Voluntary Service System (VSS)
Department of Veterans Affairs — Voluntary Service System (VSS) is a national-level application which replaced the site-based Voluntary Timekeeping System (VTK). VTK was used for many years at the...
Directory of Open Access Journals (Sweden)
Yunfen Shi
2018-01-01
Full Text Available Piggery wastewater is a kind of high concentration organic wastewater with high concentration of pollutants, large amount of emissions, and serious environmental pollution and is difficult to deal with. Piggery wastewater was treated with autothermal hyperthermia aerobic digestion process (ATAD and its biodegradation kinetics was studied. The ATAD system was automatically heated up and the reaction temperature rose from ambient temperature of 20°C to a maximum temperature of 64°C. Based on Arrhenius formula, the empirical model is obtained through dimensional analysis. The removal of volatile suspended solids (VSS was correlated with the initial VSS concentration, water inlet temperature, aeration rate, and agitation rate in the model. In the empirical model, the apparent activation energy was 2.827 kJ·mol−1. The exponentials for the initial VSS concentration, aeration rate, and stirring rate were 1.0587, −0.0976, and −0.1618, respectively. The correlation coefficient of the exponential factor was 0.9971. The VSS removal efficiency predicted by the model was validated with an actual test, showing a maximum relative deviation of 8.82%. Sludge systems show a lower diversity of microbial populations and Bacillus occupies a very important position in the reactor. The data obtained will be useful for optimizing piggery wastewater treatment process. The new model provided good theoretical guidance with good practicality.
RETRENCHMENT STRATEGY IN HUMAN RESOURCE MANAGEMENT: THE CASE OF VOLUNTARY SEPARATION SCHEME (VSS
Directory of Open Access Journals (Sweden)
T. Ramayah
2004-01-01
Full Text Available One of the major challenges of business leadership in this millennium is to manage continued improvement in a competitive position. In order to stay competitive, companies are trying to become more "mean and lean". To achieve this, many major corporations have adopted the "downsizing and rightsizing" strategy. Voluntary Separation Scheme (VSS has been a global phenomenon since the 1980's and is common particularly in larger companies. In this study, the reaction to the VSS program involving the employees of a government agency embracing privatisation was studied, specifically the influence of the basic needs and referent power on the choice of acceptance and non-acceptance of VSS. The second objective of this study was to evaluate the success or failure of the VSS from the workers perspective in particular, whether their decision met their needs. The results showed that basic needs had an influence on the acceptance and the non-acceptance of VSS, namely health needs, security needs and self-esteem needs. All the referent powers (subjective norms had an influence, but surprisingly close friends had the strongest influence. Differences were also found between the expectations and the perception of the workers who accepted or rejected the VSS. From the workers' perspective, it appeared that the VSS carried out in this organization was not a success.
Directory of Open Access Journals (Sweden)
Windarti Windarti
2016-06-01
Full Text Available Penelitian ini bertujuan untuk meningkatkan perolehan kosakata dalam pemahaman membaca bahasa Inggris menggunakan Vocabulary Self-Collection Strategy (VSS siswa kelas VII SMP Negeri 3 Kalasan. Metode penelitian yang digunakan yaitu penelitian tindakan kelas (PTK, yang terdiri dari dua siklus. Tiap siklus terdiri dari empat tahap, yaitu perencanaan, pelaksanaan, pengamatan, dan refleksi. Subjek penelitian ini adalah 32 siswa kelas VII B SMP Negeri 3 Kalasan tahun ajaran 2013/2014. Teknik pengumpulan data yang digunakan yaitu observasi, tes, dan wawancara. Analisis data yang digunakan yaitu deskriptif kuantitatif dan deskriptif kualitatif. Hasil penelitian ini menunjukan bahwa penerapan strategi VSS dapat digunakan untuk meningkatkan perolehan kosakata dalam pemahaman membaca bahasa Inggris. Peningkatan hasil belajar siswa ditunjukkan dengan meningkatnya jumlah siswa yang lulus standar KKM pada siklus I dan II. Nilai rata-rata tes pada siklus I adalah 77,2. Nilai rata-rata tes pada siklus II adalah 82,4. Kesimpulan pada penelitian ini adalah bahwa penerapan strategi VSS dapat meningkatkan perolehan kosakata bahasa Inggris dalam pemahaman membaca siswa kelas VII SMP Negeri 3 Kalasan. Kata kunci: VSS, perolehan kosakata, pemahaman membaca bahasa Inggris. THE EFFORT TO IMPROVE VOCABULARY ACQUISITION IN ENGLISH READING COMPREHENSION USING VSS ON THE STUDENTS OF SMP Abstract This study aims to improve vocabulary acquisition in English reading comprehension using Vocabulary Self-Collection Strategy (VSS on the seventh grade students of SMP Negeri 3 Kalasan. This was an action reserch study consisting of two cycles. Each cycle consisted of four steps, namely planning, implementation, observation, and reflection. The research subjects were 32 seventh grade students of SMP 3 Kalasan in the academic year of 2013/2014. The data were collected through observation, tests, and interviews and analyzed by means of quantitative and qualitative descriptive
Linear VSS and Distributed Commitments Based on Secret Sharing and Pairwise Checks
DEFF Research Database (Denmark)
Fehr, Serge; Maurer, Ueli M.
2002-01-01
. VSS and DC are main building blocks for unconditional secure multi-party computation protocols. This general approach covers all known linear VSS and DC schemes. The main theorem states that the security of a scheme is equivalent to a pure linear-algebra condition on the linear mappings (e.......g. described as matrices and vectors) describing the scheme. The security of all known schemes follows as corollaries whose proofs are pure linear-algebra arguments, in contrast to some hybrid arguments used in the literature. Our approach is demonstrated for the CDM DC scheme, which we generalize to be secure......We present a general treatment of all non-cryptographic (i.e., information-theoretically secure) linear veriable-secret-sharing (VSS) and distributed-commitment (DC) schemes, based on an underlying secret sharing scheme, pairwise checks between players, complaints, and accusations of the dealer...
Linear VSS and Distributed Commitments Based on Secret Sharing and Pairwise Checks
DEFF Research Database (Denmark)
Fehr, Serge; Maurer, Ueli M.
2002-01-01
. VSS and DC are main building blocks for unconditional secure multi-party computation protocols. This general approach covers all known linear VSS and DC schemes. The main theorem states that the security of a scheme is equivalent to a pure linear-algebra condition on the linear mappings (e.......g. described as matrices and vectors) describing the scheme. The security of all known schemes follows as corollaries whose proofs are pure linear-algebra arguments, in contrast to some hybrid arguments used in the literature. Our approach is demonstrated for the CDM DC scheme, which we generalize to be secure...
International Nuclear Information System (INIS)
Huckaby, J.L.; Edwards, J.A.; Evans, J.C.
1996-08-01
This report discusses comparison tests for two methods of collecting vapor samples from the Hanford Site high-level radioactive waste tank headspaces. The two sampling methods compared are the truck-mounted vapor sampling system (VSS) and the cart-mounted in-situ vapor sampling (ISVS). Three tanks were sampled by both the VSS and ISVS methods from the same access risers within the same 8-hour period. These tanks have diverse headspace compositions and they represent the highest known level of several key vapor analytes
Energy Technology Data Exchange (ETDEWEB)
Swaminathan-Gopalan, Krishnan; Stephani, Kelly A., E-mail: ksteph@illinois.edu [Department of Mechanical Science and Engineering, University of Illinois at Urbana-Champaign, Urbana, Illinois 61801 (United States)
2016-02-15
A systematic approach for calibrating the direct simulation Monte Carlo (DSMC) collision model parameters to achieve consistency in the transport processes is presented. The DSMC collision cross section model parameters are calibrated for high temperature atmospheric conditions by matching the collision integrals from DSMC against ab initio based collision integrals that are currently employed in the Langley Aerothermodynamic Upwind Relaxation Algorithm (LAURA) and Data Parallel Line Relaxation (DPLR) high temperature computational fluid dynamics solvers. The DSMC parameter values are computed for the widely used Variable Hard Sphere (VHS) and the Variable Soft Sphere (VSS) models using the collision-specific pairing approach. The recommended best-fit VHS/VSS parameter values are provided over a temperature range of 1000-20 000 K for a thirteen-species ionized air mixture. Use of the VSS model is necessary to achieve consistency in transport processes of ionized gases. The agreement of the VSS model transport properties with the transport properties as determined by the ab initio collision integral fits was found to be within 6% in the entire temperature range, regardless of the composition of the mixture. The recommended model parameter values can be readily applied to any gas mixture involving binary collisional interactions between the chemical species presented for the specified temperature range.
Improved Fractional Order VSS Inc-Cond MPPT Algorithm for Photovoltaic Scheme
Directory of Open Access Journals (Sweden)
R. Arulmurugan
2014-01-01
Full Text Available Nowadays a hot topic among the research community is the harnessing energy from the free sunlight which is abundant and pollution-free. The availability of cheap solar photovoltaic (PV modules has to harvest solar energy with better efficiency. The nature of solar modules is nonlinear and therefore the proper impedance matching is essential. The proper impedance matching ensures the extraction of the maximum power from solar PV module. Maximum power point tracking (MPPT algorithm is acting as a significant part in solar power generating system because it varies in the output power from a PV generating set for various climatic conditions. This paper suggested a new improved work for MPPT of PV energy system by using the optimized novel improved fractional order variable step size (FOVSS incremental conductance (Inc-Cond algorithm. The new proposed controller combines the merits of both improved fractional order (FO and variable step size (VSS Inc-Cond which is well suitable for design control and execution. The suggested controller results in attaining the desired transient reaction under changing operating points. MATLAB simulation effort shows MPPT controller and a DC to DC Luo converter feeding a battery load is achieved. The laboratory experimental results demonstrate that the new proposed MPPT controller in the photovoltaic generating system is valid.
Ghorbani, M; Eskicioglu, C
2011-12-01
Batch and semi-continuous flow aerobic digesters were used to stabilize thickened waste-activated sludge at different initial conditions and mean solids retention times. Under dynamic conditions, total suspended solids, volatile suspended solids (VSS) and total and particulate chemical oxygen demand (COD and PCOD) were monitored in the batch reactors and effluent from the semi-continuous flow reactors. Activated Sludge Model (ASM) no. 1 and ASM no. 3 were applied to measured data (calibration data set) to evaluate the consistency and performances of models at different flow regimes for digester COD and VSS modelling. The results indicated that both ASM1 and ASM3 predicted digester COD, VSS and PCOD concentrations well (R2, Ra2 > or = 0.93). Parameter estimation concluded that compared to ASM1, ASM3 parameters were more consistent across different batch and semi-continuous flow runs with different operating conditions. Model validation on a data set independent from the calibration data successfully predicted digester COD (R2 = 0.88) and VSS (R2 = 0.94) concentrations by ASM3, while ASM1 overestimated both reactor COD (R2 = 0.74) and VSS concentrations (R2 = 0.79) after 15 days of aerobic batch digestion.
Biasetti, Jacopo; Spazzini, Pier Giorgio; Swedenborg, Jesper; Gasser, T Christian
2012-01-01
Abdominal Aortic Aneurysms (AAAs) are frequently characterized by the presence of an Intra-Luminal Thrombus (ILT) known to influence their evolution biochemically and biomechanically. The ILT progression mechanism is still unclear and little is known regarding the impact of the chemical species transported by blood flow on this mechanism. Chemical agonists and antagonists of platelets activation, aggregation, and adhesion and the proteins involved in the coagulation cascade (CC) may play an important role in ILT development. Starting from this assumption, the evolution of chemical species involved in the CC, their relation to coherent vortical structures (VSs) and their possible effect on ILT evolution have been studied. To this end a fluid-chemical model that simulates the CC through a series of convection-diffusion-reaction (CDR) equations has been developed. The model involves plasma-phase and surface-bound enzymes and zymogens, and includes both plasma-phase and membrane-phase reactions. Blood is modeled as a non-Newtonian incompressible fluid. VSs convect thrombin in the domain and lead to the high concentration observed in the distal portion of the AAA. This finding is in line with the clinical observations showing that the thickest ILT is usually seen in the distal AAA region. The proposed model, due to its ability to couple the fluid and chemical domains, provides an integrated mechanochemical picture that potentially could help unveil mechanisms of ILT formation and development.
An improved AE detection method of rail defect based on multi-level ANC with VSS-LMS
Zhang, Xin; Cui, Yiming; Wang, Yan; Sun, Mingjian; Hu, Hengshan
2018-01-01
In order to ensure the safety and reliability of railway system, Acoustic Emission (AE) method is employed to investigate rail defect detection. However, little attention has been paid to the defect detection at high speed, especially for noise interference suppression. Based on AE technology, this paper presents an improved rail defect detection method by multi-level ANC with VSS-LMS. Multi-level noise cancellation based on SANC and ANC is utilized to eliminate complex noises at high speed, and tongue-shaped curve with index adjustment factor is proposed to enhance the performance of variable step-size algorithm. Defect signals and reference signals are acquired by the rail-wheel test rig. The features of noise signals and defect signals are analyzed for effective detection. The effectiveness of the proposed method is demonstrated by comparing with the previous study, and different filter lengths are investigated to obtain a better noise suppression performance. Meanwhile, the detection ability of the proposed method is verified at the top speed of the test rig. The results clearly illustrate that the proposed method is effective in detecting rail defects at high speed, especially for noise interference suppression.
Directory of Open Access Journals (Sweden)
Jacopo eBiasetti
2012-07-01
Full Text Available Abdominal Aortic Aneurysms (AAAs are frequently characterized by the presenceof an Intra-Luminal Thrombus (ILT known to influence biochemically and biomechanicallytheir evolution. ILT progression mechanism is still unclear and little is known regardingthe impact on this mechanism of the chemical species transported by blood flow.Chemical agonists and antagonists of platelets activation, aggregation, and adhesion andthe proteins involved in the coagulation cascade (CC may play an important role in ILTdevelopment. Starting from this assumption, the evolution of chemical species involvedin the CC, their relation to coherent vortical structures (VSs and their possible effect onILT evolution have been studied. To this end a fluido-chemical model that simulates theCC through a series of convection-diffusion-reaction (CDR equations has been developed.The model involves plasma-phase and surface bound enzymes and zymogens, and includesboth plasma-phase and membrane-phase reactions. Blood is modeled as a non-Newtonianincompressible fluid. VSs convect thrombin in the domain and lead to the high concentration observed in the distal portion of the AAA. This finding is in line with the clinicalobservations showing that the thickest ILT is usually seen in the distal AAA region. Theproposed model, due to its ability to couple the fluid and chemical domains, provides anintegrated mechanochemical picture that potentially could help unveil mechanisms of ILTformation and development.
Biasetti, Jacopo; Hussain, Fazle; Gasser, T Christian
2011-10-07
Abdominal aortic aneurysms (AAAs) are frequently characterized by the development of an intra-luminal thrombus (ILT), which is known to have multiple biochemical and biomechanical implications. Development of the ILT is not well understood, and shear-stress-triggered activation of platelets could be the first step in its evolution. Vortical structures (VSs) in the flow affect platelet dynamics, which motivated the present study of a possible correlation between VS and ILT formation in AAAs. VSs educed by the λ(2)-method using computational fluid dynamics simulations of the backward-facing step problem, normal aorta, fusiform AAA and saccular AAA were investigated. Patient-specific luminal geometries were reconstructed from computed tomography scans, and Newtonian and Carreau-Yasuda models were used to capture salient rheological features of blood flow. Particularly in complex flow domains, results depended on the constitutive model. VSs developed all along the normal aorta, showing that a clear correlation between VSs and high wall shear stress (WSS) existed, and that VSs started to break up during late systole. In contrast, in the fusiform AAA, large VSs developed at sites of tortuous geometry and high WSS, occupying the entire lumen, and lasting over the entire cardiac cycle. Downward motion of VSs in the AAA was in the range of a few centimetres per cardiac cycle, and with a VS burst at that location, the release (from VSs) of shear-stress-activated platelets and their deposition to the wall was within the lower part of the diseased artery, i.e. where the thickest ILT layer is typically observed. In the saccular AAA, only one VS was found near the healthy portion of the aorta, while in the aneurysmatic bulge, no VSs occurred. We present a fluid-dynamics-motivated mechanism for platelet activation, convection and deposition in AAAs that has the potential of improving our current understanding of the pathophysiology of fluid-driven ILT growth.
Substrate utilization and VSS relations in activated sludge processes
Energy Technology Data Exchange (ETDEWEB)
Droste, R L; Fernandes, L; Sun, X [Ottawa Univ., ON (Canada). Dept. of Civil Engineering
1994-12-31
A new empirical substrate removal model for activated sludge in continuous flow stirred tank reactor (CFSTR) and sequencing batch reactor (SBR) was developed in this study. This model includes an exponential function of volatile suspended solids to express the active biomass which is actually involved in substrate utilization. Results indicate that the proposed exponential models predict more accurately effluent COD in CFSTR and SBR systems than the first or zero order models. (author). 7 refs., 1 fig., 4 tabs.
Substrate utilization and VSS relations in activated sludge processes
Energy Technology Data Exchange (ETDEWEB)
Droste, R.L.; Fernandes, L.; Sun, X. [Ottawa Univ., ON (Canada). Dept. of Civil Engineering
1993-12-31
A new empirical substrate removal model for activated sludge in continuous flow stirred tank reactor (CFSTR) and sequencing batch reactor (SBR) was developed in this study. This model includes an exponential function of volatile suspended solids to express the active biomass which is actually involved in substrate utilization. Results indicate that the proposed exponential models predict more accurately effluent COD in CFSTR and SBR systems than the first or zero order models. (author). 7 refs., 1 fig., 4 tabs.
Seguino, Alessandro; Seguino, Ferruccio; Eleuteri, Antonio; Rhind, Susan M
2014-01-01
Veterinary surgeons working on farms and food-processing establishments play a fundamental role in safeguarding both public health and the welfare of animals under their care. An essential part of veterinary public health (VPH) undergraduate training in the UK involves students undertaking placements within abattoirs, a practice that remains vital to the educational experience of future veterinary professionals. However, several issues have adversely affected the ability of students to gain such extramural placements. For this reason, the Virtual Slaughterhouse Simulator (VSS) was developed to strengthen and enhance undergraduate VPH teaching at the Royal (Dick) School of Veterinary Studies, enabling students to explore a realistic abattoir work environment with embedded educational activities. The aim of this research project was to evaluate the VSS as a teaching and learning tool for training and educating veterinary students. Ninety-eight final-year veterinary students engaged with the prototype VSS, followed by assessment of their knowledge and behavior when faced with a "real-life" abattoir situation. Further evaluation of their experiences with the VSS was carried out using questionnaires and focus groups. The results of this investigation show that there is the potential for the VSS to enhance the student learning experience in basic abattoir procedures. This innovative tool provides a visually based learning resource that can support traditional lectures and practical classes and can also be used to stimulate interactive problem-solving activities embedded in the relevant context.
Physiologically Based Pharmacokinetic Model for Terbinafine in Rats and Humans
Hosseini-Yeganeh, Mahboubeh; McLachlan, Andrew J.
2002-01-01
The aim of this study was to develop a physiologically based pharmacokinetic (PB-PK) model capable of describing and predicting terbinafine concentrations in plasma and tissues in rats and humans. A PB-PK model consisting of 12 tissue and 2 blood compartments was developed using concentration-time data for tissues from rats (n = 33) after intravenous bolus administration of terbinafine (6 mg/kg of body weight). It was assumed that all tissues except skin and testis tissues were well-stirred compartments with perfusion rate limitations. The uptake of terbinafine into skin and testis tissues was described by a PB-PK model which incorporates a membrane permeability rate limitation. The concentration-time data for terbinafine in human plasma and tissues were predicted by use of a scaled-up PB-PK model, which took oral absorption into consideration. The predictions obtained from the global PB-PK model for the concentration-time profile of terbinafine in human plasma and tissues were in close agreement with the observed concentration data for rats. The scaled-up PB-PK model provided an excellent prediction of published terbinafine concentration-time data obtained after the administration of single and multiple oral doses in humans. The estimated volume of distribution at steady state (Vss) obtained from the PB-PK model agreed with the reported value of 11 liters/kg. The apparent volume of distribution of terbinafine in skin and adipose tissues accounted for 41 and 52%, respectively, of the Vss for humans, indicating that uptake into and redistribution from these tissues dominate the pharmacokinetic profile of terbinafine. The PB-PK model developed in this study was capable of accurately predicting the plasma and tissue terbinafine concentrations in both rats and humans and provides insight into the physiological factors that determine terbinafine disposition. PMID:12069977
Ye, Min; Nagar, Swati; Korzekwa, Ken
2015-01-01
Predicting the pharmacokinetics of highly protein-bound drugs is difficult. Also, since historical plasma protein binding data was often collected using unbuffered plasma, the resulting inaccurate binding data could contribute to incorrect predictions. This study uses a generic physiologically based pharmacokinetic (PBPK) model to predict human plasma concentration-time profiles for 22 highly protein-bound drugs. Tissue distribution was estimated from in vitro drug lipophilicity data, plasma protein binding, and blood: plasma ratio. Clearance was predicted with a well-stirred liver model. Underestimated hepatic clearance for acidic and neutral compounds was corrected by an empirical scaling factor. Predicted values (pharmacokinetic parameters, plasma concentration-time profile) were compared with observed data to evaluate model accuracy. Of the 22 drugs, less than a 2-fold error was obtained for terminal elimination half-life (t1/2, 100% of drugs), peak plasma concentration (Cmax, 100%), area under the plasma concentration-time curve (AUC0–t, 95.4%), clearance (CLh, 95.4%), mean retention time (MRT, 95.4%), and steady state volume (Vss, 90.9%). The impact of fup errors on CLh and Vss prediction was evaluated. Errors in fup resulted in proportional errors in clearance prediction for low-clearance compounds, and in Vss prediction for high-volume neutral drugs. For high-volume basic drugs, errors in fup did not propagate to errors in Vss prediction. This is due to the cancellation of errors in the calculations for tissue partitioning of basic drugs. Overall, plasma profiles were well simulated with the present PBPK model. PMID:26531057
Ye, Min; Nagar, Swati; Korzekwa, Ken
2016-04-01
Predicting the pharmacokinetics of highly protein-bound drugs is difficult. Also, since historical plasma protein binding data were often collected using unbuffered plasma, the resulting inaccurate binding data could contribute to incorrect predictions. This study uses a generic physiologically based pharmacokinetic (PBPK) model to predict human plasma concentration-time profiles for 22 highly protein-bound drugs. Tissue distribution was estimated from in vitro drug lipophilicity data, plasma protein binding and the blood: plasma ratio. Clearance was predicted with a well-stirred liver model. Underestimated hepatic clearance for acidic and neutral compounds was corrected by an empirical scaling factor. Predicted values (pharmacokinetic parameters, plasma concentration-time profile) were compared with observed data to evaluate the model accuracy. Of the 22 drugs, less than a 2-fold error was obtained for the terminal elimination half-life (t1/2 , 100% of drugs), peak plasma concentration (Cmax , 100%), area under the plasma concentration-time curve (AUC0-t , 95.4%), clearance (CLh , 95.4%), mean residence time (MRT, 95.4%) and steady state volume (Vss , 90.9%). The impact of fup errors on CLh and Vss prediction was evaluated. Errors in fup resulted in proportional errors in clearance prediction for low-clearance compounds, and in Vss prediction for high-volume neutral drugs. For high-volume basic drugs, errors in fup did not propagate to errors in Vss prediction. This is due to the cancellation of errors in the calculations for tissue partitioning of basic drugs. Overall, plasma profiles were well simulated with the present PBPK model. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
Kinetic and stoichiometric modelling of acidogenic fermentation of glucose and fructose
International Nuclear Information System (INIS)
Fernandez, F.J.; Villasenor, J.; Infantes, D.
2011-01-01
In this work, a model based on Monod equation for the description of the acidogenic fermentation of glucose and fructose as the main substrates contained in the winery wastewater was developed. The data used for calibration and validation of the model parameters were obtained from an acidogenic mixed culture fermenting glucose and fructose in a batch reactor at 35 o C and pH 5. The calibrated model accurately describes the experimental results from biomass growth, substrate consumption and fermentation products generation. The results showed that the microorganisms growth rate and biomass yield were higher when glucose was used as substrate: μ max-Glucose = 0.163 h -1 , μ max-Fructose = 0.108 h -1 , Y x-Glucose = 0.027 g VSS per mmol Glucose and Y x-Fructose 0.017 g VSS per mmol Fructose. Regarding to the fermentation products, the acetic acid was the main fermentation product obtained in both fermentations, followed by lactic and butyric acid. Comparing glucose and fructose fermentations, the main difference was the yield of butyric acid in both fermentations, 0.249 mol per mol Glucose and 0.131 mol per mol Fructose since the other acids concentration were quite similar. In the case of the H 2 production, it was 0.76 mol H 2 per mol Glucose while 0.85 was the yield in fructose fermentation. -- Highlights: → Acidogenic fermentation of glucose and fructose was studied. → A model describing the kinetics and stoichiometry of the fermentation was developed. → The model developed predicted accurately the substrate, products and biomass profiles along the fermentation process. → The microorganisms growth rate was higher in the glucose fermentation. → The fructose fermentation presented higher hydrogen yields.
Prause, Nicole; Steele, Vaughn R; Staley, Cameron; Sabatinelli, Dean; Hajcak, Greg
2015-07-01
"Excessive" viewing of visual sexual stimuli (VSS) is the most commonly reported hypersexual behavior problem and is especially amenable to laboratory study. A pattern of enhanced sexual cue responsiveness is expected in this sample if hypersexuality shares features of other addiction models. Participants (N=122) who either reported or denied problematic VSS use were presented with emotional, including explicit sexual, images while their evoked response potentials were recorded. An interaction of hypersexual problem group and the level of desire for sex with a partner predicted LPP amplitude. Specifically, those reporting problems regulating their VSS use who also reported higher sexual desire had lower LPP in response to VSS. This pattern appears different from substance addiction models. These are the first functional physiological data of persons reporting VSS regulation problems. Copyright © 2015 Elsevier B.V. All rights reserved.
DSMC simulation and experimental validation of shock interaction in hypersonic low density flow.
Xiao, Hong; Shang, Yuhe; Wu, Di
2014-01-01
Direct simulation Monte Carlo (DSMC) of shock interaction in hypersonic low density flow is developed. Three collision molecular models, including hard sphere (HS), variable hard sphere (VHS), and variable soft sphere (VSS), are employed in the DSMC study. The simulations of double-cone and Edney's type IV hypersonic shock interactions in low density flow are performed. Comparisons between DSMC and experimental data are conducted. Investigation of the double-cone hypersonic flow shows that three collision molecular models can predict the trend of pressure coefficient and the Stanton number. HS model shows the best agreement between DSMC simulation and experiment among three collision molecular models. Also, it shows that the agreement between DSMC and experiment is generally good for HS and VHS models in Edney's type IV shock interaction. However, it fails in the VSS model. Both double-cone and Edney's type IV shock interaction simulations show that the DSMC errors depend on the Knudsen number and the models employed for intermolecular interaction. With the increase in the Knudsen number, the DSMC error is decreased. The error is the smallest in HS compared with those in the VHS and VSS models. When the Knudsen number is in the level of 10(-4), the DSMC errors, for pressure coefficient, the Stanton number, and the scale of interaction region, are controlled within 10%.
Balancing Public and Private Regulation
Directory of Open Access Journals (Sweden)
Martijn Scheltema
2016-01-01
Full Text Available Voluntary Sustainability Standards (VSS might develop into a viable alternative to public regulation. However, it turns on the (regulatory circumstances whether that holds true in practice. If public regulation on CSR topics is lacking, governments are unable to agree upon certain topics on a global level or diverging public regulation exists, VSS can be helpful to set global standards. Obviously, private standards will especially be helpful if they are commensurate with local public legislation (and e.g. treaties and/or are accepted by local governments. If one neglects this, numerous domestic structures might exist that frustrate VSS. Furthermore, governments have to remain vigilant as to whether these private regimes do not result in market disruption, consumer detriment or hamper trade. VSS might also compete with public arrangements which might limit the uptake of VSS. However, if public regulation exists VSS might be a viable alternative if compliance with not too compelling public norms by market participants is rather poor and the public policymaker is aiming to incentivize the better performing part of the market to embark on higher standards and thus only desires to regulate the less performing part of the market. However, of paramount importance is the effectiveness of VSS in order to be a viable alternative to public regulation. The effectiveness of VSS should be assessed using an integrated multi-disciplinary (comparative approach entailing legal, impact-assessment, legitimacy, governance and behavioural aspects. Only effective VSS in the aforementioned sense are a true alternative to public regulation.Beyond that, the legal perspective in connection with (the effectiveness of VSS is discussed, featuring FSC and UTZ Certified as an example. It is important from this perspective that VSS have a clear and sufficiently selective objective and sufficiently specific norms, are regularly evaluated, entail ‘conflict of law rules’ and
Freitas, Alex A; Limbu, Kriti; Ghafourian, Taravat
2015-01-01
Volume of distribution is an important pharmacokinetic property that indicates the extent of a drug's distribution in the body tissues. This paper addresses the problem of how to estimate the apparent volume of distribution at steady state (Vss) of chemical compounds in the human body using decision tree-based regression methods from the area of data mining (or machine learning). Hence, the pros and cons of several different types of decision tree-based regression methods have been discussed. The regression methods predict Vss using, as predictive features, both the compounds' molecular descriptors and the compounds' tissue:plasma partition coefficients (Kt:p) - often used in physiologically-based pharmacokinetics. Therefore, this work has assessed whether the data mining-based prediction of Vss can be made more accurate by using as input not only the compounds' molecular descriptors but also (a subset of) their predicted Kt:p values. Comparison of the models that used only molecular descriptors, in particular, the Bagging decision tree (mean fold error of 2.33), with those employing predicted Kt:p values in addition to the molecular descriptors, such as the Bagging decision tree using adipose Kt:p (mean fold error of 2.29), indicated that the use of predicted Kt:p values as descriptors may be beneficial for accurate prediction of Vss using decision trees if prior feature selection is applied. Decision tree based models presented in this work have an accuracy that is reasonable and similar to the accuracy of reported Vss inter-species extrapolations in the literature. The estimation of Vss for new compounds in drug discovery will benefit from methods that are able to integrate large and varied sources of data and flexible non-linear data mining methods such as decision trees, which can produce interpretable models. Graphical AbstractDecision trees for the prediction of tissue partition coefficient and volume of distribution of drugs.
Virtual substitution scan via single-step free energy perturbation.
Chiang, Ying-Chih; Wang, Yi
2016-02-05
With the rapid expansion of our computing power, molecular dynamics (MD) simulations ranging from hundreds of nanoseconds to microseconds or even milliseconds have become increasingly common. The majority of these long trajectories are obtained from plain (vanilla) MD simulations, where no enhanced sampling or free energy calculation method is employed. To promote the 'recycling' of these trajectories, we developed the Virtual Substitution Scan (VSS) toolkit as a plugin of the open-source visualization and analysis software VMD. Based on the single-step free energy perturbation (sFEP) method, VSS enables the user to post-process a vanilla MD trajectory for a fast free energy scan of substituting aryl hydrogens by small functional groups. Dihedrals of the functional groups are sampled explicitly in VSS, which improves the performance of the calculation and is found particularly important for certain groups. As a proof-of-concept demonstration, we employ VSS to compute the solvation free energy change upon substituting the hydrogen of a benzene molecule by 12 small functional groups frequently considered in lead optimization. Additionally, VSS is used to compute the relative binding free energy of four selected ligands of the T4 lysozyme. Overall, the computational cost of VSS is only a fraction of the corresponding multi-step FEP (mFEP) calculation, while its results agree reasonably well with those of mFEP, indicating that VSS offers a promising tool for rapid free energy scan of small functional group substitutions. This article is protected by copyright. All rights reserved. © 2016 Wiley Periodicals, Inc.
Microbial Methane Fermentation Kinetics for Toxicant Exposure.
1981-08-31
Algorithms of k and K s.*.*....*.............. . .... 241 Inhibition Coefficient Model .. .... ...... .... 252 Activity Model...enrichment culture was developed with sludge from an anaerobic digester. This system, a 400-liter, complete-mix ( CSTR ) reac- tor operated at a 50-day...reasonably constant. However, in a real CSTR , longer SRTs result in lower VSS levels. This is an area worthy of further study. Effect of Temperature
Model-Aided Altimeter-Based Water Level Forecasting System in Mekong River
Chang, C. H.; Lee, H.; Hossain, F.; Okeowo, M. A.; Basnayake, S. B.; Jayasinghe, S.; Saah, D. S.; Anderson, E.; Hwang, E.
2017-12-01
Mekong River, one of the massive river systems in the world, has drainage area of about 795,000 km2 covering six countries. People living in its drainage area highly rely on resources given by the river in terms of agriculture, fishery, and hydropower. Monitoring and forecasting the water level in a timely manner, is urgently needed over the Mekong River. Recently, using TOPEX/Poseidon (T/P) altimetry water level measurements in India, Biancamaria et al. [2011] has demonstrated the capability of an altimeter-based flood forecasting system in Bangladesh, with RMSE from 0.6 - 0.8 m for lead times up to 5 days on 10-day basis due to T/P's repeat period. Hossain et al. [2013] further established a daily water level forecasting system in Bangladesh using observations from Jason-2 in India and HEC-RAS hydraulic model, with RMSE from 0.5 - 1.5 m and an underestimating mean bias of 0.25 - 1.25 m. However, such daily forecasting system relies on a collection of Jason-2 virtual stations (VSs) to ensure frequent sampling and data availability. Since the Mekong River is a meridional river with few number of VSs, the direct application of this system to the Mekong River becomes challenging. To address this problem, we propose a model-aided altimeter-based forecasting system. The discharge output by Variable Infiltration Capacity hydrologic model is used to reconstruct a daily water level product at upstream Jason-2 VSs based on the discharge-to-level rating curve. The reconstructed daily water level is then used to perform regression analysis with downstream in-situ water level to build regression models, which are used to forecast a daily water level. In the middle reach of the Mekong River from Nakhon Phanom to Kratie, a 3-day lead time forecasting can reach RMSE about 0.7 - 1.3 m with correlation coefficient around 0.95. For the lower reach of the Mekong River, the water flow becomes more complicated due to the reversal flow between the Tonle Sap Lake and the Mekong River
Disintegration impact on sludge digestion process.
Dauknys, Regimantas; Rimeika, Mindaugas; Jankeliūnaitė, Eglė; Mažeikienė, Aušra
2016-11-01
The anaerobic sludge digestion is a widely used method for sludge stabilization in wastewater treatment plant. This process can be improved by applying the sludge disintegration methods. As the sludge disintegration is not investigated enough, an analysis of how the application of thermal hydrolysis affects the sludge digestion process based on full-scale data was conducted. The results showed that the maximum volatile suspended solids (VSS) destruction reached the value of 65% independently on the application of thermal hydrolysis. The average VSS destruction increased by 14% when thermal hydrolysis was applied. In order to have the maximum VSS reduction and biogas production, it is recommended to keep the maximum defined VSS loading of 5.7 kg VSS/m(3)/d when the thermal hydrolysis is applied and to keep the VSS loading between 2.1-2.4 kg VSS/m(3)/d when the disintegration of sludge is not applied. The application of thermal hydrolysis leads to an approximately 2.5 times higher VSS loading maintenance comparing VSS loading without the disintegration; therefore, digesters with 1.8 times smaller volume is required.
On Converting Secret Sharing Scheme to Visual Secret Sharing Scheme
Directory of Open Access Journals (Sweden)
Wang Daoshun
2010-01-01
Full Text Available Abstract Traditional Secret Sharing (SS schemes reconstruct secret exactly the same as the original one but involve complex computation. Visual Secret Sharing (VSS schemes decode the secret without computation, but each share is m times as big as the original and the quality of the reconstructed secret image is reduced. Probabilistic visual secret sharing (Prob.VSS schemes for a binary image use only one subpixel to share the secret image; however the probability of white pixels in a white area is higher than that in a black area in the reconstructed secret image. SS schemes, VSS schemes, and Prob. VSS schemes have various construction methods and advantages. This paper first presents an approach to convert (transform a -SS scheme to a -VSS scheme for greyscale images. The generation of the shadow images (shares is based on Boolean XOR operation. The secret image can be reconstructed directly by performing Boolean OR operation, as in most conventional VSS schemes. Its pixel expansion is significantly smaller than that of VSS schemes. The quality of the reconstructed images, measured by average contrast, is the same as VSS schemes. Then a novel matrix-concatenation approach is used to extend the greyscale -SS scheme to a more general case of greyscale -VSS scheme.
Gola, Mateusz; Wordecha, Małgorzata; Marchewka, Artur; Sescousse, Guillaume
2016-01-01
There is an increasing number of neuroimaging studies using visual sexual stimuli (VSS), especially within the emerging field of research on compulsive sexual behaviors (CSB). A central question in this field is whether behaviors such as excessive pornography consumption share common brain mechanisms with widely studied substance and behavioral addictions. Depending on how VSS are conceptualized, different predictions can be formulated within the frameworks of Reinforcement Learning or Incentive Salience Theory, where a crucial distinction is made between conditioned and unconditioned stimuli (related to reward anticipation vs. reward consumption, respectively). Surveying 40 recent human neuroimaging studies we show existing ambiguity about the conceptualization of VSS. Therefore, we feel that it is important to address the question of whether VSS should be considered as conditioned stimuli (cue) or unconditioned stimuli (reward). Here we present our own perspective, which is that in most laboratory settings VSS play a role of reward, as evidenced by: (1) experience of pleasure while watching VSS, possibly accompanied by genital reaction; (2) reward-related brain activity correlated with these pleasurable feelings in response to VSS; (3) a willingness to exert effort to view VSS similarly as for other rewarding stimuli such as money; and (4) conditioning for cues predictive of VSS. We hope that this perspective article will initiate a scientific discussion on this important and overlooked topic and increase attention for appropriate interpretations of results of human neuroimaging studies using VSS.
Gola, Mateusz; Wordecha, Małgorzata; Marchewka, Artur; Sescousse, Guillaume
2016-01-01
There is an increasing number of neuroimaging studies using visual sexual stimuli (VSS), especially within the emerging field of research on compulsive sexual behaviors (CSB). A central question in this field is whether behaviors such as excessive pornography consumption share common brain mechanisms with widely studied substance and behavioral addictions. Depending on how VSS are conceptualized, different predictions can be formulated within the frameworks of Reinforcement Learning or Incentive Salience Theory, where a crucial distinction is made between conditioned and unconditioned stimuli (related to reward anticipation vs. reward consumption, respectively). Surveying 40 recent human neuroimaging studies we show existing ambiguity about the conceptualization of VSS. Therefore, we feel that it is important to address the question of whether VSS should be considered as conditioned stimuli (cue) or unconditioned stimuli (reward). Here we present our own perspective, which is that in most laboratory settings VSS play a role of reward, as evidenced by: (1) experience of pleasure while watching VSS, possibly accompanied by genital reaction; (2) reward-related brain activity correlated with these pleasurable feelings in response to VSS; (3) a willingness to exert effort to view VSS similarly as for other rewarding stimuli such as money; and (4) conditioning for cues predictive of VSS. We hope that this perspective article will initiate a scientific discussion on this important and overlooked topic and increase attention for appropriate interpretations of results of human neuroimaging studies using VSS. PMID:27574507
Burger, Gillian; Parker, Wayne
2013-09-15
This study investigated the impacts of high pressure thermal hydrolysis (HPTH) pretreatment on the distribution of chemical oxygen demand (COD) species in waste activated sludge (WAS). In the first phase of the project, WAS from a synthetically-fed biological reactor (BR) was fed to an aerobic digester (AD). In the second phase, WAS from the BR was pretreated by HPTH at 150 °C and 3 bars for 30 min prior to being fed to the AD. A range of physical, biochemical and biological properties were regularly measured in each process stream in both phases. The COD of the BR WAS consisted of storage products (XSTO), active heterotrophs (XH) and endogenous decay products (XE). Pretreatment did not increase the extent to which the BR WAS was aerobically digested and hence it was concluded that the unbiodegradable COD fraction, i.e. XE, was unchanged by pretreatment. However, pretreatment did increase the rate of degradation as it converted 36% of XH to readily biodegradable COD (SB) and the remaining XH to slowly biodegradable COD (XB). Furthermore, XSTO was fully converted to SB by pretreatment. Although pretreatment did not change the VSS concentration in the downstream aerobic digester, it did decrease the ISS concentration by 46 ± 11%. This reduced the total mass of solids produced by the digester by 21 ± 8%. A COD-based HPTH pretreatment model was developed and calibrated. When this model was integrated into BioWin 3.1(®), it was able to accurately simulate both the steady state performance of the overall system employed in this study as well as dynamic respirometry results. Copyright © 2013 Elsevier Ltd. All rights reserved.
den Hollander, Richard J. M.; Bouma, Henri; van Rest, Jeroen H. C.; ten Hove, Johan-Martijn; ter Haar, Frank B.; Burghouts, Gertjan J.
2017-10-01
Video analytics is essential for managing large quantities of raw data that are produced by video surveillance systems (VSS) for the prevention, repression and investigation of crime and terrorism. Analytics is highly sensitive to changes in the scene, and for changes in the optical chain so a VSS with analytics needs careful configuration and prompt maintenance to avoid false alarms. However, there is a trend from static VSS consisting of fixed CCTV cameras towards more dynamic VSS deployments over public/private multi-organization networks, consisting of a wider variety of visual sensors, including pan-tilt-zoom (PTZ) cameras, body-worn cameras and cameras on moving platforms. This trend will lead to more dynamic scenes and more frequent changes in the optical chain, creating structural problems for analytics. If these problems are not adequately addressed, analytics will not be able to continue to meet end users' developing needs. In this paper, we present a three-part solution for managing the performance of complex analytics deployments. The first part is a register containing meta data describing relevant properties of the optical chain, such as intrinsic and extrinsic calibration, and parameters of the scene such as lighting conditions or measures for scene complexity (e.g. number of people). A second part frequently assesses these parameters in the deployed VSS, stores changes in the register, and signals relevant changes in the setup to the VSS administrator. A third part uses the information in the register to dynamically configure analytics tasks based on VSS operator input. In order to support the feasibility of this solution, we give an overview of related state-of-the-art technologies for autocalibration (self-calibration), scene recognition and lighting estimation in relation to person detection. The presented solution allows for rapid and robust deployment of Video Content Analysis (VCA) tasks in large scale ad-hoc networks.
Directory of Open Access Journals (Sweden)
Mateusz Gola
2016-08-01
Full Text Available There is an increasing number of neuroimaging studies using visual sexual stimuli (VSS for human sexuality studies, including emerging field of research on compulsive sexual behaviors. A central question in this field is whether behaviors such as extensive pornography consumption share common brain mechanisms with widely studied substance and behavioral addictions. Depending on how VSS are conceptualized, different predictions can be formulated within the frameworks of Reinforcement Learning or Incentive Salience Theory, where a crucial distinction is made between conditioned (cue and unconditioned (reward stimuli (related to reward anticipation vs reward consumption, respectively. Surveying 40 recent human neuroimaging studies we show existing ambiguity about the conceptualization of VSS. Therefore, we feel that it is important to address the question of whether VSS should be considered as cues (conditioned stimuli or rewards (unconditioned stimuli. Here we present our own perspective, which is that in most laboratory settings VSS play a role of reward (unconditioned stimuli, as evidenced by: 1. experience of pleasure while watching VSS, possibly accompanied by genital reaction 2. reward-related brain activity correlated with these pleasurable feelings in response to VSS, 3. a willingness to exert effort to view VSS similarly as for other rewarding stimuli such as money, and/or 4. conditioning for cues (CS predictive for. We hope that this perspective paper will initiate a scientific discussion on this important and overlooked topic and increase attention for appropriate interpretations of results of human neuroimaging studies using VSS.
Desain dan Implementasi Aplikasi Video Surveillance System Berbasis Web-SIG
Directory of Open Access Journals (Sweden)
I M.O. Widyantara
2015-06-01
Full Text Available Video surveillance system (VSS is an monitoring system based-on IP-camera. VSS implemented in live streaming and serves to observe and monitor a site remotely. Typically, IP- camera in the VSS has a management software application. However, for ad hoc applications, where the user wants to manage VSS independently, application management software has become ineffective. In the IP-camera installation spread over a large area, an administrator would be difficult to describe the location of the IP-camera. In addition, monitoring an area of IP- Camera will also become more difficult. By looking at some of the flaws in VSS, this paper has proposed a VSS application for easy monitoring of each IP Camera. Applications that have been proposed to integrate the concept of web-based geographical information system with the Google Maps API (Web-GIS. VSS applications built with smart features include maps ip-camera, live streaming of events, information on the info window and marker cluster. Test results showed that the application is able to display all the features built well
Sliding Modes after the First Decade of the 21st Century State of the Art
Moreno, Jaime; Iriarte, Rafael
2012-01-01
The book presents the newest results of the major world research groups working in the area of Variable Structure Systems and Sliding Mode Control (VSS/SMC). The research activity of these groups is coordinated by the IEEE Technical Committee on Variable Structure Systems (VSS) and Sliding Modes (SM). The presented results include the reports of the research groups collaborating in a framework of the Unión European Union – México project of Fondo de Cooperación Internacional en Ciencia y Tecnología (FONCICyT) 93302 titled "Automatization and Monitoring of Energy Production Processes via Sliding Mode Control". The book starts with the overview of the sliding mode control concepts and algorithms that were developed and discussed in the last two decades The research papers are combined in three sections: Part I: VSS and SM Algorithms and their Analysis Part II: SMC Design Part III: Applications of VSS and SMC The book will be of interests of engineers, researchers and graduate students working in the area ...
Combined thermo-chemo-sonic disintegration of waste activated sludge for biogas production.
Kavitha, S; Yukesh Kannah, R; Yeom, Ick Tae; Do, Khac-Uan; Banu, J Rajesh
2015-12-01
In the present study, there was an investigation about the impact of a new combined thermo-chemo-sonic disintegration of waste activated sludge (WAS) on biodegradability. The outcome of sludge disintegration reveals that maximum Suspended Solids (SS) reduction and Chemical Oxygen Demand (COD) solubilization effectuated at a specific energy input of 5290.5kJ/kgTS, and was found to be 20%, 16.4%, 15% and 27%, 22%, and 20%, respectively for the three alkalis (NaOH, KOH, and Ca(OH)2). The conversion coefficient of the Volatile Suspended Solids (VSS) to product Soluble COD (SCOD), calculated by nonlinear regression modeling, was found to be 0.5530gSCOD/gVSS, 0.4587gSCOD/gVSS, and 0.4195gSCOD/gVSS for NaOH, KOH, and Ca(OH)2, respectively. In the biodegradability studies, the parameter evaluation provides an estimate of parameter uncertainty and correlation, and elucidates that there is no significant difference in biodegradability (0.413gCOD/gCOD, 0.367gCOD/gCOD, and 0.342gCOD/gCOD) for three alkalis (NaOH, KOH, and Ca(OH)2). Copyright © 2015 Elsevier Ltd. All rights reserved.
DEFF Research Database (Denmark)
Dziembowski, Stefan
here and discuss other problems caused by the adaptiveness. All protocols in the thesis are formally specified and the proofs of their security are given. [1]Ronald Cramer, Ivan Damgård, Stefan Dziembowski, Martin Hirt, and Tal Rabin. Efficient multiparty computations with dishonest minority......In this thesis we study a problem of doing Verifiable Secret Sharing (VSS) and Multiparty Computations in a model where private channels between the players and a broadcast channel is available. The adversary is active, adaptive and has an unbounded computing power. The thesis is based on two...... to a polynomial time black-box reduction, the complexity of adaptively secure VSS is the same as that of ordinary secret sharing (SS), where security is only required against a passive, static adversary. Previously, such a connection was only known for linear secret sharing and VSS schemes. We then show...
A Software Reference Architecture for Service-Oriented 3D Geovisualization Systems
Directory of Open Access Journals (Sweden)
Dieter Hildebrandt
2014-12-01
Full Text Available Modern 3D geovisualization systems (3DGeoVSs are complex and evolving systems that are required to be adaptable and leverage distributed resources, including massive geodata. This article focuses on 3DGeoVSs built based on the principles of service-oriented architectures, standards and image-based representations (SSI to address practically relevant challenges and potentials. Such systems facilitate resource sharing and agile and efficient system construction and change in an interoperable manner, while exploiting images as efficient, decoupled and interoperable representations. The software architecture of a 3DGeoVS and its underlying visualization model have strong effects on the system’s quality attributes and support various system life cycle activities. This article contributes a software reference architecture (SRA for 3DGeoVSs based on SSI that can be used to design, describe and analyze concrete software architectures with the intended primary benefit of an increase in effectiveness and efficiency in such activities. The SRA integrates existing, proven technology and novel contributions in a unique manner. As the foundation for the SRA, we propose the generalized visualization pipeline model that generalizes and overcomes expressiveness limitations of the prevalent visualization pipeline model. To facilitate exploiting image-based representations (IReps, the SRA integrates approaches for the representation, provisioning and styling of and interaction with IReps. Five applications of the SRA provide proofs of concept for the general applicability and utility of the SRA. A qualitative evaluation indicates the overall suitability of the SRA, its applications and the general approach of building 3DGeoVSs based on SSI.
State of the art of teledermatopathology.
Massone, Cesare; Brunasso, Alexandra M G; Campbell, Terri M; Soyer, H Peter
2008-10-01
Teledermatopathology may involve real-time transmission of images from distant locations to consulting pathologists by the remote manipulation of a robotic microscope. Alternatively, the static store-and-forward option involves the single-file transmission of subjectively preselected and captured areas of microscopic images by a referring physician. The recent introduction of virtual slide systems (VSS) involves the digitization of whole slides at high resolution thus enabling the user to view any part of the specimen at any magnification. Such technology has surmounted previous restrictions caused by the size of preselected areas and specimen sampling for telepathology. In terms of client access, these VSS may be stored on a virtual slide server, made available on the Web for remote consultation by pathologists via an integrated virtual slide client network. Despite store-and-forward teledermatopathology being the most frequently used and less expensive approach to teledermatopathology, VSS represents the future in this discipline. The recent pilot studies suggest that the use of remote expert consultants in diagnostic dermatopathology can be integrated into daily routine, teleconsultation, and teleteaching. The new technology enables rapid and reproducible diagnoses, but despite its usability, VSS is not completely feasible for teledermatopathology of inflammatory skin diseases as the performance seems to be influenced by the availability of complete clinical data. Improvements in the diagnostic facility will no doubt follow from further development of the VSS, the slide processor, and of course training in the use of virtual microscope. Undoubtedly, as technology becomes even more sophisticated in the future, VSS will overcome the present drawbacks and find its place in all facets of teledermatopathology.
Development of a dynamic model of a Upflow Anaerobic Sludge Blanket (UASB) reactor
International Nuclear Information System (INIS)
Peters, D.A.; Al-Zybaidy, S.; Bridge, J.
2002-01-01
'Full text:' The Upflow Anaerobic Sludge Blanket Reactor has been modeled in this paper using a semi-empirical correlation. The main objective of the modeling exercise was to examine the dynamics (hydrodynamics and transformation) of critical variables that are important for the reactor process design, performance and operation. These factors include some microbiological variables such as soluble (as COD) and biodegradable organics (as BOD), suspended solids (SS), and biomass concentration (as VSS). The hydraulic variables such as the upflow velocity of the liquid and by extension, upflow velocity of the solids and the volumetric fractions of the liquid (voidage) are also given considerations. The dynamics of external mass transfer of organics and inorganics and the transformation reactions within the reactor are modeled by five non-linear partial differential equations (PDE's), which define dependent variables in one-dimensional temporal and spatial planes, one integrand equation for the gas rate of flow and six algebraic equations that define the reactor performance (conversion rates and removal efficiencies). The PDE's are solved using backward finite differencing method. The discretized equations are computed using a simulation program that was written in the Borland C++ programming language. The model defines the dynamics of the UASB in a simplistic way but which, nonetheless, can be useful for engineering designs where the interest is in qualitative results and not quantitative outcomes. The simulation was validated with data derived from the operation of a pilot model UASB. The pilot model was operated using raw domestic wastewater as substrate, which had an average total COD of 492 mg/L, soluble COD of 172 mg/L, BOD of 220 mg/L, suspended solid of 0.235 g/L and a high sulphate content of 108 mg/L. The average nutrient concentrations were, NH3-N 20 mg/L and PO4 15 mg/L. The UASB was operated at HRT's of 10.968, 8.326 and 5.51 hours The average removal
Bosman, Renske; Borg, Charmaine; Jong, de Peter J.; Georgiadis, Janniko
Samenvatting Achtergrond Aan de ene kant kunnen mensen visuele seksuele stimulatie (VSS) ervaren als plezierig, maar aan de andere kant kunnen mensen VSS ook ervaren als iets “viezigs” en negatief. Dit onderzoek richt zich op de vraag hoe het brein bij vrouwen reageert op VSS en hoe de
Extraretinal induced visual sensations during IMRT of the brain.
Wilhelm-Buchstab, Timo; Buchstab, Barbara Myrthe; Leitzen, Christina; Garbe, Stephan; Müdder, Thomas; Oberste-Beulmann, Susanne; Sprinkart, Alois Martin; Simon, Birgit; Nelles, Michael; Block, Wolfgang; Schoroth, Felix; Schild, Hans Heinz; Schüller, Heinrich
2015-01-01
We observed visual sensations (VSs) in patients undergoing intensity modulated radiotherapy (IMRT) of the brain without the beam passing through ocular structures. We analyzed this phenomenon especially with regards to reproducibility, and origin. Analyzed were ten consecutive patients (aged 41-71 years) with glioblastoma multiforme who received pulsed IMRT (total dose 60Gy) with helical tomotherapy (TT). A megavolt-CT (MVCT) was performed daily before treatment. VSs were reported and recorded using a triggered event recorder. The frequency of VSs was calculated and VSs were correlated with beam direction and couch position. Subjective patient perception was plotted on an 8x8 visual field (VF) matrix. Distance to the orbital roof (OR) from the first beam causing a VS was calculated from the Dicom radiation therapy data and MVCT data. During 175 treatment sessions (average 17.5 per patient) 5959 VSs were recorded and analyzed. VSs occurred only during the treatment session not during the MVCTs. Plotting events over time revealed patient-specific patterns. The average cranio-caudad extension of VS-inducing area was 63.4mm (range 43.24-92.1mm). The maximum distance between the first VS and the OR was 56.1mm so that direct interaction with the retina is unlikely. Data on subjective visual perception showed that VSs occurred mainly in the upper right and left quadrants of the VF. Within the visual pathways the highest probability for origin of VSs was seen in the optic chiasm and the optic tract (22%). There is clear evidence that interaction of photon irradiation with neuronal structures distant from the eye can lead to VSs.
Extraretinal induced visual sensations during IMRT of the brain.
Directory of Open Access Journals (Sweden)
Timo Wilhelm-Buchstab
Full Text Available We observed visual sensations (VSs in patients undergoing intensity modulated radiotherapy (IMRT of the brain without the beam passing through ocular structures. We analyzed this phenomenon especially with regards to reproducibility, and origin.Analyzed were ten consecutive patients (aged 41-71 years with glioblastoma multiforme who received pulsed IMRT (total dose 60Gy with helical tomotherapy (TT. A megavolt-CT (MVCT was performed daily before treatment. VSs were reported and recorded using a triggered event recorder. The frequency of VSs was calculated and VSs were correlated with beam direction and couch position. Subjective patient perception was plotted on an 8x8 visual field (VF matrix. Distance to the orbital roof (OR from the first beam causing a VS was calculated from the Dicom radiation therapy data and MVCT data. During 175 treatment sessions (average 17.5 per patient 5959 VSs were recorded and analyzed. VSs occurred only during the treatment session not during the MVCTs. Plotting events over time revealed patient-specific patterns. The average cranio-caudad extension of VS-inducing area was 63.4mm (range 43.24-92.1mm. The maximum distance between the first VS and the OR was 56.1mm so that direct interaction with the retina is unlikely. Data on subjective visual perception showed that VSs occurred mainly in the upper right and left quadrants of the VF. Within the visual pathways the highest probability for origin of VSs was seen in the optic chiasm and the optic tract (22%.There is clear evidence that interaction of photon irradiation with neuronal structures distant from the eye can lead to VSs.
Developing Agent-Oriented Video Surveillance System through Agent-Oriented Methodology (AOM
Directory of Open Access Journals (Sweden)
Cheah Wai Shiang
2016-12-01
Full Text Available Agent-oriented methodology (AOM is a comprehensive and unified agent methodology for agent-oriented software development. Although AOM is claimed to be able to cope with a complex system development, it is still not yet determined up to what extent this may be true. Therefore, it is vital to conduct an investigation to validate this methodology. This paper presents the adoption of AOM in developing an agent-oriented video surveillance system (VSS. An intruder handling scenario is designed and implemented through AOM. AOM provides an alternative method to engineer a distributed security system in a systematic manner. It presents the security system at a holistic view; provides a better conceptualization of agent-oriented security system and supports rapid prototyping as well as simulation of video surveillance system.
Progress with enhancing veterinary surveillance in the United Kingdom.
Lysons, R E; Gibbens, J C; Smith, L H
2007-01-27
The UK has experienced various animal health events that have had national impact in recent years. In response, a ;Veterinary Surveillance Strategy' (VSS) was published in 2003, with the objective of enhancing and coordinating national veterinary surveillance practice in a way that would enable important animal health events to be detected and assessed more rapidly and reliably. The VSS adopts an integrated UK-wide approach, which includes widespread engagement with interested parties both within government and beyond. It proposes enhancing surveillance through improved collaboration; transparent and defensible prioritisation of government resources to surveillance; deriving better value from existing resources, and assuring quality of the surveillance reports and source data. This article describes progress with implementing the VSS, in particular the methodology for developing a functional network and creating an effective, quality-assured, information management system, RADAR.
Chen, Jiazhong; Lee, Yoomin; Oleszkiewicz, Jan A
2013-01-01
The applicability of four industrial waste streams from potato processing, canola processing and oil refining, biodiesel production (glycerol), and glycol as substitutes to methanol and ethanol in denitrification of anaerobically digested sludge dewatering liquor (centrate) was evaluated in bench-scale sequencing batch reactors. It was found that glycerol was the best substitute with the specific denitrification rate (SDNR) of 13 mg NO3-N/(g VSS x h) followed by potato processing wastewater at 12mg NO3-N/(g VSS x h). Both substrates produced faster SDNR than methanol's 10mg NO3-N/(g VSS x h); however, they were inferior to ethanol's 17 mg NO3-N/(g VSS x h). Glycol had SDNR of 8 mg NO3-N/(g VSS x h) and demonstrated a very fast acclimation rate, i.e. the response in increased denitrification rate was visible in three days following glycol addition. Canola processing and oil refining wastewater was considered an inappropriate carbon source due to a low SDNR of 5 mg NO3-N/(g VSS x h) and apparent inhibitory effect on nitrification.
Nickelson, Jen; Alfonso, Moya L; McDermott, Robert J; Bumpus, Elizabeth C; Bryant, Carol A; Baldwin, Julie A
2011-04-01
Creating community-based opportunities for youth to be physically active is challenging for many municipalities. A Lexington, Kentucky community coalition designed and piloted a physical activity program, 'VERB™ summer scorecard (VSS)', leveraging the brand equity of the national VERB™--It's What You Do! campaign. Key elements of VSS subsequently were adopted in Sarasota County, FL. This study identified characteristics of Sarasota's VSS participants and non-participants. Students in Grades 5-8 from six randomly selected public schools completed a survey assessing VSS participation, physical activity level, psychosocial variables, parental support for physical activity and demographics. Logistic regression showed that VSS participants were more likely to be from Grades 5 to 6 versus Grades 7 and 8 [odds ratio (OR) = 6.055] and perceive high versus low parental support for physical activity (OR = 4.627). Moreover, for each unit rise in self-efficacy, the odds of VSS participation rose by 1.839. Chi-squared automatic interaction detector (CHAID) analysis suggested an interaction effect between grade and school socioeconomic status (SES), with a large proportion of seventh and eighth graders from high SES schools being non-participants (76.6%). A VSS-style program can be expected to be more effective with tweens who are younger, in a middle SES school, having high self-efficacy and high parental support for physical activity.
Mathematical modeling of high-rate Anammox UASB reactor based on granular packing patterns
International Nuclear Information System (INIS)
Tang, Chong-Jian; He, Rui; Zheng, Ping; Chai, Li-Yuan; Min, Xiao-Bo
2013-01-01
Highlights: ► A novel model was conducted to estimate volumetric nitrogen conversion rates. ► The packing patterns of the granules in Anammox reactor are investigated. ► The simple cubic packing pattern was simulated in high-rate Anammox UASB reactor. ► Operational strategies concerning sludge concentration were proposed by the modeling. -- Abstract: A novel mathematical model was developed to estimate the volumetric nitrogen conversion rates of a high-rate Anammox UASB reactor based on the packing patterns of granular sludge. A series of relationships among granular packing density, sludge concentration, hydraulic retention time and volumetric conversion rate were constructed to correlate Anammox reactor performance with granular packing patterns. It was suggested that the Anammox granules packed as the equivalent simple cubic pattern in high-rate UASB reactor with packing density of 50–55%, which not only accommodated a high concentration of sludge inside the reactor, but also provided large pore volume, thus prolonging the actual substrate conversion time. Results also indicated that it was necessary to improve Anammox reactor performance by enhancing substrate loading when sludge concentration was higher than 37.8 gVSS/L. The established model was carefully calibrated and verified, and it well simulated the performance of granule-based high-rate Anammox UASB reactor
Mathematical modeling of high-rate Anammox UASB reactor based on granular packing patterns
Energy Technology Data Exchange (ETDEWEB)
Tang, Chong-Jian, E-mail: chjtangzju@yahoo.com.cn [Department of Environmental Engineering, School of Metallurgical Science and Engineering, Central South University, Changsha 410083 (China); National Engineering Research Center for Control and Treatment of Heavy Metal Pollution, Changsha 410083 (China); He, Rui; Zheng, Ping [Department of Environmental Engineering, Zhejiang University, Zijingang Campus, Hangzhou 310058 (China); Chai, Li-Yuan; Min, Xiao-Bo [Department of Environmental Engineering, School of Metallurgical Science and Engineering, Central South University, Changsha 410083 (China); National Engineering Research Center for Control and Treatment of Heavy Metal Pollution, Changsha 410083 (China)
2013-04-15
Highlights: ► A novel model was conducted to estimate volumetric nitrogen conversion rates. ► The packing patterns of the granules in Anammox reactor are investigated. ► The simple cubic packing pattern was simulated in high-rate Anammox UASB reactor. ► Operational strategies concerning sludge concentration were proposed by the modeling. -- Abstract: A novel mathematical model was developed to estimate the volumetric nitrogen conversion rates of a high-rate Anammox UASB reactor based on the packing patterns of granular sludge. A series of relationships among granular packing density, sludge concentration, hydraulic retention time and volumetric conversion rate were constructed to correlate Anammox reactor performance with granular packing patterns. It was suggested that the Anammox granules packed as the equivalent simple cubic pattern in high-rate UASB reactor with packing density of 50–55%, which not only accommodated a high concentration of sludge inside the reactor, but also provided large pore volume, thus prolonging the actual substrate conversion time. Results also indicated that it was necessary to improve Anammox reactor performance by enhancing substrate loading when sludge concentration was higher than 37.8 gVSS/L. The established model was carefully calibrated and verified, and it well simulated the performance of granule-based high-rate Anammox UASB reactor.
Calise, A. J.; Kadushin, I.; Kramer, F.
