribution or this thesis is providing a framework of…

A thin film passive magnetic field sensor operated at 425 MHz

KAUST Repository

Li, Bodong; Kosel, Jü rgen

2013-01-01

A passive, magnetic field sensor consisting of a 425 MHz surface acoustic wave (SAW) transponder loaded with a giant magnetoimpedance (GMI) element is developed. The transponder, consisting of two interdigital transducers (IDTs) and the GMI element, a multilayer structure composed of Ni80Fe 20/Cu/Ni80Fe20, are fabricated on a 128° Y-X cut LiNbO3 substrate. The integrated sensor is characterized with a network analyzer through an S-parameter measurement. Upon the application of a magnetic field, a maximum amplitude change and phase shift of 2.7 dB and 20 degree, respectively, are observed. Within the linear region, the magnetic sensitivity is 3870 dB/T and the resolution is 1.3 μT. © 2013 IEEE.

A thin film passive magnetic field sensor operated at 425 MHz

KAUST Repository

Li, Bodong

2013-06-01

A passive, magnetic field sensor consisting of a 425 MHz surface acoustic wave (SAW) transponder loaded with a giant magnetoimpedance (GMI) element is developed. The transponder, consisting of two interdigital transducers (IDTs) and the GMI element, a multilayer structure composed of Ni80Fe 20/Cu/Ni80Fe20, are fabricated on a 128° Y-X cut LiNbO3 substrate. The integrated sensor is characterized with a network analyzer through an S-parameter measurement. Upon the application of a magnetic field, a maximum amplitude change and phase shift of 2.7 dB and 20 degree, respectively, are observed. Within the linear region, the magnetic sensitivity is 3870 dB/T and the resolution is 1.3 μT. © 2013 IEEE.

Enhancement of giant magnetoimpedance in composite wire with insulator layer

International Nuclear Information System (INIS)

Wang, X.Z.; Yuan, W.Z.; Li, X.D.; Ruan, J.Z.; Zhao, Z.J.; Yang, J.X.; Yang, X.L.; Sun, Z.

2007-01-01

CuBe/NiFeB and CuBe/Insulator/NiFeB composite wires have been prepared by electroless-deposition. The giant magnetoimpedance (GMI) effect for NiFeB layer with thickness of 3 μm on CuBe core with diameter of 100 μm has been studied. After adding an insulator layer, the maximal GMI ratio of CuBe/Insulator/NiFeB composite wire is much higher than that of CuBe/NiFeB composite wire, and can reach to about 250% at the frequency range of 500 kHz-1 MHz. The results are explained in terms of difference of magnetic structure and different frequency dependence of resistance and reactance of the two kinds of composite wires

Thermal, magnetic, and structural properties of soft magnetic FeCrNbCuSiB alloy ribbons

International Nuclear Information System (INIS)

Rosales-Rivera, A.; Valencia, V.H.; Quintero, D.L.; Pineda-Gomez, P.; Gomez, M.

2006-01-01

The thermal, magnetic and structural properties of amorphous magnetic Fe 73.5-x Cr x Nb 3 Cu 1 Si 13.5 B 9 alloy ribbons, with x=0, 2, 4, 6, 8, and 10, were studied by using differential scanning calorimetry (DSC), thermogravimetric analysis (TGA), magneto-impedance measurements and X-ray diffraction (XRD). The ribbons exhibit ultrasoft magnetic behavior, especially giant magneto-impedance effect, GMI. A three-peak behavior was observed in GMI curves. Particular attention has been given to observation of crystallization kinetics via DSC and TGA. The primary crystallization T pcr , and Curie T c , temperatures were determined from DSC and TGA data, respectively. The effect of partial substitution of iron by Cr on the thermal and magnetic properties is discussed

Assessment of crown fire initiation and spread models in Mediterranean conifer forests by using data from field and laboratory experiments

Energy Technology Data Exchange (ETDEWEB)

Rodríguez y Silva, F.; Guijarro, M.; Madrigal, J.; Jiménez, E.; Molina, J.R.; Hernando, C.; Vélez, R.; Vega, J.A.

2017-11-01

Aims of study: To conduct the first full-scale crown fire experiment carried out in a Mediterranean conifer stand in Spain; to use different data sources to assess crown fire initiation and spread models, and to evaluate the role of convection in crown fire initiation. Area of study: The Sierra Morena mountains (Coordinates ETRS89 30N: X: 284793-285038; Y: 4218650-4218766), southern Spain, and the outdoor facilities of the Lourizán Forest Research Centre, northwestern Spain. Material and methods: The full-scale crown fire experiment was conducted in a young Pinus pinea stand. Field data were compared with data predicted using the most used crown fire spread models. A small-scale experiment was developed with Pinus pinaster trees to evaluate the role of convection in crown fire initiation. Mass loss calorimeter tests were conducted with P. pinea needles to estimate residence time of the flame, which was used to validate the crown fire spread model. Main results: The commonly used crown fire models underestimated the crown fire spread rate observed in the full-scale experiment, but the proposed new integrated approach yielded better fits. Without wind-forced convection, tree crowns did not ignite until flames from an intense surface fire contacted tree foliage. Bench-scale tests based on radiation heat flux therefore offer a limited insight to full-scale phenomena. Research highlights: Existing crown fire behaviour models may underestimate the rate of spread of crown fires in many Mediterranean ecosystems. New bench-scale methods based on flame buoyancy and more crown field experiments allowing detailed measurements of fire behaviour are needed.

Assessment of crown fire initiation and spread models in Mediterranean conifer forests by using data from field and laboratory experiments

International Nuclear Information System (INIS)

Rodríguez y Silva, F.; Guijarro, M.; Madrigal, J.; Jiménez, E.; Molina, J.R.; Hernando, C.; Vélez, R.; Vega, J.A.

2017-01-01

Aims of study: To conduct the first full-scale crown fire experiment carried out in a Mediterranean conifer stand in Spain; to use different data sources to assess crown fire initiation and spread models, and to evaluate the role of convection in crown fire initiation. Area of study: The Sierra Morena mountains (Coordinates ETRS89 30N: X: 284793-285038; Y: 4218650-4218766), southern Spain, and the outdoor facilities of the Lourizán Forest Research Centre, northwestern Spain. Material and methods: The full-scale crown fire experiment was conducted in a young Pinus pinea stand. Field data were compared with data predicted using the most used crown fire spread models. A small-scale experiment was developed with Pinus pinaster trees to evaluate the role of convection in crown fire initiation. Mass loss calorimeter tests were conducted with P. pinea needles to estimate residence time of the flame, which was used to validate the crown fire spread model. Main results: The commonly used crown fire models underestimated the crown fire spread rate observed in the full-scale experiment, but the proposed new integrated approach yielded better fits. Without wind-forced convection, tree crowns did not ignite until flames from an intense surface fire contacted tree foliage. Bench-scale tests based on radiation heat flux therefore offer a limited insight to full-scale phenomena. Research highlights: Existing crown fire behaviour models may underestimate the rate of spread of crown fires in many Mediterranean ecosystems. New bench-scale methods based on flame buoyancy and more crown field experiments allowing detailed measurements of fire behaviour are needed.

The Use of Indirect Estimates of Soil Moisture to Initialize Coupled Models and its Impact on Short-Term and Seasonal Simulations

Science.gov (United States)

Lapenta, William M.; Crosson, William; Dembek, Scott; Lakhtakia, Mercedes

1998-01-01

It is well known that soil moisture is a characteristic of the land surface that strongly affects the partitioning of outgoing radiation into sensible and latent heat which significantly impacts both weather and climate. Detailed land surface schemes are now being coupled to mesoscale atmospheric models in order to represent the effect of soil moisture upon atmospheric simulations. However, there is little direct soil moisture data available to initialize these models on regional to continental scales. As a result, a Soil Hydrology Model (SHM) is currently being used to generate an indirect estimate of the soil moisture conditions over the continental United States at a grid resolution of 36 Km on a daily basis since 8 May 1995. The SHM is forced by analyses of atmospheric observations including precipitation and contains detailed information on slope soil and landcover characteristics.The purpose of this paper is to evaluate the utility of initializing a detailed coupled model with the soil moisture data produced by SHM.

Mathematical modeling of the ethanol fermentation of cashew apple juice by a flocculent yeast: the effect of initial substrate concentration and temperature.

Science.gov (United States)

Pinheiro, Álvaro Daniel Teles; da Silva Pereira, Andréa; Barros, Emanuel Meneses; Antonini, Sandra Regina Ceccato; Cartaxo, Samuel Jorge Marques; Rocha, Maria Valderez Ponte; Gonçalves, Luciana Rocha B

2017-08-01

In this work, the effect of initial sugar concentration and temperature on the production of ethanol by Saccharomyces cerevisiae CCA008, a flocculent yeast, using cashew apple juice in a 1L-bioreactor was studied. The experimental results were used to develop a kinetic model relating biomass, ethanol production and total reducing sugar consumption. Monod, Andrews, Levenspiel and Ghose and Tyagi models were investigated to represent the specific growth rate without inhibition, with inhibition by substrate and with inhibition by product, respectively. Model validation was performed using a new set of experimental data obtained at 34 °C and using 100 g L -1 of initial substrate concentration. The model proposed by Ghose and Tyagi was able to accurately describe the dynamics of ethanol production by S. cerevisiae CCA008 growing on cashew apple juice, containing an initial reducing sugar concentration ranging from 70 to 170 g L -1 and temperature, from 26 to 42 °C. The model optimization was also accomplished based on the following parameters: percentage volume of ethanol per volume of solution (%V ethanol /V solution ), efficiency and reaction productivity. The optimal operational conditions were determined using response surface graphs constructed with simulated data, reaching an efficiency and a productivity of 93.5% and 5.45 g L -1  h -1 , respectively.

Initial singularity and pure geometric field theories

Science.gov (United States)

Wanas, M. I.; Kamal, Mona M.; Dabash, Tahia F.

2018-01-01

In the present article we use a modified version of the geodesic equation, together with a modified version of the Raychaudhuri equation, to study initial singularities. These modified equations are used to account for the effect of the spin-torsion interaction on the existence of initial singularities in cosmological models. Such models are the results of solutions of the field equations of a class of field theories termed pure geometric. The geometric structure used in this study is an absolute parallelism structure satisfying the cosmological principle. It is shown that the existence of initial singularities is subject to some mathematical (geometric) conditions. The scheme suggested for this study can be easily generalized.

Markov model of fatigue of a composite material with the poisson process of defect initiation

Science.gov (United States)

Paramonov, Yu.; Chatys, R.; Andersons, J.; Kleinhofs, M.

2012-05-01

As a development of the model where only one weak microvolume (WMV) and only a pulsating cyclic loading are considered, in the current version of the model, we take into account the presence of several weak sites where fatigue damage can accumulate and a loading with an arbitrary (but positive) stress ratio. The Poisson process of initiation of WMVs is considered, whose rate depends on the size of a specimen. The cumulative distribution function (cdf) of the fatigue life of every individual WMV is calculated using the Markov model of fatigue. For the case where this function is approximated by a lognormal distribution, a formula for calculating the cdf of fatigue life of the specimen (modeled as a chain of WMVs) is obtained. Only a pulsating cyclic loading was considered in the previous version of the model. Now, using the modified energy method, a loading cycle with an arbitrary stress ratio is "transformed" into an equivalent cycle with some other stress ratio. In such a way, the entire probabilistic fatigue diagram for any stress ratio with a positive cycle stress can be obtained. Numerical examples are presented.

[Initiation, promotion, initiation experiments with radon and cigarette smoke: Lung tumors in rats]. Progress report

International Nuclear Information System (INIS)

Moolgavkar, S.H.

1994-01-01

During the past several years, the authors have made considerable progress in modeling carcinogenesis in general, and in modeling radiation carcinogenesis, in particular. They present an overview of their progress in developing stochastic carcinogenesis models and applying them to experimental and epidemiologic data sets. Traditionally, cancer models have been used for the analysis of incidence (or prevalence) data in epidemiology and time to tumor data in experimental studies. The relevant quantities for the analysis of these data are the hazard function and the probability of tumor. The derivation of these quantities is briefly described here. More recently, the authors began to use these models for the analysis of data on intermediate lesions on the pathway to cancer. Such data are available in experimental carcinogenesis studies, in particular in initiation and promotion studies on the mouse skin and the rat liver. If however, quantitative information on intermediate lesions on the pathway to lung cancer were to be come available at some future date, the methods that they have developed for the analysis of initiation-promotion experiments could easily be applied to the analysis of these lesions. The mathematical derivations here are couched in terms of a particular two-mutation model of carcinogenesis. Extension to models postulating more than two mutations is not always straightforward

GPM, METOP-B, MHS Level 2A Radiometer Profiling V03

Data.gov (United States)

National Aeronautics and Space Administration — The 2AGPROF (also known as, GPM GPROF (Level 2)) algorithm retrieves consistent precipitation and related science fields from the following GMI and partner passive...

GPM, METOP-A, MHS Level 2A Radiometer Profiling V03

Data.gov (United States)

National Aeronautics and Space Administration — The 2AGPROF (also known as, GPM GPROF (Level 2)) algorithm retrieves consistent precipitation and related science fields from the following GMI and partner passive...

