WorldWideScience

Sample records for mitt linnar prn

  1. Doktorikraad eestlasele / Hugo Mitt

    Index Scriptorium Estoniae

    Mitt, Hugo

    2007-01-01

    31. märtsil sai James Cooki nimelises ülikoolis, Townsvilles doktorikraadi Ingrid Mitt. Tema väitekirja pealkiri on : Dominant Masculinity Discourse in the Decisions of Early Shool Leaving boys in Queensland

  2. Teaduskultuuri arengukonflikt = Entwicklungskonflikt der Wissenschaftskultur / Linnar Viik

    Index Scriptorium Estoniae

    Viik, Linnar, 1965-

    2005-01-01

    Avatud infoühiskonnas pole ettevõtjale vaja mitte rahvuslikku innovatsiooni tugisüsteemi, kus partneriks püütakse pakkuda lähimat, kohalikku teadlast, vaid globaalses konkurentsis tegutsevad ettevõtted tahavad parimat, asjakohast ja tõhust teadust, leiab autor. Tabel. Vt. ka Carl Friedrich Gethmann'i kommentaari lk. 144-151,405-411 ja Jüri Engelbrechti kommentaari lk. 152-154,412-414

  3. Linnar Viik kaotas lahingu IKEA omanikule / Airi Ilisson

    Index Scriptorium Estoniae

    Ilisson, Airi, 1980-

    2005-01-01

    Linnar Viik valiti 50 kõige mõjukama eurooplase hulka ning kandideeris Euroopa aasta ärijuhi tiitlile, tiitli pälvis IKEA asutaja Ingvar Kamprad. Kõige edukama eurooplase tiitli sai Türgi peaminister Recep Tayyip Erdogan

  4. Exposure and risks from wearing asbestos mitts

    Directory of Open Access Journals (Sweden)

    Tindall Matthew

    2005-10-01

    Full Text Available Abstract Background Very high fibre inhalation exposure has been measured while people were wearing personal protective equipment manufactured from chrysotile asbestos. However, there is little data that relates specifically to wearing asbestos gloves or mitts, particularly when used in hot environments such as those found in glass manufacturing. The aim of this study was to assess the likely personal exposure to asbestos fibres when asbestos mitts were used. Results Three types of work activity were simulated in a small test room with unused mitts and artificially aged mitts. Neither pair of mitts were treated to suppress the dust emission. The measured respirable fibre exposure levels ranged from Conclusion People who wore asbestos mitts were likely to have been exposed to relatively low levels of airborne chrysotile asbestos fibres, certainly much lower than the standards that were accepted in the 1960's and 70's. The cancer risks from this type of use are likely to be very low.

  5. MITT writer and MITT writer advanced development: Developing authoring and training systems for complex technical domains

    Science.gov (United States)

    Wiederholt, Bradley J.; Browning, Elica J.; Norton, Jeffrey E.; Johnson, William B.

    1991-01-01

    MITT Writer is a software system for developing computer based training for complex technical domains. A training system produced by MITT Writer allows a student to learn and practice troubleshooting and diagnostic skills. The MITT (Microcomputer Intelligence for Technical Training) architecture is a reasonable approach to simulation based diagnostic training. MITT delivers training on available computing equipment, delivers challenging training and simulation scenarios, and has economical development and maintenance costs. A 15 month effort was undertaken in which the MITT Writer system was developed. A workshop was also conducted to train instructors in how to use MITT Writer. Earlier versions were used to develop an Intelligent Tutoring System for troubleshooting the Minuteman Missile Message Processing System.

  6. Miks mitte abielluda Iwonaga / Kristel Nõlvak

    Index Scriptorium Estoniae

    Nõlvak, Kristel

    2005-01-01

    A. Tshehhonte ja A. Tshehhovi "Miks mitte abielluda?" Vanalinna Muusikamajas Theatrumi näitlejate esituses ja L. Petersoni lavastuses ning W. Gombrowiczi "Iwona, Burgundi printsess" M. Petersoni lavastuses Theatrumi saalis