1981-01-01
The current status of research on the application of variable structure system (VSS) theory to design aircraft flight control systems is summarized. Two aircraft types are currently being investigated: the Augmentor Wing Jet STOL Research Aircraft (AWJSRA), and AV-8A Harrier. The AWJSRA design considers automatic control of longitudinal dynamics during the landing phase. The main task for the AWJSRA is to design an automatic landing system that captures and tracks a localizer beam. The control task for the AV-8A is to track velocity commands in a hovering flight configuration. Much effort was devoted to developing computer programs that are needed to carry out VSS design in a multivariable frame work, and in becoming familiar with the dynamics and control problems associated with the aircraft types under investigation. Numerous VSS design schemes were explored, particularly for the AWJSRA. The approaches that appear best suited for these aircraft types are presented. Examples are given of the numerical results currently being generated.
Elastin Is Differentially Regulated by Pressure Therapy in a Porcine Model of Hypertrophic Scar.
Carney, Bonnie C; Liu, Zekun; Alkhalil, Abdulnaser; Travis, Taryn E; Ramella-Roman, Jessica; Moffatt, Lauren T; Shupp, Jeffrey W
Beneficial effects of pressure therapy for hypertrophic scars have been reported, but the mechanisms of action are not fully understood. This study evaluated elastin and its contribution to scar pliability. The relationship between changes in Vancouver Scar Scale (VSS) scores of pressure-treated scars and differential regulation of elastin was assessed. Hypertrophic scars were created and assessed weekly using VSS and biopsy procurement. Pressure treatment began on day 70 postinjury. Treated scars were compared with untreated shams. Treatment lasted 2 weeks, through day 84, and scars were assessed weekly through day 126. Transcript and protein levels of elastin were quantified. Pressure treatment resulted in lower VSS scores compared with sham-treated scars. Pliability (VSSP) was a key contributor to this difference. At day 70 pretreatment, VSSP = 2. Without treatment, sham-treated scars became less pliable, while pressure-treated scars became more pliable. The percentage of elastin in scars at day 70 was higher than in uninjured skin. Following treatment, the percentage of elastin increased and continued to increase through day 126. Untreated sham scars did not show a similar increase. Quantification of Verhoeff-Van Gieson staining corroborated the findings and immunofluorescence revealed the alignment of elastin fibers. Pressure treatment results in increased protein level expression of elastin compared with sham-untreated scars. These findings further characterize the extracellular matrix's response to the application of pressure as a scar treatment, which will contribute to the refinement of rehabilitation practices and ultimately improvements in functional and psychosocial outcomes for patients.
Berezhkovskiy, Leonid M
2013-02-01
The steady state, V(ss), terminal volume of distribution, V(β), and the terminal half-life, t(1/2), are commonly obtained from the drug plasma concentration-time profile, C(p)(t), following intravenous dosing. Unlike V(ss) that can be calculated based on the physicochemical properties of drugs considering the equilibrium partitioning between plasma and organ tissues, t(1/2) and V(β) cannot be calculated that way because they depend on the rates of drug transfer between blood and tissues. Considering the physiological pharmacokinetic model pertinent to the terminal phase of drug elimination, a novel equation that calculates t(1/2) (and consequently V(β)) was derived. It turns out that V(ss), the total body clearance, Cl, equilibrium blood-plasma concentration ratio, r; and the physiological parameters of the body such as cardiac output, and blood and tissue volumes are sufficient for determination of terminal kinetics. Calculation of t(1/2) by the obtained equation appears to be in good agreement with the experimentally observed vales of this parameter in pharmacokinetic studies in rat, monkey, dog, and human. The equation for the determination of the pre-exponent of the terminal phase of C(p)(t) is also found. The obtained equation allows to predict t(1/2) in human assuming that V(ss) and Cl were either obtained by allometric scaling or, respectively, calculated in silico or based on in vitro drug stability measurements. For compounds that have high clearance, the derived equation may be applied to calculate r just using the routine data on Cl, V(ss), and t(1/2), rather than doing the in vitro assay to measure this parameter. Copyright © 2012 Wiley Periodicals, Inc.
Association between vestibular schwannomas and mobile phone use
Moon, In Seok; Kim, Bo Gyung; Kim, Jinna; Lee, Jong Dae; Lee, Won-Sang
2013-01-01
Vestibular schwannomas (VSs) grow in the region where the energy from mobile phone use is absorbed. We examined the associations of VSs with mobile phone use. This study included 119 patients who had undergone surgical tumor removal. We used two approaches in this investigation. First, a case–control study for the association of mobile phone use and incidence of VSs was conducted. Both cases and controls were investigated with questions based on INTERPHONE guidelines. Amount of mobile phone u...
Additively Manufactured Ceramic Rocket Engine Components
National Aeronautics and Space Administration — HRL Laboratories, LLC, with Vector Space Systems (VSS) as subcontractor, has a 24-month effort to develop additive manufacturing technology for reinforced ceramic...
The effects of fatigue on robotic surgical skill training in Urology residents.
Mark, James R; Kelly, Douglas C; Trabulsi, Edouard J; Shenot, Patrick J; Lallas, Costas D
2014-09-01
This study reports on the effect of fatigue on Urology residents using the daVinci surgical skills simulator (dVSS). Seven Urology residents performed a series of selected exercises on the dVSS while pre-call and post-call. Prior to dVSS performance a survey of subjective fatigue was taken and residents were tested with the Epworth Sleepiness Scale (ESS). Using the metrics available in the dVSS software, the performance of each resident was evaluated. The Urology residents slept an average of 4.07 h (range 2.5-6 h) while on call compared to an average of 5.43 h while not on call (range 3-7 h, p = 0.08). Post-call residents were significantly more likely to be identified as fatigued by the Epworth Sleepiness Score than pre-call residents (p = 0.01). Significant differences were observed in fatigued residents performing the exercises, Tubes and Match Board 2 (p = 0.05, 0.02). Additionally, there were significant differences in the total number of critical errors during the training session (9.29 vs. 3.14, p = 0.04). Fatigue in post-call Urology residents leads to poorer performance on the dVSS simulator. The dVSS may become a useful instrument in the education of fatigued residents and a tool to identify fatigue in trainees.
Saikrishnan, Neelakantan; Mirabella, Lucia; Yoganathan, Ajit P
2015-06-01
Congenital bicuspid aortic valves (BAVs) are associated with accelerated disease progression, such as leaflet calcification and ascending aorta dilatation. Although common underlying genetic factors have been implicated in accelerated disease in BAV patients, several studies have suggested that altered hemodynamics also play a role in this disease process. The present study compares turbulence and wall shear stress (WSS) measurements between various BAV and trileaflet aortic valve (TAV) models to provide information for mechanobiological models of BAV disease. BAV and TAV models were constructed from excised porcine aortic valves to simulate parametric variations in BAV stenosis, hemodynamics and geometry. Particle image velocimetry experiments were conducted at physiological pressure conditions to characterize velocity fields in the ascending aorta. The velocity fields were post-processed to calculate turbulence, viscous and wall shear stresses in the ascending aorta. Stenosed BAV models showed the presence of eccentric systolic jets, causing increased WSS. Lower cardiac output resulted in a narrower jet, lower turbulence and lower viscous shear stress (VSS). The specific severe stenosis BAV model studied here showed reduced WSS due to reduction in non-fused leaflet mobility. Dilation of the aorta did not affect any turbulence or VSS, but reduced the WSS. In comparison with BAVs, TAVs have similar VSS values, but much smaller WSS and turbulence levels. These increased turbulence and WSS levels in BAVs may play a key role in amplifying the biological responses of the ascending aorta wall and valvular leaflets, and support the hemodynamic underpinnings of BAV disease processes.
Simulation of the Impact of SRT on Anaerobic Digestability of Ultrasonicated Hog Manure
Elbeshbishy; Nakevski; Hafez; Ray; Nakhla
2010-01-01
Ultrasonication at a specific energy of 500 kJ/kgTS was applied to hog manure in a continuous mode completely mixed anaerobic digestion. A process model in BioWin was developed, calibrated and tested at different solids retention times (SRTs) to evaluate the process economics. The results showed that there was a 36% increase in volatile suspended solids (VSS) removal efficiency, a 20% increase in methane production rate, a 13.5% increase in destruction of bound proteins, and a reduction from ...
Kammoun, Soulaymen; Sallem, Souhir; Ben Ali Kammoun, Mohamed
2017-11-01
The aim of this study is to enhance DFIG based Wind Energy Conversion Systems (WECS) dynamics during grid coupling. In this paper, a system modelling and a starting/coupling procedure for this generator to the grid are proposed. The proposed non-linear system is a variable structure system (VSS) and has two different states, before and after coupling. So, two different state models are given to the system to analyse transient stability during the coupling. The given model represents well the transient state of the machine, through which, a behaviour assessment of the generator before, during and after connection is given based on simulation results. For this, a 300 kW DFIG based wind generation system model was simulated on the Matlab/SIMULINK environment. We judge the proposed procedure to be practical, smooth and stability improved.
Quantitative measurement of hypertrophic scar: interrater reliability and concurrent validity.
Nedelec, Bernadette; Correa, José A; Rachelska, Grazyna; Armour, Alexis; LaSalle, Léo
2008-01-01
Research into the pathophysiology and treatment of hypertrophic scar (HSc) remains limited by the heterogeneity of scar and the imprecision with which its severity is measured. The objective of this study was to test the interrater reliability and concurrent validity of the Cutometer measurement of elasticity, the Mexameter measurement of erythema and pigmentation, and total thickness measure of the DermaScan C relative to the modified Vancouver Scar Scale (mVSS) in patient-matched normal skin, normal scar, and HSc. Three independent investigators evaluated 128 sites (severe HSc, moderate or mild HSc, donor site, and normal skin) on 32 burn survivors using all of the above measurement tools. The intraclass correlation coefficient, which was used to measure interrater reliability, reflects the inherent amount of error in the measure and is considered acceptable when it is >0.75. Interrater reliability of the totals of the height, pliability, and vascularity subscales of the mVSS fell below the acceptable limit ( congruent with0.50). The individual subscales of the mVSS fell well below the acceptable level (0.89) for each study site with the exception of severe scar. Mexameter and DermaScan C reliability measurements were acceptable for all sites (>0.82). Concurrent validity correlations with the mVSS were significant except for the comparison of the mVSS pliability subscale and the Cutometer maximum deformation measure comparison in severe scar. In conclusion, the Mexameter and DermaScan C measurements of scar color and thickness of all sites, as well as the Cutometer measurement of elasticity in all but the most severe scars shows high interrater reliability. Their significant concurrent validity with the mVSS confirms that these tools are measuring the same traits as the mVSS, and in a more objective way.
Borg, Charmaine; de Jong, Peter J.; Georgiadis, Janniko R.
Lifetime experiences shape people's attitudes toward sexual stimuli. Visual sexual stimulation (VSS), for instance, may be perceived as pleasurable by some, but as disgusting or ambiguous by others. VSS depicting explicit penile-vaginal penetration (PEN) is relevant in this respect, because the act
Selected sports talent development models
Directory of Open Access Journals (Sweden)
Michal Vičar
2017-06-01
Full Text Available Background: Sports talent in the Czech Republic is generally viewed as a static, stable phenomena. It stands in contrast with widespread praxis carried out in Anglo-Saxon countries that emphasise its fluctuant nature. This is reflected in the current models describing its development. Objectives: The aim is to introduce current models of talent development in sport. Methods: Comparison and analysing of the following models: Balyi - Long term athlete development model, Côté - Developmental model of sport participation, Csikszentmihalyi - The flow model of optimal expertise, Bailey and Morley - Model of talent development. Conclusion: Current models of sport talent development approach talent as dynamic phenomenon, varying in time. They are based in particular on the work of Simonton and his Emergenic and epigenic model and of Gagné and his Differentiated model of giftedness and talent. Balyi's model is characterised by its applicability and impications for practice. Côté's model highlights the role of family and deliberate play. Both models describe periodization of talent development. Csikszentmihalyi's flow model explains how the athlete acquires experience and develops during puberty based on the structure of attention and flow experience. Bailey and Morley's model accents the situational approach to talent and development of skills facilitating its growth.
ENTERPRISES DEVELOPMENT: MANAGEMENT MODEL
Directory of Open Access Journals (Sweden)
Lina Shenderivska
2018-01-01
Full Text Available The paper’s purpose is to provide recommendations for the effective managing the companies’ development taking into account the sectoral key elements’ transformation. Methodology. The enterprise profits’ econometric simulation is conducted to determine the most significant factors influencing their development. According to the model testing result, their multicollinearity was revealed. To get rid of the multicollinearity phenomenon from the profit models, isolated regressors are excluded, namely, return on assets, material returns, return on equity. To obtain qualitative models with a small error of model parameters estimation and, accordingly, high reliability of the conclusion about the interrelation between the factors of the model and the resulting feature, factors in the income model that are not closely interconnected, that is, not multicollinear, are included. Determination coefficients R2 and F-criterion were calculated for model quality checking. The modern printing enterprises of Ukraine key elements, connected with integration into the global information space, are analysed. Results. The interrelation between a company’s development and earning capacity is identified in the study. The profit importance as the main source for enterprise financing is substantiated. Factors that have the greatest impact on the enterprises’ development are labour productivity, financial autonomy, working capital turnover, and the character of their influence is most adequately reflected by the power model. Peculiarities of the enterprises’ activity include increased competition at the inter-branch level, poorly developed industrial relations, and the own sources of financing activities shortage. Practical implications. Based on information on the most significant developmental impact factors, directions for perspective enterprises development for their competitiveness increase are proposed: diversification based on the activity expansion
Hernandez, J E; Bachmann, R T; Edyvean, R G J
2006-01-01
The measurement of biomass concentration is important in biological wastewater treatment. This paper compares the accuracy and costs of the traditional volatile suspended solids (VSS) and the proposed suspended organic carbon (SOC) methods. VSS and SOC values of a dilution system were very well correlated (R(2)=0.9995). VSS and SOC of 16 samples were determined, the mean SOC/VSS ratio (0.52, n=16, sigma=0.01) was close to the theoretical value (0.53). For costing analysis, two hypothetical cases were analysed. In case A, it is assumed that 108 samples are analysed annually from two continuous reactors. Case B represents a batch experiment to be carried out in 24 incubated serum bottles. The savings, when using the SOC method, were 11,987 pounds for case A and 90 pounds for case B. This study suggests the use of SOC method as a time saving and lower cost biomass concentration measurement.
Hollander R.J.M. den; Bouma, H.; Rest, J.H.C. van; Hove, J.M. ten; Haar, F.B. ter; Burghouts, G.J.
2017-01-01
Video analytics is essential for managing large quantities of raw data that are produced by video surveillance systems (VSS) for the prevention, repression and investigation of crime and terrorism. Analytics is highly sensitive to changes in the scene, and for changes in the optical chain so a VSS
Developing mathematical modelling competence
DEFF Research Database (Denmark)
Blomhøj, Morten; Jensen, Tomas Højgaard
2003-01-01
In this paper we introduce the concept of mathematical modelling competence, by which we mean being able to carry through a whole mathematical modelling process in a certain context. Analysing the structure of this process, six sub-competences are identified. Mathematical modelling competence...... cannot be reduced to these six sub-competences, but they are necessary elements in the development of mathematical modelling competence. Experience from the development of a modelling course is used to illustrate how the different nature of the sub-competences can be used as a tool for finding...... the balance between different kinds of activities in a particular educational setting. Obstacles of social, cognitive and affective nature for the students' development of mathematical modelling competence are reported and discussed in relation to the sub-competences....
African Journals Online (AJOL)
A single product perishing inventory model with demand interaction · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT · DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. VSS Yadavalli, CdeW van Schoor, JJ Strasheim, S Udayabaskaran, 109-124. http://dx.doi.org/10.5784/20-2-10 ...
Econometric models for biohydrogen development.
Lee, Duu-Hwa; Lee, Duu-Jong; Veziroglu, Ayfer
2011-09-01
Biohydrogen is considered as an attractive clean energy source due to its high energy content and environmental-friendly conversion. Analyzing various economic scenarios can help decision makers to optimize development strategies for the biohydrogen sector. This study surveys econometric models of biohydrogen development, including input-out models, life-cycle assessment approach, computable general equilibrium models, linear programming models and impact pathway approach. Fundamentals of each model were briefly reviewed to highlight their advantages and disadvantages. The input-output model and the simplified economic input-output life-cycle assessment model proved most suitable for economic analysis of biohydrogen energy development. A sample analysis using input-output model for forecasting biohydrogen development in the United States is given. Copyright © 2011 Elsevier Ltd. All rights reserved.
UASB reactor start up in real scale for malting effluent
International Nuclear Information System (INIS)
Lopez, I.; Passeggi, M.; Boix, C.; Barcia, R.; Borzacconi, L.; Liebermann, L.
2005-01-01
An Imhoff tank was reconstructed into a 250 m3 UASB reactor in order to treat a malting plant wastewater.The UASB was inoculated with sludge from an anaerobic lagoon used for slaughterhouse wastewater treatment.The fat present in the inoculated sludge did not affect the start up performance. After two month of operation the reactor achieved full load with COD removal higher than 80% and a biogas production of 300 m3/day. The mean diameter of granules was 0a.milimeters and the Specific Methanogenic Activity was 0.25 g COD/gVSS.d The banquet development throughout time (solids concentrations at different heights, granule size, methanogenic activity) was monitored. A yield coefficient of 0.09 gVSS/g COD rem was found
PAVS: A New Privacy-Preserving Data Aggregation Scheme for Vehicle Sensing Systems.
Xu, Chang; Lu, Rongxing; Wang, Huaxiong; Zhu, Liehuang; Huang, Cheng
2017-03-03
Air pollution has become one of the most pressing environmental issues in recent years. According to a World Health Organization (WHO) report, air pollution has led to the deaths of millions of people worldwide. Accordingly, expensive and complex air-monitoring instruments have been exploited to measure air pollution. Comparatively, a vehicle sensing system (VSS), as it can be effectively used for many purposes and can bring huge financial benefits in reducing high maintenance and repair costs, has received considerable attention. However, the privacy issues of VSS including vehicles' location privacy have not been well addressed. Therefore, in this paper, we propose a new privacy-preserving data aggregation scheme, called PAVS, for VSS. Specifically, PAVS combines privacy-preserving classification and privacy-preserving statistics on both the mean E(·) and variance Var(·), which makes VSS more promising, as, with minimal privacy leakage, more vehicles are willing to participate in sensing. Detailed analysis shows that the proposed PAVS can achieve the properties of privacy preservation, data accuracy and scalability. In addition, the performance evaluations via extensive simulations also demonstrate its efficiency.
Modelling energy systems for developing countries
International Nuclear Information System (INIS)
Urban, F.; Benders, R.M.J.; Moll, H.C.
2007-01-01
Developing countries' energy use is rapidly increasing, which affects global climate change and global and regional energy settings. Energy models are helpful for exploring the future of developing and industrialised countries. However, energy systems of developing countries differ from those of industrialised countries, which has consequences for energy modelling. New requirements need to be met by present-day energy models to adequately explore the future of developing countries' energy systems. This paper aims to assess if the main characteristics of developing countries are adequately incorporated in present-day energy models. We first discuss these main characteristics, focusing particularly on developing Asia, and then present a model comparison of 12 selected energy models to test their suitability for developing countries. We conclude that many models are biased towards industrialised countries, neglecting main characteristics of developing countries, e.g. the informal economy, supply shortages, poor performance of the power sector, structural economic change, electrification, traditional bio-fuels, urban-rural divide. To more adequately address the energy systems of developing countries, energy models have to be adjusted and new models have to be built. We therefore indicate how to improve energy models for increasing their suitability for developing countries and give advice on modelling techniques and data requirements
Steinbach, Sarah M L; Sturgess, Christopher P; Dunning, Mark D; Neiger, Reto
2015-06-01
Assessment of renal function by means of plasma clearance of a suitable marker has become standard procedure for estimation of glomerular filtration rate (GFR). Sinistrin, a polyfructan solely cleared by the kidney, is often used for this purpose. Pharmacokinetic modeling using adequate software is necessary to calculate disappearance rate and half-life of sinistrin. The purpose of this study was to describe the use of a Microsoft excel based add-in program to calculate plasma sinistrin clearance, as well as additional pharmacokinetic parameters such as transfer rates (k), half-life (t1/2) and volume of distribution (Vss) for sinistrin in dogs with varying degrees of renal function. Copyright © 2015 Elsevier Ltd. All rights reserved.
Selected sports talent development models
Michal Vičar
2017-01-01
Background: Sports talent in the Czech Republic is generally viewed as a static, stable phenomena. It stands in contrast with widespread praxis carried out in Anglo-Saxon countries that emphasise its fluctuant nature. This is reflected in the current models describing its development. Objectives: The aim is to introduce current models of talent development in sport. Methods: Comparison and analysing of the following models: Balyi - Long term athlete development model, Côté - Developmen...
A modified method to determine biomass concentration as COD in ...
African Journals Online (AJOL)
drinie
2002-10-04
Oct 4, 2002 ... A modification of the standard VSS technique was also proposed using two membranes in the filtration device; this technique allowed the biomass determination in 1 μm size bacteria cultures that cannot be detected by the standard VSS method because cells are not retained by the 1.5 μm diameter pore ...
Advanced Mirror & Modelling Technology Development
Effinger, Michael; Stahl, H. Philip; Abplanalp, Laura; Maffett, Steven; Egerman, Robert; Eng, Ron; Arnold, William; Mosier, Gary; Blaurock, Carl
2014-01-01
The 2020 Decadal technology survey is starting in 2018. Technology on the shelf at that time will help guide selection to future low risk and low cost missions. The Advanced Mirror Technology Development (AMTD) team has identified development priorities based on science goals and engineering requirements for Ultraviolet Optical near-Infrared (UVOIR) missions in order to contribute to the selection process. One key development identified was lightweight mirror fabrication and testing. A monolithic, stacked, deep core mirror was fused and replicated twice to achieve the desired radius of curvature. It was subsequently successfully polished and tested. A recently awarded second phase to the AMTD project will develop larger mirrors to demonstrate the lateral scaling of the deep core mirror technology. Another key development was rapid modeling for the mirror. One model focused on generating optical and structural model results in minutes instead of months. Many variables could be accounted for regarding the core, face plate and back structure details. A portion of a spacecraft model was also developed. The spacecraft model incorporated direct integration to transform optical path difference to Point Spread Function (PSF) and between PSF to modulation transfer function. The second phase to the project will take the results of the rapid mirror modeler and integrate them into the rapid spacecraft modeler.
Posser, Gracieli; Reis, Ricardo
2017-01-01
This book describes new and effective methodologies for modeling, analyzing and mitigating cell-internal signal electromigration in nanoCMOS, with significant circuit lifetime improvements and no impact on performance, area and power. The authors are the first to analyze and propose a solution for the electromigration effects inside logic cells of a circuit. They show in this book that an interconnect inside a cell can fail reducing considerably the circuit lifetime and they demonstrate a methodology to optimize the lifetime of circuits, by placing the output, Vdd and Vss pin of the cells in the less critical regions, where the electromigration effects are reduced. Readers will be enabled to apply this methodology only for the critical cells in the circuit, avoiding impact in the circuit delay, area and performance, thus increasing the lifetime of the circuit without loss in other characteristics. .
Models for Sustainable Regional Development
DEFF Research Database (Denmark)
Rasmussen, Lauge Baungaard
2008-01-01
The chapter presents a model for integrated cross-cultural knowledge building and entrepreneurship. In addtion, narrative and numeric simulations methods are suggested to promote a further development and implementation of the model in China.......The chapter presents a model for integrated cross-cultural knowledge building and entrepreneurship. In addtion, narrative and numeric simulations methods are suggested to promote a further development and implementation of the model in China....
Kruyt, Ivo J; Verheul, Jeroen B; Hanssens, Patrick E J; Kunst, Henricus P M
2018-01-01
OBJECTIVE Neurofibromatosis Type 2 (NF2) is a tumor syndrome characterized by an autosomal dominant pattern of inheritance. The hallmark of NF2 is the development of bilateral vestibular schwannomas (VSs), generally by 30 years of age. One of the first-line treatment options for small to medium-large VSs is radiosurgery. Although radiosurgery shows excellent results in sporadic VS, its use in NF2-related VS is still a topic of dispute. The aim of this study was to evaluate long-term tumor control, hearing preservation rates, and factors influencing outcome of optimally dosed, contemporary Gamma Knife radiosurgery (GKRS) for growing VSs in patients with NF2 and compare the findings to data obtained in patients with sporadic VS also treated by means of GKRS. METHODS The authors performed a retrospective analysis of 47 growing VSs in 34 NF2 patients who underwent GKRS treatment performed with either the Model C or Perfexion Leksell Gamma Knife, with a median margin dose of 11 Gy. Actuarial tumor control rates were estimated using the Kaplan-Meier method. For patient- and treatment-related factors, a Cox proportional hazards model was used to identify predictors of outcome. Trigeminal, facial, and vestibulocochlear nerve function were assessed before and after treatment. NF2-related VS patients were matched 1:1 with sporadic VS patients who were treated in the same institute, and the same indications for treatment, definitions, and dosimetry were used in order to compare outcomes. RESULTS Actuarial tumor control rates in NF2 patients after 1, 3, 5, and 8 years were 98%, 89%, 87%, and 87%, respectively. Phenotype and tumor volume had significant hazard rates of 0.086 and 22.99, respectively, showing that Feiling-Gardner phenotype and a tumor volume not exceeding 6 cm 3 both were associated with significantly better outcome. Actuarial rates of serviceable hearing preservation after 1, 3, 5, and 7 years were 95%, 82%, 59%, and 33%, respectively. None of the patients
Strategies for developing competency models.
Marrelli, Anne F; Tondora, Janis; Hoge, Michael A
2005-01-01
There is an emerging trend within healthcare to introduce competency-based approaches in the training, assessment, and development of the workforce. The trend is evident in various disciplines and specialty areas within the field of behavioral health. This article is designed to inform those efforts by presenting a step-by-step process for developing a competency model. An introductory overview of competencies, competency models, and the legal implications of competency development is followed by a description of the seven steps involved in creating a competency model for a specific function, role, or position. This modeling process is drawn from advanced work on competencies in business and industry.
Eldyasti, Ahmed; Andalib, Mehran; Hafez, Hisham; Nakhla, George; Zhu, Jesse
2011-03-15
Steady state operational data from a pilot scale circulating fluidized bed bioreactor (CFBBR) during biological treatment of landfill leachate, at empty bed contact times (EBCTs) of 0.49, and 0.41 d and volumetric nutrients loading rates of 2.2-2.6 kg COD/(m(3)d), 0.7-0.8 kg N/(m(3)d), and 0.014-0.016 kg P/(m(3)d), was used to calibrate and compare developed process models in BioWin(®) and AQUIFAS(®). BioWin(®) and AQUIFAS(®) were both capable of predicting most of the performance parameters such as effluent TKN, NH(4)-N, NO(3)-N, TP, PO(4)-P, TSS, and VSS with an average percentage error (APE) of 0-20%. BioWin(®) underpredicted the effluent BOD and SBOD values for various runs by 80% while AQUIFAS(®) predicted effluent BOD and SBOD with an APE of 50%. Although both calibrated models, confirmed the advantages of the CFBBR technology in treating the leachate of high volumetric loading and low biomass yields due to the long solid retention time (SRT), both BioWin(®) and AQUIFAS(®) predicted the total biomass and SRT of CFBBR based on active biomass only, whereas in the CFBBR runs both active as well as inactive biomass accumulated. Copyright © 2011 Elsevier B.V. All rights reserved.
RSMASS system model development
International Nuclear Information System (INIS)
Marshall, A.C.; Gallup, D.R.
1998-01-01
RSMASS system mass models have been used for more than a decade to make rapid estimates of space reactor power system masses. This paper reviews the evolution of the RSMASS models and summarizes present capabilities. RSMASS has evolved from a simple model used to make rough estimates of space reactor and shield masses to a versatile space reactor power system model. RSMASS uses unique reactor and shield models that permit rapid mass optimization calculations for a variety of space reactor power and propulsion systems. The RSMASS-D upgrade of the original model includes algorithms for the balance of the power system, a number of reactor and shield modeling improvements, and an automatic mass optimization scheme. The RSMASS-D suite of codes cover a very broad range of reactor and power conversion system options as well as propulsion and bimodal reactor systems. Reactor choices include in-core and ex-core thermionic reactors, liquid metal cooled reactors, particle bed reactors, and prismatic configuration reactors. Power conversion options include thermoelectric, thermionic, Stirling, Brayton, and Rankine approaches. Program output includes all major component masses and dimensions, efficiencies, and a description of the design parameters for a mass optimized system. In the past, RSMASS has been used as an aid to identify and select promising concepts for space power applications. The RSMASS modeling approach has been demonstrated to be a valuable tool for guiding optimization of the power system design; consequently, the model is useful during system design and development as well as during the selection process. An improved in-core thermionic reactor system model RSMASS-T is now under development. The current development of the RSMASS-T code represents the next evolutionary stage of the RSMASS models. RSMASS-T includes many modeling improvements and is planned to be more user-friendly. RSMASS-T will be released as a fully documented, certified code at the end of
Organics removal from landfill leachate and activated sludge production in SBR reactors
International Nuclear Information System (INIS)
Klimiuk, Ewa; Kulikowska, Dorota
2006-01-01
This study is aimed at estimating organic compounds removal and sludge production in SBR during treatment of landfill leachate. Four series were performed. At each series, experiments were carried out at the hydraulic retention time (HRT) of 12, 6, 3 and 2 d. The series varied in SBR filling strategies, duration of the mixing and aeration phases, and the sludge age. In series 1 and 2 (a short filling period, mixing and aeration phases in the operating cycle), the relationship between organics concentration (COD) in the leachate treated and HRT was pseudo-first-order kinetics. In series 3 (with mixing and aeration phases) and series 4 (only aeration phase) with leachate supplied by means of a peristaltic pump for 4 h of the cycle (filling during reaction period) - this relationship was zero-order kinetics. Activated sludge production expressed as the observed coefficient of biomass production (Y obs ) decreased correspondingly with increasing HRT. The smallest differences between reactors were observed in series 3 in which Y obs was almost stable (0.55-0.6 mg VSS/mg COD). The elimination of the mixing phase in the cycle (series 4) caused the Y obs to decrease significantly from 0.32 mg VSS/mg COD at HRT 2 d to 0.04 mg VSS/mg COD at HRT 12 d. The theoretical yield coefficient Y accounted for 0.534 mg VSS/mg COD (series 1) and 0.583 mg VSS/mg COD (series 2). In series 3 and 4, it was almost stable (0.628 mg VSS/mg COD and 0.616 mg VSS/mg COD, respectively). After the elimination of the mixing phase in the operating cycle, the specific biomass decay rate increased from 0.006 d -1 (series 3) to 0.032 d -1 (series 4). The operating conditions employing mixing/aeration or only aeration phases enable regulation of the sludge production. The SBRs operated under aerobic conditions are more favourable at a short hydraulic retention time. At long hydraulic retention time, it can lead to a decrease in biomass concentration in the SBR as a result of cell decay. On the contrary
The development of a sustainable development model framework
International Nuclear Information System (INIS)
Hannoura, Alim P.; Cothren, Gianna M.; Khairy, Wael M.
2006-01-01
The emergence of the 'sustainable development' concept as a response to the mining of natural resources for the benefit of multinational corporations has advanced the cause of long-term environmental management. A sustainable development model (SDM) framework that is inclusive of the 'whole' natural environment is presented to illustrate the integration of the sustainable development of the 'whole' ecosystem. The ecosystem approach is an inclusive framework that covers the natural environment relevant futures and constraints. These are dynamically interconnected and constitute the determinates of resources development component of the SDM. The second component of the SDM framework is the resources development patterns, i.e., the use of land, water, and atmospheric resources. All of these patterns include practices that utilize environmental resources to achieve a predefined outcome producing waste and by-products that require disposal into the environment. The water quality management practices represent the third component of the framework. These practices are governed by standards, limitations and available disposal means subject to quantity and quality permits. These interconnected standards, practices and permits shape the resulting environmental quality of the ecosystem under consideration. A fourth component, environmental indicators, of the SDM framework provides a measure of the ecosystem productivity and status that may differ based on societal values and culture. The four components of the SDM are interwoven into an outcome assessment process to form the management and feedback models. The concept of Sustainable Development is expressed in the management model as an objective function subject to desired constraints imposing the required bounds for achieving ecosystem sustainability. The development of the objective function and constrains requires monetary values for ecosystem functions, resources development activities and environmental cost. The
GRA model development at Bruce Power
International Nuclear Information System (INIS)
Parmar, R.; Ngo, K.; Cruchley, I.
2011-01-01
In 2007, Bruce Power undertook a project, in partnership with AMEC NSS Limited, to develop a Generation Risk Assessment (GRA) model for its Bruce B Nuclear Generating Station. The model is intended to be used as a decision-making tool in support of plant operations. Bruce Power has recognized the strategic importance of GRA in the plant decision-making process and is currently implementing a pilot GRA application. The objective of this paper is to present the scope of the GRA model development project, methodology employed, and the results and path forward for the model implementation at Bruce Power. The required work was split into three phases. Phase 1 involved development of GRA models for the twelve systems most important to electricity production. Ten systems were added to the model during each of the next two phases. The GRA model development process consists of developing system Failure Modes and Effects Analyses (FMEA) to identify the components critical to the plant reliability and determine their impact on electricity production. The FMEAs were then used to develop the logic for system fault tree (FT) GRA models. The models were solved and post-processed to provide model outputs to the plant staff in a user-friendly format. The outputs consisted of the ranking of components based on their production impact expressed in terms of lost megawatt hours (LMWH). Another key model output was the estimation of the predicted Forced Loss Rate (FLR). (author)
Maturity Models Development in IS Research
DEFF Research Database (Denmark)
Lasrado, Lester Allan; Vatrapu, Ravi; Andersen, Kim Normann
2015-01-01
Maturity models are widespread in IS research and in particular, IT practitioner communities. However, theoretically sound, methodologically rigorous and empirically validated maturity models are quite rare. This literature review paper focuses on the challenges faced during the development...... literature reveals that researchers have primarily focused on developing new maturity models pertaining to domain-specific problems and/or new enterprise technologies. We find rampant re-use of the design structure of widely adopted models such as Nolan’s Stage of Growth Model, Crosby’s Grid, and Capability...... Maturity Model (CMM). Only recently have there been some research efforts to standardize maturity model development. We also identify three dominant views of maturity models and provide guidelines for various approaches of constructing maturity models with a standard vocabulary. We finally propose using...
Beuchelt, Tina
2017-01-01
European public procurement is becoming more sustainable. However, for goods with global supply chains, sustainable procurement faces several challenges. This paper highlights the sustainability challenges for biomass-based products, discusses the suitability of biomass-focused voluntary sustainability standards (VSS) to address them, and identifies experiences and knowledge gaps in the use of VSS in European public procurement. The paper is based on a comprehensive literature review and a ca...
A Software Reference Architecture for Service-Oriented 3D Geovisualization Systems
Hildebrandt, Dieter
2014-01-01
Modern 3D geovisualization systems (3DGeoVSs) are complex and evolving systems that are required to be adaptable and leverage distributed resources, including massive geodata. This article focuses on 3DGeoVSs built based on the principles of service-oriented architectures, standards and image-based representations (SSI) to address practically relevant challenges and potentials. Such systems facilitate resource sharing and agile and efficient system construction and change in an interoperable ...
Dynamics models and modeling of tree stand development
Directory of Open Access Journals (Sweden)
M. V. Rogozin
2015-04-01
Full Text Available Brief analysis of scientific works in Russia and in the CIS over the past 100 years. Logical and mathematical models consider the conceptual and show some of the results of their verification. It was found that the models include different laws and the parameters, the sum of which allows you to divide them into four categories: models of static states, development models, models of care for the natural forest and models of cultivation. Each category has fulfilled and fulfills its tasks in economic management. Thus, the model states in statics (table traverse growth played a prominent role in figuring out what may be the most productive (full stands in different regions of the country. However, they do not answer the question of what the initial states lead to the production of complete stands. In a study of the growth of stands used system analysis, and it is observed dominance of works studying static state, snatched from the biological time. Therefore, the real drama of the growth of stands remained almost unexplored. It is no accident there were «chrono-forestry» «plantation forestry» and even «non-traditional forestry», where there is a strong case of a number of new concepts of development stands. That is quite in keeping with Kuhn (Kuhn, 2009 in the forestry crisis began – there were alternative theories and coexist conflicting scientific schools. To develop models of stand development, it is proposed to use a well-known method of repeated observations within 10–20 years, in conjunction with the explanation of the history of the initial density. It mounted on the basis of studying the dynamics of its indicators: the trunk, crown overlap coefficient, the sum of volumes of all crowns and the relative length of the crown. According to these indicators, the researcher selects natural series of development stands with the same initial density. As a theoretical basis for the models it is possible to postulate the general properties of
Object Oriented Modeling : A method for combining model and software development
Van Lelyveld, W.
2010-01-01
When requirements for a new model cannot be met by available modeling software, new software can be developed for a specific model. Methods for the development of both model and software exist, but a method for combined development has not been found. A compatible way of thinking is required to
International Nuclear Information System (INIS)
Mirkhani, Sh.; Saboohi, Y.
2012-01-01
Highlights: ► An existing bottom-up deterministic energy system model (ESM) has limited capability in handling the uncertainties. ► Uncertainty has been modeled based on GBM. Probabilistic scenarios are generated based on Cox–Ross method. ► A multistage stochastic model has been developed where scenarios are integrated in the energy system model. ► A distributed generation system has been introduced as a case study where fuel price is considered as an uncertain parameter. - Abstract: A deterministic energy supply model with bottom-up structure has limited capability in handling the uncertainties. To enhance the applicability of such a model in an uncertain environment two main issues have been investigated in the present paper. First, a binomial lattice is generated based on the stochastic nature of the source of uncertainty. Second, an energy system model (ESM) has been reformulated as a multistage stochastic problem. The result of the application of the modified energy model encompasses all uncertain outcomes together and enables optimal timing of capacity expansion. The performance of the model has been demonstrated with the help of a case study. The case study has been formulated on the assumption that a gas fired engine competes with renewable energy technologies in an uncertain environment where the price of natural gas is volatile. The result of stochastic model has then been compared with those of a deterministic model by studying the expected value of perfect information (EVPI) and the value of stochastic solution (VSS). Finally the results of the sensitivity analysis have been discussed where the characteristics of uncertainty of the price of fuel are varied.
Gholikandi, Gagik Badalians; Kazemirad, Khashayar
2018-03-01
In this study, the performance of the electrochemical peroxidation (ECP) process for removing the volatile suspended solids (VSS) content of waste-activated sludge was evaluated. The Fe 2+ ions required by the process were obtained directly from iron electrodes in the system. The performance of the ECP process was investigated in various operational conditions employing a laboratory-scale pilot setup and optimized by response surface methodology (RSM). According to the results, the ECP process showed its best performance when the pH value, current density, H 2 O 2 concentration and the retention time were 3, 3.2 mA/cm 2 , 1,535 mg/L and 240 min, respectively. In these conditions, the introduced Fe 2+ concentration was approximately 500 (mg/L) and the VSS removal efficiency about 74%. Moreover, the results of the microbial characteristics of the raw and the stabilized sludge demonstrated that the ECP process is able to remove close to 99.9% of the coliforms in the raw sludge during the stabilization process. The energy consumption evaluation showed that the required energy of the ECP reactor (about 1.8-2.5 kWh (kg VSS removed) -1 ) is considerably lower than for aerobic digestion, the conventional waste-activated sludge stabilization method (about 2-3 kWh (kg VSS removed) -1 ). The RSM optimization process showed that the best operational conditions of the ECP process comply with the experimental results, and the actual and the predicted results are in good conformity with each other. This feature makes it possible to predict the introduced Fe 2+ concentrations into the system and the VSS removal efficiency of the process precisely.
Alignment of classification paradigms for communication abilities in children with cerebral palsy.
Hustad, Katherine C; Oakes, Ashley; McFadd, Emily; Allison, Kristen M
2016-06-01
We examined three communication ability classification paradigms for children with cerebral palsy (CP): the Communication Function Classification System (CFCS), the Viking Speech Scale (VSS), and the Speech Language Profile Groups (SLPG). Questions addressed interjudge reliability, whether the VSS and the CFCS captured impairments in speech and language, and whether there were differences in speech intelligibility among levels within each classification paradigm. Eighty children (42 males, 38 females) with a range of types and severity levels of CP participated (mean age 60mo, range 50-72mo [SD 5mo]). Two speech-language pathologists classified each child via parent-child interaction samples and previous experience with the children for the CFCS and VSS, and using quantitative speech and language assessment data for the SLPG. Intelligibility scores were obtained using standard clinical intelligibility measurement. Kappa values were 0.67 (95% confidence interval [CI] 0.55-0.79) for the CFCS, 0.82 (95% CI 0.72-0.92) for the VSS, and 0.95 (95% CI 0.72-0.92) for the SLPG. Descriptively, reliability within levels of each paradigm varied, with the lowest agreement occurring within the CFCS at levels II (42%), III (40%), and IV (61%). Neither the CFCS nor the VSS were sensitive to language impairments captured by the SLPG. Significant differences in speech intelligibility were found among levels for all classification paradigms. Multiple tools are necessary to understand speech, language, and communication profiles in children with CP. Characterization of abilities at all levels of the International Classification of Functioning, Disability and Health will advance our understanding of the ways that speech, language, and communication abilities present in children with CP. © 2015 Mac Keith Press.
Probabilistic Model Development
Adam, James H., Jr.
2010-01-01
Objective: Develop a Probabilistic Model for the Solar Energetic Particle Environment. Develop a tool to provide a reference solar particle radiation environment that: 1) Will not be exceeded at a user-specified confidence level; 2) Will provide reference environments for: a) Peak flux; b) Event-integrated fluence; and c) Mission-integrated fluence. The reference environments will consist of: a) Elemental energy spectra; b) For protons, helium and heavier ions.
Chatterjee, Pritha; Ghangrekar, M M; Rao, Surampalli
2018-02-01
A hybrid upflow anaerobic sludge blanket (UASB)-moving bed biofilm (MBB) and rope bed biofilm (RBB) reactor was designed for treatment of sewage. Possibility of enhancing granulation in an UASB reactor using moving media to improve sludge retention was explored while treating low-strength wastewater. The presence of moving media in the top portion of the UASB reactor allowed a high solid retention time even at very short hydraulic retention times and helped in maintaining selection pressure in the sludge bed to promote formation of different sized sludge granules with an average settling velocity of 67 m/h. These granules were also found to contain plenty of extracellular polymeric substance (EPS) such as 58 mg of polysaccharides (PS) per gram of volatile suspended solids (VSS) and protein (PN) content of 37 mg/g VSS. Enriched sludge of nitrogen-removing bacteria forming a porous biofilm on the media in RBB was also observed in a concentration of around 894 g/m 2 . The nitrogen removing sludge also had a high EPS content of around 22 mg PS/g VSS and 28 mg PN/g VSS. This hybrid UASB-MBB-RBB reactor with enhanced anaerobic granular sludge treating both carbonaceous and nitrogenous matter may be a sustainable solution for decentralized sewage treatment.
An improved VSS NLMS algorithm for active noise cancellation
Sun, Yunzhuo; Wang, Mingjiang; Han, Yufei; Zhang, Congyan
2017-08-01
In this paper, an improved variable step size NLMS algorithm is proposed. NLMS has fast convergence rate and low steady state error compared to other traditional adaptive filtering algorithm. But there is a contradiction between the convergence speed and steady state error that affect the performance of the NLMS algorithm. Now, we propose a new variable step size NLMS algorithm. It dynamically changes the step size according to current error and iteration times. The proposed algorithm has simple formulation and easily setting parameters, and effectively solves the contradiction in NLMS. The simulation results show that the proposed algorithm has a good tracking ability, fast convergence rate and low steady state error simultaneously.
International Nuclear Information System (INIS)
Dasgupta-Schubert, N.; Reyes, M. A.; Tamez, V. A.
2009-01-01
Alpha decay is one of the two main decay modes of the heaviest nuclei, (SHE), and constitutes one of the dominant decay modes of highly neutron deficient medium mass nuclei ('exotics'). Thus identifying and characterizing the alpha decay chains form a crucial part of the identification of SHE. We report the extension of the previously developed method for the detailed and systematic investigation of the reliability of the three main extant analytical formulae of alpha decay half-lives: the generalized liquid drop model based formula of Royer et al. (FR), the Sobiczewski modified semi-empirical Viola-Seaborg formula (VSS) and the recent phenomenological formula of Sobiczewski and Parkhomenko (SP).
Energy and Development. A Modelling Approach
International Nuclear Information System (INIS)
Van Ruijven, B.J.
2008-01-01
Rapid economic growth of developing countries like India and China implies that these countries become important actors in the global energy system. Examples of this impact are the present day oil shortages and rapidly increasing emissions of greenhouse gases. Global energy models are used to explore possible future developments of the global energy system and identify policies to prevent potential problems. Such estimations of future energy use in developing countries are very uncertain. Crucial factors in the future energy use of these regions are electrification, urbanisation and income distribution, issues that are generally not included in present day global energy models. Model simulations in this thesis show that current insight in developments in low-income regions lead to a wide range of expected energy use in 2030 of the residential and transport sectors. This is mainly caused by many different model calibration options that result from the limited data availability for model development and calibration. We developed a method to identify the impact of model calibration uncertainty on future projections. We developed a new model for residential energy use in India, in collaboration with the Indian Institute of Science. Experiments with this model show that the impact of electrification and income distribution is less univocal than often assumed. The use of fuelwood, with related health risks, can decrease rapidly if the income of poor groups increases. However, there is a trade off in terms of CO2 emissions because these groups gain access to electricity and the ownership of appliances increases. Another issue is the potential role of new technologies in developing countries: will they use the opportunities of leapfrogging? We explored the potential role of hydrogen, an energy carrier that might play a central role in a sustainable energy system. We found that hydrogen only plays a role before 2050 under very optimistic assumptions. Regional energy
Efficiency of economic development models
Directory of Open Access Journals (Sweden)
Oana Camelia Iacob
2013-03-01
Full Text Available The world economy is becoming increasingly integrated. Integrating emerging economies of Asia, such as China and India increase competition on the world stage, putting pressure on the "actors" already existing. These developments have raised questions about the effectiveness of European development model, which focuses on a high level of equity, insurance and social protection. According to analysts, the world today faces three models of economic development with significant weight in the world: the European, American and Asian. This study will focus on analyzing European development model, and a brief comparison with the United States. In addition, this study aims to highlight the relationship between efficiency and social equity that occurs in each submodel in part of the European model, given that social and economic performance in the EU are not homogeneous. To achieve this, it is necessary to analyze different indicators related to social equity and efficiency respectively, to observe the performance of each submodel individually. The article analyzes data to determine submodel performance according to social equity and economic efficiency.
Modeling Energy and Development : An Evaluation of Models and Concepts
Ruijven, Bas van; Urban, Frauke; Benders, René M.J.; Moll, Henri C.; Sluijs, Jeroen P. van der; Vries, Bert de; Vuuren, Detlef P. van
2008-01-01
Most global energy models are developed by institutes from developed countries focusing primarily oil issues that are important in industrialized countries. Evaluation of the results for Asia of the IPCC/SRES models shows that broad concepts of energy and development. the energy ladder and the
Rectenna thermal model development
Kadiramangalam, Murall; Alden, Adrian; Speyer, Daniel
1992-01-01
Deploying rectennas in space requires adapting existing designs developed for terrestrial applications to the space environment. One of the major issues in doing so is to understand the thermal performance of existing designs in the space environment. Toward that end, a 3D rectenna thermal model has been developed, which involves analyzing shorted rectenna elements and finite size rectenna element arrays. A shorted rectenna element is a single element whose ends are connected together by a material of negligible thermal resistance. A shorted element is a good approximation to a central element of a large array. This model has been applied to Brown's 2.45 GHz rectenna design. Results indicate that Brown's rectenna requires redesign or some means of enhancing the heat dissipation in order for the diode temperature to be maintained below 200 C above an output power density of 620 W/sq.m. The model developed in this paper is very general and can be used for the analysis and design of any type of rectenna design of any frequency.
China Changes the Development Model
Directory of Open Access Journals (Sweden)
Grażyna Rzeszotarska
2015-04-01
Full Text Available The last decades of the twentieth century fundamentally changed the situation in the global economy. China's spectacular economic success has increased an interest in this country. The short time in which China moved on from the a poor agricultural country into a global economic power is admirable. China's model combines conflicted elements of different economic systems: the bureaucratic planning, island-capitalism, simple goods production and natural economy. The current development and transformation of the economy have brought about spectacular achievements and successes. However, the "the world's manufacturer" produces goods designed in other countries. In contrast, the modern idea is to build a modern and independent Chinese industry. The possibilities of the current model of economic development based on simple reserves and large statedriven infrastructure projects, which no longer drive the economy to the extent they previously did, dried out. Thus, the "Middle Kingdom" will have to compete against the rest of the world on quality and innovation. Therefore the development of the new model is a prerequisite to ensure progress in the future. Discussion on further development has been expedited in 2011, when it became abundantly clear that the Chinese economy would share the experience of the effects of the global crisis. The Chinese look at the challenges that the economy is facing realistically in thinking about the modern technology which begins to dominate the country. China is determined to become the leading technological superpower of the world. Today, many developing countries are looking towards China watching the development model implemented there with the hope of its adaptation in their economies. However, China is a unique entity. Therefore, it may be that adaptation of the Chinese model of development in other countries is not possible.
Paul, Kristina Ayers; Seward, Kristen K.
2016-01-01
The place-based investment model (PBIM) of talent development is a programming model for developing talents of high-potential youth in ways that could serve as an investment in the community. In this article, we discuss the PBIM within rural contexts. The model is grounded in three theories--Moon's personal talent development theory, Sternberg's…
Hasegawa, Toshinori; Kida, Yoshihisa; Kato, Takenori; Iizuka, Hiroshi; Kuramitsu, Shunichiro; Yamamoto, Takashi
2013-03-01
Object Little is known about long-term outcomes, including tumor control and adverse radiation effects, in patients harboring vestibular schwannomas (VSs) treated with stereotactic radiosurgery > 10 years previously. The aim of this study was to confirm whether Gamma Knife surgery (GKS) for VSs continues to be safe and effective > 10 years after treatment. Methods A total of 440 patients with VS (including neurofibromatosis Type 2) treated with GKS between May 1991 and December 2000 were evaluable. Of these, 347 patients (79%) underwent GKS as an initial treatment and 93 (21%) had undergone prior resection. Three hundred fifty-eight patients (81%) had a solid tumor and 82 (19%) had a cystic tumor. The median tumor volume was 2.8 cm(3) and the median marginal dose was 12.8 Gy. Results The median follow-up period was 12.5 years. The actuarial 5- and ≥ 10-year progression-free survival was 93% and 92%, respectively. No patient developed treatment failure > 10 years after treatment. According to multivariate analysis, significant factors related to worse progression-free survival included brainstem compression with a deviation of the fourth ventricle (p 13 Gy) and 100% in the low marginal dose group (≤ 13 Gy). Ten patients (2.3%) developed delayed cyst formation. One patient alone developed malignant transformation, indicating an incidence of 0.3%. Conclusions In this study GKS was a safe and effective treatment for the majority of patients followed > 10 years after treatment. Special attention should be paid to cyst formation and malignant transformation as late adverse radiation effects, although they appeared to be rare. However, it is necessary to collect further long-term follow-up data before making conclusions about the long-term safety and efficacy of GKS, especially for young patients with VSs.
Kinetics of the biodegradation of green table olive wastewaters by aerobic and anaerobic treatments
International Nuclear Information System (INIS)
Beltran, J.; Gonzalez, T.; Garcia, J.
2008-01-01
The biodegradation of the organic pollutant matter present in green table olive wastewater (GTOW) is studied in batch reactors by an aerobic biodegradation and by an anaerobic digestion. In the aerobic biodegradation, the evolution of the substrate (in terms of chemical and biochemical oxygen demand), biomass, and total polyphenolic compounds present in the wastewater are followed during the process, and a kinetic study is performed using Contois' model, which when applied to the experimental results provides the kinetic parameter of this model, resulting in a modified Contois' equation (q = 3.3S/(0.31S 0 X + X), gCOD/gVSS d -1 ). Other kinetic parameters were determined: the cellular yield coefficient (Y X/S = 5.7 x 10 -2 gVSS/gCOD) and the kinetic constant of cellular death phase (k d = 0.16 d -1 ). Similarly, in the anaerobic digestion, the evolution of the substrate digested and the methane produced are followed, and the kinetic study is conducted using a modified Monod model combined with the Levenspiel model, due to the presence of inhibition effects. This model leads to the determination of the kinetic parameters: kinetic constant when no inhibitory substance is present (k M0 = 8.4 x 10 -2 h -1 ), critical substrate concentration of inhibition (TP* = 0.34 g/L) and inhibitory parameter (n = 2.25)
Directory of Open Access Journals (Sweden)
Oskar Modin
Full Text Available New activated sludge processes that utilize sorption as a major mechanism for organics removal are being developed to maximize energy recovery from wastewater organics, or as enhanced primary treatment technologies. To model and optimize sorption-based activated sludge processes, further knowledge about sorption of organics onto sludge is needed. This study compared primary-, anaerobic-, and aerobic activated sludge as sorbents, determined sorption capacity and kinetics, and investigated some characteristics of the organics being sorbed. Batch sorption assays were carried out without aeration at a mixing velocity of 200 rpm. Only aerobic activated sludge showed net sorption of organics. Sorption of dissolved organics occurred by a near-instantaneous sorption event followed by a slower process that obeyed 1st order kinetics. Sorption of particulates also followed 1st order kinetics but there was no instantaneous sorption event; instead there was a release of particles upon mixing. The 5-min sorption capacity of activated sludge was 6.5±10.8 mg total organic carbon (TOC per g volatile suspend solids (VSS for particulate organics and 5.0±4.7 mgTOC/gVSS for dissolved organics. The observed instantaneous sorption appeared to be mainly due to organics larger than 20 kDa in size being sorbed, although molecules with a size of about 200 Da with strong UV absorbance at 215-230 nm were also rapidly removed.
Working memory in early Alzheimer's disease: a neuropsychological review.
Huntley, J D; Howard, R J
2010-02-01
Reports of the extent of working memory (WM) impairment in early Alzheimer's disease (AD) have been inconsistent. Using the model of WM proposed by Baddeley, neuropsychological evidence for the impairment of WM in early AD is evaluated. Literature searches were performed using Medline, PsycINFO and Embase databases. Individual papers were then examined for additional references not revealed by computerised searches. Phonological loop function is intact at the preclinical and early stages of AD, becoming more impaired as the disease progresses. In mild AD, there is impairment on tasks assessing visuospatial sketchpad (VSS) function; however, these tasks also require executive processing by the central executive system (CES). There is evidence that the CES is impaired in mild AD and may be affected in the earlier preclinical stage of the disease. Episodic buffer function may be impaired but further research is required. Future research into central executive functioning at the earliest stages of the disease, combined with further longitudinal studies, needs to be carried out. Tasks to assess the proposed functions of the episodic buffer and specific tests of the VSS suitable for AD subjects need to be developed and validated. Learning more about these processes and how they are affected in AD is important in understanding and managing the cognitive deficits seen in the early stages of AD.
Zhu, Zhongyunshen; Song, Yuxin; Zhang, Zhenpu; Sun, Hao; Han, Yi; Li, Yaoyao; Zhang, Liyao; Xue, Zhongying; Di, Zengfeng; Wang, Shumin
2017-09-01
We demonstrate Au-assisted vapor-solid-solid (VSS) growth of Ge nanowires (NWs) by molecular beam epitaxy at the substrate temperature of ˜180 °C, which is compatible with the temperature window for Si-based integrated circuit. Low temperature grown Ge NWs hold a smaller size, similar uniformity, and better fit with Au tips in diameter, in contrast to Ge NWs grown at around or above the eutectic temperature of Au-Ge alloy in the vapor-liquid-solid (VLS) growth. Six ⟨110⟩ growth orientations were observed on Ge (110) by the VSS growth at ˜180 °C, differing from only one vertical growth direction of Ge NWs by the VLS growth at a high temperature. The evolution of NWs dimension and morphology from the VLS growth to the VSS growth is qualitatively explained by analyzing the mechanism of the two growth modes.
Modelling of cardiovascular system: development of a hybrid (numerical-physical) model.
Ferrari, G; Kozarski, M; De Lazzari, C; Górczyńska, K; Mimmo, R; Guaragno, M; Tosti, G; Darowski, M
2003-12-01
Physical models of the circulation are used for research, training and for testing of implantable active and passive circulatory prosthetic and assistance devices. However, in comparison with numerical models, they are rigid and expensive. To overcome these limitations, we have developed a model of the circulation based on the merging of a lumped parameter physical model into a numerical one (producing therefore a hybrid). The physical model is limited to the barest essentials and, in this application, developed to test the principle, it is a windkessel representing the systemic arterial tree. The lumped parameters numerical model was developed in LabVIEW environment and represents pulmonary and systemic circulation (except the systemic arterial tree). Based on the equivalence between hydraulic and electrical circuits, this prototype was developed connecting the numerical model to an electrical circuit--the physical model. This specific solution is valid mainly educationally but permits the development of software and the verification of preliminary results without using cumbersome hydraulic circuits. The interfaces between numerical and electrical circuits are set up by a voltage controlled current generator and a voltage controlled voltage generator. The behavior of the model is analyzed based on the ventricular pressure-volume loops and on the time course of arterial and ventricular pressures and flow in different circulatory conditions. The model can represent hemodynamic relationships in different ventricular and circulatory conditions.
Brookhaven Regional Energy Facility Siting Model (REFS): model development and application
Energy Technology Data Exchange (ETDEWEB)
Meier, P.; Hobbs, B.; Ketcham, G.; McCoy, M.; Stern, R.
1979-06-01
A siting methodology developed specifically to bridge the gap between regional-energy-system scenarios and environmental transport models is documented. Development of the model is described in Chapter 1. Chapter 2 described the basic structure of such a model. Additional chapters on model development cover: generation, transmission, demand disaggregation, the interface to other models, computational aspects, the coal sector, water resource considerations, and air quality considerations. These subjects comprise Part I. Part II, Model Applications, covers: analysis of water resource constraints, water resource issues in the New York Power Pool, water resource issues in the New England Power Pool, water resource issues in the Pennsylvania-Jersey-Maryland Power Pool, and a summary of water resource constraint analysis. (MCW)
A Generic Modeling Process to Support Functional Fault Model Development
Maul, William A.; Hemminger, Joseph A.; Oostdyk, Rebecca; Bis, Rachael A.
2016-01-01
Functional fault models (FFMs) are qualitative representations of a system's failure space that are used to provide a diagnostic of the modeled system. An FFM simulates the failure effect propagation paths within a system between failure modes and observation points. These models contain a significant amount of information about the system including the design, operation and off nominal behavior. The development and verification of the models can be costly in both time and resources. In addition, models depicting similar components can be distinct, both in appearance and function, when created individually, because there are numerous ways of representing the failure space within each component. Generic application of FFMs has the advantages of software code reuse: reduction of time and resources in both development and verification, and a standard set of component models from which future system models can be generated with common appearance and diagnostic performance. This paper outlines the motivation to develop a generic modeling process for FFMs at the component level and the effort to implement that process through modeling conventions and a software tool. The implementation of this generic modeling process within a fault isolation demonstration for NASA's Advanced Ground System Maintenance (AGSM) Integrated Health Management (IHM) project is presented and the impact discussed.
Energy Technology Data Exchange (ETDEWEB)
Keller, Eric J.; Collins, Jeremy D. [Northwestern University Feinberg School of Medicine, Department of Radiology (United States); Crowley-Matoka, Megan [Northwestern University Feinberg School of Medicine, Center for Bioethics and Medical Humanities (United States); Chrisman, Howard B. [Northwestern University Feinberg School of Medicine, Department of Radiology (United States); Milad, Magdy P. [Northwestern University Feinberg School of Medicine, Department of Obstetrics and Gynecology-Reproductive Endocrinology and Infertility (United States); Vogelzang, Robert L., E-mail: vogelzang@northwestern.edu [Northwestern University Feinberg School of Medicine, Department of Radiology (United States)
2017-06-15
PurposeTo understand how cultural differences between vascular surgeons (VSs) and interventional radiologists (IRs) affect their clinical decision making and inter-specialty relationships.MethodsTwenty-four conversational interviews were conducted with IRs and VSs about their approaches to patient care, views of their specialty and others, and solutions to any expressed concerns. Interview transcripts were systematically analyzed to identify and compare key themes according to the constructivist grounded theory and content analysis using NVivo 10 software. These data were supplemented with a retrospective analysis of 3658 endovascular stent placements performed at a large medical academic center over 11 years. Aggregate counts were divided by provider specialty, and trends were assessed via correlation coefficients.ResultsEndovascular stent placements were relatively equally divided between IR and VS over 11 years with some variability from placements by cardiology. IRs tend to lay claim to treatments as masters of procedures, whereas VSs base their claims on being masters of the treated diseases, leading to collaboration in some practices and bitter competition in others. The level of perceived competition was most associated with specialists’ awareness of and appreciation for specialty-specific values rather than differences in practice structure/reimbursement.ConclusionsUnderstanding cultural differences between IRs and VSs is imperative for fostering better collaboration to grow shared territory rather than competing for the same slice of the pie.
Energy Technology Data Exchange (ETDEWEB)
Kim, Young-Hoon [Department of Neurosurgery, Seoul National University Bundang Hospital, Seongnam-si (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Kim, Dong Gyu, E-mail: gknife@plaza.snu.ac.kr [Department of Neurosurgery, Seoul National University Hospital, Seoul (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Han, Jung Ho [Department of Neurosurgery, Seoul National University Bundang Hospital, Seongnam-si (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Chung, Hyun-Tai; Kim, In Kyung; Song, Sang Woo [Department of Neurosurgery, Seoul National University Hospital, Seoul (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Park, Jeong-Hoon [Department of Neurosurgery, Seoul National University Bundang Hospital, Seongnam-si (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Kim, Jin Wook; Kim, Yong Hwy; Park, Chul-Kee [Department of Neurosurgery, Seoul National University Hospital, Seoul (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Kim, Chae-Yong [Department of Neurosurgery, Seoul National University Bundang Hospital, Seongnam-si (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of); Paek, Sun Ha; Jung, Hee-Won [Department of Neurosurgery, Seoul National University Hospital, Seoul (Korea, Republic of); Department of Neurosurgery, Seoul National University College of Medicine, Seoul (Korea, Republic of)
2013-01-01
Purpose: We evaluated the prognostic factors for hearing outcomes after stereotactic radiosurgery (SRS) for unilateral sporadic intracanalicular vestibular schwannomas (IC-VSs) as a clinical homogeneous group of VSs. Methods and Materials: Sixty consecutive patients with unilateral sporadic IC-VSs, defined as tumors in the internal acoustic canal, and serviceable hearing (Gardner-Roberson grade 1 or 2) were treated with SRS as an initial treatment. The mean tumor volume was 0.34 {+-} 0.03 cm{sup 3} (range, 0.03-1.00 cm{sup 3}), and the mean marginal dose was 12.2 {+-} 0.1 Gy (range, 11.5-13.0 Gy). The median follow-up duration was 62 months (range, 36-141 months). Results: The actuarial rates of serviceable hearing preservation were 70%, 63%, and 55% at 1, 2, and 5 years after SRS, respectively. In multivariate analysis, transient volume expansion of {>=}20% from initial tumor size was a statistically significant risk factor for loss of serviceable hearing and hearing deterioration (increase of pure tone average {>=}20 dB) (odds ratio = 7.638; 95% confidence interval, 2.317-25.181; P=.001 and odds ratio = 3.507; 95% confidence interval, 1.228-10.018; P=.019, respectively). The cochlear radiation dose did not reach statistical significance. Conclusions: Transient volume expansion after SRS for VSs seems to be correlated with hearing deterioration when defined properly in a clinically homogeneous group of patients.