GPM, NOAA19, MHS Level 2A Radiometer Profiling V03

Data.gov (United States)

National Aeronautics and Space Administration — The 2AGPROF (also known as, GPM GPROF (Level 2)) algorithm retrieves consistent precipitation and related science fields from the following GMI and partner passive...

GPM, TRMM, TMI Level 2A Radiometer Profiling V03

Data.gov (United States)

National Aeronautics and Space Administration — The 2AGPROF (also known as, GPM GPROF (Level 2)) algorithm retrieves consistent precipitation and related science fields from the following GMI and partner passive...

GPM, F18, SSMI Level 2A Radiometer Profiling V03

Data.gov (United States)

National Aeronautics and Space Administration — The 2AGPROF (also known as, GPM GPROF (Level 2)) algorithm retrieves consistent precipitation and related science fields from the following GMI and partner passive...

GPM, F17, SSMI Level 2A Radiometer Profiling V03

Data.gov (United States)

National Aeronautics and Space Administration — The 2AGPROF (also known as, GPM GPROF (Level 2)) algorithm retrieves consistent precipitation and related science fields from the following GMI and partner passive...

GPM, NOAA18, MHS Level 2A Radiometer Profiling V03

Data.gov (United States)

National Aeronautics and Space Administration — The 2AGPROF (also known as, GPM GPROF (Level 2)) algorithm retrieves consistent precipitation and related science fields from the following GMI and partner passive...

GPM, F16, SSMI Level 2A Radiometer Profiling V03

Data.gov (United States)

National Aeronautics and Space Administration — The 2AGPROF (also known as, GPM GPROF (Level 2)) algorithm retrieves consistent precipitation and related science fields from the following GMI and partner passive...

GPM, F17, SSMI Level 2A Radiometer Profiling VV03A

Data.gov (United States)

National Aeronautics and Space Administration — The 2AGPROF (also known as, GPM GPROF (Level 2)) algorithm retrieves consistent precipitation and related science fields from the following GMI and partner passive...

Development and Initial Validation of the Five-Factor Model Adolescent Personality Questionnaire (FFM-APQ).

Science.gov (United States)

Rogers, Mary E; Glendon, A Ian

2018-01-01

This research reports on the 4-phase development of the 25-item Five-Factor Model Adolescent Personality Questionnaire (FFM-APQ). The purpose was to develop and determine initial evidence for validity of a brief adolescent personality inventory using a vocabulary that could be understood by adolescents up to 18 years old. Phase 1 (N = 48) consisted of item generation and expert (N = 5) review of items; Phase 2 (N = 179) involved item analyses; in Phase 3 (N = 496) exploratory factor analysis assessed the underlying structure; in Phase 4 (N = 405) confirmatory factor analyses resulted in a 25-item inventory with 5 subscales.

Initial conditions of urban permeable surfaces in rainfall-runoff models using Horton’s infiltration

DEFF Research Database (Denmark)

Davidsen, Steffen; Löwe, Roland; Høegh Ravn, Nanna

2017-01-01

Infiltration is a key process controlling runoff, but varies depending on antecedent conditions. This study provides estimates on initial conditions for urban permeable surfaces via continuous simulation of the infiltration capacity using historical rain data. An analysis of historical rainfall...... records show that accumulated rainfall prior to large rain events does not depend on the return period of the event. Using an infiltration-runoff model we found that for a typical large rain storm, antecedent conditions in general lead to reduced infiltration capacity both for sandy and clayey soils...... and that there is substantial runoff for return periods above 1–10 years....

Effects of Initial Values and Convergence Criterion in the Two-Parameter Logistic Model When Estimating the Latent Distribution in BILOG-MG 3.

Directory of Open Access Journals (Sweden)

Ingo W Nader

Full Text Available Parameters of the two-parameter logistic model are generally estimated via the expectation-maximization algorithm, which improves initial values for all parameters iteratively until convergence is reached. Effects of initial values are rarely discussed in item response theory (IRT, but initial values were recently found to affect item parameters when estimating the latent distribution with full non-parametric maximum likelihood. However, this method is rarely used in practice. Hence, the present study investigated effects of initial values on item parameter bias and on recovery of item characteristic curves in BILOG-MG 3, a widely used IRT software package. Results showed notable effects of initial values on item parameters. For tighter convergence criteria, effects of initial values decreased, but item parameter bias increased, and the recovery of the latent distribution worsened. For practical application, it is advised to use the BILOG default convergence criterion with appropriate initial values when estimating the latent distribution from data.

Predicting Schedule Duration for Defense Acquisition Programs: Program Initiation to Initial Operational Capability

Science.gov (United States)

2016-03-24

statistically significant. Variance inflation is a consequence of multicollinearity and the VIF scores are a common way for detecting 43 such a...produced an initial model and we have ascertained there are no issues (and tested that) with respect to multicollinearity (VIF scores), influential...The analysis of this tells us that there is no consequence of multicollinearity present in the preliminary model. By this, there is no linear

Can community change be measured for an outcomes-based initiative? A comparative case study of the success by 6 initiative.

Science.gov (United States)

Minich, Lisa; Howe, Steven; Langmeyer, Daniel; Corcoran, Kevin

2006-12-01

One of the challenges facing nonprofit organizations today is the demand for measurable results. Increasingly, these organizations are focusing less on program outputs and program outcomes in favor of community outcomes or changes demonstrated in the larger community. Success by 6(R) is a popular United Way initiative that emphasizes defining and measuring community outcomes. In this paper, we describe our work with 24 Success by 6(R) initiatives around the country. It is clear that not all of these initiatives are measuring community outcomes. Of those initiatives that are experiencing some success measuring community outcomes, similar measurement strategies are reported. Additionally, our experience suggests several United Way employees express dissatisfaction with the logic model as a framework for defining and measuring community outcomes although no preferred alternative model is identified. Evaluators working with community-wide initiatives must find ways to communicate the differences between program and community outcomes to key stakeholders and funders.

Evaluation of COSMO-ART in the Framework of the Air Quality Model Evaluation International Initiative (AQMEII)

Science.gov (United States)

Giordano, Lea; Brunner, Dominik; Im, Ulas; Galmarini, Stefano

2014-05-01

The Air Quality Model Evaluation International Initiative (AQMEII) coordinated by the EC-JRC and US-EPA, promotes since 2008 research on regional air quality model evaluation across the atmospheric modelling communities of Europe and North America. AQMEII has now reached its Phase 2 that is dedicated to the evaluation of on-line coupled chemistry-meteorology models as opposed to Phase 1 where only off-line models were considered. At European level, AQMEII collaborates with the COST Action "European framework for on-line integrated air quality and meteorology modelling" (EuMetChem). All European groups participating in AQMEII performed simulations over the same spatial domain (Europe at a resolution of about 20 km) and using the same simulation strategy (e.g. no nudging allowed) and the same input data as much as possible. The initial and boundary conditions (IC/BC) were shared between all groups. Emissions were provided by the TNO-MACC database for anthropogenic emissions and the FMI database for biomass burning emissions. Chemical IC/BC data were taken from IFS-MOZART output, and meteorological IC/BC from the ECWMF global model. Evaluation data sets were collected by the Joint Research Center (JRC) and include measurements from surface in situ networks (AirBase and EMEP), vertical profiles from ozone sondes and aircraft (MOZAIC), and remote sensing (AERONET, satellites). Since Phase 2 focuses on on-line coupled models, a special effort is devoted to the detailed speciation of particulate matter components, with the goal of studying feedback processes. For the AQMEII exercise, COSMO-ART has been run with 40 levels of vertical resolution, and a chemical scheme that includes the SCAV module of Knote and Brunner (ACP 2013) for wet-phase chemistry and the SOA treatment according to VBS (volatility basis set) approach (Athanasopoulou et al., ACP 2013). The COSMO-ART evaluation shows that, next to a good performance in the meteorology, the gas phase chemistry is well

Research on Initiation Sensitivity of Solid Explosive and Planer Initiation System

Directory of Open Access Journals (Sweden)

N Matsuo

2016-09-01

Full Text Available Firstly, recently, there are a lot of techniques being demanded for complex process, various explosive initiation method and highly accurate control of detonation are needed. In this research, the metal foil explosion using high current is focused attention on the method to obtain linear or planate initiation easily, and the main evaluation of metal foil explosion to initiate explosive was conducted. The explosion power was evaluated by observing optically the underwater shock wave generated from the metal foil explosion. Secondly, in high energy explosive processing, there are several applications, such as shock compaction, explosive welding, food processing and explosive forming. In these explosive applications, a high sensitive explosive has been mainly used. The high sensitive explosive is so dangerous, since it can lead to explosion suddenly. So, for developing explosives, the safety is the most important thing as well as low manufacturing cost and explosive characteristics. In this work, we have focused on the initiation sensitivity of a solid explosive and performed numerical analysis of sympathetic detonation. The numerical analysis is calculated by LS-DYNA 3D (commercial code. To understand the initiation reaction of an explosive, Lee-Tarver equation was used and impact detonation process was analyzed by ALE code. Configuration of simulation model is a quarter of circular cylinder. The donor type of explosive (SEP was used as initiation explosive. When the donor explosive is exploded, a shock wave is generated and it propagates into PMMA, air and metallic layers in order. During passing through the layers, the shock wave is attenuated and finally, it has influence on the acceptor explosive, Comp. B. Here, we evaluate the initiation of acceptor explosive and discuss about detonation pressure, reactive rate of acceptor explosive and attenuation of impact pressure.

On the appropriate definition of soil profile configuration and initial conditions for land surface–hydrology models in cold regions

Directory of Open Access Journals (Sweden)

G. Sapriza-Azuri

2018-06-01

Full Text Available Arctic and subarctic regions are amongst the most susceptible regions on Earth to global warming and climate change. Understanding and predicting the impact of climate change in these regions require a proper process representation of the interactions between climate, carbon cycle, and hydrology in Earth system models. This study focuses on land surface models (LSMs that represent the lower boundary condition of general circulation models (GCMs and regional climate models (RCMs, which simulate climate change evolution at the global and regional scales, respectively. LSMs typically utilize a standard soil configuration with a depth of no more than 4 m, whereas for cold, permafrost regions, field experiments show that attention to deep soil profiles is needed to understand and close the water and energy balances, which are tightly coupled through the phase change. To address this gap, we design and run a series of model experiments with a one-dimensional LSM, called CLASS (Canadian Land Surface Scheme, as embedded in the MESH (Modélisation Environmentale Communautaire – Surface and Hydrology modelling system, to (1 characterize the effect of soil profile depth under different climate conditions and in the presence of parameter uncertainty; (2 assess the effect of including or excluding the geothermal flux in the LSM at the bottom of the soil column; and (3 develop a methodology for temperature profile initialization in permafrost regions, where the system has an extended memory, by the use of paleo-records and bootstrapping. Our study area is in Norman Wells, Northwest Territories of Canada, where measurements of soil temperature profiles and historical reconstructed climate data are available. Our results demonstrate a dominant role for parameter uncertainty, that is often neglected in LSMs. Considering such high sensitivity to parameter values and dependency on the climate condition, we show that a minimum depth of 20 m is essential to

Elucidation of Altered Pathways in Tumor-Initiating Cells of Triple-Negative Breast Cancer: A Useful Cell Model System for Drug Screening.

Science.gov (United States)

Christensen, Anne G; Ehmsen, Sidse; Terp, Mikkel G; Batra, Richa; Alcaraz, Nicolas; Baumbach, Jan; Noer, Julie B; Moreira, José; Leth-Larsen, Rikke; Larsen, Martin R; Ditzel, Henrik J

2017-08-01

A limited number of cancer cells within a tumor are thought to have self-renewing and tumor-initiating capabilities that produce the remaining cancer cells in a heterogeneous tumor mass. Elucidation of central pathways preferentially used by tumor-initiating cells/cancer stem cells (CSCs) may allow their exploitation as potential cancer therapy targets. We used single cell cloning to isolate and characterize four isogenic cell clones from a triple-negative breast cancer cell line; two exhibited mesenchymal-like and two epithelial-like characteristics. Within these pairs, one, but not the other, resulted in tumors in immunodeficient NOD/Shi-scid/IL-2 Rγ null mice and efficiently formed mammospheres. Quantitative proteomics and phosphoproteomics were used to map signaling pathways associated with the tumor-initiating ability. Signaling associated with apoptosis was suppressed in tumor-initiating versus nontumorigenic counterparts with pro-apoptotic proteins, such as Bcl2-associated agonist of cell death (BAD), FAS-associated death domain protein (FADD), and myeloid differentiation primary response protein (MYD88), downregulated in tumor-initiating epithelial-like cells. Functional studies confirmed significantly lower apoptosis in tumor-initiating versus nontumorigenic cells. Moreover, central pathways, including β-catenin and nuclear factor kappa-light-chain-enhancer of activated B cells (NF-κB)-related signaling, exhibited increased activation in the tumor-initiating cells. To evaluate the CSC model as a tool for drug screening, we assessed the effect of separately blocking NF-κB and Wnt/β-catenin signaling and found markedly reduced mammosphere formation, particularly for tumor-initiating cells. Similar reduction was also observed using patient-derived primary cancer cells. Furthermore, blocking NF-κB signaling in mice transplanted with tumor-initiating cells significantly reduced tumor outgrowth. Our study demonstrates that suppressed apoptosis, activation

76 FR 61103 - Medicare Program; Comprehensive Primary Care Initiative

Science.gov (United States)

2011-10-03

...] Medicare Program; Comprehensive Primary Care Initiative AGENCY: Centers for Medicare & Medicaid Services... organizations to participate in the Comprehensive Primary Care initiative (CPC), a multipayer model designed to... the Comprehensive Primary Care initiative or the application process. SUPPLEMENTARY INFORMATION: I...