  7. Lõpetame raiskamise, mitte kulutamise / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2008-01-01

    Keerulisest majandusolukorrast välja tulemiseks tuleb lõpetada raiskamine, kuid mitte kulutamine. Autori sõnul põhjustab raiskamist alus- ja põhiharidusse piisavate kulutuste tegemata jätmine pika aja jooksul; raiskamist tähendab pisikestel omavalitsustel põhinev haldusstruktuur. Eesti vajab Riigikogu tulevikukomisjoni

  8. IT-visionäär Linnar Viik annaks igale põhikooliõpilasele sülearvuti / Holger Roonemaa

    Index Scriptorium Estoniae

    Roonemaa, Holger

    2006-01-01

    Linnar Viik peab vajalikuks anda kõigile üheksanda klassi õpilastele sülearvuti ning tekitada koolidesse WiFi leviala. Programmiga Külatee 3 eesmärk on tagada interneti püsiühendus hajusa asustusega maa-aladel, 2007. aastal hakkab traadita internetti pakkuma ka Televõrgu AS

  9. The Melbourne Institute Tax and Transfer Simulator (MITTS)

    OpenAIRE

    John Creedy; Guyonne Kalb; Hsein Kew

    2001-01-01

    This publication is a manual for the use of the Melbourne Institute Tax and Transfer Simulator (MITTS). MITTS provides a tool for analysing policy changes. It allows us to examine the effect of a variety of policy changes on labour supply and income distribution for the Australian.

  10. Microcomputer Intelligence for Technical Training (MITT): The evolution of an intelligent tutoring system

    Science.gov (United States)

    Norton, Jeffrey E.; Wiederholt, Bradley J.; Johnson, William B.

    1990-01-01

    Microcomputer Intelligence for Technical Training (MITT) uses Intelligent Tutoring System (OTS) technology to deliver diagnostic training in a variety of complex technical domains. Over the past six years, MITT technology has been used to develop training systems for nuclear power plant diesel generator diagnosis, Space Shuttle fuel cell diagnosis, and message processing diagnosis for the Minuteman missile. Presented here is an overview of the MITT system, describing the evolution of the MITT software and the benefits of using the MITT system.

  11. Eestlane ja mitte-eestlaste sallivustüpoloogia / Iris Pettai

    Index Scriptorium Estoniae

    Pettai, Iris, 1947-

    2002-01-01

    Ilmunud ka: Integratsion of Estonian Society monitoring 2002. - Tallinn, lk. 25-41. Mitte-eestlaste sallivus on arenenud intensiivsemalt kui eestlaste sallivus, sest ligi pooled mitte-eestlased on jõudnud kõrgematesse sallivuse faasidesse. Tabelid

  12. Mis saab eesti gümnaasiumist? / Igor Garšnek, Linnar Priimägi, Tiiu Purdelo ; vestluse pani kirja Raivo Juurak

    Index Scriptorium Estoniae

    Garšnek, Igor, 1958-

    2008-01-01

    Riigikirjandi drillimise asemel on vaja hakata gümnaasiumis süvendatult õppima valikaineid, leiavad TLÜ õppejõud Linnar Priimägi, Eesti Kunstiakadeemia õppejõud Igor Garšnek ja SA Õiguskolledži asutaja Tiiu Purdelo

  13. Discontinuing the Use of PRN Intramuscular Medication for Agitation in an Acute Psychiatric Hospital.

    Science.gov (United States)

    Hayes, Ariel; Russ, Mark J

    2016-03-01

    This study examined the impact of eliminating intramuscular PRN medication for agitation on patient and staff safety in an acute psychiatric inpatient setting. The current retrospective chart review investigated the use of PRN medications (oral and intramuscular) to treat acute agitation, including aggression, and related outcomes before and after a mandated change in PRN practice that required real time physician input before administration of intramuscular medications. The use of both oral and intramuscular PRN medications dramatically decreased following implementation of the mandated change in practice. In particular, the use of intramuscular PRNs for agitation decreased by about half. Despite this decrease, the assault rate in the hospital was unchanged, and the utilization of restraint and seclusion continued to decrease. It is possible to reduce the utilization of PRN medications for agitation without broadly compromising safety on acute care psychiatric inpatient units.