Two separate thoroscopic segmentectomies with vessel sealing system.
Watanabe, Atsushi; Miyajima, Masahiro; Kawaharada, Nobuyoshi; Higami, Tetsuya
2012-04-01
Total thoracoscopic segmentectomy is an appealing concept in terms of providing a parenchyma-sparing treatment. We describe our technique of two seperate total thoracoscopic segmentectomies by using a vessel sealing system (VSS). A 76-year old female with four gradually enlarging ground glass lesions on the right segment 2 (10 and 3 mm) and segment 6 (8 and 3 mm) was admitted to our institute for surgical diagnosis and treatment. Preoperative three-dimensional computed tomography showed that the A2 is composed of descending A2 and ascending A2, branch of V6 coursed to V2 and B1a originated from B2 and B1b from B3. Two separate segmentectomies were subsequently scheduled. Pulmonary vessel division was performed with VSS after proximal ligation. Intersegmental division by VSS and electrocautery was performed with the use of inflation-deflation demarcation line and the pulmonary veins along the intersegmental plane (V2a and V2c for segment 2 and V6b and V6c for segment 6) as guides to confirm the intersegmental plane after pulmonary artery and bronchial divisions. The intraoperative frozen-section examinations revealed adenocarcinoma in situ. Two separate segmentectomies were successfully completed, with a total operative time of 240 min and blood loss of 30 ml. VSS is a very useful and safe device for intersegmental division and pulmonary vessel division.
International Nuclear Information System (INIS)
Keller, Eric J.; Collins, Jeremy D.; Crowley-Matoka, Megan; Chrisman, Howard B.; Milad, Magdy P.; Vogelzang, Robert L.
2017-01-01
PurposeTo understand how cultural differences between vascular surgeons (VSs) and interventional radiologists (IRs) affect their clinical decision making and inter-specialty relationships.MethodsTwenty-four conversational interviews were conducted with IRs and VSs about their approaches to patient care, views of their specialty and others, and solutions to any expressed concerns. Interview transcripts were systematically analyzed to identify and compare key themes according to the constructivist grounded theory and content analysis using NVivo 10 software. These data were supplemented with a retrospective analysis of 3658 endovascular stent placements performed at a large medical academic center over 11 years. Aggregate counts were divided by provider specialty, and trends were assessed via correlation coefficients.ResultsEndovascular stent placements were relatively equally divided between IR and VS over 11 years with some variability from placements by cardiology. IRs tend to lay claim to treatments as masters of procedures, whereas VSs base their claims on being masters of the treated diseases, leading to collaboration in some practices and bitter competition in others. The level of perceived competition was most associated with specialists’ awareness of and appreciation for specialty-specific values rather than differences in practice structure/reimbursement.ConclusionsUnderstanding cultural differences between IRs and VSs is imperative for fostering better collaboration to grow shared territory rather than competing for the same slice of the pie.
COMPUTATIONAL MODELS FOR SUSTAINABLE DEVELOPMENT
Monendra Grover; Rajesh Kumar; Tapan Kumar Mondal; S. Rajkumar
2011-01-01
Genetic erosion is a serious problem and computational models have been developed to prevent it. The computational modeling in this field not only includes (terrestrial) reserve design, but also decision modeling for related problems such as habitat restoration, marine reserve design, and nonreserve approaches to conservation management. Models have been formulated for evaluating tradeoffs between socioeconomic, biophysical, and spatial criteria in establishing marine reserves. The percolatio...
Felgueiras, Rui; Magalhães, Rui; Correia, Manuel; Silva, Maria Carolina
2014-09-01
Vestibular symptoms (VSs) are frequent complaints in patients attending ambulatory care and the emergency room. They may represent a peripheral vestibular disorder or a stroke/transient ischemic attack (TIA), yet many patients have VSs that cannot be clearly classified at presentation. This study aims to characterize and determine the long-term prognosis of these patients. In a prospective community-based study involving 104,700 individuals registered at 4 health centers of Northern Portugal, patients with a first-ever-in-lifetime focal neurologic symptom (FNS) were ascertained using comprehensive methods, including referrals from physicians working in the study area and data retrieved from emergency/discharge records. Physicians were encouraged to report/notify any patient who might have experienced an FNS, including those with vertigo or vertigo-like symptoms, imbalance, presyncope, or nonspecific dizziness. After neurologic assessment patients were classified as having a peripheral vestibular symptom (pVS), a stroke/TIA, or an unclassified vestibular symptom (uVS). They were followed up 7 years after the index event at the outpatient clinic; predictors of survival free from stroke or vascular events were determined using Cox proportional hazards models. Of the 1163 patients with an FNS, 360 (31.0%) were included, 16.7% had a stroke/TIA, 57.8% had pVS, and 25.6% had uVS. Most patients presented only isolated VSs (62.8%); 63% were women and mean age was 60.1 years (standard deviation = 16); hypertension (47.8%), hypercholesterolemia (41.9%), and diabetes (19.2%) were the most prevalent vascular risk factors (VRFs). Cranial computed tomography (CT) scan was performed in 63.3%. Adjusting for age, sex, VRFs, and diagnosis (TIA, pVS and uVS), the long-term risk of stroke was higher when CT showed silent infarctions (hazard rate [HR] = 3.96; 95% confidence interval [CI], 1.63-9.60) and the risk of vascular events (stroke, myocardial infarction, or vascular death) was
New droplet model developments
International Nuclear Information System (INIS)
Dorso, C.O.; Myers, W.D.; Swiatecki, W.J.; Moeller, P.; Treiner, J.; Weiss, M.S.
1985-09-01
A brief summary is given of three recent contributions to the development of the Droplet Model. The first concerns the electric dipole moment induced in octupole deformed nuclei by the Coulomb redistribution. The second concerns a study of squeezing in nuclei and the third is a study of the improved predictive power of the model when an empirical ''exponential'' term is included. 25 refs., 3 figs
Development of the physical model
International Nuclear Information System (INIS)
Liu Zunqi; Morsy, Samir
2001-01-01
Full text: The Physical Model was developed during Program 93+2 as a technical tool to aid enhanced information analysis and now is an integrated part of the Department's on-going State evaluation process. This paper will describe the concept of the Physical Model, including its objectives, overall structure and the development of indicators with designated strengths, followed by a brief description of using the Physical Model in implementing the enhanced information analysis. The work plan for expansion and update of the Physical Model is also presented at the end of the paper. The development of the Physical Model is an attempt to identify, describe and characterize every known process for carrying out each step necessary for the acquisition of weapons-usable material, i.e., all plausible acquisition paths for highly enriched uranium (HEU) and separated plutonium (Pu). The overall structure of the Physical Model has a multilevel arrangement. It includes at the top level all the main steps (technologies) that may be involved in the nuclear fuel cycle from the source material production up to the acquisition of weapons-usable material, and then beyond the civilian fuel cycle to the development of nuclear explosive devices (weaponization). Each step is logically interconnected with the preceding and/or succeeding steps by nuclear material flows. It contains at its lower levels every known process that is associated with the fuel cycle activities presented at the top level. For example, uranium enrichment is broken down into three branches at the second level, i.e., enrichment of UF 6 , UCl 4 and U-metal respectively; and then further broken down at the third level into nine processes: gaseous diffusion, gas centrifuge, aerodynamic, electromagnetic, molecular laser (MLIS), atomic vapor laser (AVLIS), chemical exchange, ion exchange and plasma. Narratives are presented at each level, beginning with a general process description then proceeding with detailed
Reference model for apparel product development
Directory of Open Access Journals (Sweden)
Isabel Cristina Moretti
2017-03-01
Full Text Available The purpose of this paper was to develop a reference model for the implementation of the process of product development (PDP for apparel. The tool was developed through an interactive process of comparison between theoretical. Managers in companies and professionals working in this market can utilize the reference model as a source for the organization and improvement of the PDP for apparel and the universities as a reference source for systematized teaching of this process. This model represents the first comprehensive attempt to develop an instrument at a detailed level (macro phases, phases, activities, inputs and outputs at each stage and at the gates to systematize the PDP process for fashion products and to consider its particularities.
A Testbed for Model Development
Berry, J. A.; Van der Tol, C.; Kornfeld, A.
2014-12-01
Carbon cycle and land-surface models used in global simulations need to be computationally efficient and have a high standard of software engineering. These models also make a number of scaling assumptions to simplify the representation of complex biochemical and structural properties of ecosystems. This makes it difficult to use these models to test new ideas for parameterizations or to evaluate scaling assumptions. The stripped down nature of these models also makes it difficult to "connect" with current disciplinary research which tends to be focused on much more nuanced topics than can be included in the models. In our opinion/experience this indicates the need for another type of model that can more faithfully represent the complexity ecosystems and which has the flexibility to change or interchange parameterizations and to run optimization codes for calibration. We have used the SCOPE (Soil Canopy Observation, Photochemistry and Energy fluxes) model in this way to develop, calibrate, and test parameterizations for solar induced chlorophyll fluorescence, OCS exchange and stomatal parameterizations at the canopy scale. Examples of the data sets and procedures used to develop and test new parameterizations are presented.
METHODOLOGICAL APPROACHES FOR MODELING THE RURAL SETTLEMENT DEVELOPMENT
Directory of Open Access Journals (Sweden)
Gorbenkova Elena Vladimirovna
2017-10-01
Full Text Available Subject: the paper describes the research results on validation of a rural settlement developmental model. The basic methods and approaches for solving the problem of assessment of the urban and rural settlement development efficiency are considered. Research objectives: determination of methodological approaches to modeling and creating a model for the development of rural settlements. Materials and methods: domestic and foreign experience in modeling the territorial development of urban and rural settlements and settlement structures was generalized. The motivation for using the Pentagon-model for solving similar problems was demonstrated. Based on a systematic analysis of existing development models of urban and rural settlements as well as the authors-developed method for assessing the level of agro-towns development, the systems/factors that are necessary for a rural settlement sustainable development are identified. Results: we created the rural development model which consists of five major systems that include critical factors essential for achieving a sustainable development of a settlement system: ecological system, economic system, administrative system, anthropogenic (physical system and social system (supra-structure. The methodological approaches for creating an evaluation model of rural settlements development were revealed; the basic motivating factors that provide interrelations of systems were determined; the critical factors for each subsystem were identified and substantiated. Such an approach was justified by the composition of tasks for territorial planning of the local and state administration levels. The feasibility of applying the basic Pentagon-model, which was successfully used for solving the analogous problems of sustainable development, was shown. Conclusions: the resulting model can be used for identifying and substantiating the critical factors for rural sustainable development and also become the basis of
Beginning SQL Server Modeling Model-driven Application Development in SQL Server
Weller, Bart
2010-01-01
Get ready for model-driven application development with SQL Server Modeling! This book covers Microsoft's SQL Server Modeling (formerly known under the code name "Oslo") in detail and contains the information you need to be successful with designing and implementing workflow modeling. Beginning SQL Server Modeling will help you gain a comprehensive understanding of how to apply DSLs and other modeling components in the development of SQL Server implementations. Most importantly, after reading the book and working through the examples, you will have considerable experience using SQL M
Hollow-fiber membrane bioreactor for the treatment of high-strength landfill leachate
Rizkallah, Marwan
2013-07-15
Performance assessment of membrane bioreactor (MBR) technology for the treatability of high-strength landfill leachate is relatively limited or lacking. This study examines the feasibility of treating high-strength landfill leachate using a hollow-fiber MBR. For this purpose, a laboratory-scale MBR was constructed and operated to treat leachate with a chemical oxygen demand (COD) of 9000-11,000 mg/l, a 5-day biochemical oxygen demand (BOD5) of 4000-6,000 mg/l, volatile suspended solids (VSS) of 300-500 mg/l, total nitrogen (TN) of 2000-6000 mg/l, and an ammonia-nitrogen (NH3-N) of 1800-4000 mg/l. VSS was used with the BOD and COD data to simulate the biological activity in the activated sludge. Removal efficiencies > 95-99% for BOD5, VSS, TN and NH3-N were attained. The coupled experimental and simulation results contribute in filling a gap in managing high-strength landfill leachate and providing guidelines for corresponding MBR application. © The Author(s) 2013.
Eliciting the Intension of Drug Value Sets – Principles and Quality Assurance Applications
Bahr, Nathan J.; Nelson, Scott D.; Winnenburg, Rainer; Bodenreider, Olivier
2018-01-01
Value sets (VSs) used in electronic clinical quality measures are lists of codes from standard terminologies (“extensional” VSs), whose purpose (“intension”) is not always explicitly stated. We elicited the intension for the 09/01/2014 release of extensional medication value sets by comparison to drug classes from the October 2014 release of RxClass. Value sets matched drug classes if they shared common ingredients, as evidenced by Jaccard similarity score. We elicited the intension of 80 extensional value sets. The average Jaccard similarity was 0.65 for single classes and 0.80 for combination classes, with 34% (27/80) of the value sets having high similarity scores. Manual review by a pharmacist indicated 51% (41/80) of the drug classes selected as the best mapping for a value set matched the intension reflected in that value set name. This approach has the potential for facilitating the development and maintenance of medication value sets. PMID:29295218
Directory of Open Access Journals (Sweden)
Shahram Yazdani
2016-12-01
Full Text Available Background and Purpose: ConsideringBackground and Purpose: Considering the importance and necessity of competency-based education at a global level and with respect to globalization and the requirement of minimum competencies in medical fields, medical education communities and organizations worldwide have tried to determine the competencies, present frameworks and education models to respond to be sure of the ability of all graduates. In the literature, we observed numerous competency development models that refer to the same issues with different terminologies. It seems that evaluation and synthesis of all these models can finally result in designing a comprehensive meta-model for competency development.Methods: Meta-ethnography is a useful method for synthesis of qualitative research that is used to develop models that interpret the results in several studies. Considering that the aim of this study is to ultimately provide a competency development meta-model, in the previous section of the study, the literature review was conducted to achieve competency development models. Models obtained through the search were studied in details, and the key concepts of the models and overarching concepts were extracted in this section, models’ concepts were reciprocally translated and the available competency development models were synthesized.Results: A presentation of the competency development meta-model and providing a redefinition of the Dreyfus brothers model.Conclusions: Given the importance of competency-based education at a global level and the need to review curricula and competency-based curriculum design, it is required to provide competency development as well as meta-model to be the basis for curriculum development. As there are a variety of competency development models available, in this study, it was tried to develop the curriculum using them.Keywords: Meta-ethnography, Competency development, Meta-model, Qualitative synthesis
MODELS OF TOURIST DEVELOPMENT IN THE CONTEXT OF REGIONAL DEVELOPMENT
Directory of Open Access Journals (Sweden)
Borma Afrodita
2012-07-01
Full Text Available Third year PhD candidate at the University of Oradea, under the guidance of Professor Mrs. Alina Bădulescu in the doctoral research project entitled: "Doctoral studies and Ph.D. candidates for competitive research on a knowledge based society", a co-financed project by the European Social Fund through the Sectoral Operational Program for Human Resources Development 2007 - 2013, Priority Axis 1. "Education and training in support for growth and development of a knowledge based society" I chose to present this subject in order to demonstrate the connection that exists between tourism and regional development. Having as research topic "Tourism and development in the Euro regional context†I felt it would be appropriate to devote a subchapter in presenting the impact of tourism in regional development. Thus I have analysed a number of specialised papers found at national and international level in order to achieve a synthesis on the approached topic. Authors such as Williams and Shaw (1991, Sharma (2004, Keskin and Cansiz (2010 were concerned with presenting the positive aspects of tourism in regional development. Condes (2004 presents on one hand the secrets regarding success in matter of tourist development, and on the other side he presents the possible risks that follow the development of tourism in a country / region (Condes 2004. Following the gathered information we found that indeed tourism plays an important role in regional development. The used research methodology consisted in using specialised literature in order to identify some models that illustrate the potential success of tourism in regional development. The space-temporal development model of tourism proposed by Opperman (1993, although it was developed at national level represents a useful tool in illustrating the potential success of tourism in regional development. Miossec's model (Sharma 2004:300 describes the structural evolution of touristic regions in
Continuous Competence Development Model for Teacher Teams
DEFF Research Database (Denmark)
Weitze, Charlotte Lærke
2014-01-01
"This paper presents the development of the IT‐Pedagogical Think Tank for Teacher Teams (ITP4T), a continuous competence development model. The model was co‐designed following a design‐based research approach with teachers from VUC Storstrøm’s (VUC) Global Classroom (GC), an innovative hybrid...... to create their own continuous competence development. This article describes how and why the different components of the model were developed in response to the teachers’ challenges. Such challenges included lack of time, competence and support from the educational organisation to innovate learning design...
Model Driven Development of Data Sensitive Systems
DEFF Research Database (Denmark)
Olsen, Petur
2014-01-01
storage systems, where the actual values of the data is not relevant for the behavior of the system. For many systems the values are important. For instance the control flow of the system can be dependent on the input values. We call this type of system data sensitive, as the execution is sensitive...... to the values of variables. This theses strives to improve model-driven development of such data-sensitive systems. This is done by addressing three research questions. In the first we combine state-based modeling and abstract interpretation, in order to ease modeling of data-sensitive systems, while allowing...... efficient model-checking and model-based testing. In the second we develop automatic abstraction learning used together with model learning, in order to allow fully automatic learning of data-sensitive systems to allow learning of larger systems. In the third we develop an approach for modeling and model-based...
A Computational Model of Spatial Development
Hiraki, Kazuo; Sashima, Akio; Phillips, Steven
Psychological experiments on children's development of spatial knowledge suggest experience at self-locomotion with visual tracking as important factors. Yet, the mechanism underlying development is unknown. We propose a robot that learns to mentally track a target object (i.e., maintaining a representation of an object's position when outside the field-of-view) as a model for spatial development. Mental tracking is considered as prediction of an object's position given the previous environmental state and motor commands, and the current environment state resulting from movement. Following Jordan & Rumelhart's (1992) forward modeling architecture the system consists of two components: an inverse model of sensory input to desired motor commands; and a forward model of motor commands to desired sensory input (goals). The robot was tested on the `three cups' paradigm (where children are required to select the cup containing the hidden object under various movement conditions). Consistent with child development, without the capacity for self-locomotion the robot's errors are self-center based. When given the ability of self-locomotion the robot responds allocentrically.
Determination of cognitive development: postnonclassical theoretical model
Directory of Open Access Journals (Sweden)
Irina N. Pogozhina
2015-09-01
Full Text Available The aim of this research is to develop a postnonclassical cognitive processes content determination model in which mental processes are considered as open selfdeveloping, self-organizing systems. Three types of systems (dynamic, statistical, developing were analysed and compared on the basis of the description of the external and internal characteristics of causation, types of causal chains (dependent, independent and their interactions, as well as the nature of the relationship between the elements of the system (hard, probabilistic, mixed. Mechanisms of open non-equilibrium nonlinear systems (dissipative and four dissipative structures emergence conditions are described. Determination models of mental and behaviour formation and development that were developed under various theoretical approaches (associationism, behaviorism, gestaltism, psychology of intelligence by Piaget, Vygotsky culture historical approach, activity approach and others are mapped on each other as the models that describe behaviour of the three system types mentioned above. The development models of the mental sphere are shown to be different by the following criteria: 1 allocated determinants amount; 2 presence or absence of the system own activity that results in selecting the model not only external, but also internal determinants; 3 types of causal chains (dependent-independent-blended; 4 types of relationships between the causal chain that ultimately determines the subsequent system determination type as decisive (a tough dynamic pattern or stochastic (statistical regularity. The continuity of postnonclassical, classical and non-classical models of mental development determination are described. The process of gradual refinement, complexity, «absorption» of the mental determination by the latter models is characterized. The human mental can be deemed as the functioning of the open developing non-equilibrium nonlinear system (dissipative. The mental sphere is
Development of a generalized integral jet model
DEFF Research Database (Denmark)
Duijm, Nijs Jan; Kessler, A.; Markert, Frank
2017-01-01
Integral type models to describe stationary plumes and jets in cross-flows (wind) have been developed since about 1970. These models are widely used for risk analysis, to describe the consequences of many different scenarios. Alternatively, CFD codes are being applied, but computational requireme......Integral type models to describe stationary plumes and jets in cross-flows (wind) have been developed since about 1970. These models are widely used for risk analysis, to describe the consequences of many different scenarios. Alternatively, CFD codes are being applied, but computational...... requirements still limit the number of scenarios that can be dealt with using CFD only. The integral models, however, are not suited to handle transient releases, such as releases from pressurized equipment, where the initially high release rate decreases rapidly with time. Further, on gas ignition, a second...... model is needed to describe the rapid combustion of the flammable part of the plume (flash fire) and a third model has to be applied for the remaining jet fire. The objective of this paper is to describe the first steps of the development of an integral-type model describing the transient development...
Canadian Whole-Farm Model Holos - Development, Stakeholder Involvement, and Model Application
Kroebel, R.; Janzen, H.; Beauchemin, K. A.
2017-12-01
Agriculture and Agri-Food Canada's Holos model, based mostly on emission factors, aims to explore the effect of management on Canadian whole-farm greenhouse gas emissions. The model includes 27 commonly grown annual and perennial crops, summer fallow, grassland, and 8 types of tree plantings, along with beef, dairy, sheep, swine and other livestock or poultry operations. Model outputs encompass net emissions of CO2, CH4, and N2O (in CO2 equivalents), calculated for various farm components. Where possible, algorithms are drawn from peer-reviewed publications. For consistency, Holos is aligned with the Canadian sustainability indicator and national greenhouse gas inventory objectives. Although primarily an exploratory tool for research, the model's design makes it accessible and instructive also to agricultural producers, educators, and policy makers. Model development, therefore, proceeds iteratively, with extensive stakeholder feedback from training sessions or annual workshops. To make the model accessible to diverse users, the team developed a multi-layered interface, with general farming scenarios for general use, but giving access to detailed coefficients and assumptions to researchers. The model relies on extensive climate, soil, and agronomic databases to populate regionally-applicable default values thereby minimizing keyboard entries. In an initial application, the model was used to assess greenhouse gas emissions from the Canadian beef production system; it showed that enteric methane accounted for 63% of total GHG emissions and that 84% of emissions originated from the cow-calf herd. The model further showed that GHG emission intensity per kg beef, nationally, declined by 14% from 1981 to 2011, owing to gains in production efficiency. Holos is now being used to consider further potential advances through improved rations or other management options. We are now aiming to expand into questions of grazing management, and are developing a novel carbon
Testing Software Development Project Productivity Model
Lipkin, Ilya
Software development is an increasingly influential factor in today's business environment, and a major issue affecting software development is how an organization estimates projects. If the organization underestimates cost, schedule, and quality requirements, the end results will not meet customer needs. On the other hand, if the organization overestimates these criteria, resources that could have been used more profitably will be wasted. There is no accurate model or measure available that can guide an organization in a quest for software development, with existing estimation models often underestimating software development efforts as much as 500 to 600 percent. To address this issue, existing models usually are calibrated using local data with a small sample size, with resulting estimates not offering improved cost analysis. This study presents a conceptual model for accurately estimating software development, based on an extensive literature review and theoretical analysis based on Sociotechnical Systems (STS) theory. The conceptual model serves as a solution to bridge organizational and technological factors and is validated using an empirical dataset provided by the DoD. Practical implications of this study allow for practitioners to concentrate on specific constructs of interest that provide the best value for the least amount of time. This study outlines key contributing constructs that are unique for Software Size E-SLOC, Man-hours Spent, and Quality of the Product, those constructs having the largest contribution to project productivity. This study discusses customer characteristics and provides a framework for a simplified project analysis for source selection evaluation and audit task reviews for the customers and suppliers. Theoretical contributions of this study provide an initial theory-based hypothesized project productivity model that can be used as a generic overall model across several application domains such as IT, Command and Control
Energy Technology Data Exchange (ETDEWEB)
Slikker, William; Young, John F.; Corley, Rick A.; Dorman, David C.; Conolly, Rory B.; Knudsen, Thomas; Erstad, Brian L.; Luecke, Richard H.; Faustman, Elaine M.; Timchalk, Chuck; Mattison, Donald R.
2005-07-26
A workshop was conducted on November 18?19, 2004, to address the issue of improving predictive models for drug delivery to developing humans. Although considerable progress has been made for adult humans, large gaps remain for predicting pharmacokinetic/pharmacodynamic (PK/PD) outcome in children because most adult models have not been tested during development. The goals of the meeting included a description of when, during development, infants/children become adultlike in handling drugs. The issue of incorporating the most recent advances into the predictive models was also addressed: both the use of imaging approaches and genomic information were considered. Disease state, as exemplified by obesity, was addressed as a modifier of drug pharmacokinetics and pharmacodynamics during development. Issues addressed in this workshop should be considered in the development of new predictive and mechanistic models of drug kinetics and dynamics in the developing human.
Gsflow-py: An integrated hydrologic model development tool
Gardner, M.; Niswonger, R. G.; Morton, C.; Henson, W.; Huntington, J. L.
2017-12-01
Integrated hydrologic modeling encompasses a vast number of processes and specifications, variable in time and space, and development of model datasets can be arduous. Model input construction techniques have not been formalized or made easily reproducible. Creating the input files for integrated hydrologic models (IHM) requires complex GIS processing of raster and vector datasets from various sources. Developing stream network topology that is consistent with the model resolution digital elevation model is important for robust simulation of surface water and groundwater exchanges. Distribution of meteorologic parameters over the model domain is difficult in complex terrain at the model resolution scale, but is necessary to drive realistic simulations. Historically, development of input data for IHM models has required extensive GIS and computer programming expertise which has restricted the use of IHMs to research groups with available financial, human, and technical resources. Here we present a series of Python scripts that provide a formalized technique for the parameterization and development of integrated hydrologic model inputs for GSFLOW. With some modifications, this process could be applied to any regular grid hydrologic model. This Python toolkit automates many of the necessary and laborious processes of parameterization, including stream network development and cascade routing, land coverages, and meteorological distribution over the model domain.
Choi, Ja Young; Park, Jieun; Choi, Yoon Seong; Goh, Yu Ra; Park, Eun Sook
2018-07-01
The aim of the present study was to investigate communication function using classification systems and its association with other functional profiles, including gross motor function, manual ability, intellectual functioning, and brain magnetic resonance imaging (MRI) characteristics in children with cerebral palsy (CP). This study recruited 117 individuals with CP aged from 4 to 16 years. The Communication Function Classification System (CFCS), Viking Speech Scale (VSS), Speech Language Profile Groups (SLPG), Gross Motor Function Classification System (GMFCS), Manual Ability Classification System (MACS), and intellectual functioning were assessed in the children along with brain MRI categorization. Very strong relationships were noted among the VSS, CFCS, and SLPG, although these three communication systems provide complementary information, especially for children with mid-range communication impairment. These three communication classification systems were strongly related with the MACS, but moderately related with the GMFCS. Multiple logistic regression analysis indicated that manual ability and intellectual functioning were significantly related with VSS and CFCS function, whereas only intellectual functioning was significantly related with SLPG functioning in children with CP. Communication function in children with a periventricular white matter lesion (PVWL) varied widely. In the cases with a PVWL, poor functioning was more common on the SLPG, compared to the VSS and CFCS. Very strong relationships were noted among three communication classification systems that are closely related with intellectual ability. Compared to gross motor function, manual ability seemed more closely related with communication function in these children. © Copyright: Yonsei University College of Medicine 2018.
Sewage sludge solubilization by high-pressure homogenization.
Zhang, Yuxuan; Zhang, Panyue; Guo, Jianbin; Ma, Weifang; Fang, Wei; Ma, Boqiang; Xu, Xiangzhe
2013-01-01
The behavior of sludge solubilization using high-pressure homogenization (HPH) treatment was examined by investigating the sludge solid reduction and organics solubilization. The sludge volatile suspended solids (VSS) decreased from 10.58 to 6.67 g/L for the sludge sample with a total solids content (TS) of 1.49% after HPH treatment at a homogenization pressure of 80 MPa with four homogenization cycles; total suspended solids (TSS) correspondingly decreased from 14.26 to 9.91 g/L. About 86.15% of the TSS reduction was attributed to the VSS reduction. The increase of homogenization pressure from 20 to 80 MPa or homogenization cycle number from 1 to 4 was favorable to the sludge organics solubilization, and the protein and polysaccharide solubilization linearly increased with the soluble chemical oxygen demand (SCOD) solubilization. More proteins were solubilized than polysaccharides. The linear relationship between SCOD solubilization and VSS reduction had no significant change under different homogenization pressures, homogenization cycles and sludge solid contents. The SCOD of 1.65 g/L was solubilized for the VSS reduction of 1.00 g/L for the three experimental sludge samples with a TS of 1.00, 1.49 and 2.48% under all HPH operating conditions. The energy efficiency results showed that the HPH treatment at a homogenization pressure of 30 MPa with a single homogenization cycle for the sludge sample with a TS of 2.48% was the most energy efficient.
Soares, Ana; Kampas, Pantelis; Maillard, Sarah; Wood, Elizabeth; Brigg, Jon; Tillotson, Martin; Parsons, Simon A; Cartmell, Elise
2010-03-15
There is a need to investigate processes that enable sludge re-use while enhancing sewage treatment efficiency. Mechanically disintegrated thickened surplus activated sludge (SAS) and fermented primary sludge were compared for their capacity to produce a carbon source suitable for BNR by completing nutrient removal predictive tests. Mechanically disintegration of SAS using a deflaker enhanced volatile fatty acids (VFAs) content from 92 to 374 mg l(-1) (4.1-fold increase). In comparison, primary sludge fermentation increased the VFAs content from 3.5 g l(-1) to a final concentration of 8.7 g l(-1) (2.5-fold increase). The carbon source obtained from disintegration and fermentation treatments improved phosphate (PO(4)-P) release and denitrification by up to 0.04 mg NO(3)-Ng(-1)VSS min(-1) and 0.031 mg PO(4)-Pg(-1)VSS min(-1), respectively, in comparison to acetate (0.023 mg NO(3)-Ng(-1)VSS min(-1)and 0.010 mg PO(4)-Pg(-1)VSS min(-1)). Overall, both types of sludge were suitable for BNR but disintegrated SAS displayed lower carbon to nutrient ratios of 8 for SCOD:PO(4)-P and 9 for SCOD:NO(3)-N. On the other hand, SAS increased the concentration of PO(4)-P in the settled sewage by a further 0.97 g PO(4)-P kg(-1)SCOD indicating its potential negative impact towards nutrient recycling in the BNR process. (c) 2009 Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Kanlayanee Meesap
2012-01-01
Full Text Available The anaerobic hybrid reactor consisting of sludge and packed zones was operated with organic pollutant loading rates from 6.2 to 8.2 g COD/L day, composed mainly of suspended solids (SS and oil and grease (O&G concentrations between 5.2 to 10.2 and 0.9 to 1.9 g/L, respectively. The overall process performance in terms of chemical oxygen demands (COD, SS, and O&G removals was 73, 63, and 56%, respectively. When the organic pollutant concentrations were increased, the resultant methane potentials were higher, and the methane yield increased to 0.30 L CH4/g CODremoved. It was observed these effects on the microbial population and activity in the sludge and packed zones. The eubacterial population and activity in the sludge zone increased to 6.4 × 109 copies rDNA/g VSS and 1.65 g COD/g VSS day, respectively, whereas those in the packed zone were lower. The predominant hydrolytic and fermentative bacteria were Pseudomonas, Clostridium, and Bacteroidetes. In addition, the archaeal population and activity in the packed zone were increased from to 9.1 × 107 copies rDNA/g VSS and 0.34 g COD-CH4/g VSS day, respectively, whereas those in the sludge zone were not much changed. The most represented species of methanogens were the acetoclastic Methanosaeta, the hydrogenotrophic Methanobacterium sp., and the hydrogenotrophic Methanomicrobiaceae.
International Nuclear Information System (INIS)
Kim, Young-Hoon; Kim, Dong Gyu; Han, Jung Ho; Chung, Hyun-Tai; Kim, In Kyung; Song, Sang Woo; Park, Jeong-Hoon; Kim, Jin Wook; Kim, Yong Hwy; Park, Chul-Kee; Kim, Chae-Yong; Paek, Sun Ha; Jung, Hee-Won
2013-01-01
Purpose: We evaluated the prognostic factors for hearing outcomes after stereotactic radiosurgery (SRS) for unilateral sporadic intracanalicular vestibular schwannomas (IC-VSs) as a clinical homogeneous group of VSs. Methods and Materials: Sixty consecutive patients with unilateral sporadic IC-VSs, defined as tumors in the internal acoustic canal, and serviceable hearing (Gardner-Roberson grade 1 or 2) were treated with SRS as an initial treatment. The mean tumor volume was 0.34 ± 0.03 cm 3 (range, 0.03-1.00 cm 3 ), and the mean marginal dose was 12.2 ± 0.1 Gy (range, 11.5-13.0 Gy). The median follow-up duration was 62 months (range, 36-141 months). Results: The actuarial rates of serviceable hearing preservation were 70%, 63%, and 55% at 1, 2, and 5 years after SRS, respectively. In multivariate analysis, transient volume expansion of ≥20% from initial tumor size was a statistically significant risk factor for loss of serviceable hearing and hearing deterioration (increase of pure tone average ≥20 dB) (odds ratio = 7.638; 95% confidence interval, 2.317-25.181; P=.001 and odds ratio = 3.507; 95% confidence interval, 1.228-10.018; P=.019, respectively). The cochlear radiation dose did not reach statistical significance. Conclusions: Transient volume expansion after SRS for VSs seems to be correlated with hearing deterioration when defined properly in a clinically homogeneous group of patients.
Using the object modeling system for hydrological model development and application
Directory of Open Access Journals (Sweden)
S. Kralisch
2005-01-01
Full Text Available State of the art challenges in sustainable management of water resources have created demand for integrated, flexible and easy to use hydrological models which are able to simulate the quantitative and qualitative aspects of the hydrological cycle with a sufficient degree of certainty. Existing models which have been de-veloped to fit these needs are often constrained to specific scales or purposes and thus can not be easily adapted to meet different challenges. As a solution for flexible and modularised model development and application, the Object Modeling System (OMS has been developed in a joint approach by the USDA-ARS, GPSRU (Fort Collins, CO, USA, USGS (Denver, CO, USA, and the FSU (Jena, Germany. The OMS provides a modern modelling framework which allows the implementation of single process components to be compiled and applied as custom tailored model assemblies. This paper describes basic principles of the OMS and its main components and explains in more detail how the problems during coupling of models or model components are solved inside the system. It highlights the integration of different spatial and temporal scales by their representation as spatial modelling entities embedded into time compound components. As an exam-ple the implementation of the hydrological model J2000 is discussed.
Hydrologic and Water Quality Model Development Using Simulink
Directory of Open Access Journals (Sweden)
James D. Bowen
2014-11-01
Full Text Available A stormwater runoff model based on the Soil Conservation Service (SCS method and a finite-volume based water quality model have been developed to investigate the use of Simulink for use in teaching and research. Simulink, a MATLAB extension, is a graphically based model development environment for system modeling and simulation. Widely used for mechanical and electrical systems, Simulink has had less use for modeling of hydrologic systems. The watershed model is being considered for use in teaching graduate-level courses in hydrology and/or stormwater modeling. Simulink’s block (data process and arrow (data transfer object model, the copy and paste user interface, the large number of existing blocks, and the absence of computer code allows students to become model developers almost immediately. The visual depiction of systems, their component subsystems, and the flow of data through the systems are ideal attributes for hands-on teaching of hydrologic and mass balance processes to today’s computer-savvy visual learners. Model development with Simulink for research purposes is also investigated. A finite volume, multi-layer pond model using the water quality kinetics present in CE-QUAL-W2 has been developed using Simulink. The model is one of the first uses of Simulink for modeling eutrophication dynamics in stratified natural systems. The model structure and a test case are presented. One use of the model for teaching a graduate-level water quality modeling class is also described.
Fields, Christina M.
2013-01-01
The Spaceport Command and Control System (SCCS) Simulation Computer Software Configuration Item (CSCI) is responsible for providing simulations to support test and verification of SCCS hardware and software. The Universal Coolant Transporter System (UCTS) was a Space Shuttle Orbiter support piece of the Ground Servicing Equipment (GSE). The initial purpose of the UCTS was to provide two support services to the Space Shuttle Orbiter immediately after landing at the Shuttle Landing Facility. The UCTS is designed with the capability of servicing future space vehicles; including all Space Station Requirements necessary for the MPLM Modules. The Simulation uses GSE Models to stand in for the actual systems to support testing of SCCS systems during their development. As an intern at Kennedy Space Center (KSC), my assignment was to develop a model component for the UCTS. I was given a fluid component (dryer) to model in Simulink. I completed training for UNIX and Simulink. The dryer is a Catch All replaceable core type filter-dryer. The filter-dryer provides maximum protection for the thermostatic expansion valve and solenoid valve from dirt that may be in the system. The filter-dryer also protects the valves from freezing up. I researched fluid dynamics to understand the function of my component. The filter-dryer was modeled by determining affects it has on the pressure and velocity of the system. I used Bernoulli's Equation to calculate the pressure and velocity differential through the dryer. I created my filter-dryer model in Simulink and wrote the test script to test the component. I completed component testing and captured test data. The finalized model was sent for peer review for any improvements. I participated in Simulation meetings and was involved in the subsystem design process and team collaborations. I gained valuable work experience and insight into a career path as an engineer.
Lin, Wen; Hong, Jin-Liern; Shen, Guoxiang; Wu, Rachel T.; Wu, Yuwen; Huang, Mou-Tuan; Newmark, Harold L.; Huang, Qingrong; Khor, Tin Oo; Heimbach, Tycho; Kong, Ah-Ng
2010-01-01
The pharmacokinetic disposition of a dietary cancer chemopreventive compound dibenzoylmethane (DBM) was studied in male Sprague-Dawley rats after intravenous (i.v.) and oral (p.o.) administrations. Following a single i.v. bolus dose, the mean plasma clearance (CL) of DBM was low as compared to the hepatic blood flow. DBM displayed a high volume of distribution (Vss). The elimination terminal t1/2 was long. The mean CL, Vss and AUC0-∞/dose were similar between the i.v. 10 and 10 mg/kg doses. A...
Parallel Development of Products and New Business Models
DEFF Research Database (Denmark)
Lund, Morten; Hansen, Poul H. Kyvsgård
2014-01-01
The perception of product development and the practical execution of product development in professional organizations have undergone dramatic changes in recent years. Many of these chances relate to introduction of broader and more cross-disciplinary views that involves new organizational functi...... and innovation management the 4th generation models are increasingly including the concept business models and business model innovation....... functions and new concepts. These chances can be captured in various generations of practice. This paper will discuss the recent development of 3rd generation product development process models and the emergence of a 4th generation. While the 3rd generation models included the concept of innovation...
Matsui, Takeshi; Tabayashi, Ayako; Iwano, Megumi; Shinmyo, Atsuhiko; Kato, Ko; Nakayama, Hideki
2011-02-01
Plant class III peroxidase (PRX) catalyzes the oxidation and oxidative polymerization of a variety of phenolic compounds while reducing hydrogen peroxide. PRX proteins are classified into apoplast type and vacuole type based on the absence or the presence of C-terminal propeptides, which probably function as vacuolar sorting signals (VSSs). In this study, in order to improve our understanding of vacuole-type PRX, we analyzed regulatory mechanisms of vacuolar sorting of a model vacuole-type PRX, the C1a isozyme of horseradish (Armoracia rusticana) (HRP C1a). Using cultured transgenic tobacco cells and protoplasts derived from horseradish leaves, we characterized HRP C1a's VSS, which is a 15 amino acid C-terminal propeptide (C15). We found that the C-terminal hexapeptide of C15 (C6), which is well conserved among vacuole-type PRX proteins, forms the core of the C-terminal-dependent VSS. We also found that the function of C6 is enhanced by the remaining N-terminal part of C15 which probably folds into an amphiphilic α-helix.
A model for development of freight transport; En model for godstransportens udvikling
Energy Technology Data Exchange (ETDEWEB)
Kveiborg, O. [National Environmental Res., Systems Analysis Dept. Roskilde (Denmark)
2001-01-01
This report describes the results of a large project conducted in a corporation between Statistics Denmark and the Danish National Environmental Research Institute. The main objective of the project has been to analyse the possibilities of prescribing the development in the Danish freight transport in a more appropriate and precise way than it is done by existing models. A secondary objective of the project was to develop a model based on the findings of the analysis. The intention was to be able to describe all areas of freight transport. The analysis has proven it impossible to improve the existing calculations in some areas of transport. Hence, the project has been narrowed down to focus exclusively on road freight transport. The developed model distinguishes itself from existing models by a much higher level of detail in the calculations. This enables the model to describe the structural relations between transport and economic activity, which has previously been subsumed in the aggregate calculations of existing models. The work carried out in the process of developing a model for the freight transport has encountered many difficulties. The findings described in this report are merely one step towards a better understanding of the relation between economic development and transport. The descriptions on the following pages will describe some of the difficulties we have had in achieving an appropriate statistical description of the different linkages. Furthermore, the calculations carried out with the model point at other unsolved problems. There is an indication that the model tends to overestimate the developments in freight transport. In this respect, the very disaggregate calculations of the model can be seen as both an advantage and as a disadvantage because each extra calculation gives rise to further uncertainties in the overall result. Even though we have had great difficulties finding adequate descriptions of the development in the factors in the model
A Model-Driven Development Method for Management Information Systems
Mizuno, Tomoki; Matsumoto, Keinosuke; Mori, Naoki
Traditionally, a Management Information System (MIS) has been developed without using formal methods. By the informal methods, the MIS is developed on its lifecycle without having any models. It causes many problems such as lack of the reliability of system design specifications. In order to overcome these problems, a model theory approach was proposed. The approach is based on an idea that a system can be modeled by automata and set theory. However, it is very difficult to generate automata of the system to be developed right from the start. On the other hand, there is a model-driven development method that can flexibly correspond to changes of business logics or implementing technologies. In the model-driven development, a system is modeled using a modeling language such as UML. This paper proposes a new development method for management information systems applying the model-driven development method to a component of the model theory approach. The experiment has shown that a reduced amount of efforts is more than 30% of all the efforts.
On Support Functions for the Development of MFM Models
DEFF Research Database (Denmark)
Heussen, Kai; Lind, Morten
2012-01-01
a review of MFM applications, and contextualizes the model development with respect to process design and operation knowledge. Developing a perspective for an environment for MFM-oriented model- and application-development a tool-chain is outlined and relevant software functions are discussed......A modeling environment and methodology are necessary to ensure quality and reusability of models in any domain. For MFM in particular, as a tool for modeling complex systems, awareness has been increasing for this need. Introducing the context of modeling support functions, this paper provides....... With a perspective on MFM-modeling for existing processes and automation design, modeling stages and corresponding formal model properties are identified. Finally, practically feasible support functions and model-checks to support the model-development are suggested....
Macroeconomic model of national economy development
Directory of Open Access Journals (Sweden)
E. Naval
1996-03-01
Full Text Available Some approaches to modeling of national economy development are considered. Methods and models for determination of forecasting values of macroeconomic parameters are proposed at availability or absence of external financing.
Model-Driven Development of Safety Architectures
Denney, Ewen; Pai, Ganesh; Whiteside, Iain
2017-01-01
We describe the use of model-driven development for safety assurance of a pioneering NASA flight operation involving a fleet of small unmanned aircraft systems (sUAS) flying beyond visual line of sight. The central idea is to develop a safety architecture that provides the basis for risk assessment and visualization within a safety case, the formal justification of acceptable safety required by the aviation regulatory authority. A safety architecture is composed from a collection of bow tie diagrams (BTDs), a practical approach to manage safety risk by linking the identified hazards to the appropriate mitigation measures. The safety justification for a given unmanned aircraft system (UAS) operation can have many related BTDs. In practice, however, each BTD is independently developed, which poses challenges with respect to incremental development, maintaining consistency across different safety artifacts when changes occur, and in extracting and presenting stakeholder specific information relevant for decision making. We show how a safety architecture reconciles the various BTDs of a system, and, collectively, provide an overarching picture of system safety, by considering them as views of a unified model. We also show how it enables model-driven development of BTDs, replete with validations, transformations, and a range of views. Our approach, which we have implemented in our toolset, AdvoCATE, is illustrated with a running example drawn from a real UAS safety case. The models and some of the innovations described here were instrumental in successfully obtaining regulatory flight approval.
Computer-aided modeling framework for efficient model development, analysis and identification
DEFF Research Database (Denmark)
Heitzig, Martina; Sin, Gürkan; Sales Cruz, Mauricio
2011-01-01
Model-based computer aided product-process engineering has attained increased importance in a number of industries, including pharmaceuticals, petrochemicals, fine chemicals, polymers, biotechnology, food, energy, and water. This trend is set to continue due to the substantial benefits computer-aided...... methods introduce. The key prerequisite of computer-aided product-process engineering is however the availability of models of different types, forms, and application modes. The development of the models required for the systems under investigation tends to be a challenging and time-consuming task....... The methodology has been implemented into a computer-aided modeling framework, which combines expert skills, tools, and database connections that are required for the different steps of the model development work-flow with the goal to increase the efficiency of the modeling process. The framework has two main...
Godvin Sharmila, V; Kavitha, S; Rajashankar, K; Yeom, Ick Tae; Rajesh Banu, J
2015-12-01
This investigation explores the influence of titanium dioxide (TiO2) in deflocculating (removal of extracellular polymeric substance - EPS) the sludge and subsequent biomass disintegration by bacterial pretreatment. The EPS removed at an optimized TiO2 dosage of 0.03g/g of SS of TiO2 and a solar radiation exposure time of 15min to enhance the subsequent bacterial disintegration. The outcomes of the bacterial pretreatment reveal SS reduction and COD solubilization for the deflocculated (EPS removed and bacterially pretreated) sludge was observed to be 22.8% and 22.9% which was comparatively greater than flocculated (raw sludge inoculated with bacteria) and control (raw) sludge. The higher methane production potential of about 0.43(gCOD/gVSS) was obtained in deflocculated sludge than the flocculated (0.20gCOD/gVSS) and control (0.073gCOD/gVSS). Economic assessment of this study provides a net profit of about 131.9USD/Ton in deflocculated sludge. Copyright © 2015 Elsevier Ltd. All rights reserved.
Conduction-band valley spin splitting in single-layer H-T l2O
Ma, Yandong; Kou, Liangzhi; Du, Aijun; Huang, Baibiao; Dai, Ying; Heine, Thomas
2018-02-01
Despite numerous studies, coupled spin and valley physics is currently limited to two-dimensional (2D) transition-metal dichalcogenides (TMDCs). Here, we predict an exceptional 2D valleytronic material associated with the spin-valley coupling phenomena beyond 2D TMDCs—single-layer (SL) H-T l2O . It displays large valley spin splitting (VSS), significantly larger than that of 2D TMDCs, and a finite band gap, which are both critically attractive for the integration of valleytronics and spintronics. More importantly, in sharp contrast to all the experimentally confirmed 2D valleytronic materials, where the strong valence-band VSS (0.15-0.46 eV) supports the spin-valley coupling, the VSS in SL H-T l2O is pronounced in its conduction band (0.61 eV), but negligibly small in its valence band (21 meV), thus opening a way for manipulating the coupled spin and valley physics. Moreover, SL H-T l2O possesses extremely high carrier mobility, as large as 9.8 ×103c m2V-1s-1 .
Han, Yuanyuan; Jin, Xibiao; Wang, Yuan; Liu, Yongdi; Chen, Xiurong
2014-02-01
Inhibition of nitrification by four typical pollutants (acrylonitrile, acrylic acid, acetonitrile and cyanide) in acrylonitrile wastewater was investigated. The inhibitory effect of cyanide on nitrification was strongest, with a 50% inhibitory concentration of 0.218 mg·gVSS-1 being observed in a municipal activated sludge system. However, the performance of nitrification was recovered when cyanide was completely degraded. The nitrification, which had been inhibited by 4.17 mg·gVSS-1 of free cyanide for 24 h, was recovered to greater than 95% of that without cyanide after 10 days of recovery. To overcome cyanide inhibition, cyanide-degrading bacteria were cultivated in a batch reactor by increasing the influent cyanide concentration in a stepwise manner, which resulted in an increase in the average cyanide degradation rate from 0.14 to 1.01 mg CN-·gVSS-1·h-1 over 20 days. The cultured cyanide-degrading bacteria were shaped like short rods, and the dominant cyanide-degrading bacteria strain was identified as Pseudomonas fluorescens NCIMB by PCR.
Tank 241-BY-108 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank BY-108 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. Tank BY-108 is on the Ferrocyanide Watch List. Samples were collected from Tank BY-108 using the vapor sampling system (VSS) on october 27, 1994 by WHC Sampling and Mobile Laboratories. The tank headspace temperature was determined to be 25.7 C. Air from the Tank BY-108 headspace was withdrawn via a 7.9 m-long heated sampling probe mounted in riser 1, and transferred via heated tubing to the VSS sampling manifold. All heated zones of the VSS were maintained at approximately 50 C. Sampling media were prepared and analyzed by WHC, Oak Ridge National Laboratories, and Pacific Northwest Laboratories. The 40 tank air samples and 2 ambient air control samples collected are listed in Table X-1 by analytical laboratory. Table X-1 also lists the 14 trip blanks and 2 field blanks that accompanied the samples
Tank 241-BY-105 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank BY-105 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. Tank BY-105 is on the Ferrocyanide Watch List. Samples were collected from Tank BY-105 using the vapor sampling system (VSS) on July 7, 1994 by WHC Sampling and Mobile Laboratories. The tank headspace temperature was determined to be 26 C. Air from the Tank BY-105 headspace was withdrawn via a heated sampling probe mounted in riser 10A, and transferred via heated tubing to the VSS sampling manifold. All heated zones of the VSS were maintained at approximately 65 C. Sampling media were prepared and analyzed by WHC, Oak Ridge National Laboratories, Pacific Northwest Laboratories, and Oregon Graduate Institute of Science and Technology through a contract with Sandia National Laboratories. The 46 tank air samples and 2 ambient air control samples collected are listed in Table X-1 by analytical laboratory. Table X-1 also lists the 10 trip blanks provided by the laboratories
Tank 241-BY-110 vapor sampling and analysis tank characterization report
International Nuclear Information System (INIS)
Huckaby, J.L.
1995-01-01
Tank BY-110 headspace gas and vapor samples were collected and analyzed to help determine the potential risks to tank farm workers due to fugitive emissions from the tank. Tank BY-110 is on the Ferrocyanide Watch List. Samples were collected from Tank BY-110 using the vapor sampling system (VSS) on November 11, 1994 by WHC Sampling and Mobile Laboratories. The tank headspace temperature was determined to be 27 C. Air from the Tank BY-110 headspace was withdrawn via a 7.9 m-long heated sampling probe mounted in riser 12B, and transferred via heated tubing to the VSS sampling manifold. All heated zones of the VSS were maintained at approximately 50 C. Sampling media were prepared and analyzed by WHC, Oak Ridge National Laboratories, and Pacific Northwest Laboratories. The 40 tank air samples and 2 ambient air control samples collected are listed in Table X-1 by analytical laboratory. Table X-1 also lists the 14 trip blanks and 2 field blanks that accompanied the samples
Towards a Balanced Sustainability Vision for the Coffee Industry
Directory of Open Access Journals (Sweden)
Luis F. Samper
2017-04-01
Full Text Available As one of the world’s most traded agricultural commodities, coffee constitutes a significant part of the overall economy and a major source of foreign revenue for many developing countries. Coffee also touches a large portion of the world’s population in the South, where it is mainly produced, and in the North, where it is primarily consumed. As a product frequently purchased by a significant share of worldwide consumers on a daily basis in social occasions, the coffee industry has earned a high profile that also attracts the interest of non-governmental organizations, governments, multilateral organizations and development specialists and has been an early adopter of Voluntary Sustainability Standards (VSS. Responding to the trend of increased interest on sustainability, it is therefore not surprising that coffee continues to be at the forefront of sustainability initiatives that transcend into other agricultural industries. Based on literature and authors’ experiences, this article reflects on the VSS evolution and considers a sustainability model that specifically incorporates producers’ local realities and deals with the complex scenario of sustainability challenges in producing regions. Agreeing on a joint sustainability approach with farmers’ effective involvement is necessary so that the industry as a whole (up and downstream value chain actors can legitimately communicate its own sustainability priorities. This top-down/bottom-up approach could also lead to origin-based, actionable and focused sustainability key performance indicators, relevant for producers and consistent with the UN’s Sustainable Development Goals. The initiative also aims to provide a sustainability platform for single origin coffees and Geographical Indications (GIs in accordance with growers’ own realities and regions, providing the credibility that consumers now expect from sustainability initiatives, additional differentiation options for origin
The Development Model Electronic Commerce of Regional Agriculture
Kang, Jun; Cai, Lecai; Li, Hongchan
With the developing of the agricultural information, it is inevitable trend of the development of agricultural electronic commercial affairs. On the basis of existing study on the development application model of e-commerce, combined with the character of the agricultural information, compared with the developing model from the theory and reality, a new development model electronic commerce of regional agriculture base on the government is put up, and such key issues as problems of the security applications, payment mode, sharing mechanisms, and legal protection are analyzed, etc. The among coordination mechanism of the region is discussed on, it is significance for regulating the development of agricultural e-commerce and promoting the regional economical development.
BWR Refill-Reflood Program, Task 4.7 - model development: TRAC-BWR component models
International Nuclear Information System (INIS)
Cheung, Y.K.; Parameswaran, V.; Shaug, J.C.
1983-09-01
TRAC (Transient Reactor Analysis Code) is a computer code for best-estimate analysis for the thermal hydraulic conditions in a reactor system. The development and assessment of the BWR component models developed under the Refill/Reflood Program that are necessary to structure a BWR-version of TRAC are described in this report. These component models are the jet pump, steam separator, steam dryer, two-phase level tracking model, and upper-plenum mixing model. These models have been implemented into TRAC-B02. Also a single-channel option has been developed for individual fuel-channel analysis following a system-response calculation
Developing Integrated Care: Towards a development model for integrated care
M.M.N. Minkman (Mirella)
2012-01-01
textabstractThe thesis adresses the phenomenon of integrated care. The implementation of integrated care for patients with a stroke or dementia is studied. Because a generic quality management model for integrated care is lacking, the study works towards building a development model for integrated
Supo Thermal Model Development II
Energy Technology Data Exchange (ETDEWEB)
Wass, Alexander Joseph [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2017-07-14
This report describes the continuation of the Computational Fluid Dynamics (CFD) model of the Supo cooling system described in the report, Supo Thermal Model Development1, by Cynthia Buechler. The goal for this report is to estimate the natural convection heat transfer coefficient (HTC) of the system using the CFD results and to compare those results to remaining past operational data. Also, the correlation for determining radiolytic gas bubble size is reevaluated using the larger simulation sample size. The background, solution vessel geometry, mesh, material properties, and boundary conditions are developed in the same manner as the previous report. Although, the material properties and boundary conditions are determined using the appropriate experiment results for each individual power level.
An Overview of Strategy Development Models and the Ward-Rivani Model
David Ward; Elena Rivani
2005-01-01
Numerous models for developing strategy, defining and aligning competitive advantage have been proposed over the years (and even centuries if we consider Arian, Sun Tzu etc.) including probably the most famous of all, the 5 forces model by Porter (P5F). With publications in the field of strategy now in the thousands it is difficult to get an overall picture of how to classify and appreciate strategy tools and models. Mintzberg et al. have developed schools of thought to help alleviate and cat...
Developing rural palliative care: validating a conceptual model.
Kelley, Mary Lou; Williams, Allison; DeMiglio, Lily; Mettam, Hilary
2011-01-01
The purpose of this research was to validate a conceptual model for developing palliative care in rural communities. This model articulates how local rural healthcare providers develop palliative care services according to four sequential phases. The model has roots in concepts of community capacity development, evolves from collaborative, generalist rural practice, and utilizes existing health services infrastructure. It addresses how rural providers manage challenges, specifically those related to: lack of resources, minimal community understanding of palliative care, health professionals' resistance, the bureaucracy of the health system, and the obstacles of providing services in rural environments. Seven semi-structured focus groups were conducted with interdisciplinary health providers in 7 rural communities in two Canadian provinces. Using a constant comparative analysis approach, focus group data were analyzed by examining participants' statements in relation to the model and comparing emerging themes in the development of rural palliative care to the elements of the model. The data validated the conceptual model as the model was able to theoretically predict and explain the experiences of the 7 rural communities that participated in the study. New emerging themes from the data elaborated existing elements in the model and informed the requirement for minor revisions. The model was validated and slightly revised, as suggested by the data. The model was confirmed as being a useful theoretical tool for conceptualizing the development of rural palliative care that is applicable in diverse rural communities.
Pereira, M. A.; Sousa, D. Z.; Mota, M.; Alves, M. M.
2004-01-01
Long-chain fatty acids (LCFA) associated with anaerobic sludge by mechanisms of precipitation, adsorption, or entrapment can be biodegraded to methane. The mineralization kinetics of biomass-associated LCFA were established according to an inhibition model based on Haldane’s enzymatic inhibition kinetics. A value around 1,000 mg COD-LCFA g VSS-1 was obtained for the optimal specific LCFA content that allowed the maximal mineralization rate. For sludge with specific LCFA contents of 2838...
Preliminary Development of Regulatory PSA Models for SFR
International Nuclear Information System (INIS)
Choi, Yong Won; Shin, Andong; Bae, Moohoon; Suh, Namduk; Lee, Yong Suk
2013-01-01
Well developed PRA methodology exists for LWR (Light Water Reactor) and PHWR (Pressurized Heavy Water Reactor). Since KAERI is developing a prototype SFR targeting to apply for a license by 2017, KINS needs to have a PRA models to assess the safety of this prototype reactor. The purpose of this study is to develop the regulatory PSA models for the independent verification of the SFR safety. Since the design of the prototype SFR is not mature yet, we have tried to develop the preliminary models based on the design data of KAERI's previous SFR design. In this study, the preliminary initiating events of level 1 internal event for SFR were selected through reviews of existing PRA (LWR, PRISM, ASTRID and KALIMER-600) models. Then, the event tree for each selected initiating event was developed. The regulatory PRA models of SFR developed are preliminary in a sense, because the prototype SFR design is not mature and provided yet. Still it might be utilized for the forthcoming licensing review in assessing the risk of safety issues and the configuration control of the design
Directory of Open Access Journals (Sweden)
Nataša Šarlija
2017-01-01
Full Text Available This study sheds light on the most common issues related to applying logistic regression in prediction models for company growth. The purpose of the paper is 1 to provide a detailed demonstration of the steps in developing a growth prediction model based on logistic regression analysis, 2 to discuss common pitfalls and methodological errors in developing a model, and 3 to provide solutions and possible ways of overcoming these issues. Special attention is devoted to the question of satisfying logistic regression assumptions, selecting and defining dependent and independent variables, using classification tables and ROC curves, for reporting model strength, interpreting odds ratios as effect measures and evaluating performance of the prediction model. Development of a logistic regression model in this paper focuses on a prediction model of company growth. The analysis is based on predominantly financial data from a sample of 1471 small and medium-sized Croatian companies active between 2009 and 2014. The financial data is presented in the form of financial ratios divided into nine main groups depicting following areas of business: liquidity, leverage, activity, profitability, research and development, investing and export. The growth prediction model indicates aspects of a business critical for achieving high growth. In that respect, the contribution of this paper is twofold. First, methodological, in terms of pointing out pitfalls and potential solutions in logistic regression modelling, and secondly, theoretical, in terms of identifying factors responsible for high growth of small and medium-sized companies.
Consistency and Reconciliation Model In Regional Development Planning
Directory of Open Access Journals (Sweden)
Dina Suryawati
2016-10-01
Full Text Available The aim of this study was to identify the problems and determine the conceptual model of regional development planning. Regional development planning is a systemic, complex and unstructured process. Therefore, this study used soft systems methodology to outline unstructured issues with a structured approach. The conceptual models that were successfully constructed in this study are a model of consistency and a model of reconciliation. Regional development planning is a process that is well-integrated with central planning and inter-regional planning documents. Integration and consistency of regional planning documents are very important in order to achieve the development goals that have been set. On the other hand, the process of development planning in the region involves technocratic system, that is, both top-down and bottom-up system of participation. Both must be balanced, do not overlap and do not dominate each other. regional, development, planning, consistency, reconciliation
Lee, Sohee; Kim, Ha Yan; Lee, Cho Rok; Park, Seulkee; Son, Haiyoung; Kang, Sang-Wook; Jeong, Jong Ju; Nam, Kee-Hyun; Chung, Woong Youn; Park, Cheong Soo
2014-07-01
Body image is associated with self-esteem and identity and has a close relationship with quality of life (QoL). We compared the impact of surgical scars on the patient's perception of body image between conventional open thyroidectomy (OT) and robotic thyroidectomy (RT) in female papillary thyroid carcinoma patients. From October 2009 to December 2010, we enrolled prospectively 116 papillary thyroid carcinoma patients who underwent total thyroidectomy at the Yonsei University Health System (Seoul, Korea). Of these 116 patients, 56 had OT and 60 RT. Their scars were assessed using the Vancouver Scar Scale (VSS), and psychometric properties were evaluated using the Body Image Scale (BIS) questionnaire postoperatively. Both groups were compared using cross-sectional and time-series methods. Mean age was significantly younger in the RT group. Regarding scar quality, the OT group showed superiority in scar pigmentation and the total VSS score during the early postoperative period, but the VSS score improved over time and was similar between both groups at 9 months. The RT group had better scores regarding most of the BIS items, a trend that remained relatively constant over time. In patients with noticeable scars (VSS ≥ 2) at 9 months, the RT group had better BIS scores regarding almost all items, including "self-conscious," "physical attractiveness," "feeling of less feminine," "sexual attractiveness," "dissatisfaction with body, scar and appearance when dressed," and "avoidance of people due to appearance." RT provides a better self-body image and improves QoL compared with conventional OT by avoiding a noticeable cervical scar. Copyright © 2014 Mosby, Inc. All rights reserved.