On the sensitivity of teleseismic full-waveform inversion to earth parametrization, initial model and acquisition design

Science.gov (United States)

Beller, S.; Monteiller, V.; Combe, L.; Operto, S.; Nolet, G.

2018-02-01

Full-waveform inversion (FWI) is not yet a mature imaging technology for lithospheric imaging from teleseismic data. Therefore, its promise and pitfalls need to be assessed more accurately according to the specifications of teleseismic experiments. Three important issues are related to (1) the choice of the lithospheric parametrization for optimization and visualization, (2) the initial model and (3) the acquisition design, in particular in terms of receiver spread and sampling. These three issues are investigated with a realistic synthetic example inspired by the CIFALPS experiment in the Western Alps. Isotropic elastic FWI is implemented with an adjoint-state formalism and aims to update three parameter classes by minimization of a classical least-squares difference-based misfit function. Three different subsurface parametrizations, combining density (ρ) with P and S wave speeds (Vp and Vs) , P and S impedances (Ip and Is), or elastic moduli (λ and μ) are first discussed based on their radiation patterns before their assessment by FWI. We conclude that the (ρ, λ, μ) parametrization provides the FWI models that best correlate with the true ones after recombining a posteriori the (ρ, λ, μ) optimization parameters into Ip and Is. Owing to the low frequency content of teleseismic data, 1-D reference global models as PREM provide sufficiently accurate initial models for FWI after smoothing that is necessary to remove the imprint of the layering. Two kinds of station deployments are assessed: coarse areal geometry versus dense linear one. We unambiguously conclude that a coarse areal geometry should be favoured as it dramatically increases the penetration in depth of the imaging as well as the horizontal resolution. This results because the areal geometry significantly increases local wavenumber coverage, through a broader sampling of the scattering and dip angles, compared to a linear deployment.

A Mathematical Model of Neutral Lipid Content in terms of Initial Nitrogen Concentration and Validation in Coelastrum sp. HA-1 and Application in Chlorella sorokiniana

Directory of Open Access Journals (Sweden)

Zhenhua Yang

2017-01-01

Full Text Available Microalgae are considered to be a potential major biomass feedstock for biofuel due to their high lipid content. However, no correlation equations as a function of initial nitrogen concentration for lipid accumulation have been developed for simplicity to predict lipid production and optimize the lipid production process. In this study, a lipid accumulation model was developed with simple parameters based on the assumption protein synthesis shift to lipid synthesis by a linear function of nitrogen quota. The model predictions fitted well for the growth, lipid content, and nitrogen consumption of Coelastrum sp. HA-1 under various initial nitrogen concentrations. Then the model was applied successfully in Chlorella sorokiniana to predict the lipid content with different light intensities. The quantitative relationship between initial nitrogen concentrations and the final lipid content with sensitivity analysis of the model were also discussed. Based on the model results, the conversion efficiency from protein synthesis to lipid synthesis is higher and higher in microalgae metabolism process as nitrogen decreases; however, the carbohydrate composition content remains basically unchanged neither in HA-1 nor in C. sorokiniana.

A Mathematical Model of Neutral Lipid Content in terms of Initial Nitrogen Concentration and Validation in Coelastrum sp. HA-1 and Application in Chlorella sorokiniana

Science.gov (United States)

Zhao, Yue; Liu, Zhiyong; Liu, Chenfeng; Hu, Zhipeng

2017-01-01

Microalgae are considered to be a potential major biomass feedstock for biofuel due to their high lipid content. However, no correlation equations as a function of initial nitrogen concentration for lipid accumulation have been developed for simplicity to predict lipid production and optimize the lipid production process. In this study, a lipid accumulation model was developed with simple parameters based on the assumption protein synthesis shift to lipid synthesis by a linear function of nitrogen quota. The model predictions fitted well for the growth, lipid content, and nitrogen consumption of Coelastrum sp. HA-1 under various initial nitrogen concentrations. Then the model was applied successfully in Chlorella sorokiniana to predict the lipid content with different light intensities. The quantitative relationship between initial nitrogen concentrations and the final lipid content with sensitivity analysis of the model were also discussed. Based on the model results, the conversion efficiency from protein synthesis to lipid synthesis is higher and higher in microalgae metabolism process as nitrogen decreases; however, the carbohydrate composition content remains basically unchanged neither in HA-1 nor in C. sorokiniana. PMID:28194424

Using Deep Learning for Targeted Data Selection, Improving Satellite Observation Utilization for Model Initialization

Science.gov (United States)

Lee, Y. J.; Bonfanti, C. E.; Trailovic, L.; Etherton, B.; Govett, M.; Stewart, J.

2017-12-01

At present, a fraction of all satellite observations are ultimately used for model assimilation. The satellite data assimilation process is computationally expensive and data are often reduced in resolution to allow timely incorporation into the forecast. This problem is only exacerbated by the recent launch of Geostationary Operational Environmental Satellite (GOES)-16 satellite and future satellites providing several order of magnitude increase in data volume. At the NOAA Earth System Research Laboratory (ESRL) we are researching the use of machine learning the improve the initial selection of satellite data to be used in the model assimilation process. In particular, we are investigating the use of deep learning. Deep learning is being applied to many image processing and computer vision problems with great success. Through our research, we are using convolutional neural network to find and mark regions of interest (ROI) to lead to intelligent extraction of observations from satellite observation systems. These targeted observations will be used to improve the quality of data selected for model assimilation and ultimately improve the impact of satellite data on weather forecasts. Our preliminary efforts to identify the ROI's are focused in two areas: applying and comparing state-of-art convolutional neural network models using the analysis data from the National Center for Environmental Prediction (NCEP) Global Forecast System (GFS) weather model, and using these results as a starting point to optimize convolution neural network model for pattern recognition on the higher resolution water vapor data from GOES-WEST and other satellite. This presentation will provide an introduction to our convolutional neural network model to identify and process these ROI's, along with the challenges of data preparation, training the model, and parameter optimization.

The Belgian initiative G1000. A feasible model of deliberative cyber democracy

Directory of Open Access Journals (Sweden)

Laura Tejedor Fuentes

2016-11-01

Full Text Available In 2010, after five hundred days without any stable form of government, a group of Belgian citizens from a wide range of social backgrounds launched a citizenship summit called 'G1000'. The aim of the event was to create citizen involvement in politics by stimulating participants to take part in debates about social issues and by applying innovative techniques of deliberative democracy. In order to verify whether the model mentioned meets the criteria of an “online democratic-deliberative” experiment, this article carried out a quantitative analysis of the G1000 based on the work of Fishkin, Chadwick and Habermas. According to the majority of authors who have contributed to the topic, including the spokesperson and organizer of the event, Vincent Jacquet the results demonstrate that the G1000 summit is, in fact, a genuine democratic-deliberative initiative.

An Ontology of Quality Initiatives and a Model for Decentralized, Collaborative Quality Management on the (Semantic) World Wide Web

Science.gov (United States)

2001-01-01

This editorial provides a model of how quality initiatives concerned with health information on the World Wide Web may in the future interact with each other. This vision fits into the evolving "Semantic Web" architecture - ie, the prospective that the World Wide Web may evolve from a mess of unstructured, human-readable information sources into a global knowledge base with an additional layer providing richer and more meaningful relationships between resources. One first prerequisite for forming such a "Semantic Web" or "web of trust" among the players active in quality management of health information is that these initiatives make statements about themselves and about each other in a machine-processable language. I present a concrete model on how this collaboration could look, and provide some recommendations on what the role of the World Health Organization (WHO) and other policy makers in this framework could be. PMID:11772549

Analytical model for advective-dispersive transport involving flexible boundary inputs, initial distributions and zero-order productions

Science.gov (United States)

Chen, Jui-Sheng; Li, Loretta Y.; Lai, Keng-Hsin; Liang, Ching-Ping

2017-11-01

A novel solution method is presented which leads to an analytical model for the advective-dispersive transport in a semi-infinite domain involving a wide spectrum of boundary inputs, initial distributions, and zero-order productions. The novel solution method applies the Laplace transform in combination with the generalized integral transform technique (GITT) to obtain the generalized analytical solution. Based on this generalized analytical expression, we derive a comprehensive set of special-case solutions for some time-dependent boundary distributions and zero-order productions, described by the Dirac delta, constant, Heaviside, exponentially-decaying, or periodically sinusoidal functions as well as some position-dependent initial conditions and zero-order productions specified by the Dirac delta, constant, Heaviside, or exponentially-decaying functions. The developed solutions are tested against an analytical solution from the literature. The excellent agreement between the analytical solutions confirms that the new model can serve as an effective tool for investigating transport behaviors under different scenarios. Several examples of applications, are given to explore transport behaviors which are rarely noted in the literature. The results show that the concentration waves resulting from the periodically sinusoidal input are sensitive to dispersion coefficient. The implication of this new finding is that a tracer test with a periodic input may provide additional information when for identifying the dispersion coefficients. Moreover, the solution strategy presented in this study can be extended to derive analytical models for handling more complicated problems of solute transport in multi-dimensional media subjected to sequential decay chain reactions, for which analytical solutions are not currently available.

SeSBench - An initiative to benchmark reactive transport models for environmental subsurface processes

Science.gov (United States)

Jacques, Diederik

2017-04-01

As soil functions are governed by a multitude of interacting hydrological, geochemical and biological processes, simulation tools coupling mathematical models for interacting processes are needed. Coupled reactive transport models are a typical example of such coupled tools mainly focusing on hydrological and geochemical coupling (see e.g. Steefel et al., 2015). Mathematical and numerical complexity for both the tool itself or of the specific conceptual model can increase rapidly. Therefore, numerical verification of such type of models is a prerequisite for guaranteeing reliability and confidence and qualifying simulation tools and approaches for any further model application. In 2011, a first SeSBench -Subsurface Environmental Simulation Benchmarking- workshop was held in Berkeley (USA) followed by four other ones. The objective is to benchmark subsurface environmental simulation models and methods with a current focus on reactive transport processes. The final outcome was a special issue in Computational Geosciences (2015, issue 3 - Reactive transport benchmarks for subsurface environmental simulation) with a collection of 11 benchmarks. Benchmarks, proposed by the participants of the workshops, should be relevant for environmental or geo-engineering applications; the latter were mostly related to radioactive waste disposal issues - excluding benchmarks defined for pure mathematical reasons. Another important feature is the tiered approach within a benchmark with the definition of a single principle problem and different sub problems. The latter typically benchmarked individual or simplified processes (e.g. inert solute transport, simplified geochemical conceptual model) or geometries (e.g. batch or one-dimensional, homogeneous). Finally, three codes should be involved into a benchmark. The SeSBench initiative contributes to confidence building for applying reactive transport codes. Furthermore, it illustrates the use of those type of models for different

Initial value formulation for the spherically symmetric dust solution

International Nuclear Information System (INIS)

Liu, H.

1990-01-01

An initial value formulation for the dust solution with spherical symmetry is given explicitly in which the initial distributions of dust and its velocity on an initial surface are chosen to be the initial data. As special cases, the Friedmann universe, the Schwarzschild solution in comoving coordinates, and a spherically symmetric and radially inhomogeneous cosmological model are derived

A pore structure model for the gas transport property changes, initial oxidation rates and cumulative weight loss of AGR moderator graphite

International Nuclear Information System (INIS)

Johnson, P.A.V.

1985-09-01

A quantitative model has been developed for the gas transport property variation, cumulative weight loss and initial oxidation rates of AGR moderator graphite. The model utilises the theory of dynamic moments of the pore structure to calculate the changes in physical properties brought about by radiolytic corrosion taking place within the graphite porosity. In order to account for the behaviour of the initial rate curves, and the weight loss data obtained it is necessary to invoke the presence of a group of cylindrical pore and a group of small slab-shaped pores. The latter are methane depleted. This is in addition to the pore group involved in gas transport which is best represented by cylinders of mean radius 2.13 μm. The model satisfactorily predicts the experimental weight loss data obtained from experiments in the DIDO 6V3 and BFB loops. (author)

Probabilistic and microstructural aspects of fatigue cracks initiation in Inconel 718

International Nuclear Information System (INIS)

Alexandre, F.