  14. Nurses' attitudes towards the use of PRN psychotropic medications in acute and forensic mental health settings.

    Science.gov (United States)

    Barr, Lesley; Wynaden, Dianne; Heslop, Karen

    2018-02-01

    Many countries now have national mental health policies and guidelines to decrease or eliminate the use of seclusion and restraint yet the use of Pro Re Nata (PRN) medications has received less practice evaluation. This research aimed to identify mental health nurses' attitudes towards the use of PRN medications with mental health consumers. Participants were working in forensic mental health and non-forensic acute mental health settings. The "Attitudes towards PRN medication use survey" was used and data were collected online. Data were analysed using the Statistical Package Social Sciences, Version 22.0. Practice differences between forensic and other acute mental health settings were identified related to the use of PRN medications to manage symptoms from nicotine, alcohol and other drug withdrawal. Differences related to the useage of comfort rooms and conducting comprehensive assessments of consumers' psychiatric symptoms were also detected. Qualitative findings highlighted the need for increased accountability for the prescribing and administration of PRN medications along with more nursing education/training to use alternative first line interventions. Nurses administering PRN medications should be vigilant regarding the indications for this practice to ensure they are facilitating the consumer's recovery by reducing the use of all forms of potentially restrictive practices in the hospital setting. The reasons for using PRN medications and PRN administration rates must be continually monitored to avoid practices such as high dose antipsychotics use and antipsychotic polypharmacy to ensure the efficacy of the consumers' management plans on their health care outcomes. © 2017 Australian College of Mental Health Nurses Inc.

  15. An effective method of handling PRN orders to reduce labor and improve efficiency.

    Science.gov (United States)

    McCollum, G K; Poe, W D

    1990-11-01

    Rex Hospital, Raleigh, NC, found its method of PRN (unit dose) medication delivery to be time consuming, labor intensive, and repetitive. Thus, it was decided to evaluate this system and to find a more efficient method of PRN delivery. A 24 hour supply of unit dose medication is delivered daily using a cart exchange system at this hospital. Three approaches were used to reduce the handling of PRN medications: (1) Removing all PRN orders of Milk of Magnesia, cascara, and mineral oil from the patient drawer. These three medications are now floor stock items at each nursing station; (2) Removing all PRN orders of 325 mg aspirin and acetaminophen tablets, 600 mg aspirin, and 650 mg acetaminophen suppositories. These items are now kept at the nurses station as a "no charge" floor stock item; and (3) Using zip-lock bags for all other non-controlled PRN medication orders. A 48 hour supply of medication is sent upon receipt of the original order, and not filled again until the empty bag is returned to the pharmacy. The plastic bag is identified by a computer generated label containing the patient's name, room number, and medication identification. The patient medication drawer is divided into two areas, one for storing standing medication orders and one for PRN orders. A time study showed a 40% improvement in cart filling time. The 48 hour supply of PRN medications rarely need refilling. Milk of Magnesia, cascara, and mineral oil PRN orders are often ordered, but seldom used. Thus, floor stocking these items has not been a problem. Floor stocking aspirin and acetaminophen as no charge items has been very successful. All medication orders, including aspirin, acetaminophen, Milk of Magnesia, and so forth are entered onto the patient's medication profile even though they are not sent from the pharmacy. Drug allergies or drug-drug interactions can be detected by reviewing the patient profile when the original order is entered onto the profile. Nursing is very pleased with the

  16. Staff and patient accounts of PRN medication administration and non-pharmacological interventions for anxiety.

    Science.gov (United States)

    Martin, Krystle; Ham, Elke; Hilton, N Zoe

    2018-05-31

    Most psychiatric inpatients will receive psychotropic PRN medication during their hospital stay for agitation, anxiety, and/or insomnia. While helpful in some cases, caution is warranted with regard to PRN use due to inherent risks of additional medication; therefore, experts advise that non-pharmacological interventions should be attempted first where indicated. However, research to date highlights that, in practice, non-pharmaceutical approaches are attempted in a minority of cases. While some information is known about the practice of PRN administration and the use of and barriers to implementing non-pharmacological interventions for treating acute psychiatric symptoms, full understanding of this practice is hampered by poor or altogether missing documentation of the process. This study used interviews with patients and staff from two psychiatric hospitals to collect first-person accounts of administering PRN medication for anxiety, thereby addressing the limitations of relying on documented notation found in previous research. Our results indicate that nurses are engaging in non-pharmacological interventions more often than had previously been captured in research. However, the types of strategies suggested are not typically evidence based and further, only happening approximately half the time. The barriers to providing such care are centred on two main beliefs about client choice and efficacy of these non-medical strategies. Implications for research and practice are discussed. © 2018 Australian College of Mental Health Nurses Inc.