Colombi, Davide; Dinkel, Julien; Weinheimer, Oliver; Obermayer, Berenike; Buzan, Teodora; Nabers, Diana; Bauer, Claudia; Oltmanns, Ute; Palmowski, Karin; Herth, Felix; Kauczor, Hans Ulrich; Sverzellati, Nicola
2015-01-01
Objectives To describe changes over time in extent of idiopathic pulmonary fibrosis (IPF) at multidetector computed tomography (MDCT) assessed by semi-quantitative visual scores (VSs) and fully automatic histogram-based quantitative evaluation and to test the relationship between these two methods of quantification. Methods Forty IPF patients (median age: 70 y, interquartile: 62-75 years; M:F, 33:7) that underwent 2 MDCT at different time points with a median interval of 13 months (interquartile: 10-17 months) were retrospectively evaluated. In-house software YACTA quantified automatically lung density histogram (10th-90th percentile in 5th percentile steps). Longitudinal changes in VSs and in the percentiles of attenuation histogram were obtained in 20 untreated patients and 20 patients treated with pirfenidone. Pearson correlation analysis was used to test the relationship between VSs and selected percentiles. Results In follow-up MDCT, visual overall extent of parenchymal abnormalities (OE) increased in median by 5 %/year (interquartile: 0 %/y; +11 %/y). Substantial difference was found between treated and untreated patients in HU changes of the 40th and of the 80th percentiles of density histogram. Correlation analysis between VSs and selected percentiles showed higher correlation between the changes (Δ) in OE and Δ 40th percentile (r=0.69; phistogram analysis at one year follow-up of IPF patients, whether treated or untreated: Δ 40th percentile might reflect the change in overall extent of lung abnormalities, notably of ground-glass pattern; furthermore Δ 80th percentile might reveal the course of reticular opacities. PMID:26110421
Parametric Cost and Schedule Modeling for Early Technology Development
2018-04-02
Research NoteNational Security Rep rt PARAMETRIC MODELING FOR EARLY TECHNOLOGY DEVELOPMENT COST AND SCHEDULE Chuck...Alexander NSR_11x17_Cover_CostModeling_v8.indd 1 11/20/17 3:15 PM PARAMETRIC COST AND SCHEDULE MODELING FOR EARLY TECHNOLOGY DEVELOPMENT Chuck...COST AND SCHEDULE MODELING FOR EARLY TECHNOLOGY DEVELOPMENT iii Contents Figures
Features of Balance Model Development of Exclave Region
Directory of Open Access Journals (Sweden)
Timur Rustamovich Gareev
2015-06-01
Full Text Available In the article, the authors build a balance model for an exclave region. The aim of the work is to explore the unique properties of exclaves to evaluate the possibility of development of a more complex model for the economy of a region. Exclaves are strange phenomena in both theoretical and practical regional economy. There is lack of comparative models, so it is typically quite challenging to study exclaves. At the same time, exclaves produce better statistics, which gives more careful consideration of cross-regional economic flows. The authors discuss methodologies of model-based regional development forecasting. They analyze balance approach on a more general level of regional governance and individually, on the example of specific territories. Thus, they identify and explain the need to develop balance approach models fitted to the special needs of certain territories. By combining regional modeling for an exclave with traditional balance and simulation-based methods and event-based approach, they come up with a more detailed model for the economy of a region. Having taken one Russian exclave as an example, the authors have developed a simulation event-based long-term sustainability model. In the article, they provide the general characteristics of the model, describe its components, and simulation algorithm. The approach introduced in this article combines the traditional balance models and the peculiarities of an exclave region to develop a holistic regional economy model (with the Kaliningrad region serving as an example. It is important to underline that the resulting model helps to evaluate the degree of influence of preferential economic regimes (such as Free Customs Zone, for example on the economy of a region.
An Aristotelian Model of Moral Development
Sanderse, Wouter
2015-01-01
Despite the Aristotelian renaissance in the philosophy of education, the development of virtue has not received much attention. This is unfortunate, because an attempt to draft an Aristotelian model of moral development can help philosophers to evaluate the contribution Aristotelian virtue ethics can make to our understanding of moral development,…
A new approach for developing adjoint models
Farrell, P. E.; Funke, S. W.
2011-12-01
Many data assimilation algorithms rely on the availability of gradients of misfit functionals, which can be efficiently computed with adjoint models. However, the development of an adjoint model for a complex geophysical code is generally very difficult. Algorithmic differentiation (AD, also called automatic differentiation) offers one strategy for simplifying this task: it takes the abstraction that a model is a sequence of primitive instructions, each of which may be differentiated in turn. While extremely successful, this low-level abstraction runs into time-consuming difficulties when applied to the whole codebase of a model, such as differentiating through linear solves, model I/O, calls to external libraries, language features that are unsupported by the AD tool, and the use of multiple programming languages. While these difficulties can be overcome, it requires a large amount of technical expertise and an intimate familiarity with both the AD tool and the model. An alternative to applying the AD tool to the whole codebase is to assemble the discrete adjoint equations and use these to compute the necessary gradients. With this approach, the AD tool must be applied to the nonlinear assembly operators, which are typically small, self-contained units of the codebase. The disadvantage of this approach is that the assembly of the discrete adjoint equations is still very difficult to perform correctly, especially for complex multiphysics models that perform temporal integration; as it stands, this approach is as difficult and time-consuming as applying AD to the whole model. In this work, we have developed a library which greatly simplifies and automates the alternate approach of assembling the discrete adjoint equations. We propose a complementary, higher-level abstraction to that of AD: that a model is a sequence of linear solves. The developer annotates model source code with library calls that build a 'tape' of the operators involved and their dependencies, and
Development and Application of a Low Impact Development (LID-Based District Unit Planning Model
Directory of Open Access Journals (Sweden)
Cheol Hee Son
2017-01-01
Full Text Available The purpose of this study was to develop a low impact development-based district unit planning (LID-DP model and to verify the model by applying it to a test site. To develop the model, we identified various barriers to the urban planning process and examined the advantages of various LID-related techniques to determine where in the urban development process LID would provide the greatest benefit. The resulting model provides (1 a set of district unit planning processes that consider LID standards and (2 a set of evaluation methods that measure the benefits of the LID-DP model over standard urban development practices. The developed LID-DP process is composed of status analysis, comprehensive analysis, basic plan, and sectoral plans. To determine whether the LID-DP model met the proposed LID targets, we applied the model to a test site in Cheongju City, Chungcheongbuk-do Province, Republic of Korea. The test simulation showed that the LID-DP plan reduced nonpoint source pollutants (total nitrogen, 113%; total phosphorous, 193%; and biological oxygen demand, 199%; reduced rainfall runoff (infiltration volume, 102%; surface runoff, 101%; and improved the conservation rate of the natural environment area (132%. The successful application of this model also lent support for the greater importance of non-structural techniques over structural techniques in urban planning when taking ecological factors into account.
Mechanical Model Development for Composite Structural Supercapacitors
Ricks, Trenton M.; Lacy, Thomas E., Jr.; Santiago, Diana; Bednarcyk, Brett A.
2016-01-01
Novel composite structural supercapacitor concepts have recently been developed as a means both to store electrical charge and to provide modest mechanical load carrying capability. Double-layer composite supercapacitors are often fabricated by impregnating a woven carbon fiber fabric, which serves as the electrodes, with a structural polymer electrolyte. Polypropylene or a glass fabric is often used as the separator material. Recent research has been primarily limited to evaluating these composites experimentally. In this study, mechanical models based on the Multiscale Generalized Method of Cells (MSGMC) were developed and used to calculate the shear and tensile properties and response of two composite structural supercapacitors from the literature. The modeling approach was first validated against traditional composite laminate data. MSGMC models for composite supercapacitors were developed, and accurate elastic shear/tensile properties were obtained. It is envisioned that further development of the models presented in this work will facilitate the design of composite components for aerospace and automotive applications and can be used to screen candidate constituent materials for inclusion in future composite structural supercapacitor concepts.
Extending product modeling methods for integrated product development
DEFF Research Database (Denmark)
Bonev, Martin; Wörösch, Michael; Hauksdóttir, Dagný
2013-01-01
Despite great efforts within the modeling domain, the majority of methods often address the uncommon design situation of an original product development. However, studies illustrate that development tasks are predominantly related to redesigning, improving, and extending already existing products...... and PVM methods, in a presented Product Requirement Development model some of the individual drawbacks of each method could be overcome. Based on the UML standard, the model enables the representation of complex hierarchical relationships in a generic product model. At the same time it uses matrix....... Updated design requirements have then to be made explicit and mapped against the existing product architecture. In this paper, existing methods are adapted and extended through linking updated requirements to suitable product models. By combining several established modeling techniques, such as the DSM...
Model for Simulating a Spiral Software-Development Process
Mizell, Carolyn; Curley, Charles; Nayak, Umanath
2010-01-01
A discrete-event simulation model, and a computer program that implements the model, have been developed as means of analyzing a spiral software-development process. This model can be tailored to specific development environments for use by software project managers in making quantitative cases for deciding among different software-development processes, courses of action, and cost estimates. A spiral process can be contrasted with a waterfall process, which is a traditional process that consists of a sequence of activities that include analysis of requirements, design, coding, testing, and support. A spiral process is an iterative process that can be regarded as a repeating modified waterfall process. Each iteration includes assessment of risk, analysis of requirements, design, coding, testing, delivery, and evaluation. A key difference between a spiral and a waterfall process is that a spiral process can accommodate changes in requirements at each iteration, whereas in a waterfall process, requirements are considered to be fixed from the beginning and, therefore, a waterfall process is not flexible enough for some projects, especially those in which requirements are not known at the beginning or may change during development. For a given project, a spiral process may cost more and take more time than does a waterfall process, but may better satisfy a customer's expectations and needs. Models for simulating various waterfall processes have been developed previously, but until now, there have been no models for simulating spiral processes. The present spiral-process-simulating model and the software that implements it were developed by extending a discrete-event simulation process model of the IEEE 12207 Software Development Process, which was built using commercially available software known as the Process Analysis Tradeoff Tool (PATT). Typical inputs to PATT models include industry-average values of product size (expressed as number of lines of code
Kinetics model development of cocoa bean fermentation
Kresnowati, M. T. A. P.; Gunawan, Agus Yodi; Muliyadini, Winny
2015-12-01
Although Indonesia is one of the biggest cocoa beans producers in the world, Indonesian cocoa beans are oftenly of low quality and thereby frequently priced low in the world market. In order to improve the quality, adequate post-harvest cocoa processing techniques are required. Fermentation is the vital stage in series of cocoa beans post harvest processing which could improve the quality of cocoa beans, in particular taste, aroma, and colours. During the fermentation process, combination of microbes grow producing metabolites that serve as the precursors for cocoa beans flavour. Microbial composition and thereby their activities will affect the fermentation performance and influence the properties of cocoa beans. The correlation could be reviewed using a kinetic model that includes unstructured microbial growth, substrate utilization and metabolic product formation. The developed kinetic model could be further used to design cocoa bean fermentation process to meet the expected quality. Further the development of kinetic model of cocoa bean fermentation also serve as a good case study of mixed culture solid state fermentation, that has rarely been studied. This paper presents the development of a kinetic model for solid-state cocoa beans fermentation using an empirical approach. Series of lab scale cocoa bean fermentations, either natural fermentations without starter addition or fermentations with mixed yeast and lactic acid bacteria starter addition, were used for model parameters estimation. The results showed that cocoa beans fermentation can be modelled mathematically and the best model included substrate utilization, microbial growth, metabolites production and its transport. Although the developed model still can not explain the dynamics in microbial population, this model can sufficiently explained the observed changes in sugar concentration as well as metabolic products in the cocoa bean pulp.
How Qualitative Methods Can be Used to Inform Model Development.
Husbands, Samantha; Jowett, Susan; Barton, Pelham; Coast, Joanna
2017-06-01
Decision-analytic models play a key role in informing healthcare resource allocation decisions. However, there are ongoing concerns with the credibility of models. Modelling methods guidance can encourage good practice within model development, but its value is dependent on its ability to address the areas that modellers find most challenging. Further, it is important that modelling methods and related guidance are continually updated in light of any new approaches that could potentially enhance model credibility. The objective of this article was to highlight the ways in which qualitative methods have been used and recommended to inform decision-analytic model development and enhance modelling practices. With reference to the literature, the article discusses two key ways in which qualitative methods can be, and have been, applied. The first approach involves using qualitative methods to understand and inform general and future processes of model development, and the second, using qualitative techniques to directly inform the development of individual models. The literature suggests that qualitative methods can improve the validity and credibility of modelling processes by providing a means to understand existing modelling approaches that identifies where problems are occurring and further guidance is needed. It can also be applied within model development to facilitate the input of experts to structural development. We recommend that current and future model development would benefit from the greater integration of qualitative methods, specifically by studying 'real' modelling processes, and by developing recommendations around how qualitative methods can be adopted within everyday modelling practice.
Development of an artificial neural network model integrated with constitutive and FEM models
International Nuclear Information System (INIS)
Kong, L.X.; Hodgson, P.D.
2000-01-01
Although the standard error of IPANN model developed by Kong and Hodgson is lower than the constitutive model, it is found that the prediction of reaction force and torque during rolling with FEM is less accurate for IPANN model in some deformation regions. It is the summation of the product of the strain and stress in the deformation range, which contributes most to the precise prediction. An ANN model is therefore, developed in this work by integrating both the IPANN and FEM models. It is found that the integrated IPANN and FEM model is the most accurate model. (author)
Enabling Accessibility Through Model-Based User Interface Development.
Ziegler, Daniel; Peissner, Matthias
2017-01-01
Adaptive user interfaces (AUIs) can increase the accessibility of interactive systems. They provide personalized display and interaction modes to fit individual user needs. Most AUI approaches rely on model-based development, which is considered relatively demanding. This paper explores strategies to make model-based development more attractive for mainstream developers.
Models and automation technologies for the curriculum development
Directory of Open Access Journals (Sweden)
V. N. Volkova
2016-01-01
Full Text Available The aim of the research was to determine the sequence of the curriculum development stages on the basis of the system analysis, as well as to create models and information technologies for the implementation of thesestages.The methods and the models of the systems’ theory and the system analysis, including methods and automated procedures for structuring organizational aims, models and automated procedures for organizing complex expertise.On the basis of the analysis of existing studies in the field of curriculum modeling, using formal mathematical language, including optimization models, that help to make distribution of disciplines by years and semesters in accordance with the relevant restrictions, it is shown, that the complexity and dimension of these tasks require the development of special software; the problem of defining the input data and restrictions requires a large time investment, that seems to be difficult to provide in real conditions of plans’ developing, thus it is almost impossible to verify the objectivity of the input data and the restrictions in such models. For a complete analysis of the process of curriculum development it is proposed to use the system definition, based on the system-targeted approach. On the basis of this definition the reasonable sequence of the integrated stages for the development of the curriculum was justified: 1 definition (specification of the requirements for the educational content; 2 determining the number of subjects, included in the curriculum; 3 definition of the sequence of the subjects; 4 distribution of subjects by semesters. The models and technologies for the implementation of these stages of curriculum development were given in the article: 1 models, based on the information approach of A.Denisov and the modified degree of compliance with objectives based on Denisov’s evaluation index (in the article the idea of evaluating the degree of the impact of disciplines for realization
Li, Wei; Yu, Najiaowa; Liu, Qian; Li, Yiran; Ren, Nanqi; Xing, Defeng
2018-09-01
Sludge disintegration by ultrasound is a promising sludge treatment method. In order to enhance the efficiency of the sludge reduction and hydrolysis, potassium ferrate (K 2 FeO 4 ) (PF) was used. A novel method was developed to improve the sludge disintegration-sludge pretreatment by using PF in combination with an ultrasonic treatment (PF + ULT). After a short-term PF + ULT treatment, 17.23% of the volatile suspended solids (VSS) were reduced after a 900-min reaction time, which is 61.3% higher than the VSS reduction for the raw sludge. The supernatant soluble chemical oxygen demand (SCOD), total nitrogen (TN), volatile fatty acids (VFAs), soluble protein and polysaccharides increased by 522.5%, 1029.4%, 878.4%, 2996.6% and 801.9%, respectively. The constituent parts of the dissolved organic matter of the sludge products were released efficiently, which demonstrated the positive effect caused by the PF + ULT. The enhanced sludge disintegration process further alleviates environmental risk and offers a more efficient and convenient method for utilizing sludge. Copyright © 2018 Elsevier B.V. All rights reserved.
Development of three dimensional solid modeler
International Nuclear Information System (INIS)
Zahoor, R.M.A.
1999-01-01
The work presented in this thesis is aimed at developing a three dimensional solid modeler employing computer graphics techniques using C-Language. Primitives have been generated, by combination of plane surfaces, for various basic geometrical shapes including cylinder, cube and cone. Back face removal technique for hidden surface removal has also been incorporated. Various transformation techniques such as scaling, translation, and rotation have been included for the object animation. Three dimensional solid modeler has been created by the union of two primitives to demonstrate the capabilities of the developed program. (author)
COMPARATIVE ANALYSIS OF SOFTWARE DEVELOPMENT MODELS
Sandeep Kaur*
2017-01-01
No geek is unfamiliar with the concept of software development life cycle (SDLC). This research deals with the various SDLC models covering waterfall, spiral, and iterative, agile, V-shaped, prototype model. In the modern era, all the software systems are fallible as they can’t stand with certainty. So, it is tried to compare all aspects of the various models, their pros and cons so that it could be easy to choose a particular model at the time of need
Grulke, Christopher M.; Chang, Daniel T.; Brooks, Raina D.; Leonard, Jeremy A.; Phillips, Martin B.; Hypes, Ethan D.; Fair, Matthew J.; Tornero-Velez, Rogelio; Johnson, Jeffre; Dary, Curtis C.; Tan, Yu-Mei
2016-01-01
Developing physiologically-based pharmacokinetic (PBPK) models for chemicals can be resource-intensive, as neither chemical-specific parameters nor in vivo pharmacokinetic data are easily available for model construction. Previously developed, well-parameterized, and thoroughly-vetted models can be a great resource for the construction of models pertaining to new chemicals. A PBPK knowledgebase was compiled and developed from existing PBPK-related articles and used to develop new models. From 2,039 PBPK-related articles published between 1977 and 2013, 307 unique chemicals were identified for use as the basis of our knowledgebase. Keywords related to species, gender, developmental stages, and organs were analyzed from the articles within the PBPK knowledgebase. A correlation matrix of the 307 chemicals in the PBPK knowledgebase was calculated based on pharmacokinetic-relevant molecular descriptors. Chemicals in the PBPK knowledgebase were ranked based on their correlation toward ethylbenzene and gefitinib. Next, multiple chemicals were selected to represent exact matches, close analogues, or non-analogues of the target case study chemicals. Parameters, equations, or experimental data relevant to existing models for these chemicals and their analogues were used to construct new models, and model predictions were compared to observed values. This compiled knowledgebase provides a chemical structure-based approach for identifying PBPK models relevant to other chemical entities. Using suitable correlation metrics, we demonstrated that models of chemical analogues in the PBPK knowledgebase can guide the construction of PBPK models for other chemicals. PMID:26871706
System model development for nuclear thermal propulsion
International Nuclear Information System (INIS)
Walton, J.T.; Perkins, K.R.; Buksa, J.J.; Worley, B.A.; Dobranich, D.
1992-01-01
A critical enabling technology in the evolutionary development of nuclear thermal propulsion (NTP) is the ability to predict the system performance under a variety of operating conditions. Since October 1991, US (DOE), (DOD) and NASA have initiated critical technology development efforts for NTP systems to be used on Space Exploration Initiative (SEI) missions to the Moon and Mars. This paper presents the strategy and progress of an interagency NASA/DOE/DOD team for NTP system modeling. It is the intent of the interagency team to develop several levels of computer programs to simulate various NTP systems. An interagency team was formed for this task to use the best capabilities available and to assure appropriate peer review. The vision and strategy of the interagency team for developing NTP system models will be discussed in this paper. A review of the progress on the Level 1 interagency model is also presented
Lifescience Database Archive (English)
Full Text Available avtlllelhlhvmhfvtq*lhvqmdllmevklfhlhlfqtvnskvqvhliaqql i*kv*watgntks*nlylqlliyiqvv**edlc*vlvf*sdsyw*svh*vss*...nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnkk kckytinslsy*cnhnktsrkffkeqnki Frame B: ---hic
Simulation modelling: educational development roles for learning technologists
Directory of Open Access Journals (Sweden)
David Riley
2002-12-01
Full Text Available Simulation modelling was in the mainstream of CAL development in the 1980s when the late David Squires introduced this author to the Dynamic Modelling System. Since those early days, it seems that simulation modelling has drifted into a learning technology backwater to become a member of Laurillard's underutilized, 'adaptive and productive' media. Referring to her Conversational Framework, Laurillard constructs a pedagogic case for modelling as a productive student activity but provides few references to current practice and available resources. This paper seeks to complement her account by highlighting the pioneering initiatives of the Computers in the Curriculum Project and more recent developments in systems modelling within geographic and business education. The latter include improvements to system dynamics modelling programs such as STELLA®, the publication of introductory textbooks, and the emergence of online resources. The paper indicates several ways in which modelling activities may be approached and identifies some educational development roles for learning technologists. The paper concludes by advocating simulation modelling as an exemplary use of learning technologies - one that realizes their creative-transformative potential.
Modelling Template for the Development of the Process Flowsheet
DEFF Research Database (Denmark)
Fedorova, Marina; Gani, Rafiqul
2015-01-01
Models are playing important roles in design and analysis of chemicals/bio-chemicals based products and the processes that manufacture them. Model-based methods and tools have the potential to decrease the number of experiments, which can be expensive and time consuming, and point to candidates...... in connection to other modelling tools within the modelling framework are forming a user-friendly system, which will make the model development process easier and faster and provide the way for unified and consistent model documentation. The modeller can use the template for their specific problem or to extend...... models systematically, efficiently and reliably. In this way, development of products and processes can be faster, cheaper and very efficient. The developed modelling framework involves three main parts: 1) a modelling tool, that includes algorithms for model generation; 2) a template library, which...
Development of a solar cell model using PSCAD
Energy Technology Data Exchange (ETDEWEB)
Ramos, Sergio [Polytecnic of Porto (Portugal). GECAD - ISEP; Pinto, Sonia F.; Santana, Joao J. [Instituto Superior Tecnico, Lisbon (Portugal). Dept. de Engenharia Electrotecnica e de Computadores
2012-07-01
This paper presents the development of a solar photovoltaic (PV) model in an electromagnetic transient software environment PSCAD/EMTDC - Power System Computer Aided Design - including a mathematical model study. The implemented model can be used for simulation studies of grid interface application. An additional algorithm has been implemented in MATLAB software in order to calculate several parameters required by the PSCAD developed model. All the simulation study has been performed in PSCAD/MATLAB software simulation tool. (orig.)
A Study On Traditional And Evolutionary Software Development Models
Directory of Open Access Journals (Sweden)
Kamran Rasheed
2017-07-01
Full Text Available Today Computing technologies are becoming the pioneers of the organizations and helpful in individual functionality i.e. added to computing device we need to add softwares. Set of instruction or computer program is known as software. The development of software is done through some traditional or some new or evolutionary models. Software development is becoming a key and a successful business nowadays. Without software all hardware is useless. Some collective steps that are performed in the development of these are known as Software development life cycle SDLC. There are some adaptive and predictive models for developing software. Predictive mean already known like WATERFALL Spiral Prototype and V-shaped models while Adaptive model include agile Scrum. All methodologies of both adaptive and predictive have their own procedure and steps. Predictive are Static and Adaptive are dynamic mean change cannot be made to the predictive while adaptive have the capability of changing. The purpose of this study is to get familiar with all these and discuss their uses and steps of development. This discussion will be helpful in deciding which model they should use in which circumstance and what are the development step including in each model.
International Nuclear Information System (INIS)
Moffatt, I.
1992-01-01
This paper outlines one way in which researchers can make a positive methodological contribution to the debate on ecologically sustainable development (ESD) by integrating dynamic modelling and geographical information systems to form the basis for regional scale simulations. Some of the orthodox uses of Geographic Information System (GIS) are described and it is argued that most applications do not incorporate process based causal models. A description of a pilot study into developing a processed base model of ESD in the Northern Territory is given. This dynamic process based simulation model consists of two regions namely the 'Top End' and the 'Central' district. Each region consists of ten sub-sectors and the pattern of land use represents a common sector to both regions. The role of environmental defence expenditure, including environmental rehabilitation of uranium mines, in the model is noted. Similarly, it is hypothesized that the impact of exogenous changes such as the greenhouse effect and global economic fluctuations can have a differential impact on the behaviour of several sectors of the model. Some of the problems associated with calibrating and testing the model are reviewed. Finally, it is suggested that further refinement of this model can be achieved with the pooling of data sets and the development of PC based transputers for more detailed and accurate regional scale simulations. When fully developed it is anticipated that this pilot model can be of service to environmental managers and other groups involved in promoting ESD in the Northern Territory. 54 refs., 6 figs
Embedded systems development from functional models to implementations
Zeng, Haibo; Natale, Marco; Marwedel, Peter
2014-01-01
This book offers readers broad coverage of techniques to model, verify and validate the behavior and performance of complex distributed embedded systems. The authors attempt to bridge the gap between the three disciplines of model-based design, real-time analysis and model-driven development, for a better understanding of the ways in which new development flows can be constructed, going from system-level modeling to the correct and predictable generation of a distributed implementation, leveraging current and future research results. Describes integration of heterogeneous models; Discusses synthesis of task model implementations and code implementations; Compares model-based design vs. model-driven approaches; Explains how to enforce correctness by construction in the functional and time domains; Includes optimization techniques for control performance.
Progress in integrated energy-economy-environment model system development
International Nuclear Information System (INIS)
Yasukawa, Shigeru; Mankin, Shuichi; Sato, Osamu; Tadokoro, Yoshihiro; Nakano, Yasuyuki; Nagano, Takao
1987-11-01
The Integrated Energy-Economy-Environment Model System has been developed for providing analytical tools for the system analysis and technology assessments in the field of nuclear research and development. This model system consists of the following four model groups. The first model block installs 5 models and can serve to analyze and generate long-term scenarios on economy-energy-environment evolution. The second model block installs 2 models and can serve to analyze the structural transition phenomena in energy-economy-environment interactions. The third model block installs 2 models and can handle power reactor installation strategy problem and long-term fuel cycle analysis. The fourth model block installs 5 models and codes and can treats cost-benefit-risk analysis and assessments. This report describes mainly the progress and the outlines of application of the model system in these years after the first report on the research and development of the model system (JAERI-M 84 - 139). (author)
What Develops in Moral Development? A Model of Moral Sensibility
Sherblom, Stephen A.
2012-01-01
The field of moral psychology would benefit from an integrative model of what develops in moral development, contextualized within the larger scope of social science research. Moral sensibility is proposed as the best concept to embody stated aims, but the content of this concept must be more finely articulated and conceptualized as a dynamic…
Development of an Integrated Global Energy Model
International Nuclear Information System (INIS)
Krakowski, R.A.
1999-01-01
The primary objective of this research was to develop a forefront analysis tool for application to enhance understanding of long-term, global, nuclear-energy and nuclear-material futures. To this end, an existing economics-energy-environmental (E 3 ) model was adopted, modified, and elaborated to examine this problem in a multi-regional (13), long-term (approximately2,100) context. The E 3 model so developed was applied to create a Los Alamos presence in this E 3 area through ''niche analyses'' that provide input to the formulation of policies dealing with and shaping of nuclear-energy and nuclear-materials futures. Results from analyses using the E 3 model have been presented at a variety of national and international conferences and workshops. Through use of the E 3 model Los Alamos was afforded the opportunity to participate in a multi-national E 3 study team that is examining a range of global, long-term nuclear issues under the auspices of the IAEA during the 1998-99 period . Finally, the E 3 model developed under this LDRD project is being used as an important component in more recent Nuclear Material Management Systems (NMMS) project
Simulation of the Impact of SRT on Anaerobic Digestability of Ultrasonicated Hog Manure
Directory of Open Access Journals (Sweden)
Elsayed Elbeshbishy
2010-05-01
Full Text Available Ultrasonication at a specific energy of 500 kJ/kgTS was applied to hog manure in a continuous mode completely mixed anaerobic digestion. A process model in BioWin was developed, calibrated and tested at different solids retention times (SRTs to evaluate the process economics. The results showed that there was a 36% increase in volatile suspended solids (VSS removal efficiency, a 20% increase in methane production rate, a 13.5% increase in destruction of bound proteins, and a reduction from 988 to 566 ppm in H2S concentration in the digester headspace. Furthermore, a calibrated model of the process using BioWin to assess the impact of SRTs on the economics of anaerobic digestion for unsonicated and sonicated hog manure revealed that ultrasonication resulted in a net benefit of $42–46/ton dry solids at SRTs of 15–30 days.
Simulation of the impact of SRT on anaerobic digestability of ultrasonicated hog manure
Energy Technology Data Exchange (ETDEWEB)
Elbeshbishy, E.; Hafez, H.; Nakhla, G. [Department of Civil and Environmental Engineering, University of Western Ontario, London, Ontario N6A 5B9 (Canada); Nakevski, A.; Ray, M. [Department of Chemical and Biochemical Engineering, University of Western Ontario, London, Ontario N6A 5B9 (Canada)
2010-07-01
Ultrasonication at a specific energy of 500 kJ/kgTS was applied to hog manure in a continuous mode completely mixed anaerobic digestion. A process model in BioWin was developed, calibrated and tested at different solids retention times (SRTs) to evaluate the process economics. The results showed that there was a 36% increase in volatile suspended solids (VSS) removal efficiency, a 20% increase in methane production rate, a 13.5% increase in destruction of bound proteins, and a reduction from 988 to 566 ppm in H{sub 2}S concentration in the digester headspace. Furthermore, a calibrated model of the process using BioWin to assess the impact of SRTs on the economics of anaerobic digestion for unsonicated and sonicated hog manure revealed that ultrasonication resulted in a net benefit of $42-46/ton dry solids at SRTs of 15-30 days. (author)
Development of a realistic human airway model.
Lizal, Frantisek; Elcner, Jakub; Hopke, Philip K; Jedelsky, Jan; Jicha, Miroslav
2012-03-01
Numerous models of human lungs with various levels of idealization have been reported in the literature; consequently, results acquired using these models are difficult to compare to in vivo measurements. We have developed a set of model components based on realistic geometries, which permits the analysis of the effects of subsequent model simplification. A realistic digital upper airway geometry except for the lack of an oral cavity has been created which proved suitable both for computational fluid dynamics (CFD) simulations and for the fabrication of physical models. Subsequently, an oral cavity was added to the tracheobronchial geometry. The airway geometry including the oral cavity was adjusted to enable fabrication of a semi-realistic model. Five physical models were created based on these three digital geometries. Two optically transparent models, one with and one without the oral cavity, were constructed for flow velocity measurements, two realistic segmented models, one with and one without the oral cavity, were constructed for particle deposition measurements, and a semi-realistic model with glass cylindrical airways was developed for optical measurements of flow velocity and in situ particle size measurements. One-dimensional phase doppler anemometry measurements were made and compared to the CFD calculations for this model and good agreement was obtained.
Further development of the coupling model
International Nuclear Information System (INIS)
Kreuser, A.; Stiller, J.C.; Peschke, J.
2006-01-01
Uncertainties arising from different sources have to be considered for the quantification of common cause failures (CCFs). At GRS a CCF model (coupling model) has been developed for the estimation of CCF probabilities. An essential feature of the coupling model is the consideration of these uncertainties by using Bayesian estimation methods. Experiences from applying the coupling model to CCF event data over several years and analyzing the results in detail has led to improvements in the application of the model. In this paper the improved methodology of the coupling model is presented. Special emphasis is given to the description of the sources of uncertainties which are considered in the coupling model and the mathematical methodology, how these uncertainties are represented and propagated through the model. In closing topics of future improvements of the coupling models are discussed. (orig.)
MVP: A Volunteer Development & Recognition Model.
Gerhard, Gary W.
This model was developed to provide a systematic, staged approach to volunteer personnel management. It provides a general process for dealing with volunteers from the point of organization entry through volunteer career stages to the time of exiting the organization. The model provides the structural components necessary to (1) plan, coordinate,…
Development modeling of Lucilia sericata (Diptera: Calliphoridae
Directory of Open Access Journals (Sweden)
Amanda Roe
2015-03-01
Full Text Available The relationship between insect development and temperature has been well established and has a wide range of uses, including the use of blow flies for postmortem (PMI interval estimations in death investigations. To use insects in estimating PMI, we must be able to determine the insect age at the time of discovery and backtrack to time of oviposition. Unfortunately, existing development models of forensically important insects are only linear approximations and do not take into account the curvilinear properties experienced at extreme temperatures. A series of experiments were conducted with Lucilia sericata, a forensically important blow fly species, that met the requirements needed to create statistically valid development models. Experiments were conducted over 11 temperatures (7.5 to 32.5 °C, at 2.5 °C with a 16:8 L:D cycle. Experimental units contained 20 eggs, 10 g beef liver, and 2.5 cm of pine shavings. Each life stage (egg to adult had five sampling times. Each sampling time was replicated four times, for a total of 20 measurements per life stage. For each sampling time, the cups were pulled from the chambers and the stage of each maggot was documented morphologically through posterior spiracle slits and cephalopharyngeal skeletal development. Data were normally distributed with the later larval stages (L3f, L3m having the most variation within and transitioning between stages. The biological minimum was between 7.5 °C and 10 °C, with little egg development and no egg emergence at 7.5 °C. Temperature-induced mortality was highest from 10.0 to 17.5 °C and 32.5 °C. The development data generated illustrates the advantages of large datasets in modeling Lucilia sericata development and the need for curvilinear models in describing development at environmental temperatures near the biological minima and maxima.
Development and application of air quality models at the US ...
Overview of the development and application of air quality models at the U.S. EPA, particularly focused on the development and application of the Community Multiscale Air Quality (CMAQ) model developed within the Computation Exposure Division (CED) of the National Exposure Research Laboratory (NERL). This presentation will provide a simple overview of air quality model development and application geared toward a non-technical student audience. The National Exposure Research Laboratory (NERL) Computational Exposure Division (CED) develops and evaluates data, decision-support tools, and models to be applied to media-specific or receptor-specific problem areas. CED uses modeling-based approaches to characterize exposures, evaluate fate and transport, and support environmental diagnostics/forensics with input from multiple data sources. It also develops media- and receptor-specific models, process models, and decision support tools for use both within and outside of EPA.
Developing Phenomena Models from Experimental Data
DEFF Research Database (Denmark)
Kristensen, Niels Rode; Madsen, Henrik; Jørgensen, Sten Bay
2003-01-01
A systematic approach for developing phenomena models from experimental data is presented. The approach is based on integrated application of stochastic differential equation (SDE) modelling and multivariate nonparametric regression, and it is shown how these techniques can be used to uncover...... unknown functionality behind various phenomena in first engineering principles models using experimental data. The proposed modelling approach has significant application potential, e.g. for determining unknown reaction kinetics in both chemical and biological processes. To illustrate the performance...... of the approach, a case study is presented, which shows how an appropriate phenomena model for the growth rate of biomass in a fed-batch bioreactor can be inferred from data....
Developing Phenomena Models from Experimental Data
DEFF Research Database (Denmark)
A systematic approach for developing phenomena models from experimental data is presented. The approach is based on integrated application of stochastic differential equation (SDE) modelling and multivariate nonparametric regression, and it is shown how these techniques can be used to uncover...... unknown functionality behind various phenomena in first engineering principles models using experimental data. The proposed modelling approach has significant application potential, e.g. for determining unknown reaction kinetics in both chemical and biological processes. To illustrate the performance...... of the approach, a case study is presented, which shows how an appropriate phenomena model for the growth rate of biomass in a fed-batch bioreactor can be inferred from data....
The Waterfall Model in Large-Scale Development
Petersen, Kai; Wohlin, Claes; Baca, Dejan
Waterfall development is still a widely used way of working in software development companies. Many problems have been reported related to the model. Commonly accepted problems are for example to cope with change and that defects all too often are detected too late in the software development process. However, many of the problems mentioned in literature are based on beliefs and experiences, and not on empirical evidence. To address this research gap, we compare the problems in literature with the results of a case study at Ericsson AB in Sweden, investigating issues in the waterfall model. The case study aims at validating or contradicting the beliefs of what the problems are in waterfall development through empirical research.
Construction of UML class diagram with Model-Driven Development
Directory of Open Access Journals (Sweden)
Tomasz Górski
2016-03-01
Full Text Available Model transformations play a key role in software development projects based on Model--Driven Development (MDD principles. Transformations allow for automation of repetitive and well-defined steps, thus shortening design time and reducing a number of errors. In the object-oriented approach, the key elements are use cases. They are described, modelled and later designed until executable application code is obtained. The aim of the paper is to present transformation of a model-to-model type, Communication-2-Class, which automates construction of Unified Modelling Language (UML class diagram in the context of the analysis/design model. An UML class diagram is created based on UML communication diagram within use case realization. As a result, a class diagram shows all of the classes involved in the use case realization and the relationships among them. The plug-in which implements Communication-2-Class transformation was implemented in the IBM Rational Software Architect. The article presents the tests results of developed plug-in, which realizes Communication-2-Class transformation, showing capabilities of shortening use case realization’s design time.[b]Keywords[/b]: Model-Driven Development, transformations, Unified Modelling Language, analysis/design model, UML class diagram, UML communication diagram
International Nuclear Information System (INIS)
Oshita, Kazuyuki; Fujime, Motochika; Takaoka, Masaki; Fujimori, Takashi; Appels, Lise; Dewil, Raf
2015-01-01
Highlights: • Siloxanes hamper the energy-use of anaerobic digestion biogas. • D5 siloxane was considered as target compound in this study. • The treatment removed 80% of D5 in sewage sludge at 55 °C and 135 g-NaOH kg −1 -VTS. • D5 removal and the disintegration of VSS in the sludge were correlated. • At the optimal conditions, the costs of anaerobic digestion were notably diminished. - Abstract: A thermo-alkaline treatment with air stripping was applied before anaerobic sludge digestion for both siloxane removal and sludge disintegration. The treatment was expected to increase the amount of biogas produced and to reduce the amount of siloxane in the gas. Adding sodium hydroxide (NaOH) to the sludge improved the removal of siloxane from the sludge, with approximately 90% of the siloxane removed to the gas phase using a thermo-alkaline treatment. Over 80% of decamethylcyclopentasiloxane (D5) could be removed under the following conditions: 55 °C treatment temperature, 135 g-NaOH kg −1 volatile total solids (VTS), and 0.5 L min −1 air-stripping rate. The disintegration ratio of volatile suspended solids (VSS) in the sludge was correlated with the D5 removal ratio. Because most of the siloxane was adsorbed to, or was contained in the VSS, the siloxane removal ratio increased with VSS disintegration. Finally, the energy consumption and operational costs of this system were evaluated for several scenarios. Thermo-alkaline treatment at the indicated operational conditions had the lowest operating costs for a 400 m 3 day −1 anaerobic sludge digestion system
Kolla, Nathan J; Dunlop, Katharine; Downar, Jonathan; Links, Paul; Bagby, R Michael; Wilson, Alan A; Houle, Sylvain; Rasquinha, Fawn; Simpson, Alexander I; Meyer, Jeffrey H
2016-04-01
Impulsivity is a core feature of antisocial personality disorder (ASPD) associated with abnormal brain function and neurochemical alterations. The ventral striatum (VS) is a key region of the neural circuitry mediating impulsive behavior, and low monoamine oxidase-A (MAO-A) level in the VS has shown a specific relationship to the impulsivity of ASPD. Because it is currently unknown whether phenotypic MAO-A markers can influence brain function in ASPD, we investigated VS MAO-A level and the functional connectivity (FC) of two seed regions, superior and inferior VS (VSs, VSi). Nineteen impulsive ASPD males underwent [(11)C] harmine positron emission tomography scanning to measure VS MAO-A VT, an index of MAO-A density, and resting-state functional magnetic resonance imaging that assessed the FC of bilateral seed regions in the VSi and VSs. Subjects also completed self-report impulsivity measures. Results revealed functional coupling of the VSs with bilateral dorsomedial prefrontal cortex (DMPFC) that was correlated with VS MAO-A VT (r=0.47, p=0.04), and functional coupling of the VSi with right hippocampus that was anti-correlated with VS MAO-A VT (r=-0.55, p=0.01). Additionally, VSs-DMPFC FC was negatively correlated with NEO Personality Inventory-Revised impulsivity (r=-0.49, p=0.03), as was VSi-hippocampus FC with Barratt Impulsiveness Scale-11 motor impulsiveness (r=-0.50, p=0.03). These preliminary results highlight an association of VS MAO-A level with the FC of striatal regions linked to impulsive behavior in ASPD and suggest that phenotype-based brain markers of ASPD have relevance to understanding brain function. Copyright © 2016 Elsevier B.V. and ECNP. All rights reserved.
Valley–spin Seebeck effect in heavy group-IV monolayers
International Nuclear Information System (INIS)
Zhai, Xuechao; Wang, Shengdong; Zhang, Yan
2017-01-01
Akin to electron spin, the valley has become another highly valued degree of freedom in modern electronics, specifically after tremendous studies on monolayers of group-IV materials, i.e. graphene, silicene, germanene and stanene. Except for graphene, the other heavy group-IV monolayers have observable intrinsic spin–orbit interactions due to their buckled structures. Distinct from the usual electric or optical control of valley and spin, we here employ a temperature difference to drive electron motion in ferromagnetic heavy group-IV monolayers via designing a caloritronic device locally modulated by an interlayer electric (E z ) field. A unique valley–spin Seebeck (VSS) effect is discovered, with the current contributed only by one (the other) valley and one (the other) spin moving along one (the opposite) direction. This effect is suggested to be detected below the critical temperature about 18 K for silicene, 200 K for germanene and 400 K for stanene, arising from the characteristic valley–spin nondegenerate band structures tuned by the E z field, but cannot be driven in graphene without spin–orbit interaction. Above the critical temperature, the VSS effect is broken by overlarge temperature broadening. Besides the temperature, it is also found that the E z field can drive a transition between the VSS effect and the normal spin Seebeck effect. Further calculations indicate that the VSS effect is robust against many realistic perturbations. Our research represents a conceptually but substantially major step towards the study of the Seebeck effect. These findings provide a platform for encoding information simultaneously by the valley and spin quantum numbers of electrons in future thermal-logic circuits and energy-saving devices. (paper)
Directory of Open Access Journals (Sweden)
Voloshenko K.
2014-09-01
Full Text Available In this article the authors detail the methodology of regional development forecasting with the balance method. They provide with an overview and assessment of the existing models and systems, and their use for the purposes of public administration at the regional level. The article underlines the need to develop a balance approach models for specific territorial conditions. In particular, the authors identify the possibilities of studying the connections between the proportions of material and cash flows within the regional system, and reconciling the needs of a regional economy with the production and resource potentials. The long-term sustainability balance model – a simulation of event-based forecasting – has been developed for the Russian exclave. The authors provide a general description of the balance model, its elements and simulation algorithm. The results of calculations using the balance model for forecasting regional development are provided for three alternative scenarios for the Kaliningrad region for the period until 2018.
Accident sequence precursor analysis level 2/3 model development
International Nuclear Information System (INIS)
Lui, C.H.; Galyean, W.J.; Brownson, D.A.
1997-01-01
The US Nuclear Regulatory Commission's Accident Sequence Precursor (ASP) program currently uses simple Level 1 models to assess the conditional core damage probability for operational events occurring in commercial nuclear power plants (NPP). Since not all accident sequences leading to core damage will result in the same radiological consequences, it is necessary to develop simple Level 2/3 models that can be used to analyze the response of the NPP containment structure in the context of a core damage accident, estimate the magnitude of the resulting radioactive releases to the environment, and calculate the consequences associated with these releases. The simple Level 2/3 model development work was initiated in 1995, and several prototype models have been completed. Once developed, these simple Level 2/3 models are linked to the simple Level 1 models to provide risk perspectives for operational events. This paper describes the methods implemented for the development of these simple Level 2/3 ASP models, and the linkage process to the existing Level 1 models
Sodium-concrete reaction model development
International Nuclear Information System (INIS)
Nguyen, D.H.; Muhlestein, L.D.; Postma, A.K.
1982-07-01
Major observations have been formulated after reviewing test results for over 100 sodium-concrete reaction tests. The observations form the basis for developing a mechanistic model to predict the transient behavior of sodium-concrete reactions. The major observations are listed. Mechanisms associated with sodium and water transport to the reaction zone are identified, and represented by appropriate mathematical expressions. The model attempts to explain large-scale, long-term (100 h) test results were sodium-concrete reactions terminated even in the presence of unreacted sodium and concrete
Development of irradiated UO2 thermal conductivity model
International Nuclear Information System (INIS)
Lee, Chan Bock; Bang Je-Geon; Kim Dae Ho; Jung Youn Ho
2001-01-01
Thermal conductivity model of the irradiated UO 2 pellet was developed, based upon the thermal diffusivity data of the irradiated UO 2 pellet measured during thermal cycling. The model predicts the thermal conductivity by multiplying such separate correction factors as solid fission products, gaseous fission products, radiation damage and porosity. The developed model was validated by comparison with the variation of the measured thermal diffusivity data during thermal cycling and prediction of other UO 2 thermal conductivity models. Since the developed model considers the effect of gaseous fission products as a separate factor, it can predict variation of thermal conductivity in the rim region of high burnup UO 2 pellet where the fission gases in the matrix are precipitated into bubbles, indicating that decrease of thermal conductivity by bubble precipitation in rim region would be significantly compensated by the enhancing effect of fission gas depletion in the UO 2 matrix. (author)
MODELING SUSTAINABLE DEVELOPMENT OF THE ARCTIC REGION OF RUSSIA
Directory of Open Access Journals (Sweden)
K. N. Kikkas
2015-01-01
Full Text Available The article describes a model of six econometric equations, designed for the analysis of the sustainability of development in the Arctic region of the Russian Federation - Chukotka Autonomous Okrug. The article analyzes the spheres of human activity in the Chukchi Autonomous District: social, industrial, natural resources. Each sphere is estimated indicators. The theoretical views of various researchers on sustainable development and defi nes the concept of sustainable development of the spheres of human activity in the Arctic region. Under the sustainable development of the Arctic region of space refers to such changes in the indices of spheres of human activity in the region, which increase the potential for human development. The numerical value of the potential of human development is estimated Human Development Index. The article describes the methodological principles of constructing a model of six equations econometric analysis of the sustainable development of the Arctic region. Each of the six equations presented in the form of ADL-model, because it allows us to estimate the dependence of ADL values of the spheres of human activity in the region from the current and past values of the series of other indicators. Selected endogenous and exogenous variables for the model. We discuss the algorithm for fi nding the model parameters. On the basis of the Chukotka Autonomous Okrug are six coeffi cients of econometric equations. The analysis of the results of the decision model. Methodological principles and results of the decision model can be used to develop strategies for sustainable development of the municipality, a separate Arctic, or a combination of all the Arctic regions of Russia.
Pereira, M A; Sousa, D Z; Mota, M; Alves, M M
2004-11-20
Long-chain fatty acids (LCFA) associated with anaerobic sludge by mechanisms of precipitation, adsorption, or entrapment can be biodegraded to methane. The mineralization kinetics of biomass-associated LCFA were established according to an inhibition model based on Haldane's enzymatic inhibition kinetics. A value around 1,000 mg COD-LCFA..g VSS(-1) was obtained for the optimal specific LCFA content that allowed the maximal mineralization rate. For sludge with specific LCFA contents of 2,838 +/- 63 and 4,571 +/- 257 mg COD-LCFA..g VSS(-1), the specific methanogenic activities in the presence of acetate, butyrate, and H(2)/CO(2) were significantly enhanced after the mineralization of the biomass-associated LCFA. For sludge with a specific LCFA content near the optimal value defined by the kinetic model, the effect of adding VFA to the medium was studied during the mineralization of the biomass-associated LCFA. Different patterns were obtained for each individual substrate. Acetate and butyrate were preferentially consumed by the consortium, but in the case of propionate no evidence of a sequential consumption pattern could be withdrawn. It was concluded that LCFA do not exert a bactericidal neither a permanent toxic effect toward the anaerobic consortia. A discussion is addressed to the relative roles of a reversible inhibitory effect and a transport limitation effect imposed by the LCFA surrounding the cells. (c) 2004 Wiley Periodicals, Inc
Development Model for Research Infrastructures
Wächter, Joachim; Hammitzsch, Martin; Kerschke, Dorit; Lauterjung, Jörn
2015-04-01
. The maturity of individual scientific domains differs considerably. • Technologically and organisationally many different RI components have to be integrated. Individual systems are often complex and have a long-term history. Existing approaches are on different maturity levels, e.g. in relation to the standardisation of interfaces. • The concrete implementation process consists of independent and often parallel development activities. In many cases no detailed architectural blue-print for the envisioned system exists. • Most of the funding currently available for RI implementation is provided on a project basis. To increase the synergies in infrastructure development the authors propose a specific RI Maturity Model (RIMM) that is specifically qualified for open system-of-system environments. RIMM is based on the concepts of Capability Maturity Models for organisational development, concretely the Levels of Conceptual Interoperability Model (LCIM) specifying the technical, syntactical, semantic, pragmatic, dynamic, and conceptual layers of interoperation [1]. The model is complemented by the identification and integration of growth factors (according to the Nolan Stages Theory [2]). These factors include supply and demand factors. Supply factors comprise available resources, e.g., data, services and IT-management capabilities including organisations and IT-personal. Demand factors are the overall application portfolio for RIs but also the skills and requirements of scientists and communities using the infrastructure. RIMM thus enables a balanced development process of RI and RI components by evaluating the status of the supply and demand factors in relation to specific levels of interoperability. [1] Tolk, A., Diallo, A., Turnitsa, C. (2007): Applying the Levels of Conceptual Interoperability Model in Support of Integratability, Interoperability, and Composability for System-of-Systems Engineering. Systemics, Cybernetics and Informatics, Volume 5 - Number 5. [2
Model based development of engine control algorithms
Dekker, H.J.; Sturm, W.L.
1996-01-01
Model based development of engine control systems has several advantages. The development time and costs are strongly reduced because much of the development and optimization work is carried out by simulating both engine and control system. After optimizing the control algorithm it can be executed
International Nuclear Information System (INIS)
Zhang Jing; Yang Wenduo
2005-01-01
Objective: To evaluate the effect of intra-arterial infusion of basic fibroblast growth factor (bFGF) on improving neovascularization, vascular perfusion and the function of partially ischemic limbs of rabbits. Methods: Twenty-seven New Zealand male rabbits were selected. Partial ischemia model was induced by surgical ligation of the primary branches of right femoral artery in each animal, and the left hind limb of each animal was served as a nonischemic control. Then, 27 rabbits were randomly assigned to three groups: intra-arterial (IA) infusion of bFGF (n=9), intravenous (IV) infusion of bFGF and IA infusion of saline (n=9). Infusion was separately performed immediately after vascular ligation, 8th and 15th days post-surgery with 10 μg (4 ml) of bFGF per-time (or the same volume of saline). The differences between three groups and between ischemic and nonischemic limbs of the same group were compared and evaluated by the following indexes: (1) vessel section count (VSC), vessel section surface area (VSS) and vessel section perimeter (VSP) in the field of ischemic muscle tissues taken at 22nd day postoperatively; (2) capillary refilling time of ischemic limbs; and (3) functional and trophic changes of ischemic limbs. Statistical differences were evaluated by one-way ANOVA and T test. Results: VSC, VSS and VSP of the IA-bFGF group were significantly increased than those of the IV-bFGF and IA-saline groups (P<0.01). At 22nd day postoperatively, the capillary refilling time, new hair growth, the appearance and function of all ischemic limbs in IA-bFGF group were approximately normal. However, in IA-saline group, the ischemic changes, capillary refilling time and the function of ischemic limbs were not improved significantly. All the indexes of IV-bFGF group showed no difference statistically from those of IA-saline group. Conclusions: This experimental study identifies that intra-arterial infusion of bFGF may significantly promote neovascularization and vascular
3D physical modeling for patterning process development
Sarma, Chandra; Abdo, Amr; Bailey, Todd; Conley, Will; Dunn, Derren; Marokkey, Sajan; Talbi, Mohamed
2010-03-01
In this paper we will demonstrate how a 3D physical patterning model can act as a forensic tool for OPC and ground-rule development. We discuss examples where the 2D modeling shows no issues in printing gate lines but 3D modeling shows severe resist loss in the middle. In absence of corrective measure, there is a high likelihood of line discontinuity post etch. Such early insight into process limitations of prospective ground rules can be invaluable for early technology development. We will also demonstrate how the root cause of broken poly-line after etch could be traced to resist necking in the region of STI step with the help of 3D models. We discuss different cases of metal and contact layouts where 3D modeling gives an early insight in to technology limitations. In addition such a 3D physical model could be used for early resist evaluation and selection for required ground-rule challenges, which can substantially reduce the cycle time for process development.
Infrastructure development assistance modeling for nuclear power plant
International Nuclear Information System (INIS)
Park, J. H.; Hwang, K.; Park, K. M.; Kim, S. W.; Lee, S. M.
2012-01-01
The purpose of this paper is to develop a model, a general frame to be utilized in assisting newcomer countries to start a nuclear power program. A nuclear power plant project involves technical complexity and high level of investment with long duration. Considering newcomers are mostly developing countries that lack the national infrastructure, key infrastructure issues may constitute the principal constraints to the development of a nuclear power program. In this regard, it is important to provide guidance and support to set up an appropriate infrastructure when we help them with the first launch of nuclear power plant project. To date, as a sole nuclear power generation company, KHNP has been invited many times to mentor or assist newcomer countries for their successful start of a nuclear power program since Republic of Korea is an exemplary case of a developing country which began nuclear power program from scratch and became a major world nuclear energy country in a short period of time. Through hosting events organized to aid newcomer countries' initiation of nuclear power projects, difficulties have been recognized. Each event had different contents according to circumstances because they were held as an unstructured and one-off thing. By developing a general model, we can give more adequate and effective aid in an efficient way. In this paper, we created a model to identify necessary infrastructures at the right stage, which was mainly based on a case of Korea. Taking into account the assistance we received from foreign companies and our own efforts for technological self-reliance, we have developed a general time table and specified activities required to do at each stage. From a donor's perspective, we explored various ways to help nuclear infrastructure development including technical support programs, training courses, and participating in IAEA technical cooperation programs on a regular basis. If we further develop the model, the next task would be to
Infrastructure development assistance modeling for nuclear power plant
Energy Technology Data Exchange (ETDEWEB)
Park, J. H.; Hwang, K.; Park, K. M.; Kim, S. W.; Lee, S. M. [Korea Hydro and Nuclear Power Co., LTD, 23, 106 gil, Yeongdong-daero, Gangnam-gu, 153-791 (Korea, Republic of)
2012-07-01
The purpose of this paper is to develop a model, a general frame to be utilized in assisting newcomer countries to start a nuclear power program. A nuclear power plant project involves technical complexity and high level of investment with long duration. Considering newcomers are mostly developing countries that lack the national infrastructure, key infrastructure issues may constitute the principal constraints to the development of a nuclear power program. In this regard, it is important to provide guidance and support to set up an appropriate infrastructure when we help them with the first launch of nuclear power plant project. To date, as a sole nuclear power generation company, KHNP has been invited many times to mentor or assist newcomer countries for their successful start of a nuclear power program since Republic of Korea is an exemplary case of a developing country which began nuclear power program from scratch and became a major world nuclear energy country in a short period of time. Through hosting events organized to aid newcomer countries' initiation of nuclear power projects, difficulties have been recognized. Each event had different contents according to circumstances because they were held as an unstructured and one-off thing. By developing a general model, we can give more adequate and effective aid in an efficient way. In this paper, we created a model to identify necessary infrastructures at the right stage, which was mainly based on a case of Korea. Taking into account the assistance we received from foreign companies and our own efforts for technological self-reliance, we have developed a general time table and specified activities required to do at each stage. From a donor's perspective, we explored various ways to help nuclear infrastructure development including technical support programs, training courses, and participating in IAEA technical cooperation programs on a regular basis. If we further develop the model, the next task
Scripting MODFLOW model development using Python and FloPy
Bakker, Mark; Post, Vincent E. A.; Langevin, Christian D.; Hughes, Joseph D.; White, Jeremy; Starn, Jeffrey; Fienen, Michael N.
2016-01-01
Graphical user interfaces (GUIs) are commonly used to construct and postprocess numerical groundwater flow and transport models. Scripting model development with the programming language Python is presented here as an alternative approach. One advantage of Python is that there are many packages available to facilitate the model development process, including packages for plotting, array manipulation, optimization, and data analysis. For MODFLOW-based models, the FloPy package was developed by the authors to construct model input files, run the model, and read and plot simulation results. Use of Python with the available scientific packages and FloPy facilitates data exploration, alternative model evaluations, and model analyses that can be difficult to perform with GUIs. Furthermore, Python scripts are a complete, transparent, and repeatable record of the modeling process. The approach is introduced with a simple FloPy example to create and postprocess a MODFLOW model. A more complicated capture-fraction analysis with a real-world model is presented to demonstrate the types of analyses that can be performed using Python and FloPy.
GRA/RIAM model development at Darlington Nuclear
International Nuclear Information System (INIS)
Plourde, J.; Parmar, R.
2006-01-01
In 2004, the Darlington Nuclear (DN) Plant of Ontario Power Generation (OPG) undertook a project, in partnership with Nuclear Safety Solutions (NSS) Limited, to develop Risk-Informed Asset Management (RIAM) and Generation Risk Assessment (GRA) models. The models are intended to optimize plant decision-making. The objective of this paper is to present the scope of the project, the methodology employed, the results and the potential applications. DN has recognized the strategic importance of RIAM in the plant decision-making process and has begun its implementation. The required work was split into three phases. Phase 1 involved industry benchmarking, along with collection and review of the industry literature such as EPRI publications and other relevant papers. Based on the review, a description of the requirements to produce a prototype RIAM model was developed. Phase 2 consisted of the development of prototype RIAM and GRA models. Phase 3, currently underway, consists of the work required to translate the prototype models into an operational decision-making tool. RIAM and GRA are relatively new concepts hence the related methodology and the tools are still evolving. NSS has tailored the available methodology to suit the needs of the DN plant. Draft EPRI guides on GRA/RIAM were used in developing DN specific methodology. The details are provided in the paper. At DN, RIAM is expected to support business decisions by facilitating the assessment of risks associated with projects, programs and business case alternatives. These applications are further discussed in the paper. (author)
Towards Product Lining Model-Driven Development Code Generators
Roth, Alexander; Rumpe, Bernhard
2015-01-01
A code generator systematically transforms compact models to detailed code. Today, code generation is regarded as an integral part of model-driven development (MDD). Despite its relevance, the development of code generators is an inherently complex task and common methodologies and architectures are lacking. Additionally, reuse and extension of existing code generators only exist on individual parts. A systematic development and reuse based on a code generator product line is still in its inf...
Recent developments in multiperipheral models
International Nuclear Information System (INIS)
De Tar, C.
1977-01-01
Experiments do not provide all detailed information required in order to select among possible formulations of the multiperipheral model the correct one (''uniqueness problem''). There are at least three directions which lead away from the uniqueness problem. The first is simplified models with only enough complexity so as to satisfy the data approximately. The second involves invoking theoretical constraints which limit the theoretical flexibility of the model. The third and ultimate solution may be provided by the quark-gluon models or string models. The recent interest in the role of clusters in multiple production is a good illustration of the phenomenological problems facing multiperipheral models. The existence of clusters is certainly agreed upon, but for determination of their size directly from rapidity distributions the result so far depends on what one assumes about how they are produced. Theoretical work toward a unified picture of strong interactions has also led to some novel developments in multiperipheral models and the Regge pole theory. It is a problem now to choose between the more traditional picture of two vacuum singularities or the more novel approach which makes an effort to deal not merely with four-body amplitudes but in a more profound way, with multiple production processes which are related to them through unitarity
Overview of the FEP analysis approach to model development
International Nuclear Information System (INIS)
Bailey, L.
1998-01-01
This report heads a suite of documents describing the Nirex model development programme. The programme is designed to provide a clear audit trail from the identification of significant features, events and processes (FEPs) to the models and modelling processes employed within a detailed safety assessment. A five stage approach has been adopted, which provides a systematic framework for addressing uncertainty and for the documentation of all modelling decisions and assumptions. The five stages are as follows: Stage 1: EP Analysis - compilation and structuring of a FEP database; Stage 2: Scenario and Conceptual Model Development; Stage 3: Mathematical Model Development; Stage 4: Software Development; Stage 5: confidence Building. This report describes the development and structuring of a FEP database as a Master Directed Diagram (MDD) and explains how this may be used to identify different modelling scenarios, based upon the identification of scenario -defining FEPs. The methodology describes how the possible evolution of a repository system can be addressed in terms of a base scenario, a broad and reasonable representation of the 'natural' evolution of the system, and a number of variant scenarios, representing the effects of probabilistic events and processes. The MDD has been used to identify conceptual models to represent the base scenario and the interactions between these conceptual models have been systematically reviewed using a matrix diagram technique. This has led to the identification of modelling requirements for the base scenario, against which existing assessment software capabilities have been reviewed. A mechanism for combining probabilistic scenario-defining FEPs to construct multi-FEP variant scenarios has been proposed and trialled using the concept of a 'timeline', a defined sequence of events, from which consequences can be assessed. An iterative approach, based on conservative modelling principles, has been proposed for the evaluation of
Ongoing Model Development Analyzing Glass Fracture
DEFF Research Database (Denmark)
Molnar, G.; Bojtar, I.; Nielsen, Jens Henrik
2013-01-01
Present subject deals with an ongoing experimental and numerical analysis of inplane loaded glass plates. The main goal of the investigation is to develop a hybrid – discrete and finite element – model which could follow the fracture process in annealed and in tempered glass. Measurements of the ...... an overview of the structure of the research and a summary of current status archived so far.......Present subject deals with an ongoing experimental and numerical analysis of inplane loaded glass plates. The main goal of the investigation is to develop a hybrid – discrete and finite element – model which could follow the fracture process in annealed and in tempered glass. Measurements...... of the residual stress state before failure and high-speed camera recordings of the failure are being performed in order to verify the numerical model. The primary goal of this research is to follow the overall fracture of a structural element – e.g. beam – loaded inplane. Present paper would like to give...
Power-based electric vehicle energy consumption model: Model development and validation
International Nuclear Information System (INIS)
Fiori, Chiara; Ahn, Kyoungho; Rakha, Hesham A.
2016-01-01
Highlights: • The study developed an instantaneous energy consumption model (VT-CPEM) for EVs. • The model captures instantaneous braking energy regeneration. • The model can be used for transportation modeling and vehicle applications (e.g. eco-routing). • The proposed model can be easily calibrated using publically available EV data. • Usages of air conditioning and heating systems reduce EV energy consumption by up to 10% and 24%, respectively. - Abstract: The limited drive range (The maximum distance that an EV can travel.) of Electric Vehicles (EVs) is one of the major challenges that EV manufacturers are attempting to overcome. To this end, a simple, accurate, and efficient energy consumption model is needed to develop real-time eco-driving and eco-routing systems that can enhance the energy efficiency of EVs and thus extend their travel range. Although numerous publications have focused on the modeling of EV energy consumption levels, these studies are limited to measuring energy consumption of an EV’s control algorithm, macro-project evaluations, or simplified well-to-wheels analyses. Consequently, this paper addresses this need by developing a simple EV energy model that computes an EV’s instantaneous energy consumption using second-by-second vehicle speed, acceleration and roadway grade data as input variables. In doing so, the model estimates the instantaneous braking energy regeneration. The proposed model can be easily implemented in the following applications: in-vehicle, Smartphone eco-driving, eco-routing and transportation simulation software to quantify the network-wide energy consumption levels for a fleet of EVs. One of the main advantages of EVs is their ability to recover energy while braking using a regenerative braking system. State-of-the-art vehicle energy consumption models consider an average constant regenerative braking energy efficiency or regenerative braking factors that are mainly dependent on the vehicle’s average
MODEL DRIVEN DEVELOPMENT OF ONLINE BANKING SYSTEMS
Directory of Open Access Journals (Sweden)
Bresfelean Vasile Paul
2011-07-01
Full Text Available In case of online applications the cycle of software development varies from the routine. The online environment, the variety of users, the treatability of the mass of information created by them, the reusability and the accessibility from different devices are all factors of these systems complexity. The use of model drive approach brings several advantages that ease up the development process. Working prototypes that simplify client relationship and serve as the base of model tests can be easily made from models describing the system. These systems make possible for the banks clients to make their desired actions from anywhere. The user has the possibility of accessing information or making transactions.
Clinical Predictive Modeling Development and Deployment through FHIR Web Services.