2004-03-01

Thermomechanical treatments have been recently developed to produce Inconel 718DA (Direct Aged). This alloy optimisation leads to an increase of the fatigue life but also the scatter. The aim of this study is on the one hand the understanding of the fatigue crack initiation mechanisms and on the other hand the modelling of the fatigue life and the scatter. An experimental study showed that the fatigue cracks were initiated from carbide particles in fine grain alloy. Interrupted tensile tests show that the particles cracking occurred at the first quarter of the fatigue cycle. Fatigue behaviour tests were also performed on various grain size 718 alloys. The last experimental part was devoted to measurements of the low cycle fatigue crack growth rates using a high focal distance microscope. For these tests, EDM micro-defects were used for the fatigue crack initiation sites. This method was also used to observe the small fatigue crack coalescence. A fatigue life model is proposed. It is based on the three fatigue crack initiation mechanisms competition: particle crack initiation on the surface, internal particle crack initiation and Stade I crack initiation. The particle fatigue crack initiation is supposed instantaneous at a critical stress level. The Tanaka and Mura model is used for analysing the Stage I crack initiation number of cycles. The fatigue crack growth rate was analysed using the Tomkins model identified on the small fatigue crack growth rate measurements. The proposed fatigue life model decomposed in three levels: a deterministic one and two probabilistic with and without crack coalescence. (author)

Photothermal waves for two temperature with a semiconducting medium under using a dual-phase-lag model and hydrostatic initial stress

Science.gov (United States)

Lotfy, Kh.

2017-07-01

The dual-phase-lag (DPL) model with two different time translations and Lord-Shulman (LS) theory with one relaxation time are applied to study the effect of hydrostatic initial stress on medium under the influence of two temperature parameter(a new model will be introduced using two temperature theory) and photothermal theory. We solved the thermal loading at the free surface in the semi-infinite semiconducting medium-coupled plasma waves with the effect of mechanical force during a photothermal process. The exact expressions of the considered variables are obtained using normal mode analysis also the two temperature coefficient ratios were obtained analytically. Numerical results for the field quantities are given in the physical domain and illustrated graphically under the effects of several parameters. Comparisons are made between the results of the two different models with and without two temperature parameter, and for two different values of the hydrostatic initial stress. A comparison is carried out between the considered variables as calculated from the generalized thermoelasticity based on the DPL model and the LS theory in the absence and presence of the thermoelastic and thermoelectric coupling parameters.

An Analysis of Missile Systems Cost Growth and Implementation of Acquisition Reform Initiatives Using a Hybrid Adjusted Cost Growth Model

National Research Council Canada - National Science Library

Abate, Christopher

2004-01-01

...) data with a hybrid adjusted cost growth (ACG) model. In addition, an analysis of acquisition reform initiatives during the treatment period was conducted to determine if reform efforts impacted missile system cost growth. A pre-reform...

Movement initiation in groups of feral horses

NARCIS (Netherlands)

Krueger, Konstanze; Flauger, Birgit; Farmer, Kate; Hemelrijk, Charlotte

Herds of ungulates, flocks of birds, swarms of insects and schools of fish move in coordinated groups. Computer models show that only one or very few animals are needed to initiate and direct movement. To investigate initiation mechanisms further, we studied two ways in which movement can be

(1→3)-β-d-Glucan and Galactomannan for Differentiating Chemical "Black Particles" and Fungal Particles Inside Peritoneal Dialysis Tubing.

Science.gov (United States)

Leelahavanichkul, Asada; Pongpirul, Krit; Thongbor, Nisa; Worasilchai, Navaporn; Petphuak, Kwanta; Thongsawang, Bussakorn; Towannang, Piyaporn; Lorvinitnun, Pichet; Sukhontasing, Kanya; Katavetin, Pisut; Praditpornsilpa, Kearkiat; Eiam-Ong, Somchai; Chindamporn, Ariya; Kanjanabuch, Talerngsak

2016-01-01

♦ Aseptic, sheet-like foreign bodies observed inside Tenckhoff (TK) catheter lumens (referred to as "black particles") are, on gross morphology, hardly distinguishable from fungal colonization because these contaminants adhere tightly to the catheter. Detection of fungal cell wall components using (1→3)-β-d-glucan (BG) and galactomannan index (GMI) might be an alternative method for differentiating the particles. ♦ Foreign particles retrieved from TK catheters in 19 peritoneal dialysis patients were examined microscopically and cultured for fungi and bacteria. Simultaneously, a Fungitell test (Associates of Cape Cod, Falmouth, MA, USA) and a Platelia Aspergillus ELISA assay (Bio-Rad Laboratories, Marnes-La-Coquette, France) were used to test the spent dialysate for BG and GMI respectively. ♦ Of the 19 patients, 9 had aseptic black particles and 10 had fungal particles in their tubing. The fungal particles looked grainy, were tightly bound to the catheter, and appeared more "colorful" than the black particles, which looked sheet-like and could easily be removed by milking the tubing. Compared with effluent from patients having aseptic particles, effluent from patients with fungal particles had significantly higher levels of BG (501 ± 70 pg/mL vs. 46 ± 10 pg/mL) and GMI (10.98 ± 2.17 vs. 0.25 ± 0.05). Most of the fungi that formed colonies inside the catheter lumen were molds not usually found in clinical practice, but likely from water or soil, suggesting environmental contamination. Interestingly, in all 10 patients with fungal colonization, visualization of black particles preceded a peritonitis episode and TK catheter removal by approximately 1-3 weeks; in patients with aseptic particles, a 17-week onset to peritonitis was observed. ♦ In all patients with particle-coated peritoneal dialysis tubing, spent dialysate should be screened for BG and GMI. Manipulation of the TK catheter by squeezing, hard flushing, or even brushing to dislodge black

Predictors of Memory Deficits in Adolescents and Young Adults with Congenital Heart Disease Compared to Healthy Controls

Directory of Open Access Journals (Sweden)

Nancy A. Pike

2016-10-01

Full Text Available Introduction: Adolescents and young adults with congenital heart disease [CHD] show a range of memory deficits, which can dramatically impact their clinical outcomes and quality of life. However, few studies have identified predictors of these memory changes. The purpose of this investigation was to identify predictors of memory deficits in adolescents and young adults with CHD after surgical palliation compared to healthy controls. Method: 156 adolescents and young adults [80 CHD and 76 controls; age 14-21 years] were recruited and administered an instrument to assess memory [Wide Range Assessment of Memory and Learning 2nd Edition – general memory index (GMI score] and completed questionnaires that measure anxiety, depression, sleepiness, health status, and self-efficacy. Descriptive and non-parametric statistics were used to assess group differences, and logistic regression to identify predictors of memory deficits. Results: CHD subjects consisted of 58% males, median age 17 years, 41% Hispanic, and medians of 2 previous heart surgeries and 14 years since last surgery. Memory deficits [GMI < 85] were identified in 50% CHD compared to 4% healthy controls [median GMI 85 vs. 108, p <0.001]. Of GMI subscale medians, CHD subjects had significantly worse memory performance vs. healthy controls [verbal 88 vs. 105, p <0.001; attention 88 vs. 109, p<0.001; working memory 86 vs. 108, p <0.001]. No significant differences appeared between groups for visual memory. Multiple clinical and psychosocial factors were identified which were statistically different on bivariate analyses between the subjects with and without memory deficits. By multivariate analysis, male gender, number of surgeries, anxiety, and self-efficacy emerged as independent predictors of memory deficits. Conclusion: Adolescents and young adults with CHD, more than a decade since their last surgery, show significant verbal, attention and working memory deficits over controls. To enhance

The development of the Be Active & Relax “Vitality in Practice” (VIP project and design of an RCT to reduce the need for recovery in office employees

Directory of Open Access Journals (Sweden)

Coffeng Jennifer K

2012-08-01

Full Text Available Abstract Background There is strong evidence to suggest that multiple work-related health problems are preceded by a higher need for recovery. Physical activity and relaxation are helpful in decreasing the need for recovery. This article aims to describe (1 the development and (2 the design of the evaluation of a daily physical activity and relaxation intervention to reduce the need for recovery in office employees. Methods/Design The study population will consist of employees of a Dutch financial service provider. The intervention was systematically developed, based on parts of the Intervention Mapping (IM protocol. Assessment of employees needs was done by combining results of face-to-face interviews, a questionnaire and focus group interviews. A set of theoretical methods and practical strategies were selected which resulted in an intervention program consisting of Group Motivational Interviewing (GMI supported by a social media platform, and environmental modifications. The Be Active & Relax program will be evaluated in a modified 2 X 2 factorial design. The environmental modifications will be pre-stratified and GMI will be randomised on department level. The program will be evaluated, using 4 arms: (1 GMI and environmental modifications; (2 environmental modifications; (3 GMI; (4 no intervention (control group. Questionnaire data on the primary outcome (need for recovery and secondary outcomes (daily physical activity, sedentary behaviour, relaxation/detachment, work- and health-related factors will be gathered at baseline (T0, at 6 months (T1, and at 12 months (T2 follow-up. In addition, an economic and a process evaluation will be performed. Discussion Reducing the need for recovery is hypothesized to be beneficial for employees, employers and society. It is assumed that there will be a reduction in need for recovery after 6 months and 12 months in the intervention group, compared to the control group. Results are expected in 2013

Orographic Impacts on Liquid and Ice-Phase Precipitation Processes during OLYMPEX

Science.gov (United States)

Petersen, W. A.; Hunzinger, A.; Gatlin, P. N.; Wolff, D. B.

2017-12-01

The Global Precipitation Measurement (GPM) mission Olympic Mountains Experiment (OLYMPEX) focused on physical validation of GPM products in cold-season, mid-latitude frontal precipitation occurring over the Olympic Mountains of Washington State. Herein, we use data collected by the NASA S-band polarimetric radar (NPOL) to quantify and examine ice (IWP), liquid (LWP) and total water paths (TWP) relative to surface precipitation rates and column hydrometeor types for several cases occurring in different synoptic and/or Froude number regimes. These quantities are compared to coincident precipitation properties measured or estimated by GPM's Microwave Imager (GMI) and Dual-frequency Precipitation Radar (DPR). Because ice scattering is the dominant radiometric signature used by the GMI for estimating precipitation over land, and because the DPR is greatly affected by ground clutter in the lowest 1 - 2 km above ground, measurement limitations combined with orographic forcing may impact the degree to which DPR and/or GMI algorithms are able to adequately observe and estimate precipitation over and around orography.Preliminary case results suggest: 1) as expected, the Olympic Mountains force robust enhancements in the liquid and ice microphysical processes on windward slopes, especially in atmospheric river events; 2) localized orographic enhancements alter the balance of liquid and frozen precipitation contributions (IWP/TWP, LWP/TWP) to near surface rain rate, and for two cases examined thus far the balance seems to be sensitive to flow direction at specific intersections with the terrain orientation; and 3) GPM measurement limitations related to the depth of surface clutter impact for the DPR, and degree to which ice processes are coupled to the orographic rainfall process (DPR and GMI), especially along windward mountain slopes, may constrain the ability of retrieval algorithms to properly estimate near-surface precipitation quantities over complex terrain. Ongoing

Predicting debris-flow initiation and run-out with a depth-averaged two-phase model and adaptive numerical methods

Science.gov (United States)

George, D. L.; Iverson, R. M.

2012-12-01

Numerically simulating debris-flow motion presents many challenges due to the complicated physics of flowing granular-fluid mixtures, the diversity of spatial scales (ranging from a characteristic particle size to the extent of the debris flow deposit), and the unpredictability of the flow domain prior to a simulation. Accurately predicting debris-flows requires models that are complex enough to represent the dominant effects of granular-fluid interaction, while remaining mathematically and computationally tractable. We have developed a two-phase depth-averaged mathematical model for debris-flow initiation and subsequent motion. Additionally, we have developed software that numerically solves the model equations efficiently on large domains. A unique feature of the mathematical model is that it includes the feedback between pore-fluid pressure and the evolution of the solid grain volume fraction, a process that regulates flow resistance. This feature endows the model with the ability to represent the transition from a stationary mass to a dynamic flow. With traditional approaches, slope stability analysis and flow simulation are treated separately, and the latter models are often initialized with force balances that are unrealistically far from equilibrium. Additionally, our new model relies on relatively few dimensionless parameters that are functions of well-known material properties constrained by physical data (eg. hydraulic permeability, pore-fluid viscosity, debris compressibility, Coulomb friction coefficient, etc.). We have developed numerical methods and software for accurately solving the model equations. By employing adaptive mesh refinement (AMR), the software can efficiently resolve an evolving debris flow as it advances through irregular topography, without needing terrain-fit computational meshes. The AMR algorithms utilize multiple levels of grid resolutions, so that computationally inexpensive coarse grids can be used where the flow is absent, and

Recent Upgrades to NASA SPoRT Initialization Datasets for the Environmental Modeling System

Science.gov (United States)

Case, Jonathan L.; LaFontaine, Frank J.; Molthan, Andrew L.; Zavodsky, Bradley T.; Rozumalski, Robert A.