  17. Dead Center: Berlin, the Postmodern Gothic, and Norman Ohler's Mitte

    Directory of Open Access Journals (Sweden)

    Steffen H. Hantke

    2006-06-01

    Full Text Available Cultural critics often frame present-day Berlin as a space of historical discontinuities, a nexus of modernity and postmodernity that, in its orientation toward the future, represents post-reunification Germany in all its complexity. However, this framing tends to suppress Gothic imagery, of which traces can be found in the critical discourse on the city. Recuperating such Gothic tropes from critical discourse, and then consciously and strategically re-deploying them, can be a valuable strategy for opening up new venues of thinking about the lingering presence of the past, the high cost of modernization, and the uncanny emotional and affective dimensions of urban space. While this project of recuperation has been taken on in some critical analyses of Berlin, most notably among them Brian Ladd's The Ghosts of Berlin (1997, it is the new German literature on Berlin that proceeds more boldly into the terrain of the Gothic. Among this new "Berlin literature," Norman Ohler's critically acclaimed Gothic novel Mitte (2001 stands out as a cogent analysis of the new Berlin and of the problems of inhabiting a decentralized urban space and reconnecting it to authentic historical experience.

  18. Documentation of psychotropic PRN medication administration: An evaluation of electronic health records compared with paper charts and verbal reports.

    Science.gov (United States)

    Martin, Krystle; Ham, Elke; Hilton, Zoe

    2018-05-12

    To describe the documentation of pro re nata (PRN) medication for anxiety, and to compare documentation at two hospitals providing similar psychiatric services, one that used paper charts and another that used an electronic health record (EHR). We also assessed congruence between nursing documentation and verbal reports from staff about the PRN administration process. The ability to accurately document patients' symptoms and the care given is considered a core competency of the nursing profession (Wilkinson, 2007); however, researchers have found poor concordance between nursing notes and verbal reports or observations of events (e.g., De Marinis, Piredda, Pascarella et al., 2009) and considerable information missing (e.g., Marinis et al., 2010). Additionally, the administration of PRN medication has consistently been noted to be poorly documented (e.g., Baker, Lovell, & Harris, 2008). The project was a mixed method, two-phase study that collected data from two sites. In phase 1, nursing documentation of PRN medication administrations was reviewed in patient charts; phase 2 included verbal reports from staff about this practice. Nurses using EHR documented more information than those using paper charts, including the reason for PRN administration, who initiated the administration, and effectiveness. There were some differences between written and verbal reports, including whether potential side effects were explained to patients prior to PRN administration. We continue the calls for attention to be paid to improving the quality of nursing documentation. Our results support the shift to using EHR, yet not relying on this method completely to ensure comprehensiveness of documentation. Efforts to address the quality of documentation, particularly for PRN administration, are needed. This could be done through training, using structured report templates, and switching to electronic databases. This article is protected by copyright. All rights reserved. This article is

  19. Berlin Mitte: Alexanderplatz and Friedrichstaße: Urban and historical images

    Directory of Open Access Journals (Sweden)

    Aranđelović Biljana

    2014-01-01

    Full Text Available Berlin Mitte is one of the most interesting parts of the city, located in the core of Berlin where every corner and stone can tell a story. Mitte, the cultural center of Berlin is also known as the political and economic hub of Berlin. This paper explores the urban and historical image of two important parts of Berlin Mitte district: Alexanderplatz and Friedrichstaße. Friedrichstraße, as the main shopping and business street in this area, was planned with great attention by Prussian authorities, while the area around Alexanderplatz grew up randomly and its streets did not follow any special urban patterns. All potential international investors wanted to come to Friedrichstraße after the fall of the Wall, while Alexanderplatz was not so attractive to them. Many famous architects took part in numerous competitions regarding urban planning reconstructions of the famous Alex throughout the 20th century. These two areas of the Mitte district, Alexanderplatz and Friedrichstaße, are very important for contemporary Berlin and both areas have different problems.