Khalilia, Mohammed; Choi, Myung; Henderson, Amelia; Iyengar, Sneha; Braunstein, Mark; Sun, Jimeng
2015-01-01
Clinical predictive modeling involves two challenging tasks: model development and model deployment. In this paper we demonstrate a software architecture for developing and deploying clinical predictive models using web services via the Health Level 7 (HL7) Fast Healthcare Interoperability Resources (FHIR) standard. The services enable model development using electronic health records (EHRs) stored in OMOP CDM databases and model deployment for scoring individual patients through FHIR resources. The MIMIC2 ICU dataset and a synthetic outpatient dataset were transformed into OMOP CDM databases for predictive model development. The resulting predictive models are deployed as FHIR resources, which receive requests of patient information, perform prediction against the deployed predictive model and respond with prediction scores. To assess the practicality of this approach we evaluated the response and prediction time of the FHIR modeling web services. We found the system to be reasonably fast with one second total response time per patient prediction.
Energy Technology Data Exchange (ETDEWEB)
Sumida, S [U-shin Ltd., Tokyo (Japan); Nagamatsu, M; Maruyama, K [Hokkaido Institute of Technology, Sapporo (Japan); Hiramatsu, S [Mazda Motor Corp., Hiroshima (Japan)
1997-10-01
A new approach on modeling is put forward in order to compose the virtual prototype which is indispensable for fully computer integrated concurrent development of automobile product. A basic concept of the hierarchical functional model is proposed as the concrete form of this new modeling technology. This model is used mainly for explaining and simulating functions and efficiencies of both the parts and the total product of automobile. All engineers who engage themselves in design and development of automobile can collaborate with one another using this model. Some application examples are shown, and usefulness of this model is demonstrated. 5 refs., 5 figs.
Developments in Coastal Ocean Modeling
Allen, J. S.
2001-12-01
Capabilities in modeling continental shelf flow fields have improved markedly in the last several years. Progress is being made toward the long term scientific goal of utilizing numerical circulation models to interpolate, or extrapolate, necessarily limited field measurements to provide additional full-field information describing the behavior of, and providing dynamical rationalizations for, complex observed coastal flow. The improvement in modeling capabilities has been due to several factors including an increase in computer power and, importantly, an increase in experience of modelers in formulating relevant numerical experiments and in analyzing model results. We demonstrate present modeling capabilities and limitations by discussion of results from recent studies of shelf circulation off Oregon and northern California (joint work with Newberger, Gan, Oke, Pullen, and Wijesekera). Strong interactions between wind-forced coastal currents and continental shelf topography characterize the flow regimes in these cases. Favorable comparisons of model and measured alongshore currents and other variables provide confidence in the model-produced fields. The dependence of the mesoscale circulation, including upwelling and downwelling fronts and flow instabilities, on the submodel used to parameterize the effects of small scale turbulence, is discussed. Analyses of model results to provide explanations for the observed, but previously unexplained, alongshore variability in the intensity of coastal upwelling, which typically results in colder surface water south of capes, and the observed development in some locations of northward currents near the coast in response to the relaxation of southward winds, are presented.
Pham, Thi Tham
2002-11-01
A central composite design was employed to methodically investigate anaerobic treatment of aircraft deicing fluid (ADF) in bench-scale Upflow Anaerobic Sludge Blanket (UASB) reactors. A total of 23 runs at 17 different operating conditions were conducted in continuous mode. The development of four empirical models describing process responses (i.e., chemical oxygen demand (COD) removal efficiency, biomass specific acetoclastic activity, methane production rate, and methane production potential) as functions of ADF concentration, hydraulic retention time (HRT), and biomass concentration is presented. Model verification indicated that predicted responses (COD removal efficiencies, biomass specific acetoclastic activity, and methane production rates and potential) were in good agreement with experimental results. Biomass specific acetoclastic activity was improved by almost two-fold during ADF treatment in UASB reactors. For the design window, COD removal efficiencies were higher than 90%. Predicted methane production potentials were close to theoretical values, and methane production rates increased as the organic loading rate (OLR) was increased. ADF toxicity effects were evident for 1.6% ADF at medium specific organic loadings (SOLR above 0.5 g COD/g VSS/d). In contrast, good reactor stability and excellent removal efficiencies were achieved at 1.2% ADF for reactor loadings approaching that of highly loaded systems (0.73 g COD/g VSS/d). Acclimation to ADF resulted in an initial reduction in the biomass settling velocity. The fate of ADF additives was also investigated. There was minimal sorption of benzotriazole (BT), 5-methyl-1 H-benzotriazole (MeBT), and 5,6-dimethyl-1 H-benzotriazole (DiMeBT) to anaerobic granules. A higher sorption capacity was measured for NP. Active transport may be one of the mechanisms for NP sorption. Ethylene glycol degradation experiments indicated that BT, MeBT, DiMeBT, and the nonionic surfactant Tergitol NP-4 had no significant
Skills development programme: The UNISA/CSIR model
CSIR Research Space (South Africa)
Sparrow, RW
2010-09-01
Full Text Available development programmes and industry. A key component will be the use of Information Learning Technology. The skills development programmes are vocational and centred on research and industrial requirements. This programme is modelled on vocational...
The Development of Hierarchy of Effects Model in Advertising
Directory of Open Access Journals (Sweden)
Bambang Sukma Wijaya
2012-04-01
Full Text Available This paper aims to review the hierarchy of effects models in adverti-sing, especially the well-known model, AIDA (Attention, Interest, De-sire, and Action. Since its introduction by Lewis (1900 and generally attributed in the marketing and advertising literature by Strong (1925, the concept of AIDA’s hierarchy of effects model has been used by many researchers, both academicians and practitioners. The model is used to measure the effect of an advertisement. However, the deve-lopment of information technology has radically changed the way of how people communicate and socialize; as well as a paradigm shift from product-oriented marketing to consumer-oriented marketing or people-oriented marketing. Therefore, the variables in the hierarchy of effects model needs to be updated in respond to the latest develop-ments in the notice of public power as consumer audience. Based on deep literature review and reflective method, this paper introduces a new developed concept of hierarchy of effects model that was adop-ted from AIDA’s hierarchy of effects model, namely: AISDALSLove (At-tention, Interest, Search, Desire, Action, Like/dislike, Share, and Love/hate.
Development of a working Hovercraft model
Noor, S. H. Mohamed; Syam, K.; Jaafar, A. A.; Mohamad Sharif, M. F.; Ghazali, M. R.; Ibrahim, W. I.; Atan, M. F.
2016-02-01
This paper presents the development process to fabricate a working hovercraft model. The purpose of this study is to design and investigate of a fully functional hovercraft, based on the studies that had been done. The different designs of hovercraft model had been made and tested but only one of the models is presented in this paper. In this thesis, the weight, the thrust, the lift and the drag force of the model had been measured and the electrical and mechanical parts are also presented. The processing unit of this model is Arduino Uno by using the PSP2 (Playstation 2) as the controller. Since our prototype should be functioning on all kind of earth surface, our model also had been tested in different floor condition. They include water, grass, cement and tile. The Speed of the model is measured in every case as the respond variable, Current (I) as the manipulated variable and Voltage (V) as the constant variable.
Advanced Small Modular Reactor Economics Model Development
Energy Technology Data Exchange (ETDEWEB)
Harrison, Thomas J [ORNL
2014-10-01
The US Department of Energy Office of Nuclear Energy’s Advanced Small Modular Reactor (SMR) research and development activities focus on four key areas: Developing assessment methods for evaluating advanced SMR technologies and characteristics; and Developing and testing of materials, fuels and fabrication techniques; and Resolving key regulatory issues identified by US Nuclear Regulatory Commission and industry; and Developing advanced instrumentation and controls and human-machine interfaces. This report focuses on development of assessment methods to evaluate advanced SMR technologies and characteristics. Specifically, this report describes the expansion and application of the economic modeling effort at Oak Ridge National Laboratory. Analysis of the current modeling methods shows that one of the primary concerns for the modeling effort is the handling of uncertainty in cost estimates. Monte Carlo–based methods are commonly used to handle uncertainty, especially when implemented by a stand-alone script within a program such as Python or MATLAB. However, a script-based model requires each potential user to have access to a compiler and an executable capable of handling the script. Making the model accessible to multiple independent analysts is best accomplished by implementing the model in a common computing tool such as Microsoft Excel. Excel is readily available and accessible to most system analysts, but it is not designed for straightforward implementation of a Monte Carlo–based method. Using a Monte Carlo algorithm requires in-spreadsheet scripting and statistical analyses or the use of add-ons such as Crystal Ball. An alternative method uses propagation of error calculations in the existing Excel-based system to estimate system cost uncertainty. This method has the advantage of using Microsoft Excel as is, but it requires the use of simplifying assumptions. These assumptions do not necessarily bring into question the analytical results. In fact, the
Innovative model of development of traditionally industrial territories
Directory of Open Access Journals (Sweden)
Olga Anatolyevna Kozlova
2012-09-01
Full Text Available The consideration in this paper is given to innovative model of development of traditionally industrial territories. We emphasize the following basic approaches to the employment of innovative potential of territories: diversification and restructuring of local economy, integration and disintegration of life-sustaining activity of neighboring territories, progressive economic advance, as well as simultaneous combination of several approaches (mixed model. Progressive model of development is sufficiently popular and is related tothe increasing already existing potential of territories. In practice,it doesn’t generally suppose essential changes in sectoral structure of local economy and means developing existing productions and spheres of activity of territory. Mixed model of structural transformations is characterized through the fact, that it supposes simultaneous use of different elements from the models counted. It allows: firstly, to adopt in a bigger extent a complex of measures to conditions of certain territory; secondly, to take into account a broader range of exogenous and endogenous factors; thirdly, to raise the effectiveness of the program of structural transformations being realized
Model of the Product Development Lifecycle.
Energy Technology Data Exchange (ETDEWEB)
He, Sunny L. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Roe, Natalie H. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Wood, Evan [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Nachtigal, Noel M. [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Helms, Jovana [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)
2015-10-01
While the increased use of Commercial Off-The-Shelf information technology equipment has presented opportunities for improved cost effectiveness and flexibility, the corresponding loss of control over the product's development creates unique vulnerabilities and security concerns. Of particular interest is the possibility of a supply chain attack. A comprehensive model for the lifecycle of hardware and software products is proposed based on a survey of existing literature from academic, government, and industry sources. Seven major lifecycle stages are identified and defined: (1) Requirements, (2) Design, (3) Manufacturing for hardware and Development for software, (4) Testing, (5) Distribution, (6) Use and Maintenance, and (7) Disposal. The model is then applied to examine the risk of attacks at various stages of the lifecycle.
Development of Spherical Near Field Model for Geological Radioactive Waste Repository
International Nuclear Information System (INIS)
Kim, S. Y.; Lee, K. J.; Chang, S. H.; Lee, K. J.; Chang, S. H.
2012-01-01
Modeling for geological radioactive waste repository can be divided into 3 parts. They are near field modeling related to engineered barrier, far field modeling related to natural barrier and biosphere modeling. In order to make the general application for safety assessment of geological waste repository, spherical geometry near field model has been developed. This model can be used quite extensively when users calculate equivalent spherical geometry for specific engineered barrier like equivalent waste radius, equivalent barrier radius and etc. Only diffusion was considered for general purpose but advection part can be updated. Goldsim and Goldsim Radionuclide Transport (RT) module were chosen and used as developing tool for the flexible modeling. Developer can freely make their own model with developer friendly graphic interface by using Goldsim. Furthermore, model with user friendly graphic interface can be developed by using Goldsim Dashboard Authoring module. The model has been validated by comparing the result with that of another model, inserting similar inputs and conditions. The model has been proved to be reasonably operating from the comparison result by validation process. Cylindrical model can be developed as a further work based on the knowledge and experience from this research
Development of Spherical Near Field Model for Geological Radioactive Waste Repository
Energy Technology Data Exchange (ETDEWEB)
Kim, S. Y.; Lee, K. J.; Chang, S. H. [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of); Lee, K. J.; Chang, S. H. [Khalifa Univ. of Science/Technology and Research, Abu Dhabi (United Arab Emirates)
2012-03-15
Modeling for geological radioactive waste repository can be divided into 3 parts. They are near field modeling related to engineered barrier, far field modeling related to natural barrier and biosphere modeling. In order to make the general application for safety assessment of geological waste repository, spherical geometry near field model has been developed. This model can be used quite extensively when users calculate equivalent spherical geometry for specific engineered barrier like equivalent waste radius, equivalent barrier radius and etc. Only diffusion was considered for general purpose but advection part can be updated. Goldsim and Goldsim Radionuclide Transport (RT) module were chosen and used as developing tool for the flexible modeling. Developer can freely make their own model with developer friendly graphic interface by using Goldsim. Furthermore, model with user friendly graphic interface can be developed by using Goldsim Dashboard Authoring module. The model has been validated by comparing the result with that of another model, inserting similar inputs and conditions. The model has been proved to be reasonably operating from the comparison result by validation process. Cylindrical model can be developed as a further work based on the knowledge and experience from this research.
Dependability modeling and assessment in UML-based software development.
Bernardi, Simona; Merseguer, José; Petriu, Dorina C
2012-01-01
Assessment of software nonfunctional properties (NFP) is an important problem in software development. In the context of model-driven development, an emerging approach for the analysis of different NFPs consists of the following steps: (a) to extend the software models with annotations describing the NFP of interest; (b) to transform automatically the annotated software model to the formalism chosen for NFP analysis; (c) to analyze the formal model using existing solvers; (d) to assess the software based on the results and give feedback to designers. Such a modeling→analysis→assessment approach can be applied to any software modeling language, be it general purpose or domain specific. In this paper, we focus on UML-based development and on the dependability NFP, which encompasses reliability, availability, safety, integrity, and maintainability. The paper presents the profile used to extend UML with dependability information, the model transformation to generate a DSPN formal model, and the assessment of the system properties based on the DSPN results.
Developing Cognitive Models for Social Simulation from Survey Data
Alt, Jonathan K.; Lieberman, Stephen
The representation of human behavior and cognition continues to challenge the modeling and simulation community. The use of survey and polling instruments to inform belief states, issue stances and action choice models provides a compelling means of developing models and simulations with empirical data. Using these types of data to population social simulations can greatly enhance the feasibility of validation efforts, the reusability of social and behavioral modeling frameworks, and the testable reliability of simulations. We provide a case study demonstrating these effects, document the use of survey data to develop cognitive models, and suggest future paths forward for social and behavioral modeling.
International Nuclear Information System (INIS)
Costa, Kleber Souza Silva; Barbosa, Antonio Konrado de Santana; Vieira, Jose Wilson; Lima, Fernando Roberto de Andrade
2011-01-01
Computational exposure models can be used to estimate human body absorbed dose in a series of situations such as X-Ray exams for diagnosis, accidents and medical treatments. These models are fundamentally composed of an anthropomorphic simulator (phantom), an algorithm that simulates a radioactive source and a Monte Carlo Code. The accuracy of data obtained in the simulation is strongly connected to the adequacy of such simulation to the real situation. The phantoms are one of the key factors for the researcher manipulation. They are generally developed in supine position and its anatomy is patronized by compiled data from international institutions such as ICRP or ICRU. Several pathologies modify the structure of organs and body tissues. In order to measure how significant these alterations are, an anthropomorphic model was developed for this study: patient mastectomies. This model was developed using voxel phantom FASH and then coupled with EGSnrc Monte Carlo code
Wang, Dexin; Ma, Wencheng; Han, Hongjun; Li, Kun; Xu, Hao; Fang, Fang; Hou, Baolin; Jia, Shengyong
2016-12-01
Coupling of the Fe-C micro-electrolysis (IC-ME) into the up-flow anaerobic sludge blanket (UASB) was developed for enhanced Fischer-Tropsch wastewater treatment. The COD removal efficiency and methane production in R 3 with IC-ME assisted both reached up to 80.6 ± 1.7% and 1.38 ± 0.11 L/L·d that higher than those values in R 1 with GAC addition (63.0 ± 3.4% and 0.95 ± 0.09 L/L·d) and R 2 with ZVI addition (74.5 ± 2.8% and 1.21 ± 0.09 L/L·d) under the optimum HRT (5 d). The Fe corrosion as electron donor reduced the ORP values and stimulated the activities of hydrogenotrophic methanogens to lower H 2 partial pressure in R 2 and R 3 . Additionally, Fe 2+ as by-product of iron corrosion, its presence could effectively increase the percentage of protein content in tightly bound extracellular polymeric substances (TB-EPS) to promote better bioflocculation, increasing to 90.5 mg protein/g·VSS (R 2 ) and 106.3 mg protein/g·VSS (R 3 ) while this value in R1 was simply 56.6 mg protein/g·VSS. More importantly, compared with R 1 , the excess accumulation of propionic acid and butyric acid in system was avoided. The macroscopic galvanic cells around Fe-C micro-electrolysis carriers in R 3 , that larger than microscopic galvanic cells in R 2 , further accelerate to transfer the electrons from anodic Fe to cathodic carbon that enhance interspecies hydrogen transfer, making the decomposition of propionic acid and butyric acid more thermodynamically feasible, finally facilitate more methane production. Copyright © 2016 Elsevier Ltd. All rights reserved.
JEDI: Jobs and Economic Development Impact Model
Energy Technology Data Exchange (ETDEWEB)
2017-06-13
The Jobs and Economic Development Impact (JEDI) models are user-friendly tools that estimate the economic impacts of constructing and operating power generation and biofuel plants at the local (usually state) level. First developed by NREL's researchers to model wind energy jobs and impacts, JEDI has been expanded to also estimate the economic impacts of biofuels, coal, conventional hydro, concentrating solar power, geothermal, marine and hydrokinetic power, natural gas, photovoltaics, and transmission lines. This fact sheet focuses on JEDI for wind energy projects and is revised with 2017 figures.
Development of an Instructional Quality Assurance Model in Nursing Science
Ajpru, Haruthai; Pasiphol, Shotiga; Wongwanich, Suwimon
2011-01-01
The purpose of this study was to develop an instructional quality assurance model in nursing science. The study was divided into 3 phases; (1) to study the information for instructional quality assurance model development (2) to develop an instructional quality assurance model in nursing science and (3) to audit and the assessment of the developed…
Effect of increase in salinity on ANAMMOX-UASB reactor stability.
Xing, Hui; Wang, Han; Fang, Fang; Li, Kai; Liu, Lianwei; Chen, Youpeng; Guo, Jinsong
2017-05-01
The effect of salinity on the anaerobic ammonium oxidation (ANAMMOX) process in a UASB reactor was investigated by analysing ammonium, nitrite, nitrate and TN concentrations, and TN removal efficiency. Extracellular polymeric substances (EPSs) and specific ANAMMOX activity (SAA) were evaluated. Results showed the effluent deteriorated after salinity was increased from 8 to 13 g/L and from 13 to 18 g/L, and TN removal efficiency decreased from 80% to 30% and 80% to 50%, respectively. However, ANAMMOX performance recovered and TN removal efficiency increased to 80% after 40 days when the influent concentrations of [Formula: see text] and [Formula: see text] were 200 mg/L and salinity levels were at 13 and 18 g/L, respectively. The amount of EPSs decreased from 58.9 to 37.1 mg/g volatile suspended solids (VSS) when the reactor was shocked by salinity of 13 g/L, and then increased to 57.2 mg/g VSS when the reactor recovered and ran stably at 13 g/L. The amount of EPSs decreased from 57.2 to 49.1 mg/g VSS when the reactor was shocked by salinity of 18 g/L, and then increased to 60.7 mg/g VSS when the reactor recovered and ran stably at 18 g/L. The amount of EPS and the amounts of polysaccharide, protein and humus showed no evident difference when the reactor recovered from different levels of salinity shocks. Batch tests showed salinity shock load from 8 to 38 g/L inhibited the SAA. However, when the reactor recovered from salinity shocks, SAA was higher compared to that when the reactor was subjected to the same level of salinity shock.
International Nuclear Information System (INIS)
Combs, Stephanie E.; Welzel, Thomas; Schulz-Ertner, Daniela; Huber, Peter E.; Debus, Juergen
2010-01-01
Purpose: To evaluate the outcomes of patients with vestibular schwannoma (VS) treated with fractionated stereotactic radiotherapy (FSRT) vs. those treated with stereotactic radiosurgery (SRS). Methods and Materials: This study is based on an analysis of 200 patients with 202 VSs treated with FSRT (n = 172) or SRS (n = 30). Patients with tumor progression and/or progression of clinical symptoms were selected for treatment. In 165 out of 202 VSs (82%), RT was performed as the primary treatment for VS, and for 37 VSs (18%), RT was conducted for tumor progression after neurosurgical intervention. For patients receiving FSRT, a median total dose of 57.6 Gy was prescribed, with a median fractionation of 5 x 1.8 Gy per week. For patients who underwent SRS, a median single dose of 13 Gy was prescribed to the 80% isodose. Results: FSRT and SRS were well tolerated. Median follow-up time was 75 months. Local control was not statistically different for both groups. The probability of maintaining the pretreatment hearing level after SRS with doses of ≤13 Gy was comparable to that of FSRT. The radiation dose for the SRS group (≤13 Gy vs. >13 Gy) significantly influenced hearing preservation rates (p = 0.03). In the group of patients treated with SRS doses of ≤13 Gy, cranial nerve toxicity was comparable to that of the FSRT group. Conclusions: FSRT and SRS are both safe and effective alternatives for the treatment of VS. Local control rates are comparable in both groups. SRS with doses of ≤13 Gy is a safe alternative to FSRT. While FSRT can be applied safely for the treatment of VSs of all sizes, SRS should be reserved for smaller lesions.
Status report on dissolution model development
International Nuclear Information System (INIS)
Jackson, D.D.
1983-07-01
The computer program PROTOCOL models the dissolution reactions of chemical species in water. It is being developed particularly to study the dissolution of proposed nuclear waste forms and related phases. Experimentally derived leaching rate functions are coupled to thermochemical equilibrium calculations and water flow rates. The program has been developed over a period of years. This report describes improvements that have been done in the past year
Prediction of Chemical Function: Model Development and ...
The United States Environmental Protection Agency’s Exposure Forecaster (ExpoCast) project is developing both statistical and mechanism-based computational models for predicting exposures to thousands of chemicals, including those in consumer products. The high-throughput (HT) screening-level exposures developed under ExpoCast can be combined with HT screening (HTS) bioactivity data for the risk-based prioritization of chemicals for further evaluation. The functional role (e.g. solvent, plasticizer, fragrance) that a chemical performs can drive both the types of products in which it is found and the concentration in which it is present and therefore impacting exposure potential. However, critical chemical use information (including functional role) is lacking for the majority of commercial chemicals for which exposure estimates are needed. A suite of machine-learning based models for classifying chemicals in terms of their likely functional roles in products based on structure were developed. This effort required collection, curation, and harmonization of publically-available data sources of chemical functional use information from government and industry bodies. Physicochemical and structure descriptor data were generated for chemicals with function data. Machine-learning classifier models for function were then built in a cross-validated manner from the descriptor/function data using the method of random forests. The models were applied to: 1) predict chemi
Integrating Design Decision Management with Model-based Software Development
DEFF Research Database (Denmark)
Könemann, Patrick
Design decisions are continuously made during the development of software systems and are important artifacts for design documentation. Dedicated decision management systems are often used to capture such design knowledge. Most such systems are, however, separated from the design artifacts...... of the system. In model-based software development, where design models are used to develop a software system, outcomes of many design decisions have big impact on design models. The realization of design decisions is often manual and tedious work on design models. Moreover, keeping design models consistent......, or by ignoring the causes. This substitutes manual reviews to some extent. The concepts, implemented in a tool, have been validated with design patterns, refactorings, and domain level tests that comprise a replay of a real project. This proves the applicability of the solution to realistic examples...
Architecture design in global and model-centric software development
Heijstek, Werner
2012-01-01
This doctoral dissertation describes a series of empirical investigations into representation, dissemination and coordination of software architecture design in the context of global software development. A particular focus is placed on model-centric and model-driven software development.
Development of a Gas Systems Analysis Model (GSAM)
International Nuclear Information System (INIS)
Becker, A.B.; Pepper, W.J.
1995-01-01
Objective of developing this model (GSAM) is to create a comprehensive, nonproprietary, PC-based model of domestic gas industry activity. The system can assess impacts of various changes in the natural gas system in North America; individual and collective impacts due to changes in technology and economic conditions are explicitly modeled in GSAM. Major gas resources are all modeled, including conventional, tight, Devonian Shale, coalbed methane, and low-quality gas sources. The modeling system assesses all key components of the gas industry, including available resources, exploration, drilling, completion, production, and processing practices. Distribution, storage, and utilization of natural gas in a dynamic market-gased analytical structure is assessed. GSAM is designed to provide METC managers with a tool to project impacts of future research, development, and demonstration benefits
Model Driven Software Development for Agricultural Robotics
DEFF Research Database (Denmark)
Larsen, Morten
The design and development of agricultural robots, consists of both mechan- ical, electrical and software components. All these components must be de- signed and combined such that the overall goal of the robot is fulfilled. The design and development of these systems require collaboration between...... processing, control engineering, etc. This thesis proposes a Model-Driven Software Develop- ment based approach to model, analyse and partially generate the software implementation of a agricultural robot. Furthermore, Guidelines for mod- elling the architecture of an agricultural robots are provided......, assisting with bridging the different engineering disciplines. Timing play an important role in agricultural robotic applications, synchronisation of robot movement and implement actions is important in order to achieve precision spraying, me- chanical weeding, individual feeding, etc. Discovering...
Conceptual Development af a 3D Product Configuration Model
DEFF Research Database (Denmark)
Skauge, Jørn
2006-01-01
in the development of IT-systems that support the procedures in companies and in the building industry. In other words, it is a knowledge-based system that helps companies in their daily work. The aim of the project has been to develop and examine conceptual ideas about 3D modelling configurator used in the company......’s production of steel fire sliding doors. The development of the 3D digital model is based on practical rather than theoretical research. The result of the research is a prototype digital 3D model to be presented live.......Paper. This project deals with 3D product configuration of a digital building element which has been developed as a prototype in cooperation between a product manufacturer and a research institution in Denmark. The project falls within the concept of product modelling which is more and more used...
Quasi steady-state aerodynamic model development for race vehicle simulations
Mohrfeld-Halterman, J. A.; Uddin, M.
2016-01-01
Presented in this paper is a procedure to develop a high fidelity quasi steady-state aerodynamic model for use in race car vehicle dynamic simulations. Developed to fit quasi steady-state wind tunnel data, the aerodynamic model is regressed against three independent variables: front ground clearance, rear ride height, and yaw angle. An initial dual range model is presented and then further refined to reduce the model complexity while maintaining a high level of predictive accuracy. The model complexity reduction decreases the required amount of wind tunnel data thereby reducing wind tunnel testing time and cost. The quasi steady-state aerodynamic model for the pitch moment degree of freedom is systematically developed in this paper. This same procedure can be extended to the other five aerodynamic degrees of freedom to develop a complete six degree of freedom quasi steady-state aerodynamic model for any vehicle.
Cognitive components underpinning the development of model-based learning.
Potter, Tracey C S; Bryce, Nessa V; Hartley, Catherine A
2017-06-01
Reinforcement learning theory distinguishes "model-free" learning, which fosters reflexive repetition of previously rewarded actions, from "model-based" learning, which recruits a mental model of the environment to flexibly select goal-directed actions. Whereas model-free learning is evident across development, recruitment of model-based learning appears to increase with age. However, the cognitive processes underlying the development of model-based learning remain poorly characterized. Here, we examined whether age-related differences in cognitive processes underlying the construction and flexible recruitment of mental models predict developmental increases in model-based choice. In a cohort of participants aged 9-25, we examined whether the abilities to infer sequential regularities in the environment ("statistical learning"), maintain information in an active state ("working memory") and integrate distant concepts to solve problems ("fluid reasoning") predicted age-related improvements in model-based choice. We found that age-related improvements in statistical learning performance did not mediate the relationship between age and model-based choice. Ceiling performance on our working memory assay prevented examination of its contribution to model-based learning. However, age-related improvements in fluid reasoning statistically mediated the developmental increase in the recruitment of a model-based strategy. These findings suggest that gradual development of fluid reasoning may be a critical component process underlying the emergence of model-based learning. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.
Multiscale Modeling in the Clinic: Drug Design and Development
Energy Technology Data Exchange (ETDEWEB)
Clancy, Colleen E.; An, Gary; Cannon, William R.; Liu, Yaling; May, Elebeoba E.; Ortoleva, Peter; Popel, Aleksander S.; Sluka, James P.; Su, Jing; Vicini, Paolo; Zhou, Xiaobo; Eckmann, David M.
2016-02-17
A wide range of length and time scales are relevant to pharmacology, especially in drug development, drug design and drug delivery. Therefore, multi-scale computational modeling and simulation methods and paradigms that advance the linkage of phenomena occurring at these multiple scales have become increasingly important. Multi-scale approaches present in silico opportunities to advance laboratory research to bedside clinical applications in pharmaceuticals research. This is achievable through the capability of modeling to reveal phenomena occurring across multiple spatial and temporal scales, which are not otherwise readily accessible to experimentation. The resultant models, when validated, are capable of making testable predictions to guide drug design and delivery. In this review we describe the goals, methods, and opportunities of multi-scale modeling in drug design and development. We demonstrate the impact of multiple scales of modeling in this field. We indicate the common mathematical techniques employed for multi-scale modeling approaches used in pharmacology and present several examples illustrating the current state-of-the-art regarding drug development for: Excitable Systems (Heart); Cancer (Metastasis and Differentiation); Cancer (Angiogenesis and Drug Targeting); Metabolic Disorders; and Inflammation and Sepsis. We conclude with a focus on barriers to successful clinical translation of drug development, drug design and drug delivery multi-scale models.
A model of optimization for local energy infrastructure development
International Nuclear Information System (INIS)
Juroszek, Zbigniew; Kudelko, Mariusz
2016-01-01
The authors present a non-linear, optimization model supporting the planning of local energy systems development. The model considers two forms of final energy – heat and electricity. The model reflects both private and external costs and is designed to show the social perspective. It considers the variability of the marginal costs attributed to local renewable resources. In order to demonstrate the capacity of the model, the authors present a case study by modelling the development of the energy infrastructure in a municipality located in the south of Poland. The ensuing results show that a swift and significant shift in the local energy policy of typical central European municipalities is needed. The modelling is done in two scenarios – with and without the internalization of external environmental costs. The results confirm that the internalization of the external costs of energy production on a local scale leads to a significant improvement in the allocation of resources. - Highlights: • A model for municipal energy system development in Central European environment has been developed. • The variability of marginal costs of local, renewable fuels is considered. • External, environmental costs are considered. • The model reflects both network and individual energy infrastructure (e.g. individual housing boilers). • A swift change in Central European municipal energy infrastructure is necessary.
Multiscale mechanistic modeling in pharmaceutical research and development.
Kuepfer, Lars; Lippert, Jörg; Eissing, Thomas
2012-01-01
Discontinuation of drug development projects due to lack of efficacy or adverse events is one of the main cost drivers in pharmaceutical research and development (R&D). Investments have to be written-off and contribute to the total costs of a successful drug candidate receiving marketing authorization and allowing return on invest. A vital risk for pharmaceutical innovator companies is late stage clinical failure since costs for individual clinical trials may exceed the one billion Euro threshold. To guide investment decisions and to safeguard maximum medical benefit and safety for patients recruited in clinical trials, it is therefore essential to understand the clinical consequences of all information and data generated. The complexity of the physiological and pathophysiological processes and the sheer amount of information available overcharge the mental capacity of any human being and prevent a prediction of the success in clinical development. A rigorous integration of knowledge, assumption, and experimental data into computational models promises a significant improvement of the rationalization of decision making in pharmaceutical industry. We here give an overview of the current status of modeling and simulation in pharmaceutical R&D and outline the perspectives of more recent developments in mechanistic modeling. Specific modeling approaches for different biological scales ranging from intracellular processes to whole organism physiology are introduced and an example for integrative multiscale modeling of therapeutic efficiency in clinical oncology trials is showcased.
Development of a common data model for scientific simulations
Energy Technology Data Exchange (ETDEWEB)
Ambrosiano, J. [Los Alamos National Lab., NM (United States); Butler, D.M. [Limit Point Systems, Inc. (United States); Matarazzo, C.; Miller, M. [Lawrence Livermore National Lab., CA (United States); Schoof, L. [Sandia National Lab., Albuquerque, NM (United States)
1999-06-01
The problem of sharing data among scientific simulation models is a difficult and persistent one. Computational scientists employ an enormous variety of discrete approximations in modeling physical processes on computers. Problems occur when models based on different representations are required to exchange data with one another, or with some other software package. Within the DOE`s Accelerated Strategic Computing Initiative (ASCI), a cross-disciplinary group called the Data Models and Formats (DMF) group, has been working to develop a common data model. The current model is comprised of several layers of increasing semantic complexity. One of these layers is an abstract model based on set theory and topology called the fiber bundle kernel (FBK). This layer provides the flexibility needed to describe a wide range of mesh-approximated functions as well as other entities. This paper briefly describes the ASCI common data model, its mathematical basis, and ASCI prototype development. These prototypes include an object-oriented data management library developed at Los Alamos called the Common Data Model Library or CDMlib, the Vector Bundle API from the Lawrence Livermore Laboratory, and the DMF API from Sandia National Laboratory.
Study on the development of geological environmental model
International Nuclear Information System (INIS)
Tsujimoto, Keiichi; Shinohara, Yoshinori; Ueta, Shinzo; Saito, Shigeyuki; Kawamura, Yuji; Tomiyama, Shingo; Ohashi, Toyo
2002-03-01
The safety performance assessment was carried out in potential geological environment in the conventional research and development of geological disposal, but the importance of safety assessment based on the repository design and scenario considering the concrete geological environment will increase in the future. The research considering the link of the major three fields of geological disposal, investigation of geological environment, repository design, and safety performance assessment, is the contemporary worldwide research theme. Hence it is important to organize information flow that contains the series of information process form the data production to analysis in the three fields, and to systemize the knowledge base that unifies the information flow hierarchically. The purpose of the research is to support the development of the unified analysis system for geological disposal. The development technology for geological environmental model studied for the second progress report by JNC are organized and examined for the purpose of developing database system with considering the suitability for the deep underground research facility. The geological environmental investigation technology and building methodology for geological structure and hydro geological structure models are organized and systemized. Furthermore, the quality assurance methods in building geological environment models are examined. Information which is used and stored in the unified analysis system are examined to design database structure of the system based on the organized methodology for building geological environmental model. The graphic processing function for data stored in the unified database are examined. furthermore, future research subjects for the development of detail models for geological disposal are surveyed to organize safety performance system. (author)
Built To Last: Using Iterative Development Models for Sustainable Scientific Software Development
Jasiak, M. E.; Truslove, I.; Savoie, M.
2013-12-01
In scientific research, software development exists fundamentally for the results they create. The core research must take focus. It seems natural to researchers, driven by grant deadlines, that every dollar invested in software development should be used to push the boundaries of problem solving. This system of values is frequently misaligned with those of the software being created in a sustainable fashion; short-term optimizations create longer-term sustainability issues. The National Snow and Ice Data Center (NSIDC) has taken bold cultural steps in using agile and lean development and management methodologies to help its researchers meet critical deadlines, while building in the necessary support structure for the code to live far beyond its original milestones. Agile and lean software development and methodologies including Scrum, Kanban, Continuous Delivery and Test-Driven Development have seen widespread adoption within NSIDC. This focus on development methods is combined with an emphasis on explaining to researchers why these methods produce more desirable results for everyone, as well as promoting developers interacting with researchers. This presentation will describe NSIDC's current scientific software development model, how this addresses the short-term versus sustainability dichotomy, the lessons learned and successes realized by transitioning to this agile and lean-influenced model, and the current challenges faced by the organization.
Development of modeling tools for pin-by-pin precise reactor simulation
International Nuclear Information System (INIS)
Ma Yan; Li Shu; Li Gang; Zhang Baoyin; Deng Li; Fu Yuanguang
2013-01-01
In order to develop large-scale transport simulation and calculation method (such as simulation of whole reactor core pin-by-pin problem), the Institute of Applied Physics and Computational Mathematics developed the neutron-photon coupled transport code JMCT and the toolkit JCOGIN. Creating physical calculation model easily and efficiently can essentially reduce problem solving time. Currently, lots of visual modeling programs have been developed based on different CAD systems. In this article, the developing idea of a visual modeling tool based on field oriented development was introduced. Considering the feature of physical modeling, fast and convenient operation modules were developed. In order to solve the storage and conversion problems of large scale models, the data structure and conversional algorithm based on the hierarchical geometry tree were designed. The automatic conversion and generation of physical model input file for JMCT were realized. By using this modeling tool, the Dayawan reactor whole core physical model was created, and the transformed file was delivered to JMCT for transport calculation. The results validate the correctness of the visual modeling tool. (authors)
Importance of Computer Model Validation in Pyroprocessing Technology Development
Energy Technology Data Exchange (ETDEWEB)
Jung, Y. E.; Li, Hui; Yim, M. S. [Korea Advanced Institute of Science and Technology, Daejeon (Korea, Republic of)
2014-05-15
In this research, we developed a plan for experimental validation of one of the computer models developed for ER process modeling, i. e., the ERAD code. Several candidate surrogate materials are selected for the experiment considering the chemical and physical properties. Molten salt-based pyroprocessing technology is being examined internationally as an alternative to treat spent nuclear fuel over aqueous technology. The central process in pyroprocessing is electrorefining(ER) which separates uranium from transuranic elements and fission products present in spent nuclear fuel. ER is a widely used process in the minerals industry to purify impure metals. Studies of ER by using actual spent nuclear fuel materials are problematic for both technical and political reasons. Therefore, the initial effort for ER process optimization is made by using computer models. A number of models have been developed for this purpose. But as validation of these models is incomplete and often times problematic, the simulation results from these models are inherently uncertain.
Agent Model Development for Assessing Climate-Induced Geopolitical Instability.
Energy Technology Data Exchange (ETDEWEB)
Boslough, Mark B.; Backus, George A.
2005-12-01
We present the initial stages of development of new agent-based computational methods to generate and test hypotheses about linkages between environmental change and international instability. This report summarizes the first year's effort of an originally proposed three-year Laboratory Directed Research and Development (LDRD) project. The preliminary work focused on a set of simple agent-based models and benefited from lessons learned in previous related projects and case studies of human response to climate change and environmental scarcity. Our approach was to define a qualitative model using extremely simple cellular agent models akin to Lovelock's Daisyworld and Schelling's segregation model. Such models do not require significant computing resources, and users can modify behavior rules to gain insights. One of the difficulties in agent-based modeling is finding the right balance between model simplicity and real-world representation. Our approach was to keep agent behaviors as simple as possible during the development stage (described herein) and to ground them with a realistic geospatial Earth system model in subsequent years. This work is directed toward incorporating projected climate data--including various C02 scenarios from the Intergovernmental Panel on Climate Change (IPCC) Third Assessment Report--and ultimately toward coupling a useful agent-based model to a general circulation model.3
Development of interpretation models for PFN uranium log analysis
International Nuclear Information System (INIS)
Barnard, R.W.
1980-11-01
This report presents the models for interpretation of borehole logs for the PFN (Prompt Fission Neutron) uranium logging system. Two models have been developed, the counts-ratio model and the counts/dieaway model. Both are empirically developed, but can be related to the theoretical bases for PFN analysis. The models try to correct for the effects of external factors (such as probe or formation parameters) in the calculation of uranium grade. The theoretical bases and calculational techniques for estimating uranium concentration from raw PFN data and other parameters are discussed. Examples and discussions of borehole logs are included
Advanced reach tool (ART) : Development of the mechanistic model
Fransman, W.; Tongeren, M. van; Cherrie, J.W.; Tischer, M.; Schneider, T.; Schinkel, J.; Kromhout, H.; Warren, N.; Goede, H.; Tielemans, E.
2011-01-01
This paper describes the development of the mechanistic model within a collaborative project, referred to as the Advanced REACH Tool (ART) project, to develop a tool to model inhalation exposure for workers sharing similar operational conditions across different industries and locations in Europe.
Applied economic model development algorithm for electronics company
Directory of Open Access Journals (Sweden)
Mikhailov I.
2017-01-01
Full Text Available The purpose of this paper is to report about received experience in the field of creating the actual methods and algorithms that help to simplify development of applied decision support systems. It reports about an algorithm, which is a result of two years research and have more than one-year practical verification. In a case of testing electronic components, the time of the contract conclusion is crucial point to make the greatest managerial mistake. At this stage, it is difficult to achieve a realistic assessment of time-limit and of wage-fund for future work. The creation of estimating model is possible way to solve this problem. In the article is represented an algorithm for creation of those models. The algorithm is based on example of the analytical model development that serves for amount of work estimation. The paper lists the algorithm’s stages and explains their meanings with participants’ goals. The implementation of the algorithm have made possible twofold acceleration of these models development and fulfilment of management’s requirements. The resulting models have made a significant economic effect. A new set of tasks was identified to be further theoretical study.
Setting development goals using stochastic dynamical system models.
Ranganathan, Shyam; Nicolis, Stamatios C; Bali Swain, Ranjula; Sumpter, David J T
2017-01-01
The Millennium Development Goals (MDG) programme was an ambitious attempt to encourage a globalised solution to important but often-overlooked development problems. The programme led to wide-ranging development but it has also been criticised for unrealistic and arbitrary targets. In this paper, we show how country-specific development targets can be set using stochastic, dynamical system models built from historical data. In particular, we show that the MDG target of two-thirds reduction of child mortality from 1990 levels was infeasible for most countries, especially in sub-Saharan Africa. At the same time, the MDG targets were not ambitious enough for fast-developing countries such as Brazil and China. We suggest that model-based setting of country-specific targets is essential for the success of global development programmes such as the Sustainable Development Goals (SDG). This approach should provide clear, quantifiable targets for policymakers.
The Development of Hierarchy of Effects Model in Advertising
Directory of Open Access Journals (Sweden)
Bambang Sukma Wijaya
2012-04-01
Full Text Available This paper aims to review the hierarchy of effects models in advertising, especially the well-known model, AIDA (Attention, Interest, Desire, and Action. Since its introduction by Lewis (1900 and generally attributed in the marketing and advertising literature by Strong (1925, the concept of AIDA’s hierarchy of effects model has been used by many researchers, both academicians and practitioners. The model is used to measure the effect of an advertisement. However, the development of information technology has radically changed the way of how people communicate and socialize; as well as a paradigm shift from product-oriented marketing to consumer-oriented marketing or people-oriented marketing. Therefore, the variables in the hierarchy of effects model needs to be updated in respond to the latest developments in the notice of public power as consumer audience. Based on deep literature review and reflective method, this paper introduces a new developed concept of hierarchy of effects model that was adopted from AIDA’s hierarchy of effects model, namely: AISDALSLove (At-tention, Interest, Search, Desire, Action, Like/dislike, Share, and Love/hate.
Sectioning Clay Models Makes Anatomy & Development Tangible
Howell, Carina Endres; Howell, James Endres
2010-01-01
Clay models have proved to be useful teaching aids for many topics in biology that depend on three-dimensional reasoning. Students studying embryonic development struggle to mentally reconstruct the three-dimensional structure of embryos and larvae by observing prepared slides of cross-sectional slices. Students who build clay models of embryos…
DEVELOPMENT OF A MAINTENANCE SCHEDULING MODEL FOR ...
African Journals Online (AJOL)
... of minor maintenance, for each machine within this time span. In order to minimize the total cost of repairs and production. A numerical application of this development model in a case study is presented. Key words: Maintenance, modeling, scheduling, optimization. [Global Jnl Engineering Res. Vol.1(2) 2002: 107-118] ...
Development of thermal hydraulic models for the reliable regulatory auditing code
Energy Technology Data Exchange (ETDEWEB)
Chung, B. D.; Song, C. H.; Lee, Y. J.; Kwon, T. S. [Korea Atomic Energy Research Institute, Taejon (Korea, Republic of)
2003-04-15
The objective of this project is to develop thermal hydraulic models for use in improving the reliability of the regulatory auditing codes. The current year fall under the first step of the 3 year project, and the main researches were focused on identifying the candidate thermal hydraulic models for improvement and to develop prototypical model development. During the current year, the verification calculations submitted for the APR 1400 design certification have been reviewed, the experimental data from the MIDAS DVI experiment facility in KAERI have been analyzed and evaluated, candidate thermal hydraulic models for improvement have been identified, prototypical models for the improved thermal hydraulic models have been developed, items for experiment in connection with the model development have been identified, and preliminary design of the experiment has been carried out.
Development of thermal hydraulic models for the reliable regulatory auditing code
International Nuclear Information System (INIS)
Chung, B. D.; Song, C. H.; Lee, Y. J.; Kwon, T. S.
2003-04-01
The objective of this project is to develop thermal hydraulic models for use in improving the reliability of the regulatory auditing codes. The current year fall under the first step of the 3 year project, and the main researches were focused on identifying the candidate thermal hydraulic models for improvement and to develop prototypical model development. During the current year, the verification calculations submitted for the APR 1400 design certification have been reviewed, the experimental data from the MIDAS DVI experiment facility in KAERI have been analyzed and evaluated, candidate thermal hydraulic models for improvement have been identified, prototypical models for the improved thermal hydraulic models have been developed, items for experiment in connection with the model development have been identified, and preliminary design of the experiment has been carried out
Agribusiness model approach to territorial food development
Directory of Open Access Journals (Sweden)
Murcia Hector Horacio
2011-04-01
Full Text Available
Several research efforts have coordinated the academic program of Agricultural Business Management from the University De La Salle (Bogota D.C., to the design and implementation of a sustainable agribusiness model applied to food development, with territorial projection. Rural development is considered as a process that aims to improve the current capacity and potential of the inhabitant of the sector, which refers not only to production levels and productivity of agricultural items. It takes into account the guidelines of the Organization of the United Nations “Millennium Development Goals” and considered the concept of sustainable food and agriculture development, including food security and nutrition in an integrated interdisciplinary context, with holistic and systemic dimension. Analysis is specified by a model with an emphasis on sustainable agribusiness production chains related to agricultural food items in a specific region. This model was correlated with farm (technical objectives, family (social purposes and community (collective orientations projects. Within this dimension are considered food development concepts and methodologies of Participatory Action Research (PAR. Finally, it addresses the need to link the results to low-income communities, within the concepts of the “new rurality”.
Development of CCF modeling and analysis methodology for diverse system status
Energy Technology Data Exchange (ETDEWEB)
Lim, Tae Jin; Byun, Si Sub; Yoon, Tae Kwan [Soongsil University, Seoul (Korea); Moon, Jae Pil [Seoul National University, Seoul (Korea)
1999-04-01
The objectives of this project is to develop a procedure for modeling and analyzing CCF efficiently according to various system status. CCF events change according to the change of the system status due to maintenance, accidents, or alternating success criteria for various missions. The objective of the first year's research is to develope a CCF model for various system status. We reviewed and evaluated current CCF models, and analyze their merits and deficiency in modeling various system status. An approximate model is developed as a CCF model. The model is compatible with MGL model. Extensive sensitivity study shows the accuracy and efficiency of the proposed model. Second year's research aims to the development of an integrated CCF procedure for PSA and risk monitor. We develope an adaptive method for the approximate model in a k/m/G system with multiple common cause groups. The accuracy of the method is proved by comparing with the implicit method. Next, we develope a method for modeling CCF in a fault tree. Three alternatives are considered. It is proved to be most efficient to model the CCF events under the gate of individual component failure. The we provides a method for estimating the CCF probability, and develope a software for this purpose. We finally provide a fundamental procedure for modeling CCF in a risk monitor. The modeling procedure is applied to HPSI system, and it is proved to be efficient and accurate. (author). 48 refs., 11 figs., 53 tabs.
Gamma Knife radiosurgery for large vestibular schwannomas greater than 3 cm in diameter.
Huang, Cheng-Wei; Tu, Hsien-Tang; Chuang, Chun-Yi; Chang, Cheng-Siu; Chou, Hsi-Hsien; Lee, Ming-Tsung; Huang, Chuan-Fu
2018-05-01
OBJECTIVE Stereotactic radiosurgery (SRS) is an important alternative management option for patients with small- and medium-sized vestibular schwannomas (VSs). Its use in the treatment of large tumors, however, is still being debated. The authors reviewed their recent experience to assess the potential role of SRS in larger-sized VSs. METHODS Between 2000 and 2014, 35 patients with large VSs, defined as having both a single dimension > 3 cm and a volume > 10 cm 3 , underwent Gamma Knife radiosurgery (GKRS). Nine patients (25.7%) had previously undergone resection. The median total volume covered in this group of patients was 14.8 cm 3 (range 10.3-24.5 cm 3 ). The median tumor margin dose was 11 Gy (range 10-12 Gy). RESULTS The median follow-up duration was 48 months (range 6-156 months). All 35 patients had regular MRI follow-up examinations. Twenty tumors (57.1%) had a volume reduction of greater than 50%, 5 (14.3%) had a volume reduction of 15%-50%, 5 (14.3%) were stable in size (volume change 3 cm and a volume > 10 cm 3 and tolerable mass effect can be managed satisfactorily with GKRS. Tumor volume ≥ 15 cm 3 is a significant factor predicting poor tumor control following GKRS.
A Method for Traffic Calming Using Radio Transmitter
Directory of Open Access Journals (Sweden)
Amin Mirza Boroujerdian
2017-01-01
Full Text Available Excessive speed is one of the major factors in transportation safety assessment and is influenced by road geometric design, vehicle properties, and driving pattern. Exploiting innovative methods along with the conventional ones has been proven to be effective in road safety to control the speed limit. In this study, a supplementary tool is introduced to help drivers to observe the speed limit. In line with this objective, the effectiveness of Voice Sign System (VSS as an Intelligent Transportation System is evaluated. In order to measure the speed, video processing software is used. Moreover, SPSS is utilized to perform statistical analysis and compare upstream and downstream speeds before and after a message transmission. The study is conducted in Yadegar-e-Imam expressway, located in Tehran, to evaluate the effectiveness of a voice message. The message reads as follows: “Observe the Speed Limit.” The results reveal that VSS is an effective tool for speed reduction as well as the speed limit observation in expressways. The study shows that the speed is reduced by 18% on average, and speed limit observation is improved by 46.5%, out of which 18.2% is direct and 28.3% is indirect influence of VSS.
Esparza-Soto, M; Arzate-Archundia, O; Solís-Morelos, C; Fall, C
2013-01-01
The aim of this work was to evaluate the performance of a 244-L pilot-scale upflow anaerobic sludge blanket (UASB) reactor during the treatment of chocolate-processing industry wastewater under low-temperature conditions (18 ± 0.6 °C) for approximately 250 d. The applied organic loading rate (OLR) was varied between 4 and 7 kg/m(3)/d by varying the influent soluble chemical oxygen demand (CODsol), while keeping the hydraulic retention time constant (6.4 ± 0.3 h). The CODsol removal efficiency was low (59-78%). The measured biogas production increased from 240 ± 54 to 431 ± 61 L/d during the experiments. A significant linear correlation between the measured biogas production and removed OLR indicated that 81.69 L of biogas were produced per kg/m(3) of CODsol removed. Low average reactor volatile suspended solids (VSS) (2,700-4,800 mg/L) and high effluent VSS (177-313 mg/L) were derived in a short sludge retention time (SRT) (4.9 d). The calculated SRT was shorter than those reported in the literature, but did not affect the reactor's performance. Average sludge yield was 0.20 kg-VSS/kg-CODsol. The low-temperature anaerobic treatment was a good option for the pre-treatment of chocolate-processing industry wastewater.
Virtual slides: application in pulmonary pathology consultations.
Directory of Open Access Journals (Sweden)
Michał Wojciechowski
2008-02-01
Full Text Available The Virtual Slide (VS is an interactive microscope emulator that presents a complete digitized tissue section via the Internet. A successful implementation of VS has been observed for educational, research venues and quality control. VS acquisition for consultative pathology is not so common. The purpose of this study was to explore the efficacy and usability of VS in the consultative pulmonary telepathology. 20 lung tumors entered the study. The performance was programmed for 2 medical centers specialized in pulmonary pathology (beginner and advancer in telepathology. A high-quality VSs were prepared by Coolscope (Nikon, Eclipsnet VSL, Japan, and were evaluated via the Internet. The cases were reviewed for the second time with conventional light microscope. VS diagnostic accuracy and the interobserver variability were evaluated. Also the time taken by examiners to render the diagnoses and time needed to scan the microscopic slide were analyzed. Percentage concordance between original glass-slides diagnosis and diagnosis for VSs was very high. Pathologists found the download speed of VSs adequate; experience in telepathology reduced the time of VS diagnosis. VS implementation suggests advantages for teleconsulation and education but also indicate some technical limitations. This is the first Polish trial of VS implementation in telepathology consultative service.
Preliminary Phase Field Computational Model Development
Energy Technology Data Exchange (ETDEWEB)
Li, Yulan [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Hu, Shenyang Y. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Xu, Ke [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Suter, Jonathan D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); McCloy, John S. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Johnson, Bradley R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Ramuhalli, Pradeep [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2014-12-15
This interim report presents progress towards the development of meso-scale models of magnetic behavior that incorporate microstructural information. Modeling magnetic signatures in irradiated materials with complex microstructures (such as structural steels) is a significant challenge. The complexity is addressed incrementally, using the monocrystalline Fe (i.e., ferrite) film as model systems to develop and validate initial models, followed by polycrystalline Fe films, and by more complicated and representative alloys. In addition, the modeling incrementally addresses inclusion of other major phases (e.g., martensite, austenite), minor magnetic phases (e.g., carbides, FeCr precipitates), and minor nonmagnetic phases (e.g., Cu precipitates, voids). The focus of the magnetic modeling is on phase-field models. The models are based on the numerical solution to the Landau-Lifshitz-Gilbert equation. From the computational standpoint, phase-field modeling allows the simulation of large enough systems that relevant defect structures and their effects on functional properties like magnetism can be simulated. To date, two phase-field models have been generated in support of this work. First, a bulk iron model with periodic boundary conditions was generated as a proof-of-concept to investigate major loop effects of single versus polycrystalline bulk iron and effects of single non-magnetic defects. More recently, to support the experimental program herein using iron thin films, a new model was generated that uses finite boundary conditions representing surfaces and edges. This model has provided key insights into the domain structures observed in magnetic force microscopy (MFM) measurements. Simulation results for single crystal thin-film iron indicate the feasibility of the model for determining magnetic domain wall thickness and mobility in an externally applied field. Because the phase-field model dimensions are limited relative to the size of most specimens used in
The Community Water Model (CWATM) / Development of a community driven global water model
Burek, Peter; Satoh, Yusuke; Greve, Peter; Kahil, Taher; Wada, Yoshihide
2017-04-01
With a growing population and economic development, it is expected that water demands will increase significantly in the future, especially in developing regions. At the same time, climate change is expected to alter spatial patterns of hydrological cycle and will have global, regional and local impacts on water availability. Thus, it is important to assess water supply, water demand and environmental needs over time to identify the populations and locations that will be most affected by these changes linked to water scarcity, droughts and floods. The Community Water Model (CWATM) will be designed for this purpose in that it includes an accounting of how future water demands will evolve in response to socioeconomic change and how water availability will change in response to climate. CWATM represents one of the new key elements of IIASA's Water program. It has been developed to work flexibly at both global and regional level at different spatial resolutions. The model is open source and community-driven to promote our work amongst the wider water community worldwide and is flexible enough linking to further planned developments such as water quality and hydro-economic modules. CWATM will be a basis to develop a next-generation global hydro-economic modeling framework that represents the economic trade-offs among different water management options over a basin looking at water supply infrastructure and demand managements. The integrated modeling framework will consider water demand from agriculture, domestic, energy, industry and environment, investment needs to alleviate future water scarcity, and will provide a portfolio of economically optimal solutions for achieving future water management options under the Sustainable Development Goals (SDG) for example. In addition, it will be able to track the energy requirements associated with the water supply system e.g., pumping, desalination and interbasin transfer to realize the linkage with the water-energy economy. In
Argonne Bubble Experiment Thermal Model Development
Energy Technology Data Exchange (ETDEWEB)
Buechler, Cynthia Eileen [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)
2015-12-03
This report will describe the Computational Fluid Dynamics (CFD) model that was developed to calculate the temperatures and gas volume fractions in the solution vessel during the irradiation. It is based on the model used to calculate temperatures and volume fractions in an annular vessel containing an aqueous solution of uranium . The experiment was repeated at several electron beam power levels, but the CFD analysis was performed only for the 12 kW irradiation, because this experiment came the closest to reaching a steady-state condition. The aim of the study is to compare results of the calculation with experimental measurements to determine the validity of the CFD model.
A model for the development of university curricula in nanoelectronics
DEFF Research Database (Denmark)
Bruun, Erik; Nielsen, I
2010-01-01
Nanotechnology is having an increasing impact on university curricula in electrical engineering and in physics. Major influencers affecting developments in university programmes related to nanoelectronics are discussed and a model for university programme development is described. The model takes...... engineering. Examples of European curricula following this framework are identified and described. These examples may serve as sources of inspiration for future developments and the model...
Modeling and managing risk early in software development
Briand, Lionel C.; Thomas, William M.; Hetmanski, Christopher J.
1993-01-01
In order to improve the quality of the software development process, we need to be able to build empirical multivariate models based on data collectable early in the software process. These models need to be both useful for prediction and easy to interpret, so that remedial actions may be taken in order to control and optimize the development process. We present an automated modeling technique which can be used as an alternative to regression techniques. We show how it can be used to facilitate the identification and aid the interpretation of the significant trends which characterize 'high risk' components in several Ada systems. Finally, we evaluate the effectiveness of our technique based on a comparison with logistic regression based models.
Computer-Aided Template for Model Reuse, Development and Maintenance
DEFF Research Database (Denmark)
Fedorova, Marina; Sin, Gürkan; Gani, Rafiqul
2014-01-01
A template-based approach for model development is presented in this work. Based on a model decomposition technique, the computer-aided template concept has been developed. This concept is implemented as a software tool , which provides a user-friendly interface for following the workflow steps...
Aspect-Oriented Model Development at Different Levels of Abstraction
Alférez, Mauricio; Amálio, Nuno; Ciraci, S.; Fleurey, Franck; Kienzle, Jörg; Klein, Jacques; Kramer, Max; Mosser, Sebastien; Mussbacher, Gunter; Roubtsova, Ella; Zhang, Gefei; France, Robert B.; Kuester, Jochen M.; Bordbar, Behzad; Paige, Richard F.
2011-01-01
The last decade has seen the development of diverse aspect- oriented modeling (AOM) approaches. This paper presents eight different AOM approaches that produce models at different level of abstraction. The approaches are different with respect to the phases of the development lifecycle they target,
Model-based scenarios for rural electrification in developing countries
Ruijven, B. van; Schers, J.; Vuuren, D.P. van
2012-01-01
Promoting access to modern energy forms in developing countries to replace traditional fuels is high on the political agenda. This paper describes the development and application of a global model for rural electrification. The model is used to assess future trends in electrification, and the
Development and verification of printed circuit board toroidal transformer model
DEFF Research Database (Denmark)
Pejtersen, Jens; Mønster, Jakob Døllner; Knott, Arnold
2013-01-01
An analytical model of an air core printed circuit board embedded toroidal transformer configuration is presented. The transformer has been developed for galvanic isolation of very high frequency switch-mode dc-dc power converter applications. The theoretical model is developed and verified...... by comparing calculated parameters with 3D finite element simulations and experimental measurement results. The developed transformer model shows good agreement with the simulated and measured results. The model can be used to predict the parameters of printed circuit board toroidal transformer configurations...
Green, Carie; Kalvaitis, Darius; Worster, Anneliese
2016-01-01
This article presents an Environmental Identity Development model, which considers the progression of young children's self-cognitions in relation to the natural world. We recontextualize four of Erikson's psychosocial stages, in order to consider children's identity development in learning in, about, and for the environment. Beginning with…
Understanding Mammalian Germ Line Development with In Vitro Models.
Martínez-Arroyo, Ana M; Míguez-Forján, Jose M; Remohí, Jose; Pellicer, Antonio; Medrano, Jose V
2015-09-15
Germ line development is crucial in organisms with sexual reproduction to complete their life cycle. In mammals, knowledge about germ line development is based mainly on the mouse model, in which genetic and epigenetic events are well described. However, little is known about how germ line development is orchestrated in humans, especially in the earliest stages. New findings derived from human in vitro models to obtain germ cells can shed light on these questions. This comprehensive review summarizes the current knowledge about mammalian germ line development, emphasizing the state of the art obtained from in vitro models for germ cell-like cell derivation. Current knowledge of the pluripotency cycle and germ cell specification has allowed different in vitro strategies to obtain germ cells with proven functionality in mouse models. Several reports during the last 10 years show that in vitro germ cell derivation with proven functionality to generate a healthy offspring is possible in mice. However, differences in the embryo development and pluripotency potential between human and mouse make it difficult to extrapolate these results. Further efforts on both human and mouse in vitro models to obtain germ cells from pluripotent stem cells may help to elucidate how human physiological events take place; therefore, therapeutic strategies can also be considered.
Acting and Teacher Education: Being Model for Identity Development
Directory of Open Access Journals (Sweden)
Kemal Sinan Özmen
2011-02-01
Full Text Available This study follows three pre-service teachers during three academic semesters in which they took an acting course for teachers and participated in practicum with a special focus on rehearsing and developing their teacher identities. In order to create the necessary context for them, an acting course for pre-service teacher education was designed in parallel with a model which is based on an influential acting theory. This model, namely the BEING (Believe, Experiment, Invent, Navigate, Generate, was also designed by the researcher. The incentive behind designing a model grounded on acting literature was that the relevant literature does not provide trainers with a universal model which can be referred as a manual for running and monitoring acting courses for teachers. In this case study, this model was also tested in terms of its applicability and functionality in practice. Based on analyses of audio taped interviews, session journals and reflections, the five stages of the BEING Model was found to be highly applicable and functional in terms of reflecting the natural development process of teacher identity development. Pre-service teachers displayed a significant development in communication skills and professional identities. Therefore, the BEING model provides a perspective and a philosophy of benefiting from acting literature for teacher educators with little or no knowledge on acting and theatre
Acting and Teacher Education: Being Model for Identity Development
Directory of Open Access Journals (Sweden)
Kemal Sinan Özmen
2011-04-01
Full Text Available This study follows three pre-service teachers during three academic semesters in which they took an acting course for teachers and participated in practicum with a special focus on rehearsing and developing their teacher identities. In order to create the necessary context for them, an acting course for pre-service teacher education was designed in parallel with a model which is based on an influential acting theory. This model, namely the BEING (Believe, Experiment, Invent, Navigate, Generate, was also designed by the researcher. The incentive behind designing a model grounded on acting literature was that the relevant literature does not provide trainers with a universal model which can be referred as a manual for running and monitoring acting courses for teachers. In this case study, this model was also tested in terms of its applicability and functionality in practice. Based on analyses of audio taped interviews, session journals and reflections, the five stages of the BEING Model was found to be highly applicable and functional in terms of reflecting the natural development process of teacher identity development. Pre-service teachers displayed a significant development in communication skills and professional identities. Therefore, the BEING model provides a perspective and a philosophy of benefiting from acting literature for teacher educators with little or no knowledge on acting and theatre.
International Nuclear Information System (INIS)
Akiyoshi, H.