2012-01-01

The NASA Short-term Prediction Research and Transition (SPoRT) Center has developed several products for its National Weather Service (NWS) partners that can initialize specific fields for local model runs within the NOAA/NWS Science and Training Resource Center (STRC) Environmental Modeling System (EMS). In last year's NWA abstract on this topic, the suite of SPoRT products supported in the STRC EMS was presented, which includes a Sea Surface Temperature (SST) composite, a Great Lakes sea-ice extent, a Green Vegetation Fraction (GVF) composite, and NASA Land Information System (LIS) gridded output. This abstract and companion presentation describes recent upgrades made to the SST and GVF composites, as well as the real-time LIS runs. The Great Lakes sea-ice product is unchanged from 2011. The SPoRT SST composite product has been expanded geographically and as a result, the resolution has been coarsened from 1 km to 2 km to accommodate the larger domain. The expanded domain covers much of the northern hemisphere from eastern Asia to western Europe (0 N to 80 N latitude and 150 E to 10 E longitude). In addition, the NESDIS POES-GOES product was added to fill in gaps caused by the Moderate Resolution Imaging Spectroradiometer (MODIS) being unable to sense in cloudy regions, replacing the recently-lost Advanced Microwave Scanning Radiometer for EOS with negligible change to product fidelity. The SST product now runs twice per day for Terra and Aqua combined data collections from 0000 to 1200 UTC and from 1200 to 0000 UTC, with valid analysis times at 0600 and 1800 UTC. The twice-daily compositing technique reduces the overall latency of the previous version while still representing the diurnal cycle characteristics. The SST composites are available at approximately four hours after the end of each collection period (i.e. 1600 UTC for the nighttime analysis and 0400 UTC for the daytime analysis). The real-time MODIS GVF composite has only received minor updates in the

Impact of Active Climate Control Seats on Energy Use, Fuel Use, and CO2 Emissions

Energy Technology Data Exchange (ETDEWEB)

Kreutzer, Cory J [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Rugh, John P [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Titov, Eugene V [National Renewable Energy Laboratory (NREL), Golden, CO (United States); Kekelia, Bidzina [National Renewable Energy Laboratory (NREL), Golden, CO (United States)

2017-11-28

A project was developed through collaboration between Gentherm and NREL to determine the impact of climate control seats for light-duty vehicles in the United States. The project used a combination of experimentation and analysis, with experimental results providing critical input to the analysis process. First, outdoor stationary vehicle testing was performed at NREL's facility in Golden, CO using multiple occupants. Two pre-production Ford Focus electric vehicles were used for testing; one containing a standard inactive seat and the second vehicle containing a Gentherm climate control seat. Multiple maximum cool-down and steady-state cooling tests were performed in late summer conditions. The two vehicles were used to determine the increase in cabin temperature when using the climate control seat in comparison to the baseline vehicle cabin temperature with a standard seat at the equivalent occupant whole-body sensation. The experiments estimated that on average, the climate control seats allowed for a 2.61 degrees Celsius increase in vehicle cabin temperature at equivalent occupant body sensation compared to the baseline vehicle. The increased cabin air temperature along with their measured energy usage were then used as inputs to the national analysis process. The national analysis process was constructed from full vehicle cabin, HVAC, and propulsion models previously developed by NREL. In addition, three representative vehicle platforms, vehicle usage patterns, and vehicle registration weighted environmental data were integrated into the analysis process. Both the baseline vehicle and the vehicle with climate control seats were simulated, using the experimentally determined cabin temperature offset of 2.61degrees Celsius and added seat energy as inputs to the climate control seat vehicle model. The U.S. composite annual fuel use savings for the climate control seats over the baseline A/C system was determined to be 5.1 gallons of gasoline per year per

Experimental and modeling study on pyrolysis of n-decane initiated by nitromethane

KAUST Repository

Jia, Zhenjian; Wang, Zhandong; Cheng, Zhanjun; Zhou, Weixing

2016-01-01

Initiator could accelerate the rate of hydrocarbon pyrolysis and reduce the required material temperatures for a hypersonic aircraft heat exchanger/reactor. Nitroalkanes were proposed as the effective initiator because of the lower CN bond

GPM Mission Gridded Text Products Providing Surface Precipitation Retrievals

Science.gov (United States)

Stocker, Erich Franz; Kelley, Owen; Huffman, George; Kummerow, Christian

2015-04-01

In February 2015, the Global Precipitation Measurement (GPM) mission core satellite will complete its first year in space. The core satellite carries a conically scanning microwave imager called the GPM Microwave Imager (GMI), which also has 166 GHz and 183 GHz frequency channels. The GPM core satellite also carries a dual frequency radar (DPR) which operates at Ku frequency, similar to the Tropical Rainfall Measuring Mission (TRMM) Precipitation Radar), and a new Ka frequency. The precipitation processing system (PPS) is producing swath-based instantaneous precipitation retrievals from GMI, both radars including a dual-frequency product, and a combined GMI/DPR precipitation retrieval. These level 2 products are written in the HDF5 format and have many additional parameters beyond surface precipitation that are organized into appropriate groups. While these retrieval algorithms were developed prior to launch and are not optimal, these algorithms are producing very creditable retrievals. It is appropriate for a wide group of users to have access to the GPM retrievals. However, for reseachers requiring only surface precipitation, these L2 swath products can appear to be very intimidating and they certainly do contain many more variables than the average researcher needs. Some researchers desire only surface retrievals stored in a simple easily accessible format. In response, PPS has begun to produce gridded text based products that contain just the most widely used variables for each instrument (surface rainfall rate, fraction liquid, fraction convective) in a single line for each grid box that contains one or more observations. This paper will describe the gridded data products that are being produced and provide an overview of their content. Currently two types of gridded products are being produced: (1) surface precipitation retrievals from the core satellite instruments - GMI, DPR, and combined GMI/DPR (2) surface precipitation retrievals for the partner

International EUREKA: Initialization Segment

International Nuclear Information System (INIS)

1982-02-01

The Initialization Segment creates the starting description of the uranium market. The starting description includes the international boundaries of trade, the geologic provinces, resources, reserves, production, uranium demand forecasts, and existing market transactions. The Initialization Segment is designed to accept information of various degrees of detail, depending on what is known about each region. It must transform this information into a specific data structure required by the Market Segment of the model, filling in gaps in the information through a predetermined sequence of defaults and built in assumptions. A principal function of the Initialization Segment is to create diagnostic messages indicating any inconsistencies in data and explaining which assumptions were used to organize the data base. This permits the user to manipulate the data base until such time the user is satisfied that all the assumptions used are reasonable and that any inconsistencies are resolved in a satisfactory manner

Maximum likelihood fitting of FROC curves under an initial-detection-and-candidate-analysis model

International Nuclear Information System (INIS)

Edwards, Darrin C.; Kupinski, Matthew A.; Metz, Charles E.; Nishikawa, Robert M.

2002-01-01

We have developed a model for FROC curve fitting that relates the observer's FROC performance not to the ROC performance that would be obtained if the observer's responses were scored on a per image basis, but rather to a hypothesized ROC performance that the observer would obtain in the task of classifying a set of 'candidate detections' as positive or negative. We adopt the assumptions of the Bunch FROC model, namely that the observer's detections are all mutually independent, as well as assumptions qualitatively similar to, but different in nature from, those made by Chakraborty in his AFROC scoring methodology. Under the assumptions of our model, we show that the observer's FROC performance is a linearly scaled version of the candidate analysis ROC curve, where the scaling factors are just given by the FROC operating point coordinates for detecting initial candidates. Further, we show that the likelihood function of the model parameters given observational data takes on a simple form, and we develop a maximum likelihood method for fitting a FROC curve to this data. FROC and AFROC curves are produced for computer vision observer datasets and compared with the results of the AFROC scoring method. Although developed primarily with computer vision schemes in mind, we hope that the methodology presented here will prove worthy of further study in other applications as well

Characteristics of patients initiating raloxifene compared to those initiating bisphosphonates

Directory of Open Access Journals (Sweden)

Wang Sara

2008-12-01

previous 12 months. These differences remained statistically significant in the multivariate model. Conclusion In this sample of patients enrolled in commercial, Medicare, and Medicaid plans, patients who initiated raloxifene treatment differed from those initiating bisphosphonates. Raloxifene patients were younger, had better overall health status and appeared to be less likely to have risk factors for new osteoporotic fractures than bisphosphonate patients. Differences in the clinical profiles of these agents may impact prescribing decisions. Investigators using observational data to make comparisons of treatment outcomes associated with these medications should take these important differences in patient characteristics into consideration.

NCBI nr-aa BLAST: CBRC-LAFR-01-2095 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-LAFR-01-2095 ref|NP_519386.1| PROBABLE SN-GLYCEROL-3-PHOSPHATE TRANSMEMBRANE A...BC TRANSPORTER PROTEIN [Ralstonia solanacearum GMI1000] emb|CAD14967.1| probable sn-glycerol-3-phosphate transme

Using Collaborative Simulation Modeling to Develop a Web-Based Tool to Support Policy-Level Decision Making About Breast Cancer Screening Initiation Age

Directory of Open Access Journals (Sweden)

Elizabeth S. Burnside MD, MPH, MS

2017-07-01

Full Text Available Background: There are no publicly available tools designed specifically to assist policy makers to make informed decisions about the optimal ages of breast cancer screening initiation for different populations of US women. Objective: To use three established simulation models to develop a web-based tool called Mammo OUTPuT. Methods: The simulation models use the 1970 US birth cohort and common parameters for incidence, digital screening performance, and treatment effects. Outcomes include breast cancers diagnosed, breast cancer deaths averted, breast cancer mortality reduction, false-positive mammograms, benign biopsies, and overdiagnosis. The Mammo OUTPuT tool displays these outcomes for combinations of age at screening initiation (every year from 40 to 49, annual versus biennial interval, lifetime versus 10-year horizon, and breast density, compared to waiting to start biennial screening at age 50 and continuing to 74. The tool was piloted by decision makers (n = 16 who completed surveys. Results: The tool demonstrates that benefits in the 40s increase linearly with earlier initiation age, without a specific threshold age. Likewise, the harms of screening increase monotonically with earlier ages of initiation in the 40s. The tool also shows users how the balance of benefits and harms varies with breast density. Surveys revealed that 100% of users (16/16 liked the appearance of the site; 94% (15/16 found the tool helpful; and 94% (15/16 would recommend the tool to a colleague. Conclusions: This tool synthesizes a representative subset of the most current CISNET (Cancer Intervention and Surveillance Modeling Network simulation model outcomes to provide policy makers with quantitative data on the benefits and harms of screening women in the 40s. Ultimate decisions will depend on program goals, the population served, and informed judgments about the weight of benefits and harms.

Evidence of Convective Redistribution of Carbon Monoxide in Aura Tropospheric Emission Sounder (TES) and Microwave Limb Sounder (MLS) Observations

Science.gov (United States)

Manyin, Michael; Douglass, Anne; Schoeberl, Mark

2010-01-01

Vertical convective transport is a key element of the tropospheric circulation. Convection lofts air from the boundary layer into the free troposphere, allowing surface emissions to travel much further, and altering the rate of chemical processes such as ozone production. This study uses satellite observations to focus on the convective transport of CO from the boundary layer to the mid and upper troposphere. Our hypothesis is that strong convection associated with high rain rate regions leads to a correlation between mid level and upper level CO amounts. We first test this hypothesis using the Global Modeling Initiative (GMI) chemistry and transport model. We find the correlation is robust and increases as the precipitation rate (the strength of convection) increases. We next examine three years of CO profiles from the Tropospheric Emission Sounder (TES) and Microwave Limb Sounder (MLS) instruments aboard EOS Aura. Rain rates are taken from the Tropical Rainfall Measuring Mission (TRMM) 3B-42 multi-satellite product. Again we find a correlation between mid-level and upper tropospheric CO, which increases with rain rate. Our result shows the critical importance of tropical convection in coupling vertical levels of the troposphere in the transport of trace gases. The effect is seen most clearly in strong convective regions such as the Inter-tropical Convergence Zone.

Formal Specification and Description Language and Message Sequence Chart to Model and Validate Session Initiation Protocol Services

OpenAIRE

Sa'ed Abed; Mohammad H. Al Shayeji; Ovais Ahmed; Sahel Alouneh

2016-01-01

Session Initiation Protocol (SIP) is a signaling layer protocol for building, adjusting and ending sessions among participants including Internet conferences, telephone calls and multimedia distribution. SIP facilitates user movement by proxying and forwarding requests to the present location of the user. In this paper, we provide a formal Specification and Description Language (SDL) and Message Sequence Chart (MSC) to model and define the Internet Engineering Task Force (IETF) SIP protocol a...

Initiation of Setaria as a model plant

Directory of Open Access Journals (Sweden)

Xianmin DIAO,James SCHNABLE,Jeffrey L. BENNETZEN,Jiayang LI

2014-02-01

Full Text Available Model organisms such as Arabidopsis (Arabidopsis thaliana and rice (Oryza sativa have proven essential for efficient scientific discovery and development of new methods. With the diversity of plant lineages, some important processes such as C4 photosynthesis are not found in either Arabidopsis or rice, so new model species are needed. Due to their small diploid genomes, short life cycles, self-pollination, small adult statures and prolific seed production, domesticated foxtail millet (Setaria italica and its wild ancestor, green foxtail (S. viridis, have recently been proposed as novel model species for functional genomics of the Panicoideae, especially for study of C4 photosynthesis. This review outlines the development of these species as model organisms, and discusses current challenges and future potential of a Setaria model.

The Initial Conditions of Fractional Calculus

International Nuclear Information System (INIS)

Trigeassou, J. C.; Maamri, N.

2011-01-01

During the past fifty years , Fractional Calculus has become an original and renowned mathematical tool for the modelling of diffusion Partial Differential Equations and the design of robust control algorithms. However, in spite of these celebrated results, some theoretical problems have not yet received a satisfying solution. The mastery of initial conditions, either for Fractional Differential Equations (FDEs) or for the Caputo and Riemann-Liouville fractional derivatives, remains an open research domain. The solution of this fundamental problem, also related to the long range memory property, is certainly the necessary prerequisite for a satisfying approach to modelling and control applications. The fractional integrator and its continuously frequency distributed differential model is a valuable tool for the simulation of fractional systems and the solution of initial condition problems. Indeed, the infinite dimensional state vector of fractional integrators allows the direct generalization to fractional calculus of the theoretical results of integer order systems. After a reminder of definitions and properties related to fractional derivatives and systems, this presentation is intended to show, based on the results of two recent publications [1,2], how the fractional integrator provides the solution of the initial condition problem of FDEs and of Caputo and Riemann-Liouville fractional derivatives. Numerical simulation examples illustrate and validate these new theoretical concepts.

ORF Alignment: NC_003296 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003296 gi|17548586 >1gkmA 10 504 26 526 e-118 ... ref|NP_521926.1| PROBABLE HISTIDINE AMMONIA...-LYASE PROTEIN [Ralstonia solanacearum ... GMI1000] emb|CAD17516.1| PROBABLE HISTIDINE ... AMMONIA

An Initial Design of ISO 19152:2012 LADM Based Valuation and Taxation Data Model

Science.gov (United States)

Çağdaş, V.; Kara, A.; van Oosterom, P.; Lemmen, C.; Işıkdağ, Ü.; Kathmann, R.; Stubkjær, E.

2016-10-01

A fiscal registry or database is supposed to record geometric, legal, physical, economic, and environmental characteristics in relation to property units, which are subject to immovable property valuation and taxation. Apart from procedural standards, there is no internationally accepted data standard that defines the semantics of fiscal databases. The ISO 19152:2012 Land Administration Domain Model (LADM), as an international land administration standard focuses on legal requirements, but considers out of scope specifications of external information systems including valuation and taxation databases. However, it provides a formalism which allows for an extension that responds to the fiscal requirements. This paper introduces an initial version of a LADM - Fiscal Extension Module for the specification of databases used in immovable property valuation and taxation. The extension module is designed to facilitate all stages of immovable property taxation, namely the identification of properties and taxpayers, assessment of properties through single or mass appraisal procedures, automatic generation of sales statistics, and the management of tax collection, dealing with arrears and appeals. It is expected that the initial version will be refined through further activities held by a possible joint working group under FIG Commission 7 (Cadastre and Land Management) and FIG Commission 9 (Valuation and the Management of Real Estate) in collaboration with other relevant international bodies.

(Re)evaluating the Implications of the Autoregressive Latent Trajectory Model Through Likelihood Ratio Tests of Its Initial Conditions.

Science.gov (United States)

Ou, Lu; Chow, Sy-Miin; Ji, Linying; Molenaar, Peter C M

2017-01-01

The autoregressive latent trajectory (ALT) model synthesizes the autoregressive model and the latent growth curve model. The ALT model is flexible enough to produce a variety of discrepant model-implied change trajectories. While some researchers consider this a virtue, others have cautioned that this may confound interpretations of the model's parameters. In this article, we show that some-but not all-of these interpretational difficulties may be clarified mathematically and tested explicitly via likelihood ratio tests (LRTs) imposed on the initial conditions of the model. We show analytically the nested relations among three variants of the ALT model and the constraints needed to establish equivalences. A Monte Carlo simulation study indicated that LRTs, particularly when used in combination with information criterion measures, can allow researchers to test targeted hypotheses about the functional forms of the change process under study. We further demonstrate when and how such tests may justifiably be used to facilitate our understanding of the underlying process of change using a subsample (N = 3,995) of longitudinal family income data from the National Longitudinal Survey of Youth.

Experimental verification of dose calculation using the simplified Monte Carlo method with an improved initial beam model for a beam-wobbling system

International Nuclear Information System (INIS)

Tansho, Ryohei; Takada, Yoshihisa; Mizutani, Shohei; Kohno, Ryosuke; Hotta, Kenji; Akimoto, Tetsuo; Hara, Yousuke

2013-01-01

A beam delivery system using a single-radius-beam-wobbling method has been used to form a conformal irradiation field for proton radiotherapy in Japan. A proton beam broadened by the beam-wobbling system provides a non-Gaussian distribution of projection angle different in two mutually orthogonal planes with a common beam central axis, at a certain position. However, the conventional initial beam model for dose calculations has been using an approximation of symmetric Gaussian angular distribution with the same variance in both planes (called here a Gaussian model with symmetric variance (GMSV)), instead of the accurate one. We have developed a more accurate initial beam model defined as a non-Gaussian model with asymmetric variance (NonGMAV), and applied it to dose calculations using the simplified Monte Carlo (SMC) method. The initial beam model takes into account the different distances of two beam-wobbling magnets from the iso-center and also the different amplitudes of kick angle given by each magnet. We have confirmed that the calculation using the SMC with NonGMAV reproduced the measured dose distribution formed in air by a mono-energetic proton beam passing through a square aperture collimator better than with the GMSV and with a Gaussian model with asymmetric variance (GMAV) in which different variances of angular distributions are used in the two mutually orthogonal planes. Measured dose distributions in a homogeneous phantom formed by a modulated proton beam passing through a range shifter and an L-shaped range compensator, were consistent with calculations using the SMC with GMAV and NonGMAV, but in disagreement with calculations using the SMC with GMSV. Measured lateral penumbrae in a lateral direction were reproduced better by calculations using the SMC with NonGMAV than by those with GMAV, when an aperture collimator with a smaller opening was used. We found that such a difference can be attributed to the non-Gaussian angular distribution of the

Longitudinal Modeling of Adolescent Normative Beliefs and Substance Initiation

Science.gov (United States)

Lillehoj, Catherine J.; Trudeau, Linda; Spoth, Richard

2005-01-01

Pstudy investigated the effects of baseline levels of academic achievement and longitudinal trends in normative beliefs on adolescent substance initiation across a 42-month time period. Participants were 272 rural adolescents who were an average of 12.3 years old at the baseline assessment. Academic achievement positively predicted the intercept…

The initiation and tectonic regimes of the Cenozoic extension in the Bohai Bay Basin, North China revealed by numerical modelling

Science.gov (United States)

Li, Lu; Qiu, Nansheng

2017-06-01

In this study the dynamic aspects of the Cenozoic extension in the Bohai Bay Basin are considered in the context of initial thickness of the crust and lithosphere, tectonic force, strain rate and thermal rheology, which are directly or indirectly estimated from a pure shear extensional model. It is accordingly reasonable to expect that, in the Bohai Bay Basin, the thickness variation could be present prior to the initiation of extension. The extensional deformation is localized by a thickness variation of the crust and lithosphere and the heterogeneity of the initial thickness plays an important role in rifting dynamics. The onset of rifting requires a critical tectonic force (initial tectonic force) to be applied, which then immediately begins to decay gradually. Rifting will only occur when the total effective buoyancy force of the subducting slab reaches a critical level, after a certain amount of subduction taking place. The magnitude of the tectonic force decreases with time in the early phase of rifting, which indicates the weakening due to the increase in geothermal gradient. In order to deform the continental lithosphere within the currently accepted maximum magnitude of the force derived from subducted slab roll-back, the following conditions should be satisfied: (1) the thickness of the continental lithosphere is significantly thin and less than 125 km and (2) the lithosphere has a wet and hot rheology, which provides implications for rheological layering in continental lithosphere. Our results are strongly supported by the ;crème brûlée; model, in which the lower crust and mantle are relatively ductile.

Multi-Stakeholder Collaboration in Russian and Swedish Model Forest Initiatives: Adaptive Governance Toward Sustainable Forest Management?

Directory of Open Access Journals (Sweden)

Marine Elbakidze

2010-06-01

Full Text Available Building the adaptive capacity of interlinked social and ecological systems is assumed to improve implementation of sustainable forest management (SFM policies. One mechanism is collaborative learning by continuous evaluation, communication, and transdisciplinary knowledge production. The Model Forest (MF concept, developed in Canada, is intended to encourage all dimensions of sustainable development through collaboration among stakeholders of forest resources in a geographical area. Because the MF approach encompasses both social and ecological systems, it can be seen as a process aimed at improving adaptive capacity to deal with uncertainty and change. We analyzed multi-stakeholder approaches used in four MF initiatives representing social-ecological systems with different governance legacies and economic histories in the northwest of the Russian Federation (Komi MF and Pskov MF and in Sweden (Vilhelmina MF and the Foundation Säfsen Forests in the Bergslagen region. To describe the motivations behind development of the initiative and the governance systems, we used qualitative open-ended interviews and analyzed reports and official documents. The initial driving forces for establishing new local governance arrangements were different in all four cases. All MFs were characterized by multi-level and multi-sector collaboration. However, the distribution of power among stakeholders ranged from clearly top down in the Russian Federation to largely bottom up in Sweden. All MF initiatives shared three main challenges: (a to develop governance arrangements that include representative actors and stakeholders, (b to combine top-down and bottom-up approaches to governance, and (c to coordinate different sectors' modes of landscape governance. We conclude that, in principle, the MF concept is a promising approach to multi-stakeholder collaboration. However, to understand the local and regional dimensions of sustainability, and the level of adaptability

The role of social networks and media receptivity in predicting age of smoking initiation: a proportional hazards model of risk and protective factors.

Science.gov (United States)

Unger, J B; Chen, X

1999-01-01

The increasing prevalence of adolescent smoking demonstrates the need to identify factors associated with early smoking initiation. Previous studies have shown that smoking by social network members and receptivity to pro-tobacco marketing are associated with smoking among adolescents. It is not clear, however, whether these variables also are associated with the age of smoking initiation. Using data from 10,030 California adolescents, this study identified significant correlates of age of smoking initiation using bivariate methods and a multivariate proportional hazards model. Age of smoking initiation was earlier among those adolescents whose friends, siblings, or parents were smokers, and among those adolescents who had a favorite tobacco advertisement, had received tobacco promotional items, or would be willing to use tobacco promotional items. Results suggest that the smoking behavior of social network members and pro-tobacco media influences are important determinants of age of smoking initiation. Because early smoking initiation is associated with higher levels of addiction in adulthood, tobacco control programs should attempt to counter these influences.

H I versus H α - comparing the kinematic tracers in modelling the initial conditions of the Mice

Science.gov (United States)

Mortazavi, S. Alireza; Lotz, Jennifer M.; Barnes, Joshua E.; Privon, George C.; Snyder, Gregory F.

2018-03-01

We explore the effect of using different kinematic tracers (H I and H α) on reconstructing the encounter parameters of the Mice major galaxy merger (NGC 4676A/B). We observed the Mice using the SparsePak Integral Field Unit (IFU) on the WIYN telescope, and compared the H α velocity map with VLA H I observations. The relatively high spectral resolution of our data (R ≈ 5000) allows us to resolve more than one kinematic component in the emission lines of some fibres. We separate the H α-[N II] emission of the star-forming regions from shocks using their [N II]/H α line ratio and velocity dispersion. We show that the velocity of star-forming regions agree with that of the cold gas (H I), particularly, in the tidal tails of the system. We reconstruct the morphology and kinematics of these tidal tails utilizing an automated modelling method based on the IDENTIKIT software package. We quantify the goodness of fit and the uncertainties of the derived encounter parameters. Most of the initial conditions reconstructed using H α and H I are consistent with each other, and qualitatively agree with the results of previous works. For example, we find 210± ^{50}_{40} Myr, and 180± ^{50}_{40} Myr for the time since pericentre, when modelling H α and H I kinematics, respectively. This confirms that in some cases, H α kinematics can be used instead of H I kinematics for reconstructing the initial conditions of galaxy mergers, and our automated modelling method is applicable to some merging systems.

NCBI nr-aa BLAST: CBRC-ACAR-01-1107 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-ACAR-01-1107 ref|NP_519445.1| PROBABLE TRANSMEMBRANE PROTEIN [Ralstonia solana...cearum GMI1000] emb|CAD15026.1| probable lipid a biosynthesis transmembrane protein [Ralstonia solanacearum] NP_519445.1 6.1 29% ...

NCBI nr-aa BLAST: CBRC-SCER-15-0000 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-SCER-15-0000 ref|NP_520947.1| PROBABLE FIMBRIAL ASSEMBLY TRANSMEMBRANE PROTEIN... [Ralstonia solanacearum GMI1000] emb|CAD16533.1| probable fimbrial assembly transmembrane protein [Ralstonia solanacearum] NP_520947.1 1.3 24% ...