1997-01-01
A global one-dimensional, chemically and radiatively coupled model has been developed. The basic concept of the coupled model, definition of globally averaged zenith angles, the formulation of the model chemistry, radiation, the coupled processes, and profiles and diurnal variations of temperature and chemical species at a normal steady state are presented. Furthermore, a suddenly doubled CO 2 experiment and a Pinatubo aerosol increase experiment were performed with the model. The time scales of variations in ozone and temperature in the lower stratosphere of the coupled system in the doubled CO 2 experiment was long, due to a feedback process among ultra violet radiation, O(1D), NO y , NO x , and O 3 . From the Pinatubo aerosol experiment, a delay of maximum ozone decrease from the maximum aerosol loading is shown and discussed. Developments of 3-D chemical models with coupled processes are briefly described, and the ozone distribution from the first version of the 3-D model are presented. Chemical model development in National Institute for Environmental Studies (NIES) are briefly described. (author)
Recent development of hydrodynamic modeling
Hirano, Tetsufumi
2014-09-01
In this talk, I give an overview of recent development in hydrodynamic modeling of high-energy nuclear collisions. First, I briefly discuss about current situation of hydrodynamic modeling by showing results from the integrated dynamical approach in which Monte-Carlo calculation of initial conditions, quark-gluon fluid dynamics and hadronic cascading are combined. In particular, I focus on rescattering effects of strange hadrons on final observables. Next I highlight three topics in recent development in hydrodynamic modeling. These include (1) medium response to jet propagation in di-jet asymmetric events, (2) causal hydrodynamic fluctuation and its application to Bjorken expansion and (3) chiral magnetic wave from anomalous hydrodynamic simulations. (1) Recent CMS data suggest the existence of QGP response to propagation of jets. To investigate this phenomenon, we solve hydrodynamic equations with source term which exhibits deposition of energy and momentum from jets. We find a large number of low momentum particles are emitted at large angle from jet axis. This gives a novel interpretation of the CMS data. (2) It has been claimed that a matter created even in p-p/p-A collisions may behave like a fluid. However, fluctuation effects would be important in such a small system. We formulate relativistic fluctuating hydrodynamics and apply it to Bjorken expansion. We found the final multiplicity fluctuates around the mean value even if initial condition is fixed. This effect is relatively important in peripheral A-A collisions and p-p/p-A collisions. (3) Anomalous transport of the quark-gluon fluid is predicted when extremely high magnetic field is applied. We investigate this possibility by solving anomalous hydrodynamic equations. We found the difference of the elliptic flow parameter between positive and negative particles appears due to the chiral magnetic wave. Finally, I provide some personal perspective of hydrodynamic modeling of high energy nuclear collisions
LG Solid Oxide Fuel Cell (SOFC) Model Development
Energy Technology Data Exchange (ETDEWEB)
Haberman, Ben [LG Fuel Cell Systems Inc., North Canton, OH (United States); Martinez-Baca, Carlos [LG Fuel Cell Systems Inc., North Canton, OH (United States); Rush, Greg [LG Fuel Cell Systems Inc., North Canton, OH (United States)
2013-05-31
This report presents a summary of the work performed by LG Fuel Cell Systems Inc. during the project LG Solid Oxide Fuel Cell (SOFC) Model Development (DOE Award Number: DE-FE0000773) which commenced on October 1, 2009 and was completed on March 31, 2013. The aim of this project is for LG Fuel Cell Systems Inc. (formerly known as Rolls-Royce Fuel Cell Systems (US) Inc.) (LGFCS) to develop a multi-physics solid oxide fuel cell (SOFC) computer code (MPC) for performance calculations of the LGFCS fuel cell structure to support fuel cell product design and development. A summary of the initial stages of the project is provided which describes the MPC requirements that were developed and the selection of a candidate code, STAR-CCM+ (CD-adapco). This is followed by a detailed description of the subsequent work program including code enhancement and model verification and validation activities. Details of the code enhancements that were implemented to facilitate MPC SOFC simulations are provided along with a description of the models that were built using the MPC and validated against experimental data. The modeling work described in this report represents a level of calculation detail that has not been previously available within LGFCS.
Development of hydrogeological modelling tools based on NAMMU
Energy Technology Data Exchange (ETDEWEB)
Marsic, N. [Kemakta Konsult AB, Stockholm (Sweden); Hartley, L.; Jackson, P.; Poole, M. [AEA Technology, Harwell (United Kingdom); Morvik, A. [Bergen Software Services International AS, Bergen (Norway)
2001-09-01
A number of relatively sophisticated hydrogeological models were developed within the SR 97 project to handle issues such as nesting of scales and the effects of salinity. However, these issues and others are considered of significant importance and generality to warrant further development of the hydrogeological methodology. Several such developments based on the NAMMU package are reported here: - Embedded grid: nesting of the regional- and site-scale models within the same numerical model has given greater consistency in the structural model representation and in the flow between scales. Since there is a continuous representation of the regional- and site-scales the modelling of pathways from the repository no longer has to be contained wholly by the site-scale region. This allows greater choice in the size of the site-scale. - Implicit Fracture Zones (IFZ): this method of incorporating the structural model is very efficient and allows changes to either the mesh or fracture zones to be implemented quickly. It also supports great flexibility in the properties of the structures and rock mass. - Stochastic fractures: new functionality has been added to IFZ to allow arbitrary combinations of stochastic or deterministic fracture zones with the rock-mass. Whether a fracture zone is modelled deterministically or stochastically its statistical properties can be defined independently. - Stochastic modelling: efficient methods for Monte-Carlo simulation of stochastic permeability fields have been implemented and tested on SKB's computers. - Visualisation: the visualisation tool Avizier for NAMMU has been enhanced such that it is efficient for checking models and presentation. - PROPER interface: NAMMU outputs pathlines in PROPER format so that it can be included in PA workflow. The developed methods are illustrated by application to stochastic nested modelling of the Beberg site using data from SR 97. The model properties were in accordance with the regional- and site
Development of hydrogeological modelling tools based on NAMMU
International Nuclear Information System (INIS)
Marsic, N.; Hartley, L.; Jackson, P.; Poole, M.; Morvik, A.
2001-09-01
A number of relatively sophisticated hydrogeological models were developed within the SR 97 project to handle issues such as nesting of scales and the effects of salinity. However, these issues and others are considered of significant importance and generality to warrant further development of the hydrogeological methodology. Several such developments based on the NAMMU package are reported here: - Embedded grid: nesting of the regional- and site-scale models within the same numerical model has given greater consistency in the structural model representation and in the flow between scales. Since there is a continuous representation of the regional- and site-scales the modelling of pathways from the repository no longer has to be contained wholly by the site-scale region. This allows greater choice in the size of the site-scale. - Implicit Fracture Zones (IFZ): this method of incorporating the structural model is very efficient and allows changes to either the mesh or fracture zones to be implemented quickly. It also supports great flexibility in the properties of the structures and rock mass. - Stochastic fractures: new functionality has been added to IFZ to allow arbitrary combinations of stochastic or deterministic fracture zones with the rock-mass. Whether a fracture zone is modelled deterministically or stochastically its statistical properties can be defined independently. - Stochastic modelling: efficient methods for Monte-Carlo simulation of stochastic permeability fields have been implemented and tested on SKB's computers. - Visualisation: the visualisation tool Avizier for NAMMU has been enhanced such that it is efficient for checking models and presentation. - PROPER interface: NAMMU outputs pathlines in PROPER format so that it can be included in PA workflow. The developed methods are illustrated by application to stochastic nested modelling of the Beberg site using data from SR 97. The model properties were in accordance with the regional- and site
Development of Numerical Grids for UZ Flow and Transport Modeling
International Nuclear Information System (INIS)
Hinds, J.
2001-01-01
This Analysis/Model Report (AMR) describes the methods used to develop numerical grids of the unsaturated hydrogeologic system beneath Yucca Mountain. Numerical grid generation is an integral part of the development of a complex, three-dimensional (3-D) model, such as the Unsaturated-Zone Flow and Transport Model (UZ Model) of Yucca Mountain. The resulting numerical grids, developed using current geologic, hydrogeologic, and mineralogic data, provide the necessary framework to: (1) develop calibrated hydrogeologic property sets and flow fields, (2) test conceptual hypotheses of flow and transport, and (3) predict flow and transport behavior under a variety of climatic and thermal loading conditions. Revision 00 of the work described herein follows the planning and work direction outlined in the ''Development of Numerical Grids for UZ Flow and Transport Modeling'' (CRWMS M and O 1999c). The technical scope, content, and management of ICN 01 of this AMR is currently controlled by the planning document, ''Technical Work Plan for Unsaturated Zone (UZ) Flow and Transport Process Model Report'' (BSC 2001a). The scope for the TBV resolution actions in this ICN is described in the ''Technical Work Plan for: Integrated Management of Technical Product Input Department'' (BSC 2001 b, Addendum B, Section 4.1). The steps involved in numerical grid development include: (1) defining the location of important calibration features, (2) determining model grid layers and fault geometry based on the Geologic Framework Model (GFM), the Integrated Site Model (ISM), and definition of hydrogeologic units (HGUs), (3) analyzing and extracting GFM and ISM data pertaining to layer contacts and property distributions, (4) discretizing and refining the two-dimensional (2-D), plan-view numerical grid, (5) generating the 3-D grid with finer resolution at the repository horizon and within the Calico Hills nonwelded (CHn) hydrogeologic unit, and (6) formulating the dual-permeability mesh. The
Development of Wolsong Unit 2 Containment Analysis Model
Energy Technology Data Exchange (ETDEWEB)
Hoon, Choi [Korea Hydro and Nuclear Power Co., Ltd., Daejeon (Korea, Republic of); Jin, Ko Bong; Chan, Park Young [Hanbat National Univ., Daejeon (Korea, Republic of)
2014-05-15
To be prepared for the full scope safety analysis of Wolsong unit 2 with modified fuel, input decks for the various objectives, which can be read by GOTHIC 7.2b(QA), are developed and tested for the steady state simulation. A detailed nodalization of 39 control volumes and 92 flow paths is constructed to determine the differential pressure across internal walls or hydrogen concentration and distribution inside containment. A lumped model with 15 control volumes and 74 flow paths has also been developed to reduce the computer run time for the assessments in which the analysis results are not sensitive to detailed thermal hydraulic distribution inside containment such as peak pressure, pressure dependent signal and radionuclide release. The input data files provide simplified representations of the geometric layout of the containment building (volumes, dimensions, flow paths, doors, panels, etc.) and the performance characteristics of the various containment subsystems. The parameter values are based on best estimate or design values for that parameter. The analysis values are determined by conservatism depending on the analysis objective and may be different for various analysis objectives. Basic input decks of Wolsong unit 2 were developed for the various analysis purposes with GOTHIC 7.2b(QA). Depend on the analysis objective, two types of models are prepared. Detailed model models each confined room in the containment as a separate node. All of the geometric data are based on the drawings of Wolsong unit 2. Developed containment models are simulating the steady state well to the designated initial condition. These base models will be used for Wolsong unit 2 in case of safety analysis of full scope is needed.
Developing a Malaysia flood model
Haseldine, Lucy; Baxter, Stephen; Wheeler, Phil; Thomson, Tina
2014-05-01
Faced with growing exposures in Malaysia, insurers have a need for models to help them assess their exposure to flood losses. The need for an improved management of flood risks has been further highlighted by the 2011 floods in Thailand and recent events in Malaysia. The increasing demand for loss accumulation tools in Malaysia has lead to the development of the first nationwide probabilistic Malaysia flood model, which we present here. The model is multi-peril, including river flooding for thousands of kilometres of river and rainfall-driven surface water flooding in major cities, which may cause losses equivalent to river flood in some high-density urban areas. The underlying hazard maps are based on a 30m digital surface model (DSM) and 1D/2D hydraulic modelling in JFlow and RFlow. Key mitigation schemes such as the SMART tunnel and drainage capacities are also considered in the model. The probabilistic element of the model is driven by a stochastic event set based on rainfall data, hence enabling per-event and annual figures to be calculated for a specific insurance portfolio and a range of return periods. Losses are estimated via depth-damage vulnerability functions which link the insured damage to water depths for different property types in Malaysia. The model provides a unique insight into Malaysian flood risk profiles and provides insurers with return period estimates of flood damage and loss to property portfolios through loss exceedance curve outputs. It has been successfully validated against historic flood events in Malaysia and is now being successfully used by insurance companies in the Malaysian market to obtain reinsurance cover.
Turbulence models development and engineering applications
International Nuclear Information System (INIS)
Groetzbach, G.; Ammann, T.; Dorr, B.; Hiltner, I.; Hofmann, S.; Kampczyk, M.; Kimhi, Y.; Seiter, C.; Woerner, M.; Alef, M.; Hennemuth, A.
1995-01-01
The FLUTAN code is used for analyzing the decay heat removal in new reactor concepts. The turbulence models applied in FLUTAN are improved by the development of the TURBIT code. TURBIT serves for a numerical simulation of turbulent channel flow. (orig.)
Wake models developed during the Wind Shadow project
Energy Technology Data Exchange (ETDEWEB)
Larsen, S.; Ott, S.; Pena, A.; Berg, J.; Nielsen, M.; Rathmann, O.; Joergensen, H.
2011-11-15
The Wind Shadow project has developed and validated improved models for determining the wakes losses, and thereby the array efficiency of very large, closely packed wind farms. The rationale behind the project has been that the existing software has been covering these types of wind farms poorly, both with respect to the densely packed turbines and the large fetches needed to describe the collective shadow effects of one farm to the next. Further the project has developed the necessary software for the use of the models. Guidelines with recommendations for the use of the models are included in the model deliverables. The project has been carried out as a collaborative project between Risoe DTU, DONG, Vattenfall, DNV and VESTAS, and it has been financed by energinet.dk grant no. 10086. (Author)
Developing a Domain Model for Relay Circuits
DEFF Research Database (Denmark)
Haxthausen, Anne Elisabeth
2009-01-01
In this paper we stepwise develop a domain model for relay circuits as used in railway control systems. First we provide an abstract, property-oriented model of networks consisting of components that can be glued together with connectors. This model is strongly inspired by a network model...... for railways madeby Bjørner et.al., however our model is more general: the components can be of any kind and can later be refined to e.g. railway components or circuit components. Then we show how the abstract network model can be refined into an explicit model for relay circuits. The circuit model describes...... the statics as well as the dynamics of relay circuits, i.e. how a relay circuit can be composed legally from electrical components as well as how the components may change state over time. Finally the circuit model is transformed into an executable model, and we show how a concrete circuit can be defined...
Protein adsorption on nanoparticles: model development using computer simulation
International Nuclear Information System (INIS)
Shao, Qing; Hall, Carol K
2016-01-01
The adsorption of proteins on nanoparticles results in the formation of the protein corona, the composition of which determines how nanoparticles influence their biological surroundings. We seek to better understand corona formation by developing models that describe protein adsorption on nanoparticles using computer simulation results as data. Using a coarse-grained protein model, discontinuous molecular dynamics simulations are conducted to investigate the adsorption of two small proteins (Trp-cage and WW domain) on a model nanoparticle of diameter 10.0 nm at protein concentrations ranging from 0.5 to 5 mM. The resulting adsorption isotherms are well described by the Langmuir, Freundlich, Temkin and Kiselev models, but not by the Elovich, Fowler–Guggenheim and Hill–de Boer models. We also try to develop a generalized model that can describe protein adsorption equilibrium on nanoparticles of different diameters in terms of dimensionless size parameters. The simulation results for three proteins (Trp-cage, WW domain, and GB3) on four nanoparticles (diameter = 5.0, 10.0, 15.0, and 20.0 nm) illustrate both the promise and the challenge associated with developing generalized models of protein adsorption on nanoparticles. (paper)
Development of 3D Oxide Fuel Mechanics Models
Energy Technology Data Exchange (ETDEWEB)
Spencer, B. W. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Casagranda, A. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Pitts, S. A. [Idaho National Lab. (INL), Idaho Falls, ID (United States); Jiang, W. [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2017-07-27
This report documents recent work to improve the accuracy and robustness of the mechanical constitutive models used in the BISON fuel performance code. These developments include migration of the fuel mechanics models to be based on the MOOSE Tensor Mechanics module, improving the robustness of the smeared cracking model, implementing a capability to limit the time step size based on material model response, and improving the robustness of the return mapping iterations used in creep and plasticity models.
Modelling energy demand of developing countries: Are the specific features adequately captured?
International Nuclear Information System (INIS)
Bhattacharyya, Subhes C.; Timilsina, Govinda R.
2010-01-01
This paper critically reviews existing energy demand forecasting methodologies highlighting the methodological diversities and developments over the past four decades in order to investigate whether the existing energy demand models are appropriate for capturing the specific features of developing countries. The study finds that two types of approaches, econometric and end-use accounting, are commonly used in the existing energy demand models. Although energy demand models have greatly evolved since the early seventies, key issues such as the poor-rich and urban-rural divides, traditional energy resources and differentiation between commercial and non-commercial energy commodities are often poorly reflected in these models. While the end-use energy accounting models with detailed sectoral representations produce more realistic projections as compared to the econometric models, they still suffer from huge data deficiencies especially in developing countries. Development and maintenance of more detailed energy databases, further development of models to better reflect developing country context and institutionalizing the modelling capacity in developing countries are the key requirements for energy demand modelling to deliver richer and more reliable input to policy formulation in developing countries.
Modelling energy demand of developing countries: Are the specific features adequately captured?
Energy Technology Data Exchange (ETDEWEB)
Bhattacharyya, Subhes C. [CEPMLP, University of Dundee, Dundee DD1 4HN (United Kingdom); Timilsina, Govinda R. [Development Research Group, The World Bank, Washington DC (United States)
2010-04-15
This paper critically reviews existing energy demand forecasting methodologies highlighting the methodological diversities and developments over the past four decades in order to investigate whether the existing energy demand models are appropriate for capturing the specific features of developing countries. The study finds that two types of approaches, econometric and end-use accounting, are commonly used in the existing energy demand models. Although energy demand models have greatly evolved since the early seventies, key issues such as the poor-rich and urban-rural divides, traditional energy resources and differentiation between commercial and non-commercial energy commodities are often poorly reflected in these models. While the end-use energy accounting models with detailed sectoral representations produce more realistic projections as compared to the econometric models, they still suffer from huge data deficiencies especially in developing countries. Development and maintenance of more detailed energy databases, further development of models to better reflect developing country context and institutionalizing the modelling capacity in developing countries are the key requirements for energy demand modelling to deliver richer and more reliable input to policy formulation in developing countries. (author)
Mathematical modeling of efficacy and safety for anticancer drugs clinical development.
Lavezzi, Silvia Maria; Borella, Elisa; Carrara, Letizia; De Nicolao, Giuseppe; Magni, Paolo; Poggesi, Italo
2018-01-01
Drug attrition in oncology clinical development is higher than in other therapeutic areas. In this context, pharmacometric modeling represents a useful tool to explore drug efficacy in earlier phases of clinical development, anticipating overall survival using quantitative model-based metrics. Furthermore, modeling approaches can be used to characterize earlier the safety and tolerability profile of drug candidates, and, thus, the risk-benefit ratio and the therapeutic index, supporting the design of optimal treatment regimens and accelerating the whole process of clinical drug development. Areas covered: Herein, the most relevant mathematical models used in clinical anticancer drug development during the last decade are described. Less recent models were considered in the review if they represent a standard for the analysis of certain types of efficacy or safety measures. Expert opinion: Several mathematical models have been proposed to predict overall survival from earlier endpoints and validate their surrogacy in demonstrating drug efficacy in place of overall survival. An increasing number of mathematical models have also been developed to describe the safety findings. Modeling has been extensively used in anticancer drug development to individualize dosing strategies based on patient characteristics, and design optimal dosing regimens balancing efficacy and safety.
Integrating Usability Evaluation into Model-Driven Video Game Development
Fernandez , Adrian; Insfran , Emilio; Abrahão , Silvia; Carsí , José ,; Montero , Emanuel
2012-01-01
Part 3: Short Papers; International audience; The increasing complexity of video game development highlights the need of design and evaluation methods for enhancing quality and reducing time and cost. In this context, Model-Driven Development approaches seem to be very promising since a video game can be obtained by transforming platform-independent models into platform-specific models that can be in turn transformed into code. Although this approach is started to being used for video game de...
Time dependent patient no-show predictive modelling development.
Huang, Yu-Li; Hanauer, David A
2016-05-09
Purpose - The purpose of this paper is to develop evident-based predictive no-show models considering patients' each past appointment status, a time-dependent component, as an independent predictor to improve predictability. Design/methodology/approach - A ten-year retrospective data set was extracted from a pediatric clinic. It consisted of 7,291 distinct patients who had at least two visits along with their appointment characteristics, patient demographics, and insurance information. Logistic regression was adopted to develop no-show models using two-thirds of the data for training and the remaining data for validation. The no-show threshold was then determined based on minimizing the misclassification of show/no-show assignments. There were a total of 26 predictive model developed based on the number of available past appointments. Simulation was employed to test the effective of each model on costs of patient wait time, physician idle time, and overtime. Findings - The results demonstrated the misclassification rate and the area under the curve of the receiver operating characteristic gradually improved as more appointment history was included until around the 20th predictive model. The overbooking method with no-show predictive models suggested incorporating up to the 16th model and outperformed other overbooking methods by as much as 9.4 per cent in the cost per patient while allowing two additional patients in a clinic day. Research limitations/implications - The challenge now is to actually implement the no-show predictive model systematically to further demonstrate its robustness and simplicity in various scheduling systems. Originality/value - This paper provides examples of how to build the no-show predictive models with time-dependent components to improve the overbooking policy. Accurately identifying scheduled patients' show/no-show status allows clinics to proactively schedule patients to reduce the negative impact of patient no-shows.
Automated data acquisition technology development:Automated modeling and control development
Romine, Peter L.
1995-01-01
This report documents the completion of, and improvements made to, the software developed for automated data acquisition and automated modeling and control development on the Texas Micro rackmounted PC's. This research was initiated because a need was identified by the Metal Processing Branch of NASA Marshall Space Flight Center for a mobile data acquisition and data analysis system, customized for welding measurement and calibration. Several hardware configurations were evaluated and a PC based system was chosen. The Welding Measurement System (WMS), is a dedicated instrument strickly for use of data acquisition and data analysis. In addition to the data acquisition functions described in this thesis, WMS also supports many functions associated with process control. The hardware and software requirements for an automated acquisition system for welding process parameters, welding equipment checkout, and welding process modeling were determined in 1992. From these recommendations, NASA purchased the necessary hardware and software. The new welding acquisition system is designed to collect welding parameter data and perform analysis to determine the voltage versus current arc-length relationship for VPPA welding. Once the results of this analysis are obtained, they can then be used to develop a RAIL function to control welding startup and shutdown without torch crashing.
Pig models on intestinal development and therapeutics.
Yin, Lanmei; Yang, Huansheng; Li, Jianzhong; Li, Yali; Ding, Xueqing; Wu, Guoyao; Yin, Yulong
2017-12-01
The gastrointestinal tract plays a vital role in nutrient supply, digestion, and absorption, and has a crucial impact on the entire organism. Much attention is being paid to utilize animal models to study the pathogenesis of gastrointestinal diseases in response to intestinal development and health. The piglet has a body size similar to that of the human and is an omnivorous animal with comparable anatomy, nutritional requirements, and digestive and associated inflammatory processes, and displays similarities to the human intestinal microbial ecosystem, which make piglets more appropriate as an animal model for human than other non-primate animals. Therefore, the objective of this review is to summarize key attributes of the piglet model with which to study human intestinal development and intestinal health through probing into the etiology of several gastrointestinal diseases, thus providing a theoretical and hopefully practical, basis for further studies on mammalian nutrition, health, and disease, and therapeutics. Given the comparable nutritional requirements and strikingly similar brain developmental patterns between young piglets and humans, the piglet has been used as an important translational model for studying neurodevelopmental outcomes influenced by pediatric nutrition. Because of similarities in anatomy and physiology between pigs and mankind, more emphasises are put on how to use the piglet model for human organ transplantation research.
A Leadership Identity Development Model: Applications from a Grounded Theory
Komives, Susan R.; Mainella, Felicia C.; Longerbeam, Susan D.; Osteen, Laura; Owen, Julie E.
2006-01-01
This article describes a stage-based model of leadership identity development (LID) that resulted from a grounded theory study on developing a leadership identity (Komives, Owen, Longerbeam, Mainella, & Osteen, 2005). The LID model expands on the leadership identity stages, integrates the categories of the grounded theory into the LID model, and…
International Nuclear Information System (INIS)
Campbell, Eleanor E; Paustian, Keith
2015-01-01
Soil organic matter (SOM) is an important natural resource. It is fundamental to soil and ecosystem functions across a wide range of scales, from site-specific soil fertility and water holding capacity to global biogeochemical cycling. It is also a highly complex material that is sensitive to direct and indirect human impacts. In SOM research, simulation models play an important role by providing a mathematical framework to integrate, examine, and test the understanding of SOM dynamics. Simulation models of SOM are also increasingly used in more ‘applied’ settings to evaluate human impacts on ecosystem function, and to manage SOM for greenhouse gas mitigation, improved soil health, and sustainable use as a natural resource. Within this context, there is a need to maintain a robust connection between scientific developments in SOM modeling approaches and SOM model applications. This need forms the basis of this review. In this review we first provide an overview of SOM modeling, focusing on SOM theory, data-model integration, and model development as evidenced by a quantitative review of SOM literature. Second, we present the landscape of SOM model applications, focusing on examples in climate change policy. We conclude by discussing five areas of recent developments in SOM modeling including: (1) microbial roles in SOM stabilization; (2) modeling SOM saturation kinetics; (3) temperature controls on decomposition; (4) SOM dynamics in deep soil layers; and (5) SOM representation in earth system models. Our aim is to comprehensively connect SOM model development to its applications, revealing knowledge gaps in need of focused interdisciplinary attention and exposing pitfalls that, if avoided, can lead to best use of SOM models to support policy initiatives and sustainable land management solutions. (topical review)
A Framework for Developing the Structure of Public Health Economic Models.
Squires, Hazel; Chilcott, James; Akehurst, Ronald; Burr, Jennifer; Kelly, Michael P
2016-01-01
A conceptual modeling framework is a methodology that assists modelers through the process of developing a model structure. Public health interventions tend to operate in dynamically complex systems. Modeling public health interventions requires broader considerations than clinical ones. Inappropriately simple models may lead to poor validity and credibility, resulting in suboptimal allocation of resources. This article presents the first conceptual modeling framework for public health economic evaluation. The framework presented here was informed by literature reviews of the key challenges in public health economic modeling and existing conceptual modeling frameworks; qualitative research to understand the experiences of modelers when developing public health economic models; and piloting a draft version of the framework. The conceptual modeling framework comprises four key principles of good practice and a proposed methodology. The key principles are that 1) a systems approach to modeling should be taken; 2) a documented understanding of the problem is imperative before and alongside developing and justifying the model structure; 3) strong communication with stakeholders and members of the team throughout model development is essential; and 4) a systematic consideration of the determinants of health is central to identifying the key impacts of public health interventions. The methodology consists of four phases: phase A, aligning the framework with the decision-making process; phase B, identifying relevant stakeholders; phase C, understanding the problem; and phase D, developing and justifying the model structure. Key areas for further research involve evaluation of the framework in diverse case studies and the development of methods for modeling individual and social behavior. This approach could improve the quality of Public Health economic models, supporting efficient allocation of scarce resources. Copyright © 2016 International Society for Pharmacoeconomics
Ecological aspects in sustainable development model
International Nuclear Information System (INIS)
Kurlapov, L.I.
1996-01-01
Environment problems are caused by intensive use of natural resources due to scientific progress in combination with the present structure of unlimited consumption. To prevent the impending ecological disaster a model of sustainable development has been worked out. It is aimed at satisfying the ever-growing requirements of the modern man without damaging the environment. Scientifically grounded use of nature mat contribute to solution of the problem. The acceptable use of nature should take account of the land ecosystem resources which is ensured by reliable model including flow balance in particular. Irreversible flows generate entropy which could be the universal measure of technic genetics impact. Entropic condition of the acceptable (sustainable) development are started: techno-genic entropy production must be less than natural entropy production. Particular sciences should be re-oriented towards environmental problems. Environmental monitoring strategy should provide for determination of macro properties as well as flows. (author)
A descriptive ecosystem model - a strategy for model development during site investigations
International Nuclear Information System (INIS)
Loefgren, Anders
2003-09-01
This report describes a strategy for the development of a site descriptive model for the surface ecosystem on the potential deep repository sites. The surface ecosystem embraces many disciplines, and these have to be identified, described and integrated in order to construct a descriptive ecosystem model that describes and quantifies biotic and abiotic patterns and processes of importance for the ecosystem on the site. The descriptive model includes both present day conditions and historical information. The descriptive ecosystem model will be used to supply input data for the safety assessment and to serve as the baseline model for devising a monitoring program to detect short-term disturbances caused first by the site investigations and later by the construction of the deep repository. Furthermore, it will serve as a reference for future comparisons to determine more long-term effects or changes caused by the deep repository. The report adopts a non-site-specific approach focusing on the following aims: 1. To present and define the properties that will constitute the descriptive ecosystem model. 2. To present a methodology for determining those properties. 3. To describe and develop the framework for the descriptive ecosystem model by integrating the different properties. 4. To present vital data from other site descriptive models such as those for geology or hydrogeology that interacts with and affects the descriptive ecosystem model. The properties are described under four different sections: general physical properties of the landscape, the terrestrial system, the limnic system and the marine system. These headings are further subdivided into entities that integrate properties in relation to processes
A descriptive ecosystem model - a strategy for model development during site investigations
Energy Technology Data Exchange (ETDEWEB)
Loefgren, Anders [Stockholm Univ. (Sweden). Dept. of Botany; Lindborg, Tobias [Swedish Nuclear Fuel and Waste Management Co., Stockholm (Sweden)
2003-09-01
This report describes a strategy for the development of a site descriptive model for the surface ecosystem on the potential deep repository sites. The surface ecosystem embraces many disciplines, and these have to be identified, described and integrated in order to construct a descriptive ecosystem model that describes and quantifies biotic and abiotic patterns and processes of importance for the ecosystem on the site. The descriptive model includes both present day conditions and historical information. The descriptive ecosystem model will be used to supply input data for the safety assessment and to serve as the baseline model for devising a monitoring program to detect short-term disturbances caused first by the site investigations and later by the construction of the deep repository. Furthermore, it will serve as a reference for future comparisons to determine more long-term effects or changes caused by the deep repository. The report adopts a non-site-specific approach focusing on the following aims: 1. To present and define the properties that will constitute the descriptive ecosystem model. 2. To present a methodology for determining those properties. 3. To describe and develop the framework for the descriptive ecosystem model by integrating the different properties. 4. To present vital data from other site descriptive models such as those for geology or hydrogeology that interacts with and affects the descriptive ecosystem model. The properties are described under four different sections: general physical properties of the landscape, the terrestrial system, the limnic system and the marine system. These headings are further subdivided into entities that integrate properties in relation to processes.
Some Recent Developments in Turbulence Closure Modeling
Durbin, Paul A.
2018-01-01
Turbulence closure models are central to a good deal of applied computational fluid dynamical analysis. Closure modeling endures as a productive area of research. This review covers recent developments in elliptic relaxation and elliptic blending models, unified rotation and curvature corrections, transition prediction, hybrid simulation, and data-driven methods. The focus is on closure models in which transport equations are solved for scalar variables, such as the turbulent kinetic energy, a timescale, or a measure of anisotropy. Algebraic constitutive representations are reviewed for their role in relating scalar closures to the Reynolds stress tensor. Seamless and nonzonal methods, which invoke a single closure model, are reviewed, especially detached eddy simulation (DES) and adaptive DES. Other topics surveyed include data-driven modeling and intermittency and laminar fluctuation models for transition prediction. The review concludes with an outlook.
Limitations of JEDI Models | Jobs and Economic Development Impact Models |
Group's IMPLAN accounting software. For JEDI, these are updated every two years for the best available -output modeling remains a widely used methodology for measuring economic development activity. Definition definition of the geographic area under consideration. Datasets of multipliers from IMPLAN are available at
International Jobs and Economic Development Impacts (I-JEDI) Model
Energy Technology Data Exchange (ETDEWEB)
2016-09-01
International Jobs and Economic Development Impacts (I-JEDI) is a freely available economic model that estimates gross economic impacts from wind, solar, biomass, and geothermal energy projects. Building on a similar model for the United States, I-JEDI was developed by the National Renewable Energy Laboratory under the U.S. government's Enhancing Capacity for Low Emission Development Strategies (EC-LEDS) program to support partner countries in assessing economic impacts of LEDS actions in the energy sector.
Historical development of entrainment models for Hudson River striped bass
International Nuclear Information System (INIS)
Christensen, S.W.; Englert, T.L.
1988-01-01
In the mid-1960s, concerns surfaced regarding entrainment and impingement of young-of-the-year (age-0) striped bass by electric power generating facilities on the Hudson River. These concerns stimulated the development of increasingly complex models to evaluate the impacts of these facilities. The earliest simplistic formulas, based on empirical data, proved inadequate because of conceptual shortcomings, incomplete development, and lack of data. By 1972, complex transport models based on biological and hydrodynamic principles had been developed and applied by scientists representing both the utilities and the government. Disagreements about the acceptability of these models spurred the development of even more complex models. The entrainment models stimulated the collection of substantial amounts of field data to define the spatial distributions and entrainment survival of early life stages. As the difficulties of accounting for the movement of early life stages from hydrodynamic principles became more evident and as more field data became available, simpler empirical modeling approaches became both practical and defensible. Both empirical and hydrodynamic modeling approaches were applied during the US Environmental Protection Agency's hearings on the Hudson River power case (1977-1980). The main lessons learned from the experience with entrainment-impingement modeling are that complex mechanistic models are not necessarily better than simpler empirical models for young fish, and that care must be taken to construct even the simple models correctly. 29 refs., 4 figs., 1 tab
Energy and development : A modelling approach
van Ruijven, B.J.|info:eu-repo/dai/nl/304834521
2008-01-01
Rapid economic growth of developing countries like India and China implies that these countries become important actors in the global energy system. Examples of this impact are the present day oil shortages and rapidly increasing emissions of greenhouse gases. Global energy models are used explore
Evolutionary modelling of transitions to sustainable development
International Nuclear Information System (INIS)
Safarzynska, K.
2010-01-01
This thesis has examined how evolutionary economics can contribute to modelling the micromechanisms that underlie transitions towards sustainable development. In general, transitions are fundamental or structural system changes. They involve, or even require, escaping lock-in of dominant, environmentally unsustainable technologies, introducing major technical or social innovations, and changing prevailing social practices and structures. Due to the complexity of socioeconomic interactions, it is not always possible to identify, and thus target with appropriate policy instruments, causes of specific unsustainable patterns of behaviour. Formal modelling exercises can help improve our understanding of the interaction of various transition mechanisms which are otherwise difficult to grasp intuitively. They allow exploring effects of policy interventions in complex systems. However, existing models of transitions focus on social phenomena and seldom address economic problems. As opposed, mainstream (neoclassical) economic models of technological change do not account for social interactions, and changing heterogeneity of users and their perspectives - even though all of these can influence the direction of innovations and patterns of socio-technological development. Evolutionary economics offers an approach that goes beyond neoclassical economics - in the sense of employing more realistic assumptions regarding the behaviour and heterogeneity of consumers, firms and investors. It can complement current transition models by providing them with a better understanding of associated economic dynamics. In this thesis, formal models were proposed to illustrate the usefulness of a range of evolutionary-economic techniques for modelling transitions. Modelling exercises aimed to explain the core properties of socio-economic systems, such as lock-in, path-dependence, coevolution, group selection and recombinant innovation. The studies collected in this dissertation illustrate that
Development of bubble-induced turbulence model for advanced two-fluid model
International Nuclear Information System (INIS)
Hosoi, Hideaki; Yoshida, Hiroyuki
2011-01-01
A two-fluid model can simulate two-phase flow by computational cost less than detailed two-phase flow simulation method such as interface tracking method. The two-fluid model is therefore useful for thermal hydraulic analysis in the large-scale domain such as rod bundles. However, since the two-fluid model includes a lot of constitutive equations verified by use of experimental results, it has problems that the result of analyses depends on accuracy of the constitutive equations. To solve these problems, an advanced two-fluid model has been developed by Japan Atomic Energy Agency. In this model, interface tracking method is combined with two-fluid model to accurately predict large interface structure behavior. Liquid clusters and bubbles larger than a computational cell are calculated using the interface tracking method, and those smaller than the cell are simulated by the two-fluid model. The constitutive equations to evaluate the effects of small bubbles or droplets on two-phase flow are also required in the advanced two-fluid model, just as with the conventional two-fluid model. However, the dependency of small bubbles and droplets on two-phase flow characteristics is relatively small, and fewer experimental results are required to verify the characteristics of large interface structures. Turbulent dispersion force model is one of the most important constitutive equations for the advanced two-fluid model. The turbulent dispersion force model has been developed by many researchers for the conventional two-fluid model. However, existing models implicitly include the effects of large bubbles and the deformation of bubbles, and are unfortunately not applicable to the advanced two-fluid model. In the previous study, the authors suggested the turbulent dispersion force model based on the analogy of Brownian motion. And the authors improved the turbulent dispersion force model in consideration of bubble-induced turbulence to improve the analysis results for small
The Cognitive Modeling of Development of Tourism Sphere
Directory of Open Access Journals (Sweden)
Los Vita O.
2017-10-01
Full Text Available The article explores the inter-sectoral interaction in the tourism sphere, which is based on the application of cognitive modeling. The authors consider the interaction of powers (political environment, tourism (tourism business, business (socio-economic environment and ecology (ecological environment. The ecology is identified as the exceptional decisive factor in creating an enabling environment for the development of the market for tourism services. A static analysis of the cognitive model was carried out, which revealed 624 contours, of which 473 were stabilizing and 151 were destabilizing. Based on results of the systemic characterizations of the cognitive model, it was found that the interaction between the two sectors, tourism (tourist business and business (socio-economic environment needs special attention. A dynamic analysis of the built cognitive model was carried out using the method of impulse processes that helped to generate alternative scenarios for the development of tourism services. As a result, it has been found that increased investment in restaurant and hotel activities facilitates the increase in the level of development of market for tourism services for one period earlier than the increase in financing tourism sphere from the budget.
Development of a dynamic computational model of social cognitive theory.
Riley, William T; Martin, Cesar A; Rivera, Daniel E; Hekler, Eric B; Adams, Marc A; Buman, Matthew P; Pavel, Misha; King, Abby C
2016-12-01
Social cognitive theory (SCT) is among the most influential theories of behavior change and has been used as the conceptual basis of health behavior interventions for smoking cessation, weight management, and other health behaviors. SCT and other behavior theories were developed primarily to explain differences between individuals, but explanatory theories of within-person behavioral variability are increasingly needed as new technologies allow for intensive longitudinal measures and interventions adapted from these inputs. These within-person explanatory theoretical applications can be modeled as dynamical systems. SCT constructs, such as reciprocal determinism, are inherently dynamical in nature, but SCT has not been modeled as a dynamical system. This paper describes the development of a dynamical system model of SCT using fluid analogies and control systems principles drawn from engineering. Simulations of this model were performed to assess if the model performed as predicted based on theory and empirical studies of SCT. This initial model generates precise and testable quantitative predictions for future intensive longitudinal research. Dynamic modeling approaches provide a rigorous method for advancing health behavior theory development and refinement and for guiding the development of more potent and efficient interventions.
Developing a facilitation model to promote organisational development in primary care practices
Directory of Open Access Journals (Sweden)
Elwyn Glyn
2006-06-01
Full Text Available Abstract Background The relationship between effective organisation of general practices and health improvement is widely accepted. The Maturity Matrix is an instrument designed to assess organisational development in general practice settings and to stimulate quality improvement. It is undertaken by a practice team with the aid of a facilitator. There is a tradition in the primary care systems in many countries of using practice visitors to educate practice teams about how to improve. However the role of practice visitors as facilitators who enable teams to plan practice-led organisational development using quality improvement instruments is less well understood. The objectives of the study were to develop and explore a facilitation model to support practice teams in stimulating organisational development using a quality improvement instrument called the Maturity Matrix. A qualitative study based on transcript analysis was adopted. Method A model of facilitation was constructed based on a review of relevant literature. Audio tapes of Maturity Matrix assessment sessions with general practices were transcribed and facilitator skills were compared to the model. The sample consisted of two facilitators working with twelve general practices based in UK primary care. Results The facilitation model suggested that four areas describing eighteen skills were important. The four areas are structuring the session, obtaining consensus, handling group dynamics and enabling team learning. Facilitators effectively employed skills associated with the first three areas, but less able to consistently stimulate team learning. Conclusion This study suggests that facilitators need careful preparation for their role and practices need protected time in order to make best use of practice-led quality improvement instruments. The role of practice visitor as a facilitator is becoming important as the need to engender ownership of the quality improvement process by
Developing a facilitation model to promote organisational development in primary care practices.
Rhydderch, Melody; Edwards, Adrian; Marshall, Martin; Elwyn, Glyn; Grol, Richard
2006-06-19
The relationship between effective organisation of general practices and health improvement is widely accepted. The Maturity Matrix is an instrument designed to assess organisational development in general practice settings and to stimulate quality improvement. It is undertaken by a practice team with the aid of a facilitator. There is a tradition in the primary care systems in many countries of using practice visitors to educate practice teams about how to improve. However the role of practice visitors as facilitators who enable teams to plan practice-led organisational development using quality improvement instruments is less well understood. The objectives of the study were to develop and explore a facilitation model to support practice teams in stimulating organisational development using a quality improvement instrument called the Maturity Matrix. A qualitative study based on transcript analysis was adopted. A model of facilitation was constructed based on a review of relevant literature. Audio tapes of Maturity Matrix assessment sessions with general practices were transcribed and facilitator skills were compared to the model. The sample consisted of two facilitators working with twelve general practices based in UK primary care. The facilitation model suggested that four areas describing eighteen skills were important. The four areas are structuring the session, obtaining consensus, handling group dynamics and enabling team learning. Facilitators effectively employed skills associated with the first three areas, but less able to consistently stimulate team learning. This study suggests that facilitators need careful preparation for their role and practices need protected time in order to make best use of practice-led quality improvement instruments. The role of practice visitor as a facilitator is becoming important as the need to engender ownership of the quality improvement process by practices increases.
Performance of fire behavior fuel models developed for the Rothermel Surface Fire Spread Model
Robert Ziel; W. Matt Jolly
2009-01-01
In 2005, 40 new fire behavior fuel models were published for use with the Rothermel Surface Fire Spread Model. These new models are intended to augment the original 13 developed in 1972 and 1976. As a compiled set of quantitative fuel descriptions that serve as input to the Rothermel model, the selected fire behavior fuel model has always been critical to the resulting...
Research on the Development of E-commerce Model of Agricultural Products
Directory of Open Access Journals (Sweden)
Huo Yaping
2017-01-01
Full Text Available In recent years, electronic commerce of agricultural products has developed rapidly. In the development process of electronic commerce of agricultural products,many classic cases and business models have emerged. Such as tootoo industrial commune model (product drive type, Original life model (marketing driven type, Suichang model (service platform type. The author analyzes and compares each model from 7 aspects, and summarizes their differences and links. Finally, The author puts forward suggestions on the development of electronic commerce of agricultural products in china.
Game dynamic model for yeast development.
Huang, Yuanyuan; Wu, Zhijun
2012-07-01
Game theoretic models, along with replicator equations, have been applied successfully to the study of evolution of populations of competing species, including the growth of a population, the reaching of the population to an equilibrium state, and the evolutionary stability of the state. In this paper, we analyze a game model proposed by Gore et al. (Nature 456:253-256, 2009) in their recent study on the co-development of two mixed yeast strains. We examine the mathematical properties of this model with varying experimental parameters. We simulate the growths of the yeast strains and compare them with the experimental results. We also compute and analyze the equilibrium state of the system and prove that it is asymptotically and evolutionarily stable.
Main principles of developing exploitation models of semiconductor devices
Gradoboev, A. V.; Simonova, A. V.
2018-05-01
The paper represents primary tasks, solutions of which allow to develop the exploitation modes of semiconductor devices taking into account complex and combined influence of ionizing irradiation and operation factors. The structure of the exploitation model of the semiconductor device is presented, which is based on radiation and reliability models. Furthermore, it was shown that the exploitation model should take into account complex and combine influence of various ionizing irradiation types and operation factors. The algorithm of developing the exploitation model of the semiconductor devices is proposed. The possibility of creating the radiation model of Schottky barrier diode, Schottky field-effect transistor and Gunn diode is shown based on the available experimental data. The basic exploitation model of IR-LEDs based upon double AlGaAs heterostructures is represented. The practical application of the exploitation models will allow to output the electronic products with guaranteed operational properties.
Report on the model developments in the sectoral assessments
DEFF Research Database (Denmark)
Iglesias, Ana; Termansen, Mette; Bouwer, Laurens
2014-01-01
into the economic assessments. At the same time, the models will link to the case studies in two ways. First, they use the data in the case studies for model validation and then they provide information to inform stakeholders on adaptation strategies. Therefore, Deliverable 3.2 aims to address three main questions......The Objective of this Deliverable D3.2 is to describe the models developed in BASE that is, the experimental setup for the sectoral modelling. The model development described in this deliverable will then be implemented in the adaptation and economic analysis in WP6 in order to integrate adaptation......: How to address climate adaptation options with the sectoral bottom-up models? - This includes a quantification of the costs of adaptation with the sectoral models, in monetary terms or in other measures of costs. The benefits in this framework will be the avoided damages, therefore a measure...
The waterfall model in large-scale development
Petersen, Kai; Wohlin, Claes; Baca, Dejan
2009-01-01
Waterfall development is still a widely used way of working in software development companies. Many problems have been reported related to the model. Commonly accepted problems are for example to cope with change and that defects all too often are detected too late in the software development process. However, many of the problems mentioned in literature are based on beliefs and experiences, and not on empirical evidence. To address this research gap, we compare the problems in literature wit...
A review on pilot plant development models
International Nuclear Information System (INIS)
Rosli Darmawan
2005-01-01
After more than 30 years, MINT has been able to produce many new findings, products and processes. Some of these have been able to penetrate local and international markets. This was achieved through a systematic commercialisation program practiced in MINT with its technological chain and MINT Technology Park program. This paper will review the development process of MINT pilot plants and compare them with a few other models from other institutions in Malaysia and abroad. The advantages and disadvantages of each model are reviewed and a discussion against MINT's model is presented. (Author)
Energy Technology Data Exchange (ETDEWEB)
Tonks, Michael R [Idaho National Lab. (INL), Idaho Falls, ID (United States); Zhang, Yongfeng [Idaho National Lab. (INL), Idaho Falls, ID (United States); Bai, Xianming [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2014-06-01
This report summarizes development work funded by the Nuclear Energy Advanced Modeling Simulation program's Fuels Product Line (FPL) to develop a mechanistic model for the average grain size in UO₂ fuel. The model is developed using a multiscale modeling and simulation approach involving atomistic simulations, as well as mesoscale simulations using INL's MARMOT code.
Development of Dynamic Spent Nuclear Fuel Environmental Effect Analysis Model
International Nuclear Information System (INIS)
Jeong, Chang Joon; Ko, Won Il; Lee, Ho Hee; Cho, Dong Keun; Park, Chang Je
2010-07-01
The dynamic environmental effect evaluation model for spent nuclear fuel has been developed and incorporated into the system dynamic DANESS code. First, the spent nuclear fuel isotope decay model was modeled. Then, the environmental effects were modeled through short-term decay heat model, short-term radioactivity model, and long-term heat load model. By using the developed model, the Korean once-through nuclear fuel cycles was analyzed. The once-through fuel cycle analysis was modeled based on the Korean 'National Energy Basic Plan' up to 2030 and a postulated nuclear demand growth rate until 2150. From the once-through results, it is shown that the nuclear power demand would be ∼70 GWe and the total amount of the spent fuel accumulated by 2150 would be ∼168000 t. If the disposal starts from 2060, the short-term decay heat of Cs-137 and Sr-90 isotopes are W and 1.8x10 6 W in 2100. Also, the total long-term heat load in 2100 will be 4415 MW-y. From the calculation results, it was found that the developed model is very convenient and simple for evaluation of the environmental effect of the spent nuclear fuel
Development of a robust model-based reactivity control system
International Nuclear Information System (INIS)
Rovere, L.A.; Otaduy, P.J.; Brittain, C.R.
1990-01-01
This paper describes the development and implementation of a digital model-based reactivity control system that incorporates a knowledge of the plant physics into the control algorithm to improve system performance. This controller is composed of a model-based module and modified proportional-integral-derivative (PID) module. The model-based module has an estimation component to synthesize unmeasurable process variables that are necessary for the control action computation. These estimated variables, besides being used within the control algorithm, will be used for diagnostic purposes by a supervisory control system under development. The PID module compensates for inaccuracies in model coefficients by supplementing the model-based output with a correction term that eliminates any demand tracking or steady state errors. This control algorithm has been applied to develop controllers for a simulation of liquid metal reactors in a multimodular plant. It has shown its capability to track demands in neutron power much more accurately than conventional controllers, reducing overshoots to almost negligible value while providing a good degree of robustness to unmodeled dynamics. 10 refs., 4 figs
A Product Development Decision Model for Cockpit Weather Information Systems
Sireli, Yesim; Kauffmann, Paul; Gupta, Surabhi; Kachroo, Pushkin
2003-01-01
There is a significant market demand for advanced cockpit weather information products. However, it is unclear how to identify the most promising technological options that provide the desired mix of consumer requirements by employing feasible technical systems at a price that achieves market success. This study develops a unique product development decision model that employs Quality Function Deployment (QFD) and Kano's model of consumer choice. This model is specifically designed for exploration and resolution of this and similar information technology related product development problems.
A Product Development Decision Model for Cockpit Weather Information System
Sireli, Yesim; Kauffmann, Paul; Gupta, Surabhi; Kachroo, Pushkin; Johnson, Edward J., Jr. (Technical Monitor)
2003-01-01
There is a significant market demand for advanced cockpit weather information products. However, it is unclear how to identify the most promising technological options that provide the desired mix of consumer requirements by employing feasible technical systems at a price that achieves market success. This study develops a unique product development decision model that employs Quality Function Deployment (QFD) and Kano's model of consumer choice. This model is specifically designed for exploration and resolution of this and similar information technology related product development problems.
Joshi, Nitin; Ojha, C. S. P.; Sharma, P. K.
2012-10-01
In this study a conceptual model that accounts for the effects of nonequilibrium contaminant transport in a fractured porous media is developed. Present model accounts for both physical and sorption nonequilibrium. Analytical solution was developed using the Laplace transform technique, which was then numerically inverted to obtain solute concentration in the fracture matrix system. The semianalytical solution developed here can incorporate both semi-infinite and finite fracture matrix extent. In addition, the model can account for flexible boundary conditions and nonzero initial condition in the fracture matrix system. The present semianalytical solution was validated against the existing analytical solutions for the fracture matrix system. In order to differentiate between various sorption/transport mechanism different cases of sorption and mass transfer were analyzed by comparing the breakthrough curves and temporal moments. It was found that significant differences in the signature of sorption and mass transfer exists. Applicability of the developed model was evaluated by simulating the published experimental data of Calcium and Strontium transport in a single fracture. The present model simulated the experimental data reasonably well in comparison to the model based on equilibrium sorption assumption in fracture matrix system, and multi rate mass transfer model.
Whitten-Andrews, Jeanie
2016-01-01
The social change model has proven an effective and widely utilized model assisting college students in leadership development toward positive social change. However, while this particular model gives much needed attention to the process of development leading to social change, it fails to acknowledge the external factors which significantly…
An Assessment between Software Development Life Cycle Models of Software Engineering
Er. KESHAV VERMA; Er. PRAMOD KUMAR; Er. MOHIT KUMAR; Er.GYANESH TIWARI
2013-01-01
This research deals with an essential and important subject in Digital world. It is related with the software managing processes that inspect the part of software development during the development models, which are called as software development life cycle. It shows five of the development models namely, waterfall, Iteration, V-shaped, spiral and Extreme programming. These models have advantages and disadvantages as well. So, the main objective of this research is to represent dissimilar mod...
Developing engineering processes through integrated modelling of product and process
DEFF Research Database (Denmark)
Nielsen, Jeppe Bjerrum; Hvam, Lars
2012-01-01
This article aims at developing an operational tool for integrated modelling of product assortments and engineering processes in companies making customer specific products. Integrating a product model in the design of engineering processes will provide a deeper understanding of the engineering...... activities as well as insight into how product features affect the engineering processes. The article suggests possible ways of integrating models of products with models of engineering processes. The models have been tested and further developed in an action research study carried out in collaboration...... with a major international engineering company....
Model-centric approaches for the development of health information systems.
Tuomainen, Mika; Mykkänen, Juha; Luostarinen, Heli; Pöyhölä, Assi; Paakkanen, Esa
2007-01-01
Modeling is used increasingly in healthcare to increase shared knowledge, to improve the processes, and to document the requirements of the solutions related to health information systems (HIS). There are numerous modeling approaches which aim to support these aims, but a careful assessment of their strengths, weaknesses and deficiencies is needed. In this paper, we compare three model-centric approaches in the context of HIS development: the Model-Driven Architecture, Business Process Modeling with BPMN and BPEL and the HL7 Development Framework. The comparison reveals that all these approaches are viable candidates for the development of HIS. However, they have distinct strengths and abstraction levels, they require local and project-specific adaptation and offer varying levels of automation. In addition, illustration of the solutions to the end users must be improved.
Logic models as a tool for sexual violence prevention program development.
Hawkins, Stephanie R; Clinton-Sherrod, A Monique; Irvin, Neil; Hart, Laurie; Russell, Sarah Jane
2009-01-01
Sexual violence is a growing public health problem, and there is an urgent need to develop sexual violence prevention programs. Logic models have emerged as a vital tool in program development. The Centers for Disease Control and Prevention funded an empowerment evaluation designed to work with programs focused on the prevention of first-time male perpetration of sexual violence, and it included as one of its goals, the development of program logic models. Two case studies are presented that describe how significant positive changes can be made to programs as a result of their developing logic models that accurately describe desired outcomes. The first case study describes how the logic model development process made an organization aware of the importance of a program's environmental context for program success; the second case study demonstrates how developing a program logic model can elucidate gaps in organizational programming and suggest ways to close those gaps.
School nurse summer institute: a model for professional development.
Neighbors, Marianne; Barta, Kathleen
2004-06-01
The components of a professional development model designed to empower school nurses to become leaders in school health services is described. The model was implemented during a 3-day professional development institute that included clinical and leadership components, especially coalition building, with two follow-up sessions in the fall and spring. Coalition building is an important tool to enhance the influence of the school nurse in improving the health of individuals, families, and communities. School nurses and nursing educators with expertise in the specialty of school nursing could replicate this model in their own regions.
Spectral Cascade-Transport Turbulence Model Development for Two-Phase Flows
Brown, Cameron Scott
Turbulence modeling remains a challenging problem in nuclear reactor applications, particularly for the turbulent multiphase flow conditions in nuclear reactor subchannels. Understanding the fundamental physics of turbulent multiphase flows is crucial for the improvement and further development of multiphase flow models used in reactor operation and safety calculations. Reactor calculations with Reynolds-averaged Navier-Stokes (RANS) approach continue to become viable tools for reactor analysis. The on-going increase in available computational resources allows for turbulence models that are more complex than the traditional two-equation models to become practical choices for nuclear reactor computational fluid dynamic (CFD) and multiphase computational fluid dynamic (M-CFD) simulations. Similarly, increased computational capabilities continue to allow for higher Reynolds numbers and more complex geometries to be evaluated using direct numerical simulation (DNS), thus providing more validation and verification data for turbulence model development. Spectral turbulence models are a promising approach to M-CFD simulations. These models resolve mean flow parameters as well as the turbulent kinetic energy spectrum, reproducing more physical details of the turbulence than traditional two-equation type models. Previously, work performed by other researchers on a spectral cascade-transport model has shown that the model behaves well for single and bubbly twophase decay of isotropic turbulence, single and two-phase uniform shear flow, and single-phase flow in a channel without resolving the near-wall boundary layer for relatively low Reynolds number. Spectral models are great candidates for multiphase RANS modeling since bubble source terms can be modeled as contributions to specific turbulence scales. This work focuses on the improvement and further development of the spectral cascadetransport model (SCTM) to become a three-dimensional (3D) turbulence model for use in M
Development of uncertainty-based work injury model using Bayesian structural equation modelling.
Chatterjee, Snehamoy
2014-01-01
This paper proposed a Bayesian method-based structural equation model (SEM) of miners' work injury for an underground coal mine in India. The environmental and behavioural variables for work injury were identified and causal relationships were developed. For Bayesian modelling, prior distributions of SEM parameters are necessary to develop the model. In this paper, two approaches were adopted to obtain prior distribution for factor loading parameters and structural parameters of SEM. In the first approach, the prior distributions were considered as a fixed distribution function with specific parameter values, whereas, in the second approach, prior distributions of the parameters were generated from experts' opinions. The posterior distributions of these parameters were obtained by applying Bayesian rule. The Markov Chain Monte Carlo sampling in the form Gibbs sampling was applied for sampling from the posterior distribution. The results revealed that all coefficients of structural and measurement model parameters are statistically significant in experts' opinion-based priors, whereas, two coefficients are not statistically significant when fixed prior-based distributions are applied. The error statistics reveals that Bayesian structural model provides reasonably good fit of work injury with high coefficient of determination (0.91) and less mean squared error as compared to traditional SEM.
The Development in modeling Tibetan Plateau Land/Climate Interaction
Xue, Yongkang; Liu, Ye; li, qian; Maheswor Shrestha, Maheswor; Ma, Hsi-Yen; Cox, Peter; Sun, shufen; Koike, Toshio
2015-04-01
Tibetan Plateau (TP) plays an important role in influencing the continental and planetary scale climate, including East Asian and South Asian monsoon, circulation and precipitation over West Pacific and Indian Oceans. The numerical study has identified TP as the area with strongest land/atmosphere interactions over the midlatitude land. The land degradation there has also affected the monsoon precipitation in TP along the monsoon pathway. The water cycle there affects water sources for major Asian river systems, which include the Tarim, Amu Darya, Indus, Ganges, Brahmaputra, Irrawaddy, Salween, Mekong, Yellow, and Yangtze Rivers. Despite the importance of TP land process in the climate system, the TP land surface processes are poorly modeled due to lack of data available for model validation. To better understand, simulate, and project the role of Tibetan Plateau land surface processes, better parameterization of the Tibetan Land surface processes have been developed and evaluated. The recently available field measurement there and satellite observation have greatly helped this development. This paper presents these new developments and preliminary results using the newly developed biophysical/dynamic vegetation model, frozen soil model, and glacier model. In recent CMIP5 simulation, the CMIP5 models with dynamic vegetation model show poor performance in simulating the TP vegetation and climate. To better simulate the TP vegetation condition and its interaction with climate, we have developed biophysical/dynamic vegetation model, the Simplified Simple Biosphere Model version 4/Top-down Representation of Interactive Foliage and Flora Including Dynamics Model (SSiB4/TRIFFID), based on water, carbon, and energy balance. The simulated vegetation variables are updates, driven by carbon assimilation, allocation, and accumulation, as well as competition between plant functional types. The model has been validated with the station data, including those measured over the TP
2017-06-01
This research expands the modeling and simulation (M and S) body of knowledge through the development of an Implicit Model Development Process (IMDP...When augmented to traditional Model Development Processes (MDP), the IMDP enables the development of models that can address a broader array of...potential impacts on operational effectiveness. Specifically, the IMDP provides a formalized methodology for developing an improved model definition
Modelling and analysis of international recycling between developed and developing countries
van Beukering, P.J.H.; van den Bergh, J.C.J.M.
2006-01-01
To deal with the complexity of recycling, a wide variety of models have been developed, each serving a specific purpose. Despite the current trend increasing international trade in recycling-related material flows, the international dimension of physical and economic relationships in recycling is
Developing Project Duration Models in Software Engineering
Institute of Scientific and Technical Information of China (English)
Pierre Bourque; Serge Oligny; Alain Abran; Bertrand Fournier
2007-01-01
Based on the empirical analysis of data contained in the International Software Benchmarking Standards Group(ISBSG) repository, this paper presents software engineering project duration models based on project effort. Duration models are built for the entire dataset and for subsets of projects developed for personal computer, mid-range and mainframeplatforms. Duration models are also constructed for projects requiring fewer than 400 person-hours of effort and for projectsre quiring more than 400 person-hours of effort. The usefulness of adding the maximum number of assigned resources as asecond independent variable to explain duration is also analyzed. The opportunity to build duration models directly fromproject functional size in function points is investigated as well.
Linking the Leadership Identity Development Model to Collegiate Recreation and Athletics.
Hall, Stacey L
2015-01-01
The Leadership Identity Development (LID) Model (Komives, Owen, Longerbeam, Mainella, & Osteen, 2005) provides a stage leadership development model for college students that can be applied to collegiate recreation student staff, volunteers, participants, and varsity student-athletes. This chapter provides guidance to implement the model in these settings and to create environments that support development. © 2015 Wiley Periodicals, Inc., A Wiley Company.
Development of Model for Providing Feasible Scholarship
Directory of Open Access Journals (Sweden)
Harry Dhika
2016-05-01
Full Text Available The current work focuses on the development of a model to determine a feasible scholarship recipient on the basis of the naiv¨e Bayes’ method using very simple and limited attributes. Those attributes are the applicants academic year, represented by their semester, academic performance, represented by their GPa, socioeconomic ability, which represented the economic capability to attend a higher education institution, and their level of social involvement. To establish and evaluate the model performance, empirical data are collected, and the data of 100 students are divided into 80 student data for the model training and the remaining of 20 student data are for the model testing. The results suggest that the model is capable to provide recommendations for the potential scholarship recipient at the level of accuracy of 95%.
Developing Soil Models for Dynamic Impact Simulations
Fasanella, Edwin L.; Lyle, Karen H.; Jackson, Karen E.
2009-01-01
This paper describes fundamental soils characterization work performed at NASA Langley Research Center in support of the Subsonic Rotary Wing (SRW) Aeronautics Program and the Orion Landing System (LS) Advanced Development Program (ADP). LS-DYNA(Registered TradeMark)1 soil impact model development and test-analysis correlation results are presented for: (1) a 38-ft/s vertical drop test of a composite fuselage section, outfitted with four blocks of deployable energy absorbers (DEA), onto sand, and (2) a series of impact tests of a 1/2-scale geometric boilerplate Orion capsule onto soil. In addition, the paper will discuss LS-DYNA contact analysis at the soil/structure interface, methods used to estimate frictional forces, and the sensitivity of the model to density, moisture, and compaction.
Revisa milestones report. Task 2.1: development of material models
International Nuclear Information System (INIS)
Nicolas, L.
1998-01-01
This report is the CEA contribution to the Milestone report of the REVISA project (Task 2.1). This task is particularly devoted to the development of advanced material models. CEA uses two different constitutive concepts. The first model is a coupled damage-visco-plasticity model proposed by Lemaitre and Chaboche. The second model is a non unified visco-plasticity model proposed by Contesti and Cailletaud, where the classical decomposition of the total inelastic strain into a time independent plastic part and a time dependent creep part is assumed. The introduction of isotropic damage in this model is part of the developments presented in this report. (author)
Tabulated Combustion Model Development For Non-Premixed Flames
Kundu, Prithwish
Turbulent non-premixed flames play a very important role in the field of engineering ranging from power generation to propulsion. The coupling of fluid mechanics and complicated combustion chemistry of fuels pose a challenge for the numerical modeling of these type of problems. Combustion modeling in Computational Fluid Dynamics (CFD) is one of the most important tools used for predictive modeling of complex systems and to understand the basic fundamentals of combustion. Traditional combustion models solve a transport equation of each species with a source term. In order to resolve the complex chemistry accurately it is important to include a large number of species. However, the computational cost is generally proportional to the cube of number of species. The presence of a large number of species in a flame makes the use of CFD computationally expensive and beyond reach for some applications or inaccurate when solved with simplified chemistry. For highly turbulent flows, it also becomes important to incorporate the effects of turbulence chemistry interaction (TCI). The aim of this work is to develop high fidelity combustion models based on the flamelet concept and to significantly advance the existing capabilities. A thorough investigation of existing models (Finite-rate chemistry and Representative Interactive Flamelet (RIF)) and comparative study of combustion models was done initially on a constant volume combustion chamber with diesel fuel injection. The CFD modeling was validated with experimental results and was also successfully applied to a single cylinder diesel engine. The effect of number of flamelets on the RIF model and flamelet initialization strategies were studied. The RIF model with multiple flamelets is computationally expensive and a model was proposed on the frame work of RIF. The new model was based on tabulated chemistry and incorporated TCI effects. A multidimensional tabulated chemistry database generation code was developed based on the 1
A formative model for student nurse development and evaluation
Directory of Open Access Journals (Sweden)
A. S. van der Merwe
1996-03-01
Full Text Available Preparing student nurses for the profession is a complex task for nurse educators; especially when dealing with the development of personal and interpersonal skills, qualities and values held in high esteem by the nursing profession and the community they serve. These researchers developed a model for formative evaluation of students by using the principles of inductive and deductive reasoning. This model was implemented in clinical practice situations and evaluated for its usefulness. It seems that the model enhanced the standards of nursing care because it had a positive effect on the behaviour of students and they were better motivated; the model also improved interpersonal relationships and communication between practising nurses and students.