Combat Wound Initiative program.

Science.gov (United States)

Stojadinovic, Alexander; Elster, Eric; Potter, Benjamin K; Davis, Thomas A; Tadaki, Doug K; Brown, Trevor S; Ahlers, Stephen; Attinger, Christopher E; Andersen, Romney C; Burris, David; Centeno, Jose; Champion, Hunter; Crumbley, David R; Denobile, John; Duga, Michael; Dunne, James R; Eberhardt, John; Ennis, William J; Forsberg, Jonathan A; Hawksworth, Jason; Helling, Thomas S; Lazarus, Gerald S; Milner, Stephen M; Mullick, Florabel G; Owner, Christopher R; Pasquina, Paul F; Patel, Chirag R; Peoples, George E; Nissan, Aviram; Ring, Michael; Sandberg, Glenn D; Schaden, Wolfgang; Schultz, Gregory S; Scofield, Tom; Shawen, Scott B; Sheppard, Forest R; Stannard, James P; Weina, Peter J; Zenilman, Jonathan M

2010-07-01

The Combat Wound Initiative (CWI) program is a collaborative, multidisciplinary, and interservice public-private partnership that provides personalized, state-of-the-art, and complex wound care via targeted clinical and translational research. The CWI uses a bench-to-bedside approach to translational research, including the rapid development of a human extracorporeal shock wave therapy (ESWT) study in complex wounds after establishing the potential efficacy, biologic mechanisms, and safety of this treatment modality in a murine model. Additional clinical trials include the prospective use of clinical data, serum and wound biomarkers, and wound gene expression profiles to predict wound healing/failure and additional clinical patient outcomes following combat-related trauma. These clinical research data are analyzed using machine-based learning algorithms to develop predictive treatment models to guide clinical decision-making. Future CWI directions include additional clinical trials and study centers and the refinement and deployment of our genetically driven, personalized medicine initiative to provide patient-specific care across multiple medical disciplines, with an emphasis on combat casualty care.

A latent transition model of the effects of a teen dating violence prevention initiative.

Science.gov (United States)

Williams, Jason; Miller, Shari; Cutbush, Stacey; Gibbs, Deborah; Clinton-Sherrod, Monique; Jones, Sarah

2015-02-01

Patterns of physical and psychological teen dating violence (TDV) perpetration, victimization, and related behaviors were examined with data from the evaluation of the Start Strong: Building Healthy Teen Relationships initiative, a dating violence primary prevention program targeting middle school students. Latent class and latent transition models were used to estimate distinct patterns of TDV and related behaviors of bullying and sexual harassment in seventh grade students at baseline and to estimate transition probabilities from one pattern of behavior to another at the 1-year follow-up. Intervention effects were estimated by conditioning transitions on exposure to Start Strong. Latent class analyses suggested four classes best captured patterns of these interrelated behaviors. Classes were characterized by elevated perpetration and victimization on most behaviors (the multiproblem class), bullying perpetration/victimization and sexual harassment victimization (the bully-harassment victimization class), bullying perpetration/victimization and psychological TDV victimization (bully-psychological victimization), and experience of bully victimization (bully victimization). Latent transition models indicated greater stability of class membership in the comparison group. Intervention students were less likely to transition to the most problematic pattern and more likely to transition to the least problem class. Although Start Strong has not been found to significantly change TDV, alternative evaluation models may find important differences. Latent transition analysis models suggest positive intervention impact, especially for the transitions at the most and the least positive end of the spectrum. Copyright © 2015. Published by Elsevier Inc.

Mesenchymal stem cells cancel azoxymethane-induced tumor initiation.

Science.gov (United States)

Nasuno, Masanao; Arimura, Yoshiaki; Nagaishi, Kanna; Isshiki, Hiroyuki; Onodera, Kei; Nakagaki, Suguru; Watanabe, Shuhei; Idogawa, Masashi; Yamashita, Kentaro; Naishiro, Yasuyoshi; Adachi, Yasushi; Suzuki, Hiromu; Fujimiya, Mineko; Imai, Kohzoh; Shinomura, Yasuhisa

2014-04-01

The role of mesenchymal stem cells (MSCs) in tumorigenesis remains controversial. Therefore, our goal was to determine whether exogenous MSCs possess intrinsic antineoplastic or proneoplastic properties in azoxymethane (AOM)-induced carcinogenesis. Three in vivo models were studied: an AOM/dextran sulfate sodium colitis-associated carcinoma model, an aberrant crypt foci model, and a model to assess the acute apoptotic response of a genotoxic carcinogen (AARGC). We also performed in vitro coculture experiments. As a result, we found that MSCs partially canceled AOM-induced tumor initiation but not tumor promotion. Moreover, MSCs inhibited the AARGC in colonic epithelial cells because of the removal of O(6)-methylguanine (O(6) MeG) adducts through O(6) MeG-DNA methyltransferase activation. Furthermore, MSCs broadly affected the cell-cycle machinery, potentially leading to G1 arrest in vivo. Coculture of IEC-6 rat intestinal cells with MSCs not only arrested the cell cycle at the G1 phase, but also induced apoptosis. The anti-carcinogenetic properties of MSCs in vitro required transforming growth factor (TGF)-β signaling because such properties were completely abrogated by absorption of TGF-β under indirect coculture conditions. MSCs inhibited AOM-induced tumor initiation by preventing the initiating cells from sustaining DNA insults and subsequently inducing G1 arrest in the initiated cells that escaped from the AARGC. Furthermore, tumor initiation perturbed by MSCs might potentially dysregulate WNT and TGF-β-Smad signaling pathways in subsequent tumorigenesis. Obtaining a better understanding of MSC functions in colon carcinogenesis is essential before commencing the broader clinical application of promising MSC-based therapies for cancer-prone patients with inflammatory bowel disease. © AlphaMed Press.

A magnetic nanocomposite for biomimetic flow sensing

KAUST Repository

Alfadhel, Ahmed

2014-01-01

A magnetic nanocomposite has been implemented as artificial hair on a giant magnetoimpedance (GMI) thin-film sensor for flow sensing. The 500 μm long and 100 μm in diameter pillars are composed of iron nanowires incorporated in polydimethylsiloxane (PDMS). The nanowires\\' length and diameter are 6 μm and 35 nm, respectively. Upon fluid flow, the pillars are deflected, causing a change in the magnetic field at the GMI element and a corresponding change in impedance. The permanent magnetic behavior of the nanowires in combination with the GMI sensor and the high elasticity of the PDMS pillars result in a high-performance flow sensor with low power consumption and potential for remote detection. No additional magnetic field is required to magnetize the nanowires or bias the sensor, which simplifies miniaturization and integration in microsystems. At a power consumption of 31.6 μW, air flow rates up to 190 mm s-1 can be detected with a sensitivity of 24 mΩ (mm)-1 s and a resolution of 0.56 mm s-1 while the range for water flow is up to 7.8 mm s-1 with a sensitivity of 0.9 Ω (mm)-1 s and a resolution of 15 μm s-1. When power consumption is reduced to as low as 80 nW a high resolution of 32 μm s-1 is still maintained.

NCBI nr-aa BLAST: CBRC-XTRO-01-0649 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-0649 ref|NP_521460.1| PROBABLE TRANSMEMBRANE ABC TRANSPORTER PROTEIN [...Ralstonia solanacearum GMI1000] emb|CAD17129.1| probable transmembrane abc transporter protein [Ralstonia solanacearum] NP_521460.1 1e-133 79% ...

NCBI nr-aa BLAST: CBRC-XTRO-01-0657 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-0657 ref|NP_521459.1| PROBABLE TRANSMEMBRANE ABC TRANSPORTER PROTEIN [...Ralstonia solanacearum GMI1000] emb|CAD17128.1| probable transmembrane abc transporter protein [Ralstonia solanacearum] NP_521459.1 6e-91 75% ...

The social paediatrics initiative: a RICHER model of primary health care for at risk children and their families.

Science.gov (United States)

Wong, Sabrina T; Lynam, M Judith; Khan, Koushambhi B; Scott, Lorine; Loock, Christine

2012-10-04

The Responsive Interdisciplinary Child-Community Health Education and Research (RICHER) initiative is an intersectoral and interdisciplinary community outreach primary health care (PHC) model. It is being undertaken in partnership with community based organizations in order to address identified gaps in the continuum of health services delivery for 'at risk' children and their families. As part of a larger study, this paper reports on whether the RICHER initiative is associated with increased: 1) access to health care for children and families with multiple forms of disadvantage and 2) patient-reported empowerment. This study provides the first examination of a model of delivering PHC, using a Social Paediatrics approach. This was a mixed-methods study, using quantitative and qualitative approaches; it was undertaken in partnership with the community, both organizations and individual providers. Descriptive statistics, including logistic regression of patient survey data (n=86) and thematic analyses of patient interview data (n=7) were analyzed to examine the association between patient experiences with the RICHER initiative and parent-reported empowerment. Respondents found communication with the provider clear, that the provider explained any test results in a way they could understand, and that the provider was compassionate and respectful. Analysis of the survey and in-depth interview data provide evidence that interpersonal communication, particularly the provider's interpersonal style (e.g., being treated as an equal), was very important. Even after controlling for parents' education and ethnicity, the provider's interpersonal style remained positively associated with parent-reported empowerment (p<0.01). This model of PHC delivery is unique in its purposeful and required partnerships between health care providers and community members. This study provides beginning evidence that RICHER can better meet the health and health care needs of people, especially

The social paediatrics initiative: a RICHER model of primary health care for at risk children and their families

Directory of Open Access Journals (Sweden)

Wong Sabrina T

2012-10-01

Full Text Available Abstract Background The Responsive Interdisciplinary Child-Community Health Education and Research (RICHER initiative is an intersectoral and interdisciplinary community outreach primary health care (PHC model. It is being undertaken in partnership with community based organizations in order to address identified gaps in the continuum of health services delivery for ‘at risk’ children and their families. As part of a larger study, this paper reports on whether the RICHER initiative is associated with increased: 1 access to health care for children and families with multiple forms of disadvantage and 2 patient-reported empowerment. This study provides the first examination of a model of delivering PHC, using a Social Paediatrics approach. Methods This was a mixed-methods study, using quantitative and qualitative approaches; it was undertaken in partnership with the community, both organizations and individual providers. Descriptive statistics, including logistic regression of patient survey data (n=86 and thematic analyses of patient interview data (n=7 were analyzed to examine the association between patient experiences with the RICHER initiative and parent-reported empowerment. Results Respondents found communication with the provider clear, that the provider explained any test results in a way they could understand, and that the provider was compassionate and respectful. Analysis of the survey and in-depth interview data provide evidence that interpersonal communication, particularly the provider’s interpersonal style (e.g., being treated as an equal, was very important. Even after controlling for parents’ education and ethnicity, the provider’s interpersonal style remained positively associated with parent-reported empowerment (p Conclusions This model of PHC delivery is unique in its purposeful and required partnerships between health care providers and community members. This study provides beginning evidence that RICHER can

Using Ensemble Short-Term Initialized Coupled NASA GEOS5 Climate Model Integrations to Study Convective Bias Growth

Science.gov (United States)

Cohen, Charlie; Robertson, Franklin; Molod, Andrea

2014-01-01

The representation of convective processes, particularly deep convection in the tropics, remains a persistent problem in climate models. In fact structural biases in the distribution of tropical rainfall in the CMIP5 models is hardly different than that of the CMIP3 versions. Given that regional climate change at higher latitudes is sensitive to the configuration of tropical forcing, this persistent bias is a major issue for the credibility of climate change projections. In this study we use model output from integrations of the NASA Global Earth Observing System Five (GEOS5) climate modeling system to study the evolution of biases in the location and intensity of convective processes. We take advantage of a series of hindcast experiments done in support of the US North American Multi-Model Ensemble (NMME) initiative. For these experiments a nine-month forecast using a coupled model configuration is made approximately every five days over the past 30 years. Each forecast is started with an updated analysis of the ocean, atmosphere and land states. For a given calendar month we have approximately 180 forecasts with daily means of various quantities. These forecasts can be averaged to essentially remove "weather scales" and highlight systematic errors as they evolve. Our primary question is to ask how the spatial structure of daily mean precipitation over the tropics evolves from the initial state and what physical processes are involved. Errors in parameterized convection, various water and energy fluxes and the divergent circulation are found to set up on fast time scales (order five days) compared to errors in the ocean, although SST changes can be non-negligible over that time. For the month of June the difference between forecast day five versus day zero precipitation looks quite similar to the difference between the June precipitation climatology and that from the Global Precipitation Climatology Project (GPCP). We focus much of our analysis on the influence of

OPM: The Open Porous Media Initiative

Science.gov (United States)

Flemisch, B.; Flornes, K. M.; Lie, K.; Rasmussen, A.