Research Article Special Issue
African Journals Online (AJOL)
pc
2018-03-07
Mar 7, 2018 ... International License. ... Journal of Fundamental and Applied Scienc ... ndamental and Applied Sciences is licensed under a Creative Commons Attribution ... spatial skills (VSS), level of Geometry thinking (LGT), SketchUp.
Shigella vaccine development: prospective animal models and current status.
Kim, Yeon-Jeong; Yeo, Sang-Gu; Park, Jae-Hak; Ko, Hyun-Jeong
2013-01-01
Shigella was first discovered in 1897 and is a major causative agent of dysenteric diarrhea. The number of affected patients has decreased globally because of improved sanitary conditions; however, Shigella still causes serious problems in many subjects, including young children and the elderly, especially in developing countries. Although antibiotics may be effective, a vaccine would be the most powerful solution to combat shigellosis because of the emergence of drug-resistant strains. However, the development of a vaccine is hampered by several problems. First, there is no suitable animal model that can replace human-based studies for the investigation of the in vivo mechanisms of Shigella vaccines. Mouse, guinea pig, rat, rabbit, and nonhuman primates could be used as models for shigellosis, but they do not represent human shigellosis and each has its own weaknesses. However, a recent murine model based on peritoneal infection with virulent S. flexneri 2a is promising. Moreover, although the inflammatory responses and mechanisms such as pathogenassociated molecular patterns and danger-associated molecular patterns have been studied, the pathology and immunology of Shigella are still not clearly defined. Despite these obstacles, many vaccine candidates have been developed, including live attenuated, killed whole cells, conjugated, and subunit vaccines. The development of Shigella vaccines also demands considerations of the cost, routes of administration, ease of storage (stability), cross-reactivity, safety, and immunogenicity. The main aim of this review is to provide a detailed introduction to the many promising vaccine candidates and animal models currently available, including the newly developed mouse model.
Automation of program model developing for complex structure control objects
International Nuclear Information System (INIS)
Ivanov, A.P.; Sizova, T.B.; Mikhejkina, N.D.; Sankovskij, G.A.; Tyufyagin, A.N.
1991-01-01
A brief description of software for automated developing the models of integrating modular programming system, program module generator and program module library providing thermal-hydraulic calcualtion of process dynamics in power unit equipment components and on-line control system operation simulation is given. Technical recommendations for model development are based on experience in creation of concrete models of NPP power units. 8 refs., 1 tab., 4 figs
Rahimaghaee, Flora; Nayeri, Nahid Dehghan; Mohammadi, Eesa; Salavati, Shahram
2015-01-01
Background: Professional development is reiterated in the new definition of modern organizations as a serious undertaking of organizations. This article aims to present and describe a prescriptive model to increase the quality of professional development of Iranian nurses within an organization-based framework. Materials and Methods: This article is an outcome of the results of a study based on grounded theory describing how Iranian nurses develop. The present study adopted purposive sampling and the initial participants were experienced clinical nurses. Then, the study continued by theoretical sampling. The present study involved 21 participants. Data were mainly collected through interviews. Analysis began with open coding and continued with axial coding and selective coding. Trustworthiness was ensured by applying Lincoln and Guba criteria such as credibility, dependability, and conformability. Based on the data gathered in the study and a thorough review of related literature, a prescriptive model has been designed by use of the methodology of Walker and Avant (2005). Results: In this model, the first main component is a three-part structure: Reformation to establish a value-assigning structure, a position for human resource management, and a job redesigning. The second component is certain of opportunities for organization-oriented development. These strategies are as follows: Raising the sensitivity of the organization toward development, goal setting and planning the development of human resources, and improving management practices. Conclusions: Through this model, clinical nurses’ professional development can transform the profession from an individual, randomized activity into more planned and systematized services. This model can lead to a better quality of care. PMID:26457100
Spatial Development Modeling Methodology Application Possibilities in Vilnius
Directory of Open Access Journals (Sweden)
Lina Panavaitė
2017-05-01
Full Text Available In order to control the continued development of high-rise buildings and their irreversible visual impact on the overall silhouette of the city, the great cities of the world introduced new methodological principles to city’s spatial development models. These methodologies and spatial planning guidelines are focused not only on the controlled development of high-rise buildings, but on the spatial modelling of the whole city by defining main development criteria and estimating possible consequences. Vilnius city is no exception, however the re-establishment of independence of Lithuania caused uncontrolled urbanization process, so most of the city development regulations emerged as a consequence of unmanaged processes of investors’ expectations legalization. The importance of consistent urban fabric as well as conservation and representation of city’s most important objects gained attention only when an actual threat of overshadowing them with new architecture along with unmanaged urbanization in the city center or urban sprawl at suburbia, caused by land-use projects, had emerged. Current Vilnius’ spatial planning documents clearly define urban structure and key development principles, however the definitions are relatively abstract, causing uniform building coverage requirements for territories with distinct qualities and simplifying planar designs which do not meet quality standards. The overall quality of urban architecture is not regulated. The article deals with current spatial modeling methods, their individual parts, principles, the criteria for quality assessment and their applicability in Vilnius. The text contains an outline of possible building coverage regulations and impact assessment criteria for new development. The article contains a compendium of requirements for high-quality spatial planning and building design.
Jadcherla, Sudarshan R.; Stoner, Erin; Gupta, Alankar; Bates, D. Gregory; Fernandez, Soledad; Di Lorenzo, Carlo; Linscheid, Thomas
2013-01-01
Background and objectives Abnormal swallowing (dysphagia) among neonates is commonly evaluated using the videofluoroscopic swallow study (VSS). Radiological findings considered high risk for administration of oral feeding include nasopharyngeal reflux, laryngeal penetration, aspiration, or pooling. Our aims were to determine pharyngoesophageal motility correlates in neonates with dysphagia and the impact of multidisciplinary feeding strategy. Methods Twenty dysphagic neonates (mean gestation ± standard deviation [SD] = 30.9 ± 4.9 weeks; median 31.1 weeks; range = 23.7–38.6 weeks) with abnormal VSS results were evaluated at 49.9 ± 16.5 weeks (median 41.36 weeks) postmenstrual age. The subjects underwent a swallow-integrated pharyngoesophageal motility assessment of basal and adaptive swallowing reflexes using a micromanometry catheter and pneumohydraulic water perfusion system. Based on observations during the motility study, multidisciplinary feeding strategies were applied and included postural adaptation, sensory modification, hunger manipulation, and operant conditioning methods. To discriminate pharyngoesophageal manometry correlates between oral feeders and tube feeders, data were stratified based on the primary feeding method at discharge, oral feeding versus tube feeding. Results At discharge, 15 of 20 dysphagic neonates achieved oral feeding success, and the rest required chronic tube feeding. Pharyngoesophageal manometry correlates were significantly different (P dysphagia or its consequences. Manometry may be a better predictor than VSS in identifying patients who are likely to succeed in vigorous intervention programs. PMID:19179881
Association between vestibular schwannomas and mobile phone use.
Moon, In Seok; Kim, Bo Gyung; Kim, Jinna; Lee, Jong Dae; Lee, Won-Sang
2014-01-01
Vestibular schwannomas (VSs) grow in the region where the energy from mobile phone use is absorbed. We examined the associations of VSs with mobile phone use. This study included 119 patients who had undergone surgical tumor removal. We used two approaches in this investigation. First, a case-control study for the association of mobile phone use and incidence of VSs was conducted. Both cases and controls were investigated with questions based on INTERPHONE guidelines. Amount of mobile phone use according to duration, daily amount, and cumulative hours were compared between two groups. We also conducted a case-case study. The location and volume of the tumors were investigated by MRI. Associations between the estimated amount of mobile phone use and tumor volume and between the laterality of phone use and tumor location were analyzed. In a case-control study, the odds ratio (OR) of tumor incidence according to mobile phone use was 0.956. In the case-case study, tumor volume and estimated cumulative hours showed a strong correlation (r(2) = 0.144, p = 0.002), and regular mobile phone users showed tumors of a markedly larger volume than those of non-regular users (p mobile phones and tumor volume that showed strong correlation with amount of mobile phone use, thus there is a possibility that mobile phone use may affect tumor growth.
Ye, Tingting; Li, Xiang; Zhang, Ting; Su, Yinglong; Zhang, Wenjuan; Li, Jun; Gan, Yanfei; Zhang, Ai; Liu, Yanan; Xue, Gang
2018-03-20
Bio-refinery of food waste and waste activated sludge to high value-added chemicals, such as lactic acid, has attracted particular interest in recent years. In this paper, the effect of copper (II) dosing to the organic waste fermentation system on lactic acid production was evaluated, which proved to be a promising method to stimulate high yield of lactic acid (77.0% higher than blank) at dosage of 15 μM-Cu 2+ /g VSS. As mechanism study suggested, copper addition enhanced the activity of α-glycosidase and glycolysis, which increased the substrate for subsequent acidification; whereas, the high dosage (70 μM-Cu 2+ /g VSS) inhibited the conversion of lactic acid to VFA, thus stabilized lactic acid concentration. Microbial community study revealed that small amount of copper (II) at 15 μM/g VSS resulted in the proliferation of Lactobacillus to 82.6%, which mainly produced lactic acid. Finally, the variation of functional capabilities implied that the proposed homeostatic system II was activated at relatively low concentration of copper. Meanwhile, membrane transport function and carbohydrate metabolism were also strengthened. This study provides insights into the effect of copper (II) on the enhancement of lactic acid production from co-fermentation of food waste and waste activated sludge. Copyright © 2018 Elsevier Ltd. All rights reserved.
A model-based software development methodology for high-end automotive components
Ravanan, Mahmoud
2014-01-01
This report provides a model-based software development methodology for high-end automotive components. The V-model is used as a process model throughout the development of the software platform. It offers a framework that simplifies the relation between requirements, design, implementation,
The System Dynamics Model for Development of Organic Agriculture
Rozman, Črtomir; Škraba, Andrej; Kljajić, Miroljub; Pažek, Karmen; Bavec, Martina; Bavec, Franci
2008-10-01
Organic agriculture is the highest environmentally valuable agricultural system, and has strategic importance at national level that goes beyond the interests of agricultural sector. In this paper we address development of organic farming simulation model based on a system dynamics methodology (SD). The system incorporates relevant variables, which affect the development of the organic farming. The group decision support system (GDSS) was used in order to identify most relevant variables for construction of causal loop diagram and further model development. The model seeks answers to strategic questions related to the level of organically utilized area, levels of production and crop selection in a long term dynamic context and will be used for simulation of different policy scenarios for organic farming and their impact on economic and environmental parameters of organic production at an aggregate level.
Development of thermal hydraulic models for the reliable regulatory auditing code
Energy Technology Data Exchange (ETDEWEB)
Chung, B. D.; Song, C. H.; Lee, Y. J.; Kwon, T. S.; Lee, S. W. [Korea Automic Energy Research Institute, Taejon (Korea, Republic of)
2004-02-15
The objective of this project is to develop thermal hydraulic models for use in improving the reliability of the regulatory auditing codes. The current year fall under the second step of the 3 year project, and the main researches were focused on the development of downcorner boiling model. During the current year, the bubble stream model of downcorner has been developed and installed in he auditing code. The model sensitivity analysis has been performed for APR1400 LBLOCA scenario using the modified code. The preliminary calculation has been performed for the experimental test facility using FLUENT and MARS code. The facility for air bubble experiment has been installed. The thermal hydraulic phenomena for VHTR and super critical reactor have been identified for the future application and model development.
Development of constitutive model for composites exhibiting time dependent properties
International Nuclear Information System (INIS)
Pupure, L; Joffe, R; Varna, J; Nyström, B
2013-01-01
Regenerated cellulose fibres and their composites exhibit highly nonlinear behaviour. The mechanical response of these materials can be successfully described by the model developed by Schapery for time-dependent materials. However, this model requires input parameters that are experimentally determined via large number of time-consuming tests on the studied composite material. If, for example, the volume fraction of fibres is changed we have a different material and new series of experiments on this new material are required. Therefore the ultimate objective of our studies is to develop model which determines the composite behaviour based on behaviour of constituents of the composite. This paper gives an overview of problems and difficulties, associated with development, implementation and verification of such model
The development of the Professional Values Model in Nursing.
Kaya, Ayla; Boz, İlkay
2017-01-01
One of the most important criteria for professionalism is accumulation of knowledge that is usable in professional practice. Nursing models and theories are important elements of accumulating nursing knowledge and have a chance to guarantee the ethical professional practice. In recent years, there has been an increase in the use of models in nursing research and newly created terminology has started to be used in nursing. In this study, a new model, termed as the Professional Values Model, developed by the authors was described. Concepts comprising the conceptual framework of the model and relations between the concepts were explained. It is assumed that awareness about concepts of the model will increase not only the patients' satisfaction with nursing care, but also the nurses' job satisfaction and quality of nursing care. Contemporary literature has been reviewed and synthesized to develop this theoretical paper on the Professional Values Model in nursing. Having high values in nursing increases job satisfaction, which results in the improvement of patient care and satisfaction. Also, individual characteristics are effective in the determination of individual needs, priorities, and values. This relation, proved through research about the Professional Values Model, has been explained. With development of these concepts, individuals' satisfaction with care and nurses' job satisfaction will be enhanced, which will increase the quality of nursing care. Most importantly, nurses can take proper decisions about ethical dilemmas and take ethical action when they take these values into consideration when giving care. The Professional Values Model seems suitable for nurse managers and it is expected that testing will improve it. Implementation of the Professional Values Model by nurse managers may increase motivation of nurses they work with. It is suggested that guidance by the Professional Values Model may help in enhancement of motivation efforts of the nurse managers
Parallel Development of Products and New Business Models
Lund, Morten; Hansen, Poul H. Kyvsgård
2014-01-01
The perception of product development and the practical execution of product development in professional organizations have undergone dramatic changes in recent years. Many of these chances relate to introduction of broader and more cross-disciplinary views that involves new organizational functions and new concepts. These chances can be captured in various generations of practice. This paper will discuss the recent development of 3rd generation product development process models and the emer...
Development of hybrid 3-D hydrological modeling for the NCAR Community Earth System Model (CESM)
Energy Technology Data Exchange (ETDEWEB)
Zeng, Xubin [Univ. of Arizona, Tucson, AZ (United States); Troch, Peter [Univ. of Arizona, Tucson, AZ (United States); Pelletier, Jon [Univ. of Arizona, Tucson, AZ (United States); Niu, Guo-Yue [Univ. of Arizona, Tucson, AZ (United States); Gochis, David [NCAR Research Applications (RAL), Boulder, CO (United States)
2015-11-15
This is the Final Report of our four-year (3-year plus one-year no cost extension) collaborative project between the University of Arizona (UA) and the National Center for Atmospheric Research (NCAR). The overall objective of our project is to develop and evaluate the first hybrid 3-D hydrological model with a horizontal grid spacing of 1 km for the NCAR Community Earth System Model (CESM). We have made substantial progress in model development and evaluation, computational efficiencies and software engineering, and data development and evaluation, as discussed in Sections 2-4. Section 5 presents our success in data dissemination, while Section 6 discusses the scientific impacts of our work. Section 7 discusses education and mentoring success of our project, while Section 8 lists our relevant DOE services. All peer-reviewed papers that acknowledged this project are listed in Section 9. Highlights of our achievements include: • We have finished 20 papers (most published already) on model development and evaluation, computational efficiencies and software engineering, and data development and evaluation • The global datasets developed under this project have been permanently archived and publicly available • Some of our research results have already been implemented in WRF and CLM • Patrick Broxton and Michael Brunke have received their Ph.D. • PI Zeng has served on DOE proposal review panels and DOE lab scientific focus area (SFA) review panels
Development and evaluation of thermal model reduction algorithms for spacecraft
Deiml, Michael; Suderland, Martin; Reiss, Philipp; Czupalla, Markus
2015-05-01
This paper is concerned with the topic of the reduction of thermal models of spacecraft. The work presented here has been conducted in cooperation with the company OHB AG, formerly Kayser-Threde GmbH, and the Institute of Astronautics at Technische Universität München with the goal to shorten and automatize the time-consuming and manual process of thermal model reduction. The reduction of thermal models can be divided into the simplification of the geometry model for calculation of external heat flows and radiative couplings and into the reduction of the underlying mathematical model. For simplification a method has been developed which approximates the reduced geometry model with the help of an optimization algorithm. Different linear and nonlinear model reduction techniques have been evaluated for their applicability in reduction of the mathematical model. Thereby the compatibility with the thermal analysis tool ESATAN-TMS is of major concern, which restricts the useful application of these methods. Additional model reduction methods have been developed, which account to these constraints. The Matrix Reduction method allows the approximation of the differential equation to reference values exactly expect for numerical errors. The summation method enables a useful, applicable reduction of thermal models that can be used in industry. In this work a framework for model reduction of thermal models has been created, which can be used together with a newly developed graphical user interface for the reduction of thermal models in industry.
Proposal for product development model focused on ce certification methodology
Directory of Open Access Journals (Sweden)
Nathalia Marcia Goulart Pinheiro
2015-09-01
Full Text Available This paper presents a critical analysis comparing 21 product development models in order to identify whether these structures meet the demands Product Certification of the European Community (CE. Furthermore, it presents a product development model, comprising the steps in the models analyzed, including improvements in activities for referred product certification. The proposed improvements are justified by the growing quest for the internationalization of products and processes within companies.
ICFD modeling of final settlers - developing consistent and effective simulation model structures
DEFF Research Database (Denmark)
Plósz, Benedek G.; Guyonvarch, Estelle; Ramin, Elham
CFD concept. The case of secondary settling tanks (SSTs) is used to demonstrate the methodological steps using the validated CFD model with the hindered-transientcompression settling velocity model by (10). Factor screening and latin hypercube sampling (LSH) are used to degenerate a 2-D axi-symmetrical CFD...... of (i) assessing different density current sub-models; (ii) implementation of a combined flocculation, hindered, transient and compression settling velocity function; and (iii) assessment of modelling the onset of transient and compression settling. Results suggest that the iCFD model developed...... the feed-layer. These scenarios were inspired by literature (1; 2; 9). As for the D0--iCFD model, values of SSRE obtained are below 1 with an average SSRE=0.206. The simulation model thus can predict the solids distribution inside the tank with a satisfactory accuracy. Averaged relative errors of 8.1 %, 3...
Multilevel flow models studio: human-centralized development for operation support system
International Nuclear Information System (INIS)
Zhou Yangping; Hidekazu Yoshikawa; Liu Jingquan; Yang Ming; Ouyang Jun
2005-01-01
Computerized Operation Support Systems (COSS), integrating Artificial Intelligence, Multimedia and Network Technology, are now being proposed for reducing operator's cognitive load for process operation. This study proposed a Human-Centralized Development (HCD) that COSS can be developed and maintained independently, conveniently and flexibly by operator and expert of industry system with little expertise on software development. A graphical interface system for HCD, Multilevel Flow Models Studio (MFMS), is proposed for development assistance of COSS. An Extensible Markup Language based file structure is designed to represent the Multilevel Flow Models (MFM) model for the target system. With a friendly graphical interface, MFMS mainly consists of two components: 1) an editor to intelligently assist user establish and maintain the MFM model; 2) an executor to implement the application for monitoring, diagnosis and operational instruction in terms of the established MFM model. A prototype MFMS system has been developed and applied to construct a trial operation support system for a Nuclear Power Plant simulated by RELAP5/MOD2. (authors)
Mathematical models of human cerebellar development in the fetal period.
Dudek, Krzysztof; Nowakowska-Kotas, Marta; Kędzia, Alicja
2018-04-01
The evaluation of cerebellar growth in the fetal period forms a part of a widely used examination to identify any features of abnormalities in early stages of human development. It is well known that the development of anatomical structures, including the cerebellum, does not always follow a linear model of growth. The aim of the study was to analyse a variety of mathematical models of human cerebellar development in fetal life to determine their adequacy. The study comprised 101 fetuses (48 males and 53 females) between the 15th and 28th weeks of fetal life. The cerebellum was exposed and measurements of the vermis and hemispheres were performed, together with statistical analyses. The mathematical model parameters of fetal growth were assessed for crown-rump length (CRL) increases, transverse cerebellar diameter and ventrodorsal dimensions of the cerebellar vermis in the transverse plane, and rostrocaudal dimensions of the cerebellar vermis and hemispheres in the frontal plane. A variety of mathematical models were applied, including linear and non-linear functions. Taking into consideration the variance between models and measurements, as well as correlation parameters, the exponential and Gompertz models proved to be the most suitable for modelling cerebellar growth in the second and third trimesters of pregnancy. However, the linear model gave a satisfactory approximation of cerebellar growth, especially in older fetuses. The proposed models of fetal cerebellar growth constructed on the basis of anatomical examination and objective mathematical calculations could be useful in the estimation of fetal development. © 2018 Anatomical Society.
Leakage of colon anastomoses: development of an experimental model in pigs
DEFF Research Database (Denmark)
Nordentoft, Tyge; Sørensen, Michael
2007-01-01
model has only been developed in one gastric bypass study. The aim of the present study was to develop a leakage model of pig colon anastomoses. This type of study has never been performed before. Materials and Methods: Anastomosis was performed in 22 pigs. In all anastomoses a standardized rupture......: A model of anastomotic leakage on pig colon is developed with creation of a 21-mm rupture in the anastomotic line....
Sheriff, R; Banks, A
2001-01-01
Organization change efforts have led to critically examining the structure of education and development departments within hospitals. This qualitative study evaluated an education and development model in an academic health sciences center. The model combines centralization and decentralization. The study results can be used by staff development educators and administrators when organization structure is questioned. This particular model maximizes the benefits and minimizes the limitations of centralized and decentralized structures.
Animal Migraine Models for Drug Development
DEFF Research Database (Denmark)
Jansen-Olesen, Inger; Tfelt-Hansen, Peer; Olesen, Jes
2013-01-01
Migraine is number seven in WHO's list of all diseases causing disability and the third most costly neurological disorder in Europe. Acute attacks are treatable by highly selective drugs such as the triptans but there is still a huge unmet therapeutic need. Unfortunately, drug development...... for headache has almost come to a standstill partly because of a lack of valid animal models. Here we review previous models with emphasis on optimal characteristics of a future model. In addition to selection of animal species, the method of induction of migraine-like changes and the method of recording...... responses elicited by such measures are crucial. The most naturalistic way of inducing attacks is by infusion of endogenous signaling molecules that are known to cause migraine in patients. The most valid response is recording of neural activity in the trigeminal system. The most useful headache related...
Modelling the canopy development of bambara groundnut
DEFF Research Database (Denmark)
Karunaratne, A.S.; Azam-Ali, S.N.; Al-Shareef, I.
2010-01-01
Canopy development of bambara groundnut (Vigna subterranea (L.) Verdc) is affected by temperature stress, drought stress and photoperiod. The quantification of these documented effects by means of a suitable crop model, BAMGRO is presented in this paper. Data on canopy development from five growth...... chamber, four glasshouse and three field experiments were analyzed to calibrate and validate the BAMGRO model to produce simulations for temperature stress, drought stress and photoperiodic effect on two contrasting landraces; Uniswa Red (Swaziland) and S19-3 (Namibia). The daily initiation rate of new...... leaves is calculated by means of a Gaussian function and is altered by temperature stress, drought stress, photoperiod and plant density. The rate in dead leaf number is dependent upon the maximum senescence fraction which can be explained by physiological maturity, mutual shading, temperature stress...
SpaceWire model development technology for satellite architecture.
Energy Technology Data Exchange (ETDEWEB)
Eldridge, John M.; Leemaster, Jacob Edward; Van Leeuwen, Brian P.
2011-09-01
Packet switched data communications networks that use distributed processing architectures have the potential to simplify the design and development of new, increasingly more sophisticated satellite payloads. In addition, the use of reconfigurable logic may reduce the amount of redundant hardware required in space-based applications without sacrificing reliability. These concepts were studied using software modeling and simulation, and the results are presented in this report. Models of the commercially available, packet switched data interconnect SpaceWire protocol were developed and used to create network simulations of data networks containing reconfigurable logic with traffic flows for timing system distribution.
A Model for the Development of University Curricula in Nanoelectronics
Bruun, E.; Nielsen, I.
2010-01-01
Nanotechnology is having an increasing impact on university curricula in electrical engineering and in physics. Major influencers affecting developments in university programmes related to nanoelectronics are discussed and a model for university programme development is described. The model takes into account that nanotechnology affects not only…
Towards a reference model for portfolio management for product development
DEFF Research Database (Denmark)
Larsson, Flemming
2006-01-01
The aim of this paper is to explore the concept of portfolio management for product development at company level. Departing from a combination of explorative interviews with industry professionals and a literature review a proposal for a reference model for portfolio management is developed....... The model consists of a set of defined and interrelated concepts which forms a coherent and consistent reference model that explicate the totality of the portfolio management concept at company level in terms of structure, processes and elements. The model simultaneously pinpoints, positions and integrates...... several central dimensions of portfolio management....
Development Status of TRACE model for PGSFR Safety Evaluation
Energy Technology Data Exchange (ETDEWEB)
Shin, Andong; Choi, Yong Won; Kim, Jihun; Bae, Moohoon [Korea Institute of Nuclear Safety, Daejeon (Korea, Republic of)
2014-05-15
For the preparation of the review of licensing application for PGSFR, TRACE model for the PGSFR is being developed considering the sodium related properties and model in the code. For the use of licensing purpose, it is identified and need to be improved that model uncertainty in the code and conservative conditions for accident analysis is needs to be defined and validated. And current simulations are applicable only to assembly-averaged assessment. So it is also need to be defined for pin-wise assessment within hot assembly. On the basis on the developed model, PGSFR design change will be applied and improved for independent audit calculation for incoming licensing review. Prototype Generation IV Sodium cooled Fast Reactor (PGSFR) of 150MWe is under developing targeting licensing application by 2017. KINS is preparing review of its licensing application, especially the audit calculation tool for transient and accident analysis is being prepared for review. Since 2012, TRACE code applicability study has been doing for the Sodium-cooled Fast Reactor. At first, Sodium properties and the related heat transfer model in the code were reviewed. Demonstration Sodium cooled Fast Reactor (DSFR-600) were model and representing DBAs were assessed until the PGSFR design is fixed. EBR-II Shutdown Heat Removal Test (SHRT) experiment is also being analyzed in terms of IAEA Cooperated Research Program. In this paper, PGSFR TRACE code modeling status and considerations for SFR DBA assessment is introduced.
[Alternatives to the drug research and development model].
Velásquez, Germán
2015-03-01
One-third of the global population lacks access to medications; the situation is worse in poor countries, where up to 50% of the population lacks access. The failure of current incentive systems based in intellectual property to offer the necessary pharmaceutical products, especially in the global south, is a call to action. Problems related to drug access cannot be solved solely through improvements or modifications in the existing incentive models. The intellectual property system model does not offer sufficient innovation for developing countries; new mechanisms that effectively promote innovation and drug access simultaneously are needed. A binding international agreement on research and development, negotiated under the auspices of the World Health Organization, could provide an adequate framework for guaranteeing priority-setting, coordination, and sustainable financing of drugs at reasonable prices for developing countries.
Model of development of manager`s leadership competences
Directory of Open Access Journals (Sweden)
Milena Kirilova Filipova
2015-12-01
Full Text Available Leadership is not what the leader does, but what is done by the leader and the team together. The leader’s competences are requisite not only to the political leaders but also to the managers of big corporations. The skills of active influence on the social reality underlie each successful business and each successful career. The main purpose of the article is to propose a model for development of the leader’s competences of the manager. The main result to be achieved is designed model of leader’s competences development by the means of which the areas in which the manager needs improvement shall be developed. The major research methods used in this work are method of comparison, intuitive and systematic approach, method of analysis and synthesis.
Animal models for dengue vaccine development and testing.
Na, Woonsung; Yeom, Minjoo; Choi, Il-Kyu; Yook, Heejun; Song, Daesub
2017-07-01
Dengue fever is a tropical endemic disease; however, because of climate change, it may become a problem in South Korea in the near future. Research on vaccines for dengue fever and outbreak preparedness are currently insufficient. In addition, because there are no appropriate animal models, controversial results from vaccine efficacy assessments and clinical trials have been reported. Therefore, to study the mechanism of dengue fever and test the immunogenicity of vaccines, an appropriate animal model is urgently needed. In addition to mouse models, more suitable models using animals that can be humanized will need to be constructed. In this report, we look at the current status of model animal construction and discuss which models require further development.
PETA KENDALI X DENGAN UKURAN SAMPEL DAN INTERVAL PENGAMBILAN SAMPEL YANG BERVARIASI
Directory of Open Access Journals (Sweden)
Tanti Octavia
2000-01-01
Full Text Available Shewhart X chart is widely used in statistical process control for monitoring variable data and has shown good performance in detecting large mean shift but less sensitive in detecting moderate to small process shift. X chart with variable sample size and sampling interval (VSSI X chart is proposed to enhance the ability of detecting moderate to small process shift. The performance of VSSI X chart is compared with those of Shewhart X chart, VSS X chart (Variable Sample Size X chart and VSI X chart (Variable Sampling Interval X chart. Performance of these control charts is presented in the form of ATS (Average Time to Signal which is obtained from computer simulation and markov chain approach. The VSSI X chart shows better performance in detecting moderate mean shift. The simulation is then continued for VSSI X chart and VSS X chart with minimum sample size n 1=1 and n 1=2. Abstract in Bahasa Indonesia : Peta kendali X Shewhart telah umum digunakan dalam pengendalian proses statistis untuk data variabel dan terbukti berfungsi dengan baik untuk mendeteksi pergeseran rerata yang besar, namun kurang cepat dalam mendeteksi pergeseran rerata yang sedang hingga kecil. Untuk mengatasi kelemahan ini, diusulkan penggunaan peta kendali X dengan ukuran sampel dan interval pengambilan sampel yang bervariasi (peta kendali VSSI. Kinerja peta kendali X VSSI dibandingkan dengan kinerja peta kendali Shewhart, peta kendali X VSS (peta kendali X dengan ukuran sampel yang bervariasi, dan peta kendali X VSI (peta kendali X dengan interval waktu pengambilan sampel yang bervariasi. Kinerja peta kendali dinyatakan dalam nilai ATS (Average Time to Signal yang didapatkan dari hasil simulasi program komputer maupun perhitungan Rantai Markov. Peta kendali X VSSI terbukti mempunyai kinerja yang lebih baik dalam mendeteksi pergeseran rerata yang sedang. Selain itu juga disimulasikan penggunaan peta kendali X VSSI dan peta kendali X VSS dengan ukuran sampel minimum n1=1 dan n1
McDougall, Cameron M; Ban, Vin Shen; Beecher, Jeffrey; Pride, Lee; Welch, Babu G
2018-03-02
OBJECTIVE The role of venous sinus stenting (VSS) for idiopathic intracranial hypertension (IIH) is not well understood. The aim of this systematic review is to attempt to identify subsets of patients with IIH who will benefit from VSS based on the pressure gradients of their venous sinus stenosis. METHODS MEDLINE/PubMed was searched for studies reporting venous pressure gradients across the stenotic segment of the venous sinus, pre- and post-stent pressure gradients, and clinical outcomes after VSS. Findings are reported according to the PRISMA (Preferred Reporting Items for Systematic Reviews and Meta-Analyses) guidelines. RESULTS From 32 eligible studies, a total of 186 patients were included in the analysis. Patients who had favorable outcomes had higher mean pressure gradients (22.8 ± 11.5 mm Hg vs 17.4 ± 8.0 mm Hg, p = 0.033) and higher changes in pressure gradients after stent placement (19.4 ± 10.0 mm Hg vs 12.0 ± 6.0 mm Hg, p = 0.006) compared with those with unfavorable outcomes. The post-stent pressure gradients between the 2 groups were not significantly different (2.8 ± 4.0 mm Hg vs 2.7 ± 2.0 mm Hg, p = 0.934). In a multivariate stepwise logistic regression controlling for age, sex, body mass index, CSF opening pressure, pre-stent pressure gradient, and post-stent pressure gradient, the change in pressure gradient with stent placement was found to be an independent predictor of favorable outcome (p = 0.028). Using a pressure gradient of 21 as a cutoff, 81/86 (94.2%) of patients with a gradient > 21 achieved favorable outcomes, compared with 82/100 (82.0%) of patients with a gradient ≤ 21 (p = 0.022). CONCLUSIONS There appears to be a relationship between the pressure gradient of venous sinus stenosis and the success of VSS in IIH. A randomized controlled trial would help elucidate this relationship and potentially guide patient selection.
Linear accelerator radiosurgery for vestibular schwannomas: Results of medium-term follow-up.
Ellenbogen, Jonathan R; Waqar, Mueez; Kinshuck, Andrew J; Jenkinson, Michael D; Lesser, Tristram H J; Husband, David; Javadpour, Mohsen
2015-01-01
To examine tumour control, via volume changes, and the complications of linear accelerator (LINAC)-based stereotactic radiosurgery (SRS) treatment of vestibular schwannomas (VSs) on medium-term follow-up. Between September 2003 and November 2009 fifty consecutive patients with VSs treated with SRS using a marginal dose of 12.5 Gy utilizing a LINAC equipped with a micro-multileaf collimator were identified. Evaluation included serial magnetic resonance imaging (MRI), and neurological and hearing examinations. The median tumour volume at treatment was 2.4 (range: 0.24-10.59) cm3. The intracranial diameter of the tumours ranged between 7.7 and 28.7 (median: 15.8) mm. Follow-up MRI was available for analysis on 49 patients. The median radiological follow-up period was 5.8 (range: 1.4-9.2) years. The median tumour volume at last follow-up was 1.1 (range: 0.03-5.3) cm3. VS decreased in size in 45 (90%) patients, with a median reduction in tumour volume of 1.46 (range: 0.06-9.29) cm3 or a median tumour size reduction of 59% of the baseline (range: 6-90%) in these patients. VS remained stable in 2 patients and increased in size in 2 patients. Only 1 patient (2%) required additional intervention (surgery). 15 patients had useful hearing pre-treatment; 10 post-treatment pure-tone audiograms of these patients were available. 5 (50%) patients still had useful hearing post treatment. Non-auditory adverse radiation effects included new (House-Brackmann grade II) or worsened facial nerve palsy (House-Brackmann grade II to grade V) in 2 (4%) patients and trigeminal sensory disturbance in 2 (4%) patients. At medium term, the vast majority of VSs treated with LINAC-based SRS exhibit tumour shrinkage. The slightly higher rate of facial nerve palsy compared with Gamma Knife surgery (GKS) results may be related to the learning curve. Other complications were similar to reported GKS results for VSs of comparable sizes.
A Software Development Simulation Model of a Spiral Process
Mizell, Carolyn; Malone, Linda
2007-01-01
There is a need for simulation models of software development processes other than the waterfall because processes such as spiral development are becoming more and more popular. The use of a spiral process can make the inherently difficult job of cost and schedule estimation even more challenging due to its evolutionary nature, but this allows for a more flexible process that can better meet customers' needs. This paper will present a discrete event simulation model of spiral development that can be used to analyze cost and schedule effects of using such a process in comparison to a waterfall process.
Optimization Models and Methods Developed at the Energy Systems Institute
N.I. Voropai; V.I. Zorkaltsev
2013-01-01
The paper presents shortly some optimization models of energy system operation and expansion that have been created at the Energy Systems Institute of the Siberian Branch of the Russian Academy of Sciences. Consideration is given to the optimization models of energy development in Russia, a software package intended for analysis of power system reliability, and model of flow distribution in hydraulic systems. A general idea of the optimization methods developed at the Energy Systems Institute...
An Instructional Development Model for Global Organizations: The GOaL Model.
Hara, Noriko; Schwen, Thomas M.
1999-01-01
Presents an instructional development model, GOaL (Global Organization Localization), for use by global organizations. Topics include gaps in language, culture, and needs; decentralized processes; collaborative efforts; predetermined content; multiple perspectives; needs negotiation; learning within context; just-in-time training; and bilingual…
Development of an interactive anatomical three-dimensional eye model.
Allen, Lauren K; Bhattacharyya, Siddhartha; Wilson, Timothy D
2015-01-01
The discrete anatomy of the eye's intricate oculomotor system is conceptually difficult for novice students to grasp. This is problematic given that this group of muscles represents one of the most common sites of clinical intervention in the treatment of ocular motility disorders and other eye disorders. This project was designed to develop a digital, interactive, three-dimensional (3D) model of the muscles and cranial nerves of the oculomotor system. Development of the 3D model utilized data from the Visible Human Project (VHP) dataset that was refined using multiple forms of 3D software. The model was then paired with a virtual user interface in order to create a novel 3D learning tool for the human oculomotor system. Development of the virtual eye model was done while attempting to adhere to the principles of cognitive load theory (CLT) and the reduction of extraneous load in particular. The detailed approach, digital tools employed, and the CLT guidelines are described herein. © 2014 American Association of Anatomists.
Progress and Overview on Neutronics Modelling Development in RTP
International Nuclear Information System (INIS)
Mohamad Hairie Rabir; Muhammad Rawi Mohamed Zin; Julia Abdul Karim
2016-01-01
Reactor calculation and simulation are significantly important to ensure safety and better utilization of a research reactor. The Malaysian PUSPATI TRIGA Reactor (RTP) achieved initial criticality on June 28, 1982. The reactor is designed to effectively implement the various fields of basic nuclear research, manpower training, and production of radioisotopes. Since early 90s, neutronics modelling were used as part of its routine in-core fuel management activities. The are several computer codes have been used in RTP since then, based on 1D neutron diffusion, 2D neutron diffusion and 3D Monte Carlo neutron transport method. This paper describes current progress and overview on neutronics modelling development in RTP. Several important parameters were analysed such as k_e_f_f, reactivity, neutron flux, power distribution, B_e_f_f, and fission product build-up for the latest core configuration. The developed core neutronics model was validated by means of comparison with experimental and measurement data. Along with the RTP core model, the calculation procedure also developed to establish better prediction capability of RTP behaviour. (author)
Efficiency of Motivation Development Models for Hygienic Skills
Directory of Open Access Journals (Sweden)
Alexander V. Tscymbalystov
2017-09-01
Full Text Available The combined influence of a family and a state plays an important role in the development of an individual. This study is aimed at the model effectiveness evaluation concerning the development of oral hygiene skills among children living in families (n = 218 and being under the care of a state (n = 229. The groups were created among the children who took part in the study: the preschoolers of 5-7 years, schoolchildren of 8-11 years and adolescents of 12-15 years. During the initial examination, the hygienic status of the oral cavity before and after tooth brushing was evaluated. After that, subgroups were formed in each age group according to three models of hygienic skills training: 1 computer presentation lesson; 2 one of the students acted as a demonstrator of the skill; 3 an individual training by a hygienist. During the next 48 hours children did not take hygienic measures. Then the children were invited for a control session to demonstrate the acquired skills of oral care and evaluate the effectiveness of a model developing the skills of individual oral hygiene. During the control examination, the hygienic status was determined before and after the tooth cleaning, which allowed to determine the regimes of hygienic measure performance for children with different social status and the effectiveness of hygiene training models.
Lei, Ying; Li, Shi Feng; Yu, Yi Ling; Tan, Jun; Gold, Michael H
2017-06-01
Hypertrophic scarring is seen regularly. Tissue penetration of laser energy into hypertrophic scars using computer defaults from some lasers may be insufficient and penetration not enough. We have developed a treatment with an interrupted laser "drilling" by the Ultrapulse CO 2 (Manual Fractional Technology, MFT) and, a second pass, with fractional CO 2 . The MFT with fractional CO 2 lasers to treat hypertrophic scars is evaluated. A total of 158 patients with hypertrophic scars had three sessions of MFT with fractional CO 2 laser at 3-month intervals. Evaluations made before and 6 months after the 3rd treatment: (1) the Vancouver Scar Scale (VSS), (2) the University of North Carolina (UNC) Scar Scale, and (3) a survey of patient satisfaction. All data were analyzed using a t-test before and after treatment. The VSS score decreased from 9.35 to 3.12 (Plaser drilling by MFT and a fractional CO2 laser had profound effects on the hypertrophic scars treated. It works by increasing the penetration depth of the CO 2 laser in the scar tissue, exerting more precise effects on the hypertrophic scars. MFT combined with fractional CO 2 laser has the potential to be a major advance in the treatment of hypertrophic scars. © 2017 Wiley Periodicals, Inc.
Wu, Chih-Chun; Guo, Wan-Yuo; Chung, Wen-Yuh; Wu, Hisu-Mei; Lin, Chung-Jung; Lee, Cheng-Chia; Liu, Kang-Du; Yang, Huai-Che
2017-12-01
OBJECTIVE Gamma Knife surgery (GKS) is a promising treatment modality for patients with vestibular schwannomas (VSs), but a small percentage of patients have persistent postradiosurgical tumor growth. The aim of this study was to determine the clinical and quantitative MRI features of VS as predictors of long-term tumor control after GKS. METHODS The authors performed a retrospective study of all patients with VS treated with GKS using the Leksell Gamma Knife Unit between 2005 and 2013 at their institution. A total of 187 patients who had a minimum of 24 months of clinical and radiological assessment after radiosurgery were included in this study. Those who underwent a craniotomy with tumor removal before and after GKS were excluded. Study patients comprised 85 (45.5%) males and 102 (54.5%) females, with a median age of 52.2 years (range 20.4-82.3 years). Tumor volumes, enhancing patterns, and apparent diffusion coefficient (ADC) values were measured by region of interest (ROI) analysis of the whole tumor by serial MRI before and after GKS. RESULTS The median follow-up period was 60.8 months (range 24-128.9 months), and the median treated tumor volume was 3.54 cm 3 (0.1-16.2 cm 3 ). At last follow-up, imaging studies indicated that 150 tumors (80.2%) showed decreased tumor volume, 20 (10.7%) had stabilized, and 17 (9.1%) continued to grow following radiosurgery. The postradiosurgical outcome was not significantly correlated with pretreatment volumes or postradiosurgical enhancing patterns. Tumors that showed regression within the initial 12 months following radiosurgery were more likely to have a larger volume reduction ratio at last follow-up than those that did not (volume reduction ratio 55% vs 23.6%, respectively; p < 0.001). Compared with solid VSs, cystic VSs were more likely to regress or stabilize in the initial postradiosurgical 6-12-month period and during extended follow-up. Cystic VSs exhibited a greater volume reduction ratio at last follow-up (cystic
Experiences in Teaching a Graduate Course on Model-Driven Software Development
Tekinerdogan, Bedir
2011-01-01
Model-driven software development (MDSD) aims to support the development and evolution of software intensive systems using the basic concepts of model, metamodel, and model transformation. In parallel with the ongoing academic research, MDSD is more and more applied in industrial practices. After being accepted both by a broad community of…
Development of a master model concept for DEMO vacuum vessel
International Nuclear Information System (INIS)
Mozzillo, Rocco; Marzullo, Domenico; Tarallo, Andrea; Bachmann, Christian; Di Gironimo, Giuseppe
2016-01-01
Highlights: • The present work concerns the development of a first master concept model for DEMO vacuum vessel. • A parametric-associative CAD master model concept of a DEMO VV sector has been developed in accordance with DEMO design guidelines. • A proper CAD design methodology has been implemented in view of the later FEM analyses based on “shell elements”. - Abstract: This paper describes the development of a master model concept of the DEMO vacuum vessel (VV) conducted within the framework of the EUROfusion Consortium. Starting from the VV space envelope defined in the DEMO baseline design 2014, the layout of the VV structure was preliminarily defined according to the design criteria provided in RCC-MRx. A surface modelling technique was adopted and efficiently linked to the finite element (FE) code to simplify future FE analyses. In view of possible changes to shape and structure during the conceptual design activities, a parametric design approach allows incorporating modifications to the model efficiently.
Development of Neutronics Model for ShinKori Unit 1 Simulator
Energy Technology Data Exchange (ETDEWEB)
Hong, JinHyuk; Lee, MyeongSoo; Lee, SeungHo; Suh, JungKwan; Hwang, DoHyun [KEPRI, Daejeon (Korea, Republic of)
2008-05-15
ShinKori-Unit 1 and 2 is being built in the Kori site which will be operated at 2815 MWt of thermal core power. The purpose of this paper is to report on the performance of the developed neutronics model of ShinKori Unit 1 and 2. Also this report includes the convenient tool (XS2R5) for processing the large quantity of information received from the DIT/ROCS model and generating cross-sections. The neutronics model is based on the NESTLE code inserted to RELAP5/MOD3 thermal-hydraulics analysis code which was funded as FY-93 LDRD Project 7201 and is running on the commercial simulator environment tool (the 3KeyMaster{sup TM} of the WSC). As some examples for the verification of the developed neutronics model, some figures are provided. The output of the developed neutronics model is in accord with the Preliminary Safety Analysis Report (PSAR) of the reference plant.
Development of a master model concept for DEMO vacuum vessel
Energy Technology Data Exchange (ETDEWEB)
Mozzillo, Rocco; Marzullo, Domenico; Tarallo, Andrea [CREATE, University of Naples Federico II, DII, P.le Tecchio 80, 80125, Naples (Italy); Bachmann, Christian [EUROfusion PMU, Boltzmannstraße 2, 85748 Garching (Germany); Di Gironimo, Giuseppe, E-mail: peppe.digironimo@gmail.com [CREATE, University of Naples Federico II, DII, P.le Tecchio 80, 80125, Naples (Italy)
2016-11-15
Highlights: • The present work concerns the development of a first master concept model for DEMO vacuum vessel. • A parametric-associative CAD master model concept of a DEMO VV sector has been developed in accordance with DEMO design guidelines. • A proper CAD design methodology has been implemented in view of the later FEM analyses based on “shell elements”. - Abstract: This paper describes the development of a master model concept of the DEMO vacuum vessel (VV) conducted within the framework of the EUROfusion Consortium. Starting from the VV space envelope defined in the DEMO baseline design 2014, the layout of the VV structure was preliminarily defined according to the design criteria provided in RCC-MRx. A surface modelling technique was adopted and efficiently linked to the finite element (FE) code to simplify future FE analyses. In view of possible changes to shape and structure during the conceptual design activities, a parametric design approach allows incorporating modifications to the model efficiently.
Goethe and the ABC model of flower development.
Coen, E
2001-06-01
About 10 years ago, the ABC model for the genetic control of flower development was proposed. This model was initially based on the analysis of mutant flowers but has subsequently been confirmed by molecular analysis. This paper describes the 200-year history behind this model, from the late 18th century when Goethe arrived at his idea of plant metamorphosis, to the genetic studies on flower mutants carried out on Arabidopsis and Antirrhinum in the late 20th century.
Doren, Bonnie; Flannery, K. Brigid; Lombardi, Allison
2012-01-01
The purpose of the study was to examine the potential efficacy of a professional development training model targeting IEP case managers of transition-age students. A training model was developed and a pilot study conducted to understand the promise of the model to improve the development of critical components within the IEP document that support…
Home healthcare nurse retention and patient outcome model: discussion and model development.
Ellenbecker, Carol Hall; Cushman, Margaret
2012-08-01
This paper discusses additions to an empirically tested model of home healthcare nurse retention. An argument is made that the variables of shared decision-making and organizational commitment be added to the model based on the authors' previous research and additional evidence from the literature. Previous research testing the home healthcare nurse retention model established empirical relationships between nurse, agency, and area characteristics to nurse job satisfaction, intent to stay, and retention. Unexplained model variance prompted a new literature search to augment understanding of nurse retention and patient and agency outcomes. Data come from the authors' previous research, and a literature search from 1990 to 2011 on the topics organizational commitment, shared decision-making, nurse retention, patient outcomes and agency performance. The literature provides a rationale for the additional variables of shared decision-making and affective and continuous organizational commitment, linking these variables to nurse job satisfaction, nurse intent to stay, nurse retention and patient outcomes and agency performance. Implications for nursing. The new variables in the model suggest that all agencies, even those not struggling to retain nurses, should develop interventions to enhance nurse job satisfaction to assure quality patient outcomes. The new nurse retention and patient outcome model increases our understanding of nurse retention. An understanding of the relationship among these variables will guide future research and the development of interventions to create and maintain nursing work environments that contribute to nurse affective agency commitment, nurse retention and quality of patient outcomes. © 2011 Blackwell Publishing Ltd.
Supporting Collaborative Model and Data Service Development and Deployment with DevOps
David, O.
2016-12-01
Adopting DevOps practices for model service development and deployment enables a community to engage in service-oriented modeling and data management. The Cloud Services Integration Platform (CSIP) developed the last 5 years at Colorado State University provides for collaborative integration of environmental models into scalable model and data services as a micro-services platform with API and deployment infrastructure. Originally developed to support USDA natural resource applications, it proved suitable for a wider range of applications in the environmental modeling domain. While extending its scope and visibility it became apparent community integration and adequate work flow support through the full model development and application cycle drove successful outcomes.DevOps provide best practices, tools, and organizational structures to optimize the transition from model service development to deployment by minimizing the (i) operational burden and (ii) turnaround time for modelers. We have developed and implemented a methodology to fully automate a suite of applications for application lifecycle management, version control, continuous integration, container management, and container scaling to enable model and data service developers in various institutions to collaboratively build, run, deploy, test, and scale services within minutes.To date more than 160 model and data services are available for applications in hydrology (PRMS, Hydrotools, CFA, ESP), water and wind erosion prediction (WEPP, WEPS, RUSLE2), soil quality trends (SCI, STIR), water quality analysis (SWAT-CP, WQM, CFA, AgES-W), stream degradation assessment (SWAT-DEG), hydraulics (cross-section), and grazing management (GRAS). In addition, supporting data services include soil (SSURGO), ecological site (ESIS), climate (CLIGEN, WINDGEN), land management and crop rotations (LMOD), and pesticides (WQM), developed using this workflow automation and decentralized governance.
Pradabpech, Pipat; Chantarasombat, Chalard; Sriampai, Anan
2015-01-01
This research for: 1) to study the current situation and problem in KM, 2) to develop the KM Model, and 3) to evaluate the finding usage of the KM Model for developing the Internal Quality Assurance of Educational Opportunity Expansion Schools. There were 3 Phases of research implementation. Phase 1: the current situation and problem in KM, was…
Development of multipurpose regulatory PSA model
International Nuclear Information System (INIS)
Lee, Chang Ju; Sung, Key Yong; Kim, Hho Jung; Yang, Joon Eon; Ha, Jae Joo
2004-01-01
Generally, risk information for nuclear facilities comes from the results of Probabilistic safety assessment (PSA). PSA is a systematic tool to ensure the safety of nuclear facilities, since it is based on thorough and consistent application of probability models. In particular, the PSA has been widely utilized for risk-informed regulation (RIR), including various licensee-initiated risk-informed applications (RIA). In any regulatory decision, the main goal is to make a sound safety decision based on technically defensible information. Also, due to the increased public requests for giving a safety guarantee, the regulator should provide the visible means of safety. The use of PSA by the regulator can give the answer on this problem. Therefore, in order to study the applicability of risk information for regulatory safety management, it is a demanding task to prepare a well-established regulatory PSA model and tool. In 2002, KINS and KAERI together made a research cooperation to form a working group to develop the regulatory PSA model - so-called MPAS model. The MPAS stands for multipurpose probabilistic analysis of safety. For instance, a role of the MPAS model is to give some risk insights in the preparation of various regulatory programs. Another role of this model is to provide an independent risk information to the regulator during regulatory decision-making, not depending on the licensee's information
A Dynamic Systems Theory Model of Visual Perception Development
Coté, Carol A.
2015-01-01
This article presents a model for understanding the development of visual perception from a dynamic systems theory perspective. It contrasts to a hierarchical or reductionist model that is often found in the occupational therapy literature. In this proposed model vision and ocular motor abilities are not foundational to perception, they are seen…
A Substantiation of Macdonald's Models in Science Curriculum Development.
Searles, W. E.
1982-01-01
A history and analysis of science curriculum development is presented. Factors which influence the selection and organization of content in a science curriculum are discussed, including Macdonald's curriculum development models, propositions for curriculum development, and changes made in science curricula during the last century. (CJ)
Development of an equipment management model to improve effectiveness of processes
International Nuclear Information System (INIS)
Chang, H. S.; Ju, T. Y.; Song, T. Y.
2012-01-01
The nuclear industries have developed and are trying to create a performance model to improve effectiveness of the processes implemented at nuclear plants in order to enhance performance. Most high performing nuclear stations seek to continually improve the quality of their operations by identifying and closing important performance gaps. Thus, many utilities have implemented performance models adjusted to their plant's configuration and have instituted policies for such models. KHNP is developing a standard performance model to integrate the engineering processes and to improve the inter-relation among processes. The model, called the Standard Equipment Management Model (SEMM), is under development first by focusing on engineering processes and performance improvement processes related to plant equipment used at the site. This model includes performance indicators for each process that can allow evaluating and comparing the process performance among 21 operating units. The model will later be expanded to incorporate cost and management processes. (authors)
Balancing energy development and conservation: A method utilizing species distribution models
Jarnevich, C.S.; Laubhan, M.K.
2011-01-01
Alternative energy development is increasing, potentially leading to negative impacts on wildlife populations already stressed by other factors. Resource managers require a scientifically based methodology to balance energy development and species conservation, so we investigated modeling habitat suitability using Maximum Entropy to develop maps that could be used with other information to help site energy developments. We selected one species of concern, the Lesser Prairie-Chicken (LPCH; Tympanuchus pallidicinctus) found on the southern Great Plains of North America, as our case study. LPCH populations have been declining and are potentially further impacted by energy development. We used LPCH lek locations in the state of Kansas along with several environmental and anthropogenic parameters to develop models that predict the probability of lek occurrence across the landscape. The models all performed well as indicated by the high test area under the curve (AUC) scores (all >0.9). The inclusion of anthropogenic parameters in models resulted in slightly better performance based on AUC values, indicating that anthropogenic features may impact LPCH lek habitat suitability. Given the positive model results, this methodology may provide additional guidance in designing future survey protocols, as well as siting of energy development in areas of marginal or unsuitable habitat for species of concern. This technique could help to standardize and quantify the impacts various developments have upon at-risk species. ?? 2011 Springer Science+Business Media, LLC (outside the USA).
Developing a More Effective Recruitment and Retention Model.
Janke, Walter; Kelly, Gary
The purpose of a project was to develop a model for more effective recruitment and retention of people of color in the Associate Degree Interior Design and Diploma Interior Design Assistant Program at Milwaukee Area Technical College (MATC), Wisconsin. During Activity One, individuals in MATC's Student Development and High School Relations…
Academic Talent Development Programs: A Best Practices Model
Gagné, Françoys
2015-01-01
This article aims to describe how schools should structure the development of academic talent at all levels of the K-12 educational system. Adopting as its theoretical framework the "Differentiating Model of Giftedness and Talent," the author proposes (a) a formal definition of academic talent development (ATD) inspired by the principles…
Development of a 3D bone marrow adipose tissue model.
Fairfield, Heather; Falank, Carolyne; Farrell, Mariah; Vary, Calvin; Boucher, Joshua M; Driscoll, Heather; Liaw, Lucy; Rosen, Clifford J; Reagan, Michaela R
2018-01-26
Over the past twenty years, evidence has accumulated that biochemically and spatially defined networks of extracellular matrix, cellular components, and interactions dictate cellular differentiation, proliferation, and function in a variety of tissue and diseases. Modeling in vivo systems in vitro has been undeniably necessary, but when simplified 2D conditions rather than 3D in vitro models are used, the reliability and usefulness of the data derived from these models decreases. Thus, there is a pressing need to develop and validate reliable in vitro models to reproduce specific tissue-like structures and mimic functions and responses of cells in a more realistic manner for both drug screening/disease modeling and tissue regeneration applications. In adipose biology and cancer research, these models serve as physiologically relevant 3D platforms to bridge the divide between 2D cultures and in vivo models, bringing about more reliable and translationally useful data to accelerate benchtop to bedside research. Currently, no model has been developed for bone marrow adipose tissue (BMAT), a novel adipose depot that has previously been overlooked as "filler tissue" but has more recently been recognized as endocrine-signaling and systemically relevant. Herein we describe the development of the first 3D, BMAT model derived from either human or mouse bone marrow (BM) mesenchymal stromal cells (MSCs). We found that BMAT models can be stably cultured for at least 3 months in vitro, and that myeloma cells (5TGM1, OPM2 and MM1S cells) can be cultured on these for at least 2 weeks. Upon tumor cell co-culture, delipidation occurred in BMAT adipocytes, suggesting a bidirectional relationship between these two important cell types in the malignant BM niche. Overall, our studies suggest that 3D BMAT represents a "healthier," more realistic tissue model that may be useful for elucidating the effects of MAT on tumor cells, and tumor cells on MAT, to identify novel therapeutic
The development of environmental modeling tools in Brazil for emergency preparedness
International Nuclear Information System (INIS)
Rochedo, Elaine R.R.; Vetere, Maria I.C.; Conti, Luiz F.C.; Wasserman, Maria A.V.; Salinas, Isabel C.P.; Pereira, Jose F.; Silva, Diogo N.G.; Vinhas, Denise M
2008-01-01
Since the Goiania accident, in 1987, the IRD is developing tools to support decision-making processes after accidents involving radiological public exposure. The Environmental Modelling Project began with the development of the code CORAL, based on the German dynamic model ECOSYS, developed by the GSF, with the purpose of assessing the consequences of an accidental contamination of rural areas. Then, in cooperation with the GSF, the IRD has developed the model PARATI, based on information from Chernobyl and Goiania accidents, for the assessment of the exposure of the public due to a contamination of Cs-137 in urban areas. This model includes the ability to simulate the implementation of countermeasure and its effectiveness in reducing doses to the public. Subsequently, the SIEM - Integrated Emergency System was developed to include CORAL and PARATI, as well as some generic models developed by the IAEA, for short-term dose estimates and to support protective strategies during the emergency phase of an accident. SIEM also incorporated standardized data on the physical behavior of radionuclides and dose conversion factors. Several improvements have been performed in order to better adequate the model to Brazilian social, political, economic and climatic characteristics. Currently a multi-criteria strategy to support decision-making processes after the occurrence of an event of environmental contamination is under development. That work includes the development of a database on countermeasures and a computer model to perform the multi-criteria simulation. At all stages of the work, the pertinent weather and seasonal aspects are considered, in order to obtain a guide to protective actions accounting for social, economic and climatic characteristics, to be used in multi-criteria optimization processes adequate for tropical climate areas. (author)
Developments of STIM, the Saturn Thermosphere Ionosphere Model
Aylward, A. D.; Smith, C. G.; Miller, S.; Millward, G.
2005-05-01
The STIM (Saturn Thermosphere Ionosphere Model) model is a joint venture betwen University College London, Imperial College London, Boston University and the University of Arizona to develop a 3-d global circulation model of the Saturnian system - the primary aim being to use this as a tool for interpretation and testing of Cassini data. After initial work producing a basic thermosphere model (Muller-Wodarg et al 2005), examining issues to do with the ionosphere (Moore et al 2005) and examining auroral heating effects (Smith et al 2005), a global coupled ionosphere-plasmasphere has been added to the model. At low latitudes the model calculates ion densities on closed flux tubes passing through the ring plane. At high latitudes it performs self-consistent calculations of Joule heating and ion drag based on the calculated thermospheric and ionospheric parameters. The plasmasphere is complicated for Saturn by the strength of the centrifugal force which can dominate the forces in the outer flux tubes. Studies initially used H+ and H3+ as the principle ions but for the future it will be necessary to look at the consequences of the rings supplying OH or oxygen from ring ice particles. The high-latitude morphology is being refined as Cassini data constrains it. Long-term plans for the STIM development will be discussed.
Combat Service Support Model Development: BRASS - TRANSLOG - Army 21
1984-07-01
throughout’the system. Transitional problems may address specific hardware and related software , such as the Standard Army Ammunition System ( SAAS ...FILE. 00 Cabat Service Support Model Development .,PASS TRANSLOG -- ARMY 21 0 Contract Number DAAK11-84-D-0004 Task Order #1 DRAFT REPOkT July 1984 D...Armament Systems, Inc. 211 West Bel Air Avenue P.O. Box 158 Aberdeen, MD 21001 8 8 8 2 1 S CORMIT SERVICE SUPPORT MODEL DEVELOPMENT BRASS -- TRANSLOG
Policy Model of Sustainable Infrastructure Development (Case Study : Bandarlampung City, Indonesia)
Persada, C.; Sitorus, S. R. P.; Marimin; Djakapermana, R. D.
2018-03-01
Infrastructure development does not only affect the economic aspect, but also social and environmental, those are the main dimensions of sustainable development. Many aspects and actors involved in urban infrastructure development requires a comprehensive and integrated policy towards sustainability. Therefore, it is necessary to formulate an infrastructure development policy that considers various dimensions of sustainable development. The main objective of this research is to formulate policy of sustainable infrastructure development. In this research, urban infrastructure covers transportation, water systems (drinking water, storm water, wastewater), green open spaces and solid waste. This research was conducted in Bandarlampung City. This study use a comprehensive modeling, namely the Multi Dimensional Scaling (MDS) with Rapid Appraisal of Infrastructure (Rapinfra), it uses of Analytic Network Process (ANP) and it uses system dynamics model. The findings of the MDS analysis showed that the status of Bandarlampung City infrastructure sustainability is less sustainable. The ANP analysis produces 8 main indicators of the most influential in the development of sustainable infrastructure. The system dynamics model offered 4 scenarios of sustainable urban infrastructure policy model. The best scenario was implemented into 3 policies consist of: the integrated infrastructure management, the population control, and the local economy development.
Development of the Artistic Supervision Model Scale (ASMS)
Kapusuzoglu, Saduman; Dilekci, Umit
2017-01-01
The purpose of the study is to develop the Artistic Supervision Model Scale in accordance with the perception of inspectors and the elementary and secondary school teachers on artistic supervision. The lack of a measuring instrument related to the model of artistic supervision in the field of literature reveals the necessity of such study. 290…
ANS main control complex three-dimensional computer model development
International Nuclear Information System (INIS)
Cleaves, J.E.; Fletcher, W.M.