2011-12-01

The principal objective of the Open Porous Media (OPM) initiative is to develop a simulation suite that is capable of modeling industrially and scientifically relevant flow and transport processes in porous media and bridge the gap between the different application areas of porous media modeling, including reservoir mechanics, CO2 sequestration, biological systems, and product development of engineered media. The OPM initiative will provide a long-lasting, efficient, and well-maintained open-source software for flow and transport in porous media built on modern software principles. The suite is released under the GNU General Public License (GPL). Our motivation is to provide a means to unite industry and public research on simulation of flow and transport in porous media. For academic users, we seek to provide a software infrastructure that facilitates testing of new ideas on models with industry-standard complexity, while at the same time giving the researcher control over discretization and solvers. Similarly, we aim to accelerate the technology transfer from academic institutions to professional companies by making new research results available as free software of professional standard. The OPM initiative is currently supported by six research groups in Norway and Germany and funded by existing grants from public research agencies as well as from Statoil Petroleum and Total E&P Norge. However, a full-scale development of the OPM initiative requires substantially more funding and involvement of more research groups and potential end users. In this talk, we will provide an overview of the current activities in the OPM initiative. Special emphasis will be given to the demonstration of the synergies achieved by combining the strengths of individual open-source software components. In particular, a new fully implicit solver developed within the DUNE-based simulator DuMux could be enhanced by the ability to read industry-standard Eclipse input files and to run on

Modeling of SCC initiation and propagation mechanisms in BWR environments

Energy Technology Data Exchange (ETDEWEB)

Hoffmeister, Hans, E-mail: Hans.Hoffmeister@hsu-hh.de [Institute for Failure Analysis and Failure Prevention ISSV e.V., c/o Helmut Schmidt University of the Federal Armed Forces, D-22039 Hamburg (Germany); Klein, Oliver [Institute for Failure Analysis and Failure Prevention ISSV e.V., c/o Helmut Schmidt University of the Federal Armed Forces, D-22039 Hamburg (Germany)

2011-12-15

Highlights: Black-Right-Pointing-Pointer We show that SSC in BWR environments includes anodic crack propagation and hydrogen assisted cracking. Black-Right-Pointing-Pointer Hydrogen cracking is triggered by crack tip acidification following local impurity accumulations and subsequent phase precipitations. Black-Right-Pointing-Pointer We calculate effects of pH, chlorides, potentials and stress on crack SCC growth rates at 288 Degree-Sign C. - Abstract: During operation of mainly BWRs' (Boiling Water Reactors) excursions from recommended water chemistries may provide favorite conditions for stress corrosion cracking (SCC). Maximum levels for chloride and sulfate ion contents for avoiding local corrosion are therefore given in respective water specifications. In a previously published deterministic 288 Degree-Sign C - corrosion model for Nickel as a main alloying element of BWR components it was demonstrated that, as a theoretically worst case, bulk water chloride levels as low as 30 ppb provide local chloride ion accumulation, dissolution of passivating nickel oxide and precipitation of nickel chlorides followed by subsequent local acidification. In an extension of the above model to SCC the following work shows that, in a first step, local anodic path corrosion with subsequent oxide breakdown, chloride salt formation and acidification at 288 Degree-Sign C would establish local cathodic reduction of accumulated hydrogen ions inside the crack tip fluid. In a second step, local hydrogen reduction charges and increasing local crack tip strains from increasing crack lengths at given global stresses are time stepwise calculated and related to experimentally determined crack critical cathodic hydrogen charges and fracture strains taken from small scale SSRT tensile tests pieces. As a result, at local hydrogen equilibrium potentials higher than those of nickel in the crack tip solution, hydrogen ion reduction initiates hydrogen crack propagation that is enhanced with

Teachers’ perceptions of their own initiative: Collective initiative vs. personal initiative

Directory of Open Access Journals (Sweden)

Džinović Vladimir

2013-01-01

Full Text Available Current trends in education demand from teachers to exhibit proactive behaviour and assume responsibility for the implementation of changes in school practice. In that sense, it is important to study how teachers perceive their own initiative and to gain insight into the activities where such initiative is demonstrated. This study has been conceived as a mixed-methods research. The qualitative study implied forming four focus groups with subject teachers and class teachers (N=38, while the quantitative study entailed surveying 1441 teachers in forty primary schools in Serbia using the questionnaire constructed based on qualitative data. Data from focus groups were processed by qualitative thematic analysis, while the questionnaire data were processed by principal component analysis and univariate analysis of variance. The findings of the study have shown that teachers mostly demonstrate initiative through co­operative activities that include planning of joint teaching as well as conducting joint projects within school and with the local community actors. Teachers are least ready to demonstrate personal initiative and the initiative aimed at accomplishing considerable changes in school work. The concluding part includes the recommendations for encouraging teachers’ personal initiative and building organizational culture that would support such initiative. [Projekat Ministarstva nauke Republike Srbije, br. br. 47008: Unapređivanje kvaliteta i dostupnosti obrazovanja u procesima modernizacije Srbije i br. 179034: Od podsticanja inicijative, saradnje i stvaralaštva u obrazovanju do novih uloga i identiteta u društvu

Multipoint propagators for non-Gaussian initial conditions

International Nuclear Information System (INIS)

Bernardeau, Francis; Sefusatti, Emiliano; Crocce, Martin

2010-01-01

We show here how renormalized perturbation theory calculations applied to the quasilinear growth of the large-scale structure can be carried on in presence of primordial non-Gaussian (PNG) initial conditions. It is explicitly demonstrated that the series reordering scheme proposed in Bernardeau, Crocce, and Scoccimarro [Phys. Rev. D 78, 103521 (2008)] is preserved for non-Gaussian initial conditions. This scheme applies to the power spectrum and higher-order spectra and is based on a reorganization of the contributing terms into the sum of products of multipoint propagators. In case of PNG, new contributing terms appear, the importance of which is discussed in the context of current PNG models. The properties of the building blocks of such resummation schemes, the multipoint propagators, are then investigated. It is first remarked that their expressions are left unchanged at one-loop order irrespective of statistical properties of the initial field. We furthermore show that the high-momentum limit of each of these propagators can be explicitly computed even for arbitrary initial conditions. They are found to be damped by an exponential cutoff whose expression is directly related to the moment generating function of the one-dimensional displacement field. This extends what had been established for multipoint propagators for Gaussian initial conditions. Numerical forms of the cutoff are shown for the so-called local model of PNG.

16 CFR 238.2 - Initial offer.

Science.gov (United States)

2010-01-01

... § 238.2 Initial offer. (a) No statement or illustration should be used in any advertisement which creates a false impression of the grade, quality, make, value, currency of model, size, color, usability...

Mobile Health Initiatives in Vietnam: Scoping Study.

Science.gov (United States)

Lam, Jeffrey A; Dang, Linh Thuy; Phan, Ngoc Tran; Trinh, Hue Thi; Vu, Nguyen Cong; Nguyen, Cuong Kieu

2018-04-24

Mobile health (mHealth) offers a promising solution to the multitude of challenges the Vietnamese health system faces, but there is a scarcity of published information on mHealth in Vietnam. The objectives of this scoping study were (1) to summarize the extent, range, and nature of mHealth initiatives in Vietnam and (2) to examine the opportunities and threats of mHealth utilization in the Vietnamese context. This scoping study systematically identified and extracted relevant information from 20 past and current mHealth initiatives in Vietnam. The study includes multimodal information sources, including published literature, gray literature (ie, government reports and unpublished literature), conference presentations, Web-based documents, and key informant interviews. We extracted information from 27 records from the electronic search and conducted 14 key informant interviews, allowing us to identify 20 mHealth initiatives in Vietnam. Most of the initiatives were primarily funded by external donors (n=15), while other initiatives were government funded (n=1) or self-funded (n=4). A majority of the initiatives targeted vulnerable and hard-to-reach populations (n=11), aimed to prevent the occurrence of disease (n=12), and used text messaging (short message service, SMS) as part of their intervention (n=14). The study revealed that Vietnamese mHealth implementation has been challenged by factors including features unique to the Vietnamese language (n=4) and sociocultural factors (n=3). The largest threats to the popularity of mHealth initiatives are the absence of government policy, lack of government interest, heavy dependence on foreign funding, and lack of technological infrastructure. Finally, while current mHealth initiatives have already demonstrated promising opportunities for alternative models of funding, such as social entrepreneurship or private business models, sustainable mHealth initiatives outside of those funded by external donors have not yet been

Study of initiation and growth of stress corrosion cracks. Quantitative characterization and modeling

International Nuclear Information System (INIS)

Peyrat, Christine

1997-01-01

A phenomenological study of Stress Corrosion Cracking (SCC) cracks initiation and growth was carried out on a Z 2 CN 18.10 stainless steel in a boiling aqueous magnesium chloride solution at 153 deg. C. The characterization method exploits the morphological information (cracks shape and size distribution) available on a specimen after SCC test. This method, independent of any mechanistic hypothesis, led to the analytical representation of the growth rate of a given crack as a function of its depth and of the density of deeper cracks. The presence of this last parameter could be the expression of a 'shielding effect' of mechanical origin, exerted by the cracks of large size. A 'true initiation' rate was calculated by an extrapolation based on the analytical expression of the growth rate. This analytical representation of cracks initiation and growth accounts for the saturation observed in the experimental determination of the 'apparent initiation'. As time goes, the number of cracks deeper than a given threshold depth tends towards a limit which depends very strongly on the chosen threshold. This saturation effect can be interpreted as exclusively due to the way the small cracks propagate, as the 'true initiation' rate can be expressed versus time by a simple power law. In the case of slow strain rate tests, it is shown that the kinetic parameters characteristic of initiation and growth depend on the applied elongation rate. In particular, the initial crack growth rate increases with elongation rate. The validity domains of the proposed expressions have been specified by means of SCC tests carried out under different types of mechanical loading. (author) [fr

Flying Training Capacity Model: Initial Results

National Research Council Canada - National Science Library

Lynch, Susan

2005-01-01

OBJECTIVE: (1) Determine the flying training capacity for 6 bases: * Sheppard AFB * Randolph AFB * Moody AFB * Columbus AFB * Laughlin AFB * Vance AFB * (2) Develop versatile flying training capacity simulation model for AETC...

Mobile computing initiatives within pharmacy education.

Science.gov (United States)

Cain, Jeff; Bird, Eleanora R; Jones, Mikael

2008-08-15

To identify mobile computing initiatives within pharmacy education, including how devices are obtained, supported, and utilized within the curriculum. An 18-item questionnaire was developed and delivered to academic affairs deans (or closest equivalent) of 98 colleges and schools of pharmacy. Fifty-four colleges and schools completed the questionnaire for a 55% completion rate. Thirteen of those schools have implemented mobile computing requirements for students. Twenty schools reported they were likely to formally consider implementing a mobile computing initiative within 5 years. Numerous models of mobile computing initiatives exist in terms of device obtainment, technical support, infrastructure, and utilization within the curriculum. Responders identified flexibility in teaching and learning as the most positive aspect of the initiatives and computer-aided distraction as the most negative, Numerous factors should be taken into consideration when deciding if and how a mobile computing requirement should be implemented.

NCBI nr-aa BLAST: CBRC-XTRO-01-0098 [SEVENS

Lifescience Database Archive (English)

Full Text Available CBRC-XTRO-01-0098 ref|NP_522097.1| PROBABLE SUGAR-PROTON SYMPORTER TRANSMEMBRANE PR...OTEIN [Ralstonia solanacearum GMI1000] emb|CAD17687.1| probable sugar-proton symporter transmembrane protein [Ralstonia solanacearum] NP_522097.1 0.38 30% ...

Experimental evidence and physical models of fatigue crack initiation

Czech Academy of Sciences Publication Activity Database

Polák, Jaroslav; Man, Jiří

2016-01-01

Roč. 91, OCT (2016), s. 294-303 ISSN 0142-1123 R&D Projects: GA ČR(CZ) GA13-23652S; GA ČR GA13-32665S; GA MŠk(CZ) ED1.1.00/02.0068 Institutional support: RVO:68081723 Keywords : Crack initiation * Persistent slip band * Point defects * Extrusions * Intrusions Subject RIV: JL - Materials Fatigue, Friction Mechanics Impact factor: 2.899, year: 2016

Ductile crack initiation in the Charpy V-notch test

International Nuclear Information System (INIS)

Server, W.L.; Norris, D.M. Jr.; Prado, M.E.

1978-01-01

Initiation and growth of a crack in the Charpy V-notch test was investigated by performing both static and impact controlled deflection tests. Test specimens were deformed to various deflections, heat-tinted to mark crack extension and broken apart at low temperature to allow extension measurements. Measurement of the crack extension provided an estimate of crack initiation as defined by different criteria. Crack initiation starts well before maximum load, and is dependent on the definition of ''initiation''. Using a definition of first micro-initiation away from the ductile blunting, computer model predictions agreed favorably with the experimental results

The Dependence of Chimera States on Initial Conditions

International Nuclear Information System (INIS)

Feng Yue-E; Li Hai-Hong

2015-01-01

A chimera state consisting of both coherent and incoherent groups is a fascinating spatial pattern in non-locally coupled identical oscillators. It is thought that random initial conditions hardly evolve to chimera states. In this work, we study the dependence of chimera states on initial conditions. We show that random initial conditions may lead to chimera states and the chance of realizing chimera states becomes increasing when the model parameters are moving away from the boundary of their stable regime. (paper)