1993-01-01
A three-dimensional (3-D) computer model of the Advanced Neutron Source (ANS) main control complex is being developed. The main control complex includes the main control room, the technical support center, the materials irradiation control room, computer equipment rooms, communications equipment rooms, cable-spreading rooms, and some support offices and breakroom facilities. The model will be used to provide facility designers and operations personnel with capabilities for fit-up/interference analysis, visual ''walk-throughs'' for optimizing maintain-ability, and human factors and operability analyses. It will be used to determine performance design characteristics, to generate construction drawings, and to integrate control room layout, equipment mounting, grounding equipment, electrical cabling, and utility services into ANS building designs. This paper describes the development of the initial phase of the 3-D computer model for the ANS main control complex and plans for its development and use
Students' Development and Use of Models to Explain Electrostatic Interactions
Mayer, Kristin Elizabeth
The National Research Council (2012) recently published A Framework for K-12 Science Education that describes a vision for science classrooms where students engage in three dimensions--scientific and engineering practices, crosscutting concepts, and disciplinary core ideas--to explain phenomena or observations they can make about the universe around them. This vision of science instruction is a significant shift from current classroom instruction. This dissertation provides detailed examples of how students developed and used models to build causal explanations of phenomena. I co-taught classes that focused on having students develop and revise models of electric fields and atomic structure using a curriculum that was designed to align with the three-dimensional vision of learning. I developed case studies of eleven students from these classes. I analyzed the students' responses and interviewed the students throughout the school year. By comparing and contrasting the analysis across the analysis of students' interviews, I identified four themes: 1) students could apply their ideas to explain novel and abstract phenomena; 2) students struggled to connect changes in their atomic models to evidence, but ended up with dynamic models of atomic structure that they could apply to explain phenomena; 3) students developed models of atomic structure that they applied to explain phenomena, but they did not use models of electric fields in this way; and 4) too much focus on details interfered with students' ability to apply their models to explain new phenomena. This dissertation highlights the importance of focusing on phenomena in classrooms that aim at aligning with three-dimensional learning. Students struggled to focus on specific content and apply their ideas to explain phenomena at the same time. In order to apply ideas to new context, students had to shift their focus from recalling ideas to applying the ideas they do have. A focus on phenomena allowed students to show
International Nuclear Information System (INIS)
Gabriel, Cle-Anne; Kirkwood, Jodyanne
2016-01-01
Against the background of mounting research suggesting entrepreneurship as a means of increasing the uptake of renewable energy technologies (RETs) in developing countries, this paper presents the findings of an exploratory investigation into the business models used by renewable energy entrepreneurs in such countries. Forty-three entrepreneurs were interviewed in 28 developing countries and secondary information about country and regional conditions was analysed. We chose the Business Model Canvas as an analytical tool and the findings shed new light on established renewable energy business types. Three different types of businesses were identified – Consultants, Distributors, and Integrators; yet, there is also some overlap between these types. These business types appeared to parallel the life cycle progression of the business, but this requires further research. A key component of the study was to assess whether the types of businesses were related to country-level conditions to assess the impact of regional differences. These comparisons revealed consistencies between country-level characteristics and the entrepreneurs’ choice of business model. Conclusions suggest that different regions may support certain business models more than others due to differing levels of government interest in renewables, governance and policy support and the relative ease of doing business. - Highlights: •Business model canvas used to analyse renewable energy entrepreneurs’ businesses. •Consultants, distributors and integrators are the main business models used. •Business model characteristics are related to country and regional conditions. •Entrepreneurs in least favourable policy environments likely to be Consultants. •Energy entrepreneurship policy should focus on promoting specific business models.
Conceptual Development of a National Volcanic Hazard Model for New Zealand
Stirling, Mark; Bebbington, Mark; Brenna, Marco; Cronin, Shane; Christophersen, Annemarie; Deligne, Natalia; Hurst, Tony; Jolly, Art; Jolly, Gill; Kennedy, Ben; Kereszturi, Gabor; Lindsay, Jan; Neall, Vince; Procter, Jonathan; Rhoades, David; Scott, Brad; Shane, Phil; Smith, Ian; Smith, Richard; Wang, Ting; White, James D. L.; Wilson, Colin J. N.; Wilson, Tom
2017-06-01
We provide a synthesis of a workshop held in February 2016 to define the goals, challenges and next steps for developing a national probabilistic volcanic hazard model for New Zealand. The workshop involved volcanologists, statisticians, and hazards scientists from GNS Science, Massey University, University of Otago, Victoria University of Wellington, University of Auckland, and University of Canterbury. We also outline key activities that will develop the model components, define procedures for periodic update of the model, and effectively articulate the model to end-users and stakeholders. The development of a National Volcanic Hazard Model is a formidable task that will require long-term stability in terms of team effort, collaboration and resources. Development of the model in stages or editions that are modular will make the process a manageable one that progressively incorporates additional volcanic hazards over time, and additional functionalities (e.g. short-term forecasting). The first edition is likely to be limited to updating and incorporating existing ashfall hazard models, with the other hazards associated with lahar, pyroclastic density currents, lava flow, ballistics, debris avalanche, and gases/aerosols being considered in subsequent updates.
Conceptual Development of a National Volcanic Hazard Model for New Zealand
Directory of Open Access Journals (Sweden)
Mark Stirling
2017-06-01
Full Text Available We provide a synthesis of a workshop held in February 2016 to define the goals, challenges and next steps for developing a national probabilistic volcanic hazard model for New Zealand. The workshop involved volcanologists, statisticians, and hazards scientists from GNS Science, Massey University, University of Otago, Victoria University of Wellington, University of Auckland, and University of Canterbury. We also outline key activities that will develop the model components, define procedures for periodic update of the model, and effectively articulate the model to end-users and stakeholders. The development of a National Volcanic Hazard Model is a formidable task that will require long-term stability in terms of team effort, collaboration, and resources. Development of the model in stages or editions that are modular will make the process a manageable one that progressively incorporates additional volcanic hazards over time, and additional functionalities (e.g., short-term forecasting. The first edition is likely to be limited to updating and incorporating existing ashfall hazard models, with the other hazards associated with lahar, pyroclastic density currents, lava flow, ballistics, debris avalanche, and gases/aerosols being considered in subsequent updates.
Lung Cancer Screening Participation: Developing a Conceptual Model to Guide Research.
Carter-Harris, Lisa; Davis, Lorie L; Rawl, Susan M
2016-11-01
To describe the development of a conceptual model to guide research focused on lung cancer screening participation from the perspective of the individual in the decision-making process. Based on a comprehensive review of empirical and theoretical literature, a conceptual model was developed linking key psychological variables (stigma, medical mistrust, fatalism, worry, and fear) to the health belief model and precaution adoption process model. Proposed model concepts have been examined in prior research of either lung or other cancer screening behavior. To date, a few studies have explored a limited number of variables that influence screening behavior in lung cancer specifically. Therefore, relationships among concepts in the model have been proposed and future research directions presented. This proposed model is an initial step to support theoretically based research. As lung cancer screening becomes more widely implemented, it is critical to theoretically guide research to understand variables that may be associated with lung cancer screening participation. Findings from future research guided by the proposed conceptual model can be used to refine the model and inform tailored intervention development.
Nonlinear Dynamic Modeling and Controls Development for Supersonic Propulsion System Research
Connolly, Joseph W.; Kopasakis, George; Paxson, Daniel E.; Stuber, Eric; Woolwine, Kyle
2012-01-01
This paper covers the propulsion system component modeling and controls development of an integrated nonlinear dynamic simulation for an inlet and engine that can be used for an overall vehicle (APSE) model. The focus here is on developing a methodology for the propulsion model integration, which allows for controls design that prevents inlet instabilities and minimizes the thrust oscillation experienced by the vehicle. Limiting thrust oscillations will be critical to avoid exciting vehicle aeroelastic modes. Model development includes both inlet normal shock position control and engine rotor speed control for a potential supersonic commercial transport. A loop shaping control design process is used that has previously been developed for the engine and verified on linear models, while a simpler approach is used for the inlet control design. Verification of the modeling approach is conducted by simulating a two-dimensional bifurcated inlet and a representative J-85 jet engine previously used in a NASA supersonics project. Preliminary results are presented for the current supersonics project concept variable cycle turbofan engine design.
An innovative service process development based on a reference model
Directory of Open Access Journals (Sweden)
Lorenzo Sanfelice Frazzon
2015-06-01
Full Text Available This article examines the new service development (NSD process, focusing specifically in a case of a financial service, guided by the following research questions: what are the processes and practices used in the development and design of new financial services? How the results of the financial NSD proposal reflects on the NSD are as a whole? Therefore, the study aims to show and describe a financial service development, conducted at Helpinveste. The paper focuses on the Conceptual Design service (activities: definition of specifications and development of alternative solutions for the service and Service Process Design (Service Representation phases. The methodological procedures are based on the process approach, using a reference model for developing new services. In order to operationalize the model, several techniques for the various stages of the project were used, e.g. QFD and Service Blueprint. Lastly, conclusions report contributions from the reference model application, both theoretical and practical contributions, as well the limitations and further research recommendations.
A Competency-Based Model for Youth Leadership Development
Seemiller, Corey
2018-01-01
Whether they are in a leadership program, participate in an organization, or engage in school-based extra-curricular activities, there does not appear to be a shortage of leadership development opportunities for youth. Despite the prominence of these experiences, the lack of youth leadership development models available for educators can pose a…
Institute of Scientific and Technical Information of China (English)
Faliang; YU; Lisong; CHEN
2013-01-01
Bijie Experimental Region takes the ecological construction as the guarantee and takes population control as the key,to promote development-oriented poverty reduction and explore benign interaction between development-oriented poverty reduction and ecological construction and population control.Development-oriented poverty reduction model includes combination of raising crops and livestock,coordinated development of multiple wealth sources,transferring labor,and partner assistance;ecological construction model includes"Five sons passed imperial examinations",desertification control,agricultural circular economy,and project promotion;population control models includes human-land linkage,combination of favorable policies and propaganda and education,and combination of ambition arousing and education promotion.
Dondeynaz, C.; Lopez-Puga, J.; Carmona-Moreno, C.
2012-04-01
Improving Water and Sanitation Services (WSS), being a complex and interdisciplinary issue, passes through collaboration and coordination of different sectors (environment, health, economic activities, governance, and international cooperation). This inter-dependency has been recognised with the adoption of the "Integrated Water Resources Management" principles that push for the integration of these various dimensions involved in WSS delivery to ensure an efficient and sustainable management. The understanding of these interrelations appears as crucial for decision makers in the water sector in particular in developing countries where WSS still represent an important leverage for livelihood improvement. In this framework, the Joint Research Centre of the European Commission has developed a coherent database (WatSan4Dev database) containing 29 indicators from environmental, socio-economic, governance and financial aid flows data focusing on developing countries (Celine et al, 2011 under publication). The aim of this work is to model the WatSan4Dev dataset using probabilistic models to identify the key variables influencing or being influenced by the water supply and sanitation access levels. Bayesian Network Models are suitable to map the conditional dependencies between variables and also allows ordering variables by level of influence on the dependent variable. Separated models have been built for water supply and for sanitation because of different behaviour. The models are validated if complying with statistical criteria but either with scientific knowledge and literature. A two steps approach has been adopted to build the structure of the model; Bayesian network is first built for each thematic cluster of variables (e.g governance, agricultural pressure, or human development) keeping a detailed level for interpretation later one. A global model is then built based on significant indicators of each cluster being previously modelled. The structure of the
NUMERICAL MODELLING OF THE SOIL BEHAVIOUR BY USING NEWLY DEVELOPED ADVANCED MATERIAL MODEL
Directory of Open Access Journals (Sweden)
Jan Veselý
2017-02-01
Full Text Available This paper describes a theoretical background, implementation and validation of the newly developed Jardine plastic hardening-softening model (JPHS model, which can be used for numerical modelling of the soils behaviour. Although the JPHS model is based on the elasto-plastic theory, like the Mohr-Coulomb model that is widely used in geotechnics, it contains some improvements, which removes the main disadvantages of the MC model. The presented model is coupled with an isotopically hardening and softening law, non-linear elastic stress-strain law, non-associated elasto-plastic material description and a cap yield surface. The validation of the model is done by comparing the numerical results with real measured data from the laboratory tests and by testing of the model on the real project of the tunnel excavation. The 3D numerical analysis is performed and the comparison between the JPHS, Mohr-Coulomb, Modified Cam-Clay, Hardening small strain model and monitoring in-situ data is done.
A neuroconstructivist model of past tense development and processing.
Westermann, Gert; Ruh, Nicolas
2012-07-01
We present a neural network model of learning and processing the English past tense that is based on the notion that experience-dependent cortical development is a core aspect of cognitive development. During learning the model adds and removes units and connections to develop a task-specific final architecture. The model provides an integrated account of characteristic errors during learning the past tense, adult generalization to pseudoverbs, and dissociations between verbs observed after brain damage in aphasic patients. We put forward a theory of verb inflection in which a functional processing architecture develops through interactions between experience-dependent brain development and the structure of the environment, in this case, the statistical properties of verbs in the language. The outcome of this process is a structured processing system giving rise to graded dissociations between verbs that are easy and verbs that are hard to learn and process. In contrast to dual-mechanism accounts of inflection, we argue that describing dissociations as a dichotomy between regular and irregular verbs is a post hoc abstraction and is not linked to underlying processing mechanisms. We extend current single-mechanism accounts of inflection by highlighting the role of structural adaptation in development and in the formation of the adult processing system. In contrast to some single-mechanism accounts, we argue that the link between irregular inflection and verb semantics is not causal and that existing data can be explained on the basis of phonological representations alone. This work highlights the benefit of taking brain development seriously in theories of cognitive development. Copyright 2012 APA, all rights reserved.
The Development of a Secondary School Health Assessment Model
Sriring, Srinual; Erawan, Prawit; Sriwarom, Monoon
2015-01-01
The objective of this research was to: 1) involved a survey of information relating to secondary school health, 2) involved the construction of a model of health assessment and a handbook for using the model in secondary school, 3) develop an assessment model for secondary school. The research included 3 phases. (1) involved a survey of…
Model outputs - Developing end-to-end models of the Gulf of California
National Oceanic and Atmospheric Administration, Department of Commerce — The purpose of this project is to develop spatially discrete end-to-end models of the northern Gulf of California, linking oceanography, biogeochemistry, food web...
DEVELOPMENT OF POLITICAL PARTIES AND PARTY FUNDING: MODELS AND CHARACTERISTICS
Directory of Open Access Journals (Sweden)
Hrvoje MATAKOVIC
2015-03-01
Full Text Available The first modern political parties were formed at the end of the 18th century and have, from those times up to now, undergone 4 developing phases; each of the phases is bound to ideal-type political party model: cadre parties, mass parties, catch-all parties and cartel parties. Each of these party models differentiates in various characteristics: party foundation, number of members, and way of leading the election campaigns, but also in ways of financing. This paper describes the above mentioned 4 phases of political parties’ development and 4 phases of parties' finances development; it will be analysed in detail positive and negative sides of each of the models of party financing.
A Model for Effective Professional Development of Formal Science Educators
Bleacher, L.; Jones, A. P.; Farrell, W. M.
2015-12-01
The Lunar Workshops for Educators (LWE) series was developed by the Lunar Reconnaissance Orbiter (LRO) education team in 2010 to provide professional development on lunar science and exploration concepts for grades 6-9 science teachers. Over 300 educators have been trained to date. The LWE model incorporates best practices from pedagogical research of science education, thoughtful integration of scientists and engineer subject matter experts for both content presentations and informal networking with educators, access to NASA-unique facilities, hands-on and data-rich activities aligned with education standards, exposure to the practice of science, tools for addressing common misconceptions, follow-up with participants, and extensive evaluation. Evaluation of the LWE model via pre- and post-assessments, daily workshop surveys, and follow-up surveys at 6-month and 1-year intervals indicate that the LWE are extremely effective in increasing educators' content knowledge, confidence in incorporating content into the classroom, understanding of the practice of science, and ability to address common student misconceptions. In order to address the efficacy of the LWE model for other science content areas, the Dynamic Response of Environments at Asteroids, the Moon, and moons of Mars (DREAM2) education team, funded by NASA's Solar System Exploration Research Virtual Institute, developed and ran a pilot workshop called Dream2Explore at NASA's Goddard Space Flight Center in June, 2015. Dream2Explore utilized the LWE model, but incorporated content related to the science and exploration of asteroids and the moons of Mars. Evaluation results indicate that the LWE model was effectively used for educator professional development on non-lunar content. We will present more detail on the LWE model, evaluation results from the Dream2Explore pilot workshop, and suggestions for the application of the model with other science content for robust educator professional development.
A Model for Effective Professional Development of Formal Science Educators
Bleacher, L. V.; Jones, A. J. P.; Farrell, W. M.
2015-01-01
The Lunar Workshops for Educators (LWE) series was developed by the Lunar Reconnaissance Orbiter (LRO) education team in 2010 to provide professional development on lunar science and exploration concepts for grades 6-9 science teachers. Over 300 educators have been trained to date. The LWE model incorporates best practices from pedagogical research of science education, thoughtful integration of scientists and engineer subject matter experts for both content presentations and informal networking with educators, access to NASA-unique facilities, hands-on and data-rich activities aligned with education standards, exposure to the practice of science, tools for addressing common misconceptions, follow-up with participants, and extensive evaluation. Evaluation of the LWE model via pre- and post-assessments, daily workshop surveys, and follow-up surveys at 6-month and 1-year intervals indicate that the LWE are extremely effective in increasing educators' content knowledge, confidence in incorporating content into the classroom, understanding of the practice of science, and ability to address common student misconceptions. In order to address the efficacy of the LWE model for other science content areas, the Dynamic Response of Environments at Asteroids, the Moon, and moons of Mars (DREAM2) education team, funded by NASA's Solar System Exploration Research Virtual Institute, developed and ran a pilot workshop called Dream2Explore at NASA's Goddard Space Flight Center in June, 2015. Dream2Explore utilized the LWE model, but incorporated content related to the science and exploration of asteroids and the moons of Mars. Evaluation results indicate that the LWE model was effectively used for educator professional development on non-lunar content. We will present more detail on the LWE model, evaluation results from the Dream2Explore pilot workshop, and suggestions for the application of the model with other science content for robust educator professional development.
Development of numerical Grids for UZ Flow and Transport Modeling
International Nuclear Information System (INIS)
P. Dobson
2004-01-01
This report describes the methods used to develop numerical grids of the unsaturated hydrogeologic system beneath Yucca Mountain, Nevada. Numerical grid generation is an integral part of the development of the unsaturated zone (UZ) flow and transport model, a complex, three-dimensional (3-D) model of Yucca Mountain. This revision contains changes made to improve the clarity of the description of grid generation. The numerical grids, developed using current geologic, hydrogeologic, and mineralogic data, provide the necessary framework to: (1) develop calibrated hydrogeologic property sets and flow fields, (2) test conceptual hypotheses of flow and transport, and (3) predict flow and transport behavior under a variety of climatic and thermal-loading conditions. The technical scope, content, and management for the current revision of this report are described in the planning document ''Technical Work Plan for: Unsaturated Zone Flow Analysis and Model Report Integration'' (BSC 2004 [DIRS 169654], Section 2). Grids generated and documented in this report supersede those documented in Revision 00 of this report, ''Development of Numerical Grids for UZ Flow and Transport Modeling'' (BSC 2001 [DIRS 159356]). The grids presented in this report are the same as those developed in Revision 01 (BSC 2003 [DIRS 160109]); however, the documentation of the development of the grids in Revision 02 has been updated to address technical inconsistencies and achieve greater transparency, readability, and traceability. The constraints, assumptions, and limitations associated with this report are discussed in the appropriate sections that follow
Development of a Stirling System Dynamic Model with Enhanced Thermodynamics
Regan, Timothy F.; Lewandowski, Edward J.
2005-02-01
The Stirling Convertor System Dynamic Model developed at NASA Glenn Research Center is a software model developed from first principles that includes the mechanical and mounting dynamics, the thermodynamics, the linear alternator, and the controller of a free-piston Stirling power convertor, along with the end user load. As such it represents the first detailed modeling tool for fully integrated Stirling convertor-based power systems. The thermodynamics of the model were originally a form of the isothermal Stirling cycle. In some situations it may be desirable to improve the accuracy of the Stirling cycle portion of the model. An option under consideration is to enhance the SDM thermodynamics by coupling the model with Gedeon Associates' Sage simulation code. The result will be a model that gives a more accurate prediction of the performance and dynamics of the free-piston Stirling convertor. A method of integrating the Sage simulation code with the System Dynamic Model is described. Results of SDM and Sage simulation are compared to test data. Model parameter estimation and model validation are discussed.
A systematic review of predictive models for asthma development in children.
Luo, Gang; Nkoy, Flory L; Stone, Bryan L; Schmick, Darell; Johnson, Michael D
2015-11-28
Asthma is the most common pediatric chronic disease affecting 9.6 % of American children. Delay in asthma diagnosis is prevalent, resulting in suboptimal asthma management. To help avoid delay in asthma diagnosis and advance asthma prevention research, researchers have proposed various models to predict asthma development in children. This paper reviews these models. A systematic review was conducted through searching in PubMed, EMBASE, CINAHL, Scopus, the Cochrane Library, the ACM Digital Library, IEEE Xplore, and OpenGrey up to June 3, 2015. The literature on predictive models for asthma development in children was retrieved, with search results limited to human subjects and children (birth to 18 years). Two independent reviewers screened the literature, performed data extraction, and assessed article quality. The literature search returned 13,101 references in total. After manual review, 32 of these references were determined to be relevant and are discussed in the paper. We identify several limitations of existing predictive models for asthma development in children, and provide preliminary thoughts on how to address these limitations. Existing predictive models for asthma development in children have inadequate accuracy. Efforts to improve these models' performance are needed, but are limited by a lack of a gold standard for asthma development in children.
A Software Development Simulation Model of a Spiral Process
Carolyn Mizell; Linda Malone
2009-01-01
This paper will present a discrete event simulation model of a spiral development lifecycle that can be used to analyze cost and schedule effects of using such a process in comparison to a waterfall process. There is a need for simulation models of software development processes other than the waterfall due to new processes becoming more widely used in order to overcome the limitations of the traditional waterfall lifecycle. The use of a spiral process can make the inherently difficult job of...
Toward a Theoretical Model of Employee Turnover: A Human Resource Development Perspective
Peterson, Shari L.
2004-01-01
This article sets forth the Organizational Model of Employee Persistence, influenced by traditional turnover models and a student attrition model. The model was developed to clarify the impact of organizational practices on employee turnover from a human resource development (HRD) perspective and provide a theoretical foundation for research on…
Numerical modelling of river morphodynamics: Latest developments and remaining challenges
Siviglia, Annunziato; Crosato, Alessandra
2016-07-01
Numerical morphodynamic models provide scientific frameworks for advancing our understanding of river systems. The research on involved topics is an important and socially relevant undertaking regarding our environment. Nowadays numerical models are used for different purposes, from answering questions about basic morphodynamic research to managing complex river engineering problems. Due to increasing computer power and the development of advanced numerical techniques, morphodynamic models are now more and more used to predict the bed patterns evolution to a broad spectrum of spatial and temporal scales. The development and the success of application of such models are based upon a wide range of disciplines from applied mathematics for the numerical solution of the equations to geomorphology for the physical interpretation of the results. In this light we organized this special issue (SI) soliciting multidisciplinary contributions which encompass any aspect needed for the development and applications of such models. Most of the papers in the SI stem from contributions to session HS9.5/GM7.11 on numerical modelling and experiments in river morphodynamics at the European Geosciences Union (EGU) General Assembly held in Vienna, April 27th to May 2nd 2014.
Development on Dose Assessment Model of Northeast Asia Nuclear Accident Simulator
Energy Technology Data Exchange (ETDEWEB)
Kim, Ju Yub; Kim, Ju Youl; Kim, Suk Hoon; Lee, Seung Hee; Yoon, Tae Bin [FNC Techology, Yongin (Korea, Republic of)
2016-05-15
In order to support the emergency response system, the simulator for overseas nuclear accident is under development including source-term estimation, atmospheric dispersion modeling and dose assessment. The simulator is named NANAS (Northeast Asia Nuclear Accident Simulator). For the source-term estimation, design characteristics of each reactor type should be reflected into the model. Since there are a lot of reactor types in neighboring countries, the representative reactors of China, Japan and Taiwan have been selected and the source-term estimation models for each reactor have been developed, respectively. For the atmospheric dispersion modeling, Lagrangian particle model will be integrated into the simulator for the long range dispersion modeling in Northeast Asia region. In this study, the dose assessment model has been developed considering external and internal exposure. The dose assessment model has been developed as a part of the overseas nuclear accidents simulator which is named NANAS. It addresses external and internal pathways including cloudshine, groundshine and inhalation. Also, it uses the output of atmospheric dispersion model (i.e. the average concentrations of radionuclides in air and ground) and various coefficients (e.g. dose conversion factor and breathing rate) as an input. Effective dose and thyroid dose for each grid in the Korean Peninsula region are printed out as a format of map projection and chart. Verification and validation on the dose assessment model will be conducted in further study by benchmarking with the measured data of Fukushima Daiichi Nuclear Accident.
Autonomous Behavioral Health Countermeasures for Spaceflight
National Aeronautics and Space Administration — In this reporting year we have deployed the VSS to three space analog environments: The HI-SEAS Mars Analog for both the 8-month and 12-month missions, the Canada...
National Research Council Canada - National Science Library
Anderson, John
1998-01-01
...) and AFIT MXTOOLS toolboxes were used to produce the optimal, multiobjective designs. These designs were implemented for flight test on the Calspan VSS I Learjet, simulating the unstable longitudinal dynamics of an F-16 type aircraft...
Developing a TQM quality management method model
Zhang, Zhihai
1997-01-01
From an extensive review of total quality management literature, the external and internal environment affecting an organization's quality performance and the eleven primary elements of TQM are identified. Based on the primary TQM elements, a TQM quality management method model is developed. This
Viscoplastic Model Development with an Eye Toward Characterization
Freed, Alan D.; Walker, Kevin P.
1995-01-01
A viscoplastic theory is developed that reduces analytically to creep theory under steady-state conditions. A viscoplastic model is constructed within this theoretical framework by defining material functions that have close ties to the physics of inelasticity. As a consequence, this model is easily characterized-only steady-state creep data, monotonic stress-strain curves, and saturated stress-strain hysteresis loops are required.
Normal Brain-Skull Development with Hybrid Deformable VR Models Simulation.
Jin, Jing; De Ribaupierre, Sandrine; Eagleson, Roy
2016-01-01
This paper describes a simulation framework for a clinical application involving skull-brain co-development in infants, leading to a platform for craniosynostosis modeling. Craniosynostosis occurs when one or more sutures are fused early in life, resulting in an abnormal skull shape. Surgery is required to reopen the suture and reduce intracranial pressure, but is difficult without any predictive model to assist surgical planning. We aim to study normal brain-skull growth by computer simulation, which requires a head model and appropriate mathematical methods for brain and skull growth respectively. On the basis of our previous model, we further specified suture model into fibrous and cartilaginous sutures and develop algorithm for skull extension. We evaluate the resulting simulation by comparison with datasets of cases and normal growth.
A continuum based fem model for friction stir welding-model development
Energy Technology Data Exchange (ETDEWEB)
Buffa, G. [Ohio State University, Department of Industrial, Welding and Systems Engineering, 1971 Neil Avenue, 210 Baker Systems, Columbus, OH 43210 (United States) and Dipartimento di Tecnologia Meccanica, Produzione e Ingegneria Gestionale, Universita di Palermo, Viale delle Scienze, 90128 Palermo (Italy)]. E-mail: g.buffa@dtpm.unipa.it; Hua, J. [Ohio State University, Department of Industrial, Welding and Systems Engineering, 1971 Neil Avenue, 210 Baker Systems, Columbus, OH 43210 (United States)]. E-mail: hua.14@osu.edu; Shivpuri, R. [Ohio State University, Department of Industrial, Welding and Systems Engineering, 1971 Neil Avenue, 210 Baker Systems, Columbus, OH 43210 (United States)]. E-mail: shivpuri.1@osu.edu; Fratini, L. [Dipartimento di Tecnologia Meccanica, Produzione e Ingegneria Gestionale, Universita di Palermo, Viale delle Scienze, 90128 Palermo (Italy)]. E-mail: abaqus@dtpm.unipa.it
2006-03-15
Although friction stir welding (FSW) has been successfully used to join materials that are difficult-to-weld or unweldeable by fusion welding methods, it is still in its early development stage and, therefore, a scientific knowledge based predictive model is of significant help for thorough understanding of FSW process. In this paper, a continuum based FEM model for friction stir welding process is proposed, that is 3D Lagrangian implicit, coupled, rigid-viscoplastic. This model is calibrated by comparing with experimental results of force and temperature distribution, then is used to investigate the distribution of temperature and strain in heat affect zone and the weld nugget. The model correctly predicts the non-symmetric nature of FSW process, and the relationships between the tool forces and the variation in the process parameters. It is found that the effective strain distribution is non-symmetric about the weld line while the temperature profile is almost symmetric in the weld zone.
A continuum based fem model for friction stir welding-model development
International Nuclear Information System (INIS)
Buffa, G.; Hua, J.; Shivpuri, R.; Fratini, L.
2006-01-01
Although friction stir welding (FSW) has been successfully used to join materials that are difficult-to-weld or unweldeable by fusion welding methods, it is still in its early development stage and, therefore, a scientific knowledge based predictive model is of significant help for thorough understanding of FSW process. In this paper, a continuum based FEM model for friction stir welding process is proposed, that is 3D Lagrangian implicit, coupled, rigid-viscoplastic. This model is calibrated by comparing with experimental results of force and temperature distribution, then is used to investigate the distribution of temperature and strain in heat affect zone and the weld nugget. The model correctly predicts the non-symmetric nature of FSW process, and the relationships between the tool forces and the variation in the process parameters. It is found that the effective strain distribution is non-symmetric about the weld line while the temperature profile is almost symmetric in the weld zone
Dynamic simulation of sustainable farm development scenarios using cognitive modeling
Directory of Open Access Journals (Sweden)
Tuzhyk Kateryna
2017-03-01
Full Text Available Dynamic simulation of sustainable farm development scenarios using cognitive modeling. The paper presents a dynamic simulation system of sustainable development scenarios on farms using cognitive modeling. The system incorporates relevant variables which affect the sustainable development of farms. Its user provides answers to strategic issues connected with the level of farm sustainability over a long-term perspective of dynamic development. The work contains a description of the model structure as well as the results of simulations carried out on 16 farms in northern Ukraine. The results show that the process of sustainability is based mainly on the potential for innovation in agricultural production and biodiversity. The user is able to simulate various scenarios for the sustainable development of a farm and visualize the influence of factors on the economic and social situation, as well as on environmental aspects. Upon carrying out a series of simulations, it was determined that the development of farms characterized by sustainable development is based on additional profit, which serves as the main motivation for transforming a conventional farm into a sustainable one. Nevertheless, additional profit is not the only driving force in the system of sustainable development. The standard of living, market condition, and legal regulations as well as government support also play a significant motivational role.
Conceptual basis for developing of trainig models in complex ...
African Journals Online (AJOL)
This paper presents conceptual basis for developing of training models of interactive assembling system for automatic building of application software systems, ... software generation, such as: program module compatibility, formalization of computer interaction and choosing of formal model for human machine interface.
Development of Water Quality Modeling in the United States
This presentation describes historical trends in water quality model development in the United States, reviews current efforts, and projects promising future directions. Water quality modeling has a relatively long history in the United States. While its origins lie in the work...
Management of information in development projects – a proposed integrated model
Directory of Open Access Journals (Sweden)
C. Bester
2008-11-01
Full Text Available The first section of the article focuses on the need for development in Africa and the specific challenges of development operations. It describes the need for a holistic and integrated information management model as part of the project management body of knowledge aimed at managing the information flow between communities and development project teams. It is argued that information, and access to information, is crucial in development projects and can therefore be seen as a critical success factor in any development project. In the second section of the article, the three information areas of the holistic and integrated information management model are described. In the section thereafter we suggest roles and actions for information managers to facilitate information processes integral to the model. These processes seek to create a developing information community that aligns itself with the development project, and supports and sustains it.
A nonlinear optimal control approach to stabilization of a macroeconomic development model
Rigatos, G.; Siano, P.; Ghosh, T.; Sarno, D.
2017-11-01
A nonlinear optimal (H-infinity) control approach is proposed for the problem of stabilization of the dynamics of a macroeconomic development model that is known as the Grossman-Helpman model of endogenous product cycles. The dynamics of the macroeconomic development model is divided in two parts. The first one describes economic activities in a developed country and the second part describes variation of economic activities in a country under development which tries to modify its production so as to serve the needs of the developed country. The article shows that through control of the macroeconomic model of the developed country, one can finally control the dynamics of the economy in the country under development. The control method through which this is achieved is the nonlinear H-infinity control. The macroeconomic model for the country under development undergoes approximate linearization round a temporary operating point. This is defined at each time instant by the present value of the system's state vector and the last value of the control input vector that was exerted on it. The linearization is based on Taylor series expansion and the computation of the associated Jacobian matrices. For the linearized model an H-infinity feedback controller is computed. The controller's gain is calculated by solving an algebraic Riccati equation at each iteration of the control method. The asymptotic stability of the control approach is proven through Lyapunov analysis. This assures that the state variables of the macroeconomic model of the country under development will finally converge to the designated reference values.
Development and Validation of a 3-Dimensional CFB Furnace Model
Vepsäläinen, Arl; Myöhänen, Karl; Hyppäneni, Timo; Leino, Timo; Tourunen, Antti
At Foster Wheeler, a three-dimensional CFB furnace model is essential part of knowledge development of CFB furnace process regarding solid mixing, combustion, emission formation and heat transfer. Results of laboratory and pilot scale phenomenon research are utilized in development of sub-models. Analyses of field-test results in industrial-scale CFB boilers including furnace profile measurements are simultaneously carried out with development of 3-dimensional process modeling, which provides a chain of knowledge that is utilized as feedback for phenomenon research. Knowledge gathered by model validation studies and up-to-date parameter databases are utilized in performance prediction and design development of CFB boiler furnaces. This paper reports recent development steps related to modeling of combustion and formation of char and volatiles of various fuel types in CFB conditions. Also a new model for predicting the formation of nitrogen oxides is presented. Validation of mixing and combustion parameters for solids and gases are based on test balances at several large-scale CFB boilers combusting coal, peat and bio-fuels. Field-tests including lateral and vertical furnace profile measurements and characterization of solid materials provides a window for characterization of fuel specific mixing and combustion behavior in CFB furnace at different loads and operation conditions. Measured horizontal gas profiles are projection of balance between fuel mixing and reactions at lower part of furnace and are used together with both lateral temperature profiles at bed and upper parts of furnace for determination of solid mixing and combustion model parameters. Modeling of char and volatile based formation of NO profiles is followed by analysis of oxidizing and reducing regions formed due lower furnace design and mixing characteristics of fuel and combustion airs effecting to formation ofNO furnace profile by reduction and volatile-nitrogen reactions. This paper presents
Poss, J E
2001-06-01
This article discusses the development of a new model representing the synthesis of two models that are often used to study health behaviors: the Health Belief Model and the Theory of Reasoned Action. The new model was developed as the theoretic framework for an investigation of the factors affecting participation by Mexican migrant workers in tuberculosis screening. Development of the synthesized model evolved from the concern that models used to investigate health-seeking behaviors of mainstream Anglo groups in the United States might not be appropriate for studying migrant workers or persons from other cultural backgrounds.
Toward developing more realistic groundwater models using big data
Vahdat Aboueshagh, H.; Tsai, F. T. C.; Bhatta, D.; Paudel, K.
2017-12-01
Rich geological data is the backbone of developing realistic groundwater models for groundwater resources management. However, constructing realistic groundwater models can be challenging due to inconsistency between different sources of geological, hydrogeological and geophysical data and difficulty in processing big data to characterize the subsurface environment. This study develops a framework to utilize a big geological dataset to create a groundwater model for the Chicot Aquifer in the southwestern Louisiana, which borders on the Gulf of Mexico at south. The Chicot Aquifer is the principal source of fresh water in southwest Louisiana, underlying an area of about 9,000 square miles. Agriculture is the largest groundwater consumer in this region and overpumping has caused significant groundwater head decline and saltwater intrusion from the Gulf and deep formations. A hydrostratigraphy model was constructed using around 29,000 electrical logs and drillers' logs as well as screen lengths of pumping wells through a natural neighbor interpolation method. These sources of information have different weights in terms of accuracy and trustworthy. A data prioritization procedure was developed to filter untrustworthy log information, eliminate redundant data, and establish consensus of various lithological information. The constructed hydrostratigraphy model shows 40% sand facies, which is consistent with the well log data. The hydrostratigraphy model confirms outcrop areas of the Chicot Aquifer in the north of the study region. The aquifer sand formation is thinning eastward to merge into Atchafalaya River alluvial aquifer and coalesces to the underlying Evangeline aquifer. A grid generator was used to convert the hydrostratigraphy model into a MODFLOW grid with 57 layers. A Chicot groundwater model was constructed using the available hydrologic and hydrogeological data for 2004-2015. Pumping rates for irrigation wells were estimated using the crop type and acreage
Model Development for Atomic Force Microscope Stage Mechanisms
National Research Council Canada - National Science Library
Smith, Ralph C; Hatch, Andrew G; De, Tathagata; Salapaka, Murti V; Raye, Julie K; del Rosario, Ricardo C
2005-01-01
In this paper, we develop nonlinear constitutive equations and resulting system models quantifying the nonlinear and hysteretic field-displacement relations inherent to lead zirconate titanate (PZT...
Modelling interactions between mitigation, adaptation and sustainable development
Reusser, D. E.; Siabatto, F. A. P.; Garcia Cantu Ros, A.; Pape, C.; Lissner, T.; Kropp, J. P.
2012-04-01
Managing the interdependence of climate mitigation, adaptation and sustainable development requires a good understanding of the dominant socioecological processes that have determined the pathways in the past. Key variables include water and food availability which depend on climate and overall ecosystem services, as well as energy supply and social, political and economic conditions. We present our initial steps to build a system dynamic model of nations that represents a minimal set of relevant variables of the socio- ecological development. The ultimate goal of the modelling exercise is to derive possible future scenarios and test those for their compatibility with sustainability boundaries. Where dynamics go beyond sustainability boundaries intervention points in the dynamics can be searched.
Predictive Eco-Cruise Control (ECC) system : model development, modeling and potential benefits.
2013-02-01
The research develops a reference model of a predictive eco-cruise control (ECC) system that intelligently modulates vehicle speed within a pre-set speed range to minimize vehicle fuel consumption levels using roadway topographic information. The stu...
Research & development and growth: A Bayesian model averaging analysis
Czech Academy of Sciences Publication Activity Database
Horváth, Roman
2011-01-01
Roč. 28, č. 6 (2011), s. 2669-2673 ISSN 0264-9993. [Society for Non-linear Dynamics and Econometrics Annual Conferencen. Washington DC, 16.03.2011-18.03.2011] R&D Projects: GA ČR GA402/09/0965 Institutional research plan: CEZ:AV0Z10750506 Keywords : Research and development * Growth * Bayesian model averaging Subject RIV: AH - Economic s Impact factor: 0.701, year: 2011 http://library.utia.cas.cz/separaty/2011/E/horvath-research & development and growth a bayesian model averaging analysis.pdf
International Nuclear Information System (INIS)
Liu, Victor Lei; Nakhla, G.; Bassi, A.
2004-01-01
In this work, batch activated sludge studies were investigated for the treatment of raw pet food wastewater characterized by oil and grease concentrations of 50,000-66,000 mg/L, COD and BOD concentrations of 100,000 and 80,000 mg/L, respectively, as well as effluent from an existing anaerobic digester treating the aforementioned wastewater. A pre-treatment process, dissolved air flotation (DAF) achieved 97-99% reduction in O and G to about 400-800 mg/L, which is still atypically high for AS. The batch studies were conducted using a 4-L bioreactor at room temperature (21 deg. C) under different conditions. The experimental results showed for the DAF pretreated effluent, 92% COD removal efficiency can be achieved by using conventional activated sludge system at a 5 days contact time and applied initial soluble COD to biomass ratio of 1.17 mg COD/mg VSS. Similarly for the digester effluent at average oil and grease concentrations of 13,500 mg/L, activated sludge affected 63.7-76.2% soluble COD removal at 5 days. The results also showed that all kinetic data best conformed to the zero order biodegradation model with a low biomass specific maximum substrate utilization rate of 0.168 mg COD/mg VSS day reflecting the slow biodegradability of the wastewater even after 99% removal of oil and grease
Ten-year operational dust forecasting - Recent model development and future plans
International Nuclear Information System (INIS)
Kallos, G; Spyrou, C; Astitha, M; Mitsakou, C; Solomos, S; Kushta, J; Pytharoulis, I; Katsafados, P; Mavromatidis, E; Papantoniou, N; Vlastou, G
2009-01-01
The Sahara desert is one of the major sources of mineral dust on Earth, producing up to 2x10 8 t yr- 1 . A combined effort has been devoted during the last ten years at the University of Athens (UOA) from the Atmospheric Modeling and Weather Forecasting Group (AM and WFG) to the development of an analysis and forecasting tool that will provide early warning of Saharan dust outbreaks. The developed tool is the SKIRON limited-area forecasting system, based on the Eta limited area modeling system with embedded algorithms describing the dust cycle. A new version of the model is currently available, with extra features like eight-size particle bins, radiative transfer corrections, new dust source identification and utilization of rocky soil characterization and incorporation of more accurate deposition schemes. The new version of SKIRON modeling system is coupled with the photochemical model CAMx in order to study processes like the shading effect of dust particles on photochemical processes and the production of second and third generation of aerosols. Moreover, another new development in the AM and WFG is based on the RAMS model, with the incorporation of processes like dust and sea-salt production, gas and aqueous phase chemistry and particle formation. In this study, the major characteristics of the developed (and under development) modeling systems are presented, as well as the spatiotemporal distribution of the transported dust amounts, the interaction with anthropogenically-produced particles and the potential implications on radiative transfer.
Developing models for the prediction of hospital healthcare waste generation rate.
Tesfahun, Esubalew; Kumie, Abera; Beyene, Abebe
2016-01-01
An increase in the number of health institutions, along with frequent use of disposable medical products, has contributed to the increase of healthcare waste generation rate. For proper handling of healthcare waste, it is crucial to predict the amount of waste generation beforehand. Predictive models can help to optimise healthcare waste management systems, set guidelines and evaluate the prevailing strategies for healthcare waste handling and disposal. However, there is no mathematical model developed for Ethiopian hospitals to predict healthcare waste generation rate. Therefore, the objective of this research was to develop models for the prediction of a healthcare waste generation rate. A longitudinal study design was used to generate long-term data on solid healthcare waste composition, generation rate and develop predictive models. The results revealed that the healthcare waste generation rate has a strong linear correlation with the number of inpatients (R(2) = 0.965), and a weak one with the number of outpatients (R(2) = 0.424). Statistical analysis was carried out to develop models for the prediction of the quantity of waste generated at each hospital (public, teaching and private). In these models, the number of inpatients and outpatients were revealed to be significant factors on the quantity of waste generated. The influence of the number of inpatients and outpatients treated varies at different hospitals. Therefore, different models were developed based on the types of hospitals. © The Author(s) 2015.
Ten-year operational dust forecasting - Recent model development and future plans
Energy Technology Data Exchange (ETDEWEB)
Kallos, G; Spyrou, C; Astitha, M; Mitsakou, C; Solomos, S; Kushta, J; Pytharoulis, I; Katsafados, P; Mavromatidis, E; Papantoniou, N; Vlastou, G [University of Athens, School of Physics, Atmospheric Modeling and Weather Forecasting Group - UOA/AM and WFG, University Campus, Bldg. PHYS-V, Athens 15784 (Greece)], E-mail: kallos@mg.uoa.gr
2009-03-01
The Sahara desert is one of the major sources of mineral dust on Earth, producing up to 2x10{sup 8} t yr-{sup 1}. A combined effort has been devoted during the last ten years at the University of Athens (UOA) from the Atmospheric Modeling and Weather Forecasting Group (AM and WFG) to the development of an analysis and forecasting tool that will provide early warning of Saharan dust outbreaks. The developed tool is the SKIRON limited-area forecasting system, based on the Eta limited area modeling system with embedded algorithms describing the dust cycle. A new version of the model is currently available, with extra features like eight-size particle bins, radiative transfer corrections, new dust source identification and utilization of rocky soil characterization and incorporation of more accurate deposition schemes. The new version of SKIRON modeling system is coupled with the photochemical model CAMx in order to study processes like the shading effect of dust particles on photochemical processes and the production of second and third generation of aerosols. Moreover, another new development in the AM and WFG is based on the RAMS model, with the incorporation of processes like dust and sea-salt production, gas and aqueous phase chemistry and particle formation. In this study, the major characteristics of the developed (and under development) modeling systems are presented, as well as the spatiotemporal distribution of the transported dust amounts, the interaction with anthropogenically-produced particles and the potential implications on radiative transfer.
Development of an Upper Extremity Function Measurement Model.
Hong, Ickpyo; Simpson, Annie N; Li, Chih-Ying; Velozo, Craig A
This study demonstrated the development of a measurement model for gross upper-extremity function (GUE). The dependent variable was the Rasch calibration of the 27 ICF-GUE test items. The predictors were object weight, lifting distance from floor, carrying, and lifting. Multiple regression was used to investigate the contribution that each independent variable makes to the model with 203 outpatients. Object weight and lifting distance were the only statistically and clinically significant independent variables in the model, accounting for 83% of the variance (p model indicates that, with each one pound increase in object weight, item challenge increases by 0.16 (p measurement model for the ICF-GUE can be explained by object weight and distance lifted from the floor.
Development of a Multidisciplinary Middle School Mathematics Infusion Model
Russo, Maria; Hecht, Deborah; Burghardt, M. David; Hacker, Michael; Saxman, Laura
2011-01-01
The National Science Foundation (NSF) funded project "Mathematics, Science, and Technology Partnership" (MSTP) developed a multidisciplinary instructional model for connecting mathematics to science, technology and engineering content areas at the middle school level. Specifically, the model infused mathematics into middle school curriculum…
Application of Molecular Modeling to Urokinase Inhibitors Development
Directory of Open Access Journals (Sweden)
V. B. Sulimov
2014-01-01
Full Text Available Urokinase-type plasminogen activator (uPA plays an important role in the regulation of diverse physiologic and pathologic processes. Experimental research has shown that elevated uPA expression is associated with cancer progression, metastasis, and shortened survival in patients, whereas suppression of proteolytic activity of uPA leads to evident decrease of metastasis. Therefore, uPA has been considered as a promising molecular target for development of anticancer drugs. The present study sets out to develop the new selective uPA inhibitors using computer-aided structural based drug design methods. Investigation involves the following stages: computer modeling of the protein active site, development and validation of computer molecular modeling methods: docking (SOL program, postprocessing (DISCORE program, direct generalized docking (FLM program, and the application of the quantum chemical calculations (MOPAC package, search of uPA inhibitors among molecules from databases of ready-made compounds to find new uPA inhibitors, and design of new chemical structures and their optimization and experimental examination. On the basis of known uPA inhibitors and modeling results, 18 new compounds have been designed, calculated using programs mentioned above, synthesized, and tested in vitro. Eight of them display inhibitory activity and two of them display activity about 10 μM.
The Development of Hierarchy of Effects Model in Advertising
Bambang Sukma Wijaya
2012-01-01
This paper aims to review the hierarchy of effects models in adverti-sing, especially the well-known model, AIDA (Attention, Interest, De-sire, and Action). Since its introduction by Lewis (1900) and generally attributed in the marketing and advertising literature by Strong (1925), the concept of AIDA’s hierarchy of effects model has been used by many researchers, both academicians and practitioners. The model is used to measure the effect of an advertisement. However, the deve-lopment of inf...
A new electron gas model for lattice vibrations in metals I : development of the model
International Nuclear Information System (INIS)
Ramamurthy, V.; Neelkandan, K.
1978-01-01
The theoretical study of the lattice dynamics of metals is generally based on either the phenomenological force constant method or the pseudopotential method. However, it has been found that all the existing phenomenological models are inconsistent. Hence a new model based on the deformation potential approximation has been developed. By comparing this model with the existing models, its salient features and limitations are discussed. (author)
Conformance test development with the Java modeling language
DEFF Research Database (Denmark)
Søndergaard, Hans; Korsholm, Stephan E.; Ravn, Anders P.
2017-01-01
In order to claim conformance with a Java Specification Request, a Java implementation has to pass all tests in an associated Technology Compatibility Kit (TCK). This paper presents a model-based development of a TCK test suite and a test execution tool for the draft Safety-Critical Java (SCJ......) profile specification. The Java Modeling Language (JML) is used to model conformance constraints for the profile. JML annotations define contracts for classes and interfaces. The annotations are translated by a tool into runtime assertion checks.Hereby the design and elaboration of the concrete test cases...
Comparing single- and dual-process models of memory development.
Hayes, Brett K; Dunn, John C; Joubert, Amy; Taylor, Robert
2017-11-01
This experiment examined single-process and dual-process accounts of the development of visual recognition memory. The participants, 6-7-year-olds, 9-10-year-olds and adults, were presented with a list of pictures which they encoded under shallow or deep conditions. They then made recognition and confidence judgments about a list containing old and new items. We replicated the main trends reported by Ghetti and Angelini () in that recognition hit rates increased from 6 to 9 years of age, with larger age changes following deep than shallow encoding. Formal versions of the dual-process high threshold signal detection model and several single-process models (equal variance signal detection, unequal variance signal detection, mixture signal detection) were fit to the developmental data. The unequal variance and mixture signal detection models gave a better account of the data than either of the other models. A state-trace analysis found evidence for only one underlying memory process across the age range tested. These results suggest that single-process memory models based on memory strength are a viable alternative to dual-process models for explaining memory development. © 2016 John Wiley & Sons Ltd.
On some recent developments in microscopic nuclear models
International Nuclear Information System (INIS)
Piepenbring, R.
1987-01-01
An overview of the status of development of some microscopic nuclear models is presented. A special attention is paid to the recent calculations starting from the effective nucleon-nucleon force, to the angular momentum projection method before variation, to the multiphonon method and to the selfconsistent coordinate method. The success and the limitations of the three last mentioned models are illustrated in the example of 168 Er
Hydraulic modeling development and application in water resources engineering
Simoes, Francisco J.; Yang, Chih Ted; Wang, Lawrence K.
2015-01-01
The use of modeling has become widespread in water resources engineering and science to study rivers, lakes, estuaries, and coastal regions. For example, computer models are commonly used to forecast anthropogenic effects on the environment, and to help provide advanced mitigation measures against catastrophic events such as natural and dam-break floods. Linking hydraulic models to vegetation and habitat models has expanded their use in multidisciplinary applications to the riparian corridor. Implementation of these models in software packages on personal desktop computers has made them accessible to the general engineering community, and their use has been popularized by the need of minimal training due to intuitive graphical user interface front ends. Models are, however, complex and nontrivial, to the extent that even common terminology is sometimes ambiguous and often applied incorrectly. In fact, many efforts are currently under way in order to standardize terminology and offer guidelines for good practice, but none has yet reached unanimous acceptance. This chapter provides a view of the elements involved in modeling surface flows for the application in environmental water resources engineering. It presents the concepts and steps necessary for rational model development and use by starting with the exploration of the ideas involved in defining a model. Tangible form of those ideas is provided by the development of a mathematical and corresponding numerical hydraulic model, which is given with a substantial amount of detail. The issues of model deployment in a practical and productive work environment are also addressed. The chapter ends by presenting a few model applications highlighting the need for good quality control in model validation.
Pioch, Nicholas J.; Lofdahl, Corey; Sao Pedro, Michael; Krikeles, Basil; Morley, Liam
2007-04-01
To foster shared battlespace awareness in Air Operations Centers supporting the Joint Forces Commander and Joint Force Air Component Commander, BAE Systems is developing a Commander's Model Integration and Simulation Toolkit (CMIST), an Integrated Development Environment (IDE) for model authoring, integration, validation, and debugging. CMIST is built on the versatile Eclipse framework, a widely used open development platform comprised of extensible frameworks that enable development of tools for building, deploying, and managing software. CMIST provides two distinct layers: 1) a Commander's IDE for supporting staff to author models spanning the Political, Military, Economic, Social, Infrastructure, Information (PMESII) taxonomy; integrate multiple native (third-party) models; validate model interfaces and outputs; and debug the integrated models via intuitive controls and time series visualization, and 2) a PMESII IDE for modeling and simulation developers to rapidly incorporate new native simulation tools and models to make them available for use in the Commander's IDE. The PMESII IDE provides shared ontologies and repositories for world state, modeling concepts, and native tool characterization. CMIST includes extensible libraries for 1) reusable data transforms for semantic alignment of native data with the shared ontology, and 2) interaction patterns to synchronize multiple native simulations with disparate modeling paradigms, such as continuous-time system dynamics, agent-based discrete event simulation, and aggregate solution methods such as Monte Carlo sampling over dynamic Bayesian networks. This paper describes the CMIST system architecture, our technical approach to addressing these semantic alignment and synchronization problems, and initial results from integrating Political-Military-Economic models of post-war Iraq spanning multiple modeling paradigms.
International Nuclear Information System (INIS)
Kim, K. R.; Lee, H. S.; Hwang, I. S.
2010-12-01
The objective of this project is to develop multi-dimensional computational models in order to improve the operation of uranium electrorefiners currently used in pyroprocessing technology. These 2-D (US) and 3-D (ROK) mathematical models are based on the fundamental physical and chemical properties of the electrorefiner processes. The validated models by compiled and evaluated experimental data could provide better information for developing advanced electrorefiners for uranium recovery. The research results in this period are as follows: - Successfully assessed a common computational platform for the modeling work and identify spatial characterization requirements. - Successfully developed a 3-D electro-fluid dynamic electrorefiner model. - Successfully validated and benchmarked the two multi-dimensional models with compiled experimental data sets
Groundwater development stress: Global-scale indices compared to regional modeling
Alley, William; Clark, Brian R.; Ely, Matt; Faunt, Claudia
2018-01-01
The increased availability of global datasets and technologies such as global hydrologic models and the Gravity Recovery and Climate Experiment (GRACE) satellites have resulted in a growing number of global-scale assessments of water availability using simple indices of water stress. Developed initially for surface water, such indices are increasingly used to evaluate global groundwater resources. We compare indices of groundwater development stress for three major agricultural areas of the United States to information available from regional water budgets developed from detailed groundwater modeling. These comparisons illustrate the potential value of regional-scale analyses to supplement global hydrological models and GRACE analyses of groundwater depletion. Regional-scale analyses allow assessments of water stress that better account for scale effects, the dynamics of groundwater flow systems, the complexities of irrigated agricultural systems, and the laws, regulations, engineering, and socioeconomic factors that govern groundwater use. Strategic use of regional-scale models with global-scale analyses would greatly enhance knowledge of the global groundwater depletion problem.
Condensation of steam in horizontal pipes: model development and validation
International Nuclear Information System (INIS)
Szijarto, R.
2015-01-01
This thesis submitted to the Swiss Federal Institute of Technology ETH in Zurich presents the development and validation of a model for the condensation of steam in horizontal pipes. Condensation models were introduced and developed particularly for the application in the emergency cooling system of a Gen-III+ boiling water reactor. Such an emergency cooling system consists of slightly inclined horizontal pipes, which are immersed in a cold water tank. The pipes are connected to the reactor pressure vessel. They are responsible for a fast depressurization of the reactor core in the case of accident. Condensation in horizontal pipes was investigated with both one-dimensional system codes (RELAP5) and three-dimensional computational fluid dynamics software (ANSYS FLUENT). The performance of the RELAP5 code was not sufficient for transient condensation processes. Therefore, a mechanistic model was developed and implemented. Four models were tested on the LAOKOON facility, which analysed direct contact condensation in a horizontal duct
Development of hydrogen combustion analysis model
Energy Technology Data Exchange (ETDEWEB)
Lim, Tae Jin; Lee, K. D.; Kim, S. N. [Soongsil University, Seoul (Korea, Republic of); Hong, J. S.; Kwon, H. Y. [Seoul National Polytechnic University, Seoul (Korea, Republic of); Kim, Y. B.; Kim, J. S. [Seoul National University, Seoul (Korea, Republic of)
1997-07-01
The objectives of this project is to construct a credible DB for component reliability by developing methodologies and computer codes for assessing component independent failure and common cause failure probability, incorporating applicability and dependency of the data. In addition to this, the ultimate goal is to systematize all the analysis procedures so as to provide plans for preventing component failures by employing flexible tools for the change of specific plant or data sources. For the first subject, we construct a DB for similarity index and dependence matrix and propose a systematic procedure for data analysis by investigating the similarity and redundancy of the generic data sources. Next, we develop a computer code for this procedure and construct reliability data base for major components. The second subject is focused on developing CCF procedure for assessing the plant specific defense ability, rather than developing another CCF model. We propose a procedure and computer code for estimating CCF event probability by incorporating plant specific defensive measure. 116 refs., 25 tabs., 24 figs. (author)
Development of a phenomenological constitutive model for polyurethane foams
International Nuclear Information System (INIS)
Neilsen, M.K.; Morgan, H.S.; Krieg, R.D.; Yoshimura, H.R.
1989-01-01
Rigid, closed-cell, polyurethane foam is used in impact limiters in nuclear waste transport containers. During a hypothetical nuclear waste transport accident, the foam is expected to absorb a significant amount of impact energy by undergoing large inelastic volume reductions. Consequently, the crushing of polyurethane foams must be well characterized and accurately modeled to properly analyze a transport container accident. At the request of Sandia National Laboratories, a series of uniaxial, hydrostatic and triaxial compression tests on polyurethane foams were performed by the New Mexico Engineering Research Institute (NMERI). The combination of hydrostatic and triaxial tests was chosen to provide sufficient data to characterize both the volumetric and deviatoric behaviors of the foams and the coupling between the two responses. Typical results from the NMERI tests are included in this paper. A complete description of these tests can be found in Neilsen et al., 1987. Constitutive models that have been used in the past to model foam did not capture some important foam behaviors observed in the NMERI tests. Therefore, a new constitutive model for rigid, closed-cell, polyurethane foams was developed and implemented in two finite element codes. Development of the new model is discussed in this paper. Also, results from analyses with the new model and other constitutive models are presented to demonstrate differences between the various models. 4 refs., 6 figs., 1 tab
A user-friendly model for spray drying to aid pharmaceutical product development.
Grasmeijer, Niels; de Waard, Hans; Hinrichs, Wouter L J; Frijlink, Henderik W
2013-01-01
The aim of this study was to develop a user-friendly model for spray drying that can aid in the development of a pharmaceutical product, by shifting from a trial-and-error towards a quality-by-design approach. To achieve this, a spray dryer model was developed in commercial and open source spreadsheet software. The output of the model was first fitted to the experimental output of a Büchi B-290 spray dryer and subsequently validated. The predicted outlet temperatures of the spray dryer model matched the experimental values very well over the entire range of spray dryer settings that were tested. Finally, the model was applied to produce glassy sugars by spray drying, an often used excipient in formulations of biopharmaceuticals. For the production of glassy sugars, the model was extended to predict the relative humidity at the outlet, which is not measured in the spray dryer by default. This extended model was then successfully used to predict whether specific settings were suitable for producing glassy trehalose and inulin by spray drying. In conclusion, a spray dryer model was developed that is able to predict the output parameters of the spray drying process. The model can aid the development of spray dried pharmaceutical products by shifting from a trial-and-error towards a quality-by-design approach.
User Guide for the International Jobs and Economic Development Impacts Model
Energy Technology Data Exchange (ETDEWEB)
Keyser, David [National Renewable Energy Lab. (NREL), Golden, CO (United States); Flores-Espino, Francisco [National Renewable Energy Lab. (NREL), Golden, CO (United States); Uriarte, Caroline [National Renewable Energy Lab. (NREL), Golden, CO (United States); Cox, Sadie [National Renewable Energy Lab. (NREL), Golden, CO (United States)
2016-09-01
The International Jobs and Economic Development Impacts (I-JEDI) model is a freely available economic model that estimates gross economic impacts from wind, solar, and geothermal energy projects for several different countries. Building on the original JEDI model, which was developed for the United States, I-JEDI was developed under the USAID Enhancing Capacity for Low Emission Development Strategies (EC-LEDS) program to support countries in assessing economic impacts of LEDS actions in the energy sector. I-JEDI estimates economic impacts by characterizing the construction and operation of energy projects in terms of expenditures and the portion of these expenditures made within the country of analysis. These data are then used in a country-specific input-output (I-O) model to estimate employment, earnings, gross domestic product (GDP), and gross output impacts. Total economic impacts are presented as well as impacts by industry. This user guide presents general information about how to use I-JEDI and interpret results as well as detailed information about methodology and model limitations.
Development of models of the magnetorheological fluid damper
Energy Technology Data Exchange (ETDEWEB)
Kazakov, Yu.B., E-mail: elmash@em.ispu.ru; Morozov, N.A.; Nesterov, S.A., E-mail: sergeinesterov37@gmail.com
2017-06-01
The algorithm for analytical calculation of a power characteristic of magnetorheological (MR) dampers taking into account the rheological properties of MR fluid is considered. The nonlinear magnetorheological characteristics are represented by piecewise linear approximation to MR fluid areas with different viscosities. The extended calculated power characteristics of a MR damper are received and they coincide with actual results. The finite element model of a MR damper is developed; it allows carrying out the analysis of a MR damper taking into account the mutual influence of electromagnetic, hydrodynamic and thermal fields. The results of finite element simulation coincide with analytical solutions that allows using them for design development of a MR damper. - Highlights: • Division of a MR fluid rheological curve into two sections with different viscosities. • Algorithm for calculation of a power characteristic of MR dampers is proposed. • Finite element model of a MR damper is developed. • Results of finite element simulation coincide with analytical solutions.
Development of a fault test experimental facility model using Matlab
Energy Technology Data Exchange (ETDEWEB)
Pereira, Iraci Martinez; Moraes, Davi Almeida, E-mail: martinez@ipen.br, E-mail: dmoraes@dk8.com.br [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)
2015-07-01
The Fault Test Experimental Facility was developed to simulate a PWR nuclear power plant and is instrumented with temperature, level and pressure sensors. The Fault Test Experimental Facility can be operated to generate normal and fault data, and these failures can be added initially small, and their magnitude being increasing gradually. This work presents the Fault Test Experimental Facility model developed using the Matlab GUIDE (Graphical User Interface Development Environment) toolbox that consists of a set of functions designed to create interfaces in an easy and fast way. The system model is based on the mass and energy inventory balance equations. Physical as well as operational aspects are taken into consideration. The interface layout looks like a process flowchart and the user can set the input variables. Besides the normal operation conditions, there is the possibility to choose a faulty variable from a list. The program also allows the user to set the noise level for the input variables. Using the model, data were generated for different operational conditions, both under normal and fault conditions with different noise levels added to the input variables. Data generated by the model will be compared with Fault Test Experimental Facility data. The Fault Test Experimental Facility theoretical model results will be used for the development of a Monitoring and Fault Detection System. (author)
Development of a fault test experimental facility model using Matlab
International Nuclear Information System (INIS)
Pereira, Iraci Martinez; Moraes, Davi Almeida
2015-01-01
The Fault Test Experimental Facility was developed to simulate a PWR nuclear power plant and is instrumented with temperature, level and pressure sensors. The Fault Test Experimental Facility can be operated to generate normal and fault data, and these failures can be added initially small, and their magnitude being increasing gradually. This work presents the Fault Test Experimental Facility model developed using the Matlab GUIDE (Graphical User Interface Development Environment) toolbox that consists of a set of functions designed to create interfaces in an easy and fast way. The system model is based on the mass and energy inventory balance equations. Physical as well as operational aspects are taken into consideration. The interface layout looks like a process flowchart and the user can set the input variables. Besides the normal operation conditions, there is the possibility to choose a faulty variable from a list. The program also allows the user to set the noise level for the input variables. Using the model, data were generated for different operational conditions, both under normal and fault conditions with different noise levels added to the input variables. Data generated by the model will be compared with Fault Test Experimental Facility data. The Fault Test Experimental Facility theoretical model results will be used for the development of a Monitoring and Fault Detection System. (author)