  20. USAs tuleks bensiiniaktsiisi hoopis tõsta, mitte langetada / Kenneth Rogoff

    Index Scriptorium Estoniae

    Rogoff, Kenneth

    2008-01-01

    Autor leiab, et bensiiniaktsiisi tuleks tõsta, mitte langetada. Nafta hinda kõrgena hoides teeb OPEC keskkonna säilitamiseks rohkem kui lääne poliitikud, kes püüavad pikendada ökoloogiliselt jätkusuutmatut lääne tarbimiskultust

  1. Mitte-eestlastest noorte kohanemine eestikeelses töökeskkonnas / Elvira Küün

    Index Scriptorium Estoniae

    Küün, Elvira

    2006-01-01

    Noorte mitte-eestlaste hakkamasaamisest Eestis pärast venekeelse kooli lõpetamist, väljavaated tööturul ning kohanemisest eestikeelses töökeskkonnas. Võrreldud on Tallinnast ja Ida-Virumaalt pärit noorte sotsiaalset adaptatsiooni

  2. Kuidas saada hakkama õpilaskoduta? / Ülle Luisk, Toomas Mitt, Aivar Part ... [jt.

    Index Scriptorium Estoniae

    2011-01-01

    Küsimusele vastasid: Viljandi gümnaasiumi direktor Ülle Luisk, Tõstamaa keskkooli direktor Toomas Mitt, Rakvere gümnaasiumi direktor Aivar Part, Tartu kutsehariduskeskuse direktor Andrus Kompus, Võru Kreutzwaldi gümnaasiumi direktor Katrin Martinfeld

  3. Online multiple intelligence teaching tools (On-MITT) for enhancing interpersonal teaching activities

    Science.gov (United States)

    Mohamad, Siti Nurul Mahfuzah; Salam, Sazilah; Bakar, Norasiken; Sui, Linda Khoo Mei

    2014-07-01

    The theories of Multiple Intelligence (MI) used in this paper apply to students with interpersonal intelligence who is encouraged to work together in cooperative groups where interpersonal interaction is practiced. In this context, students used their knowledge and skills to help the group or partner to complete the tasks given. Students can interact with each other as they learn and the process of learning requires their verbal and non-verbal communication skills, co-operation and empathy in the group. Meanwhile educators can incorporate cooperative learning in groups in the classroom. On-MITT provides various tools to facilitate lecturers in preparing e-content that applies interpersonal intelligence. With minimal knowledge of Information and Technology (IT) skills, educators can produce creative and interesting teaching activities and teaching materials. The objective of this paper is to develop On-MITT prototype for interpersonal teaching activities. This paper addressed initial prototype of this study. An evaluation of On-MITT has been completed by 20 lecturers of Malaysian Polytechnics. Motivation Survey Questionnaire is used as the instrument to measure four motivation variables: ease of use, enjoyment, usefulness and self-confidence. Based on the findings, the On-MITT can facilitate educators to prepare teaching materials that are compatible for interpersonal learner.

  4. Functional characterization of the origin of replication of pRN1 from Sulfolobus islandicus REN1H1.

    Directory of Open Access Journals (Sweden)

    Chijioke J Joshua

    Full Text Available Plasmid pRN1 from Sulfolobus islandicus REN1H1 is believed to replicate by a rolling circle mechanism but its origin and mechanism of replication are not well understood. We sought to create minimal expression vectors based on pRN1 that would be useful for heterologous gene expression in S. acidocaldarius, and in the process improve our understanding of the mechanism of replication. We constructed and transformed shuttle vectors that harbored different contiguous stretches of DNA from pRN1 into S. acidocaldarius E4-39, a uracil auxotroph. A 232-bp region 3' of orf904 was found to be critical for pRN1 replication and is therefore proposed to be the putative origin of replication. This 232-bp region contains a 100-bp stem-loop structure believed to be the double-strand origin of replication. The loop of the 100-bp structure contains a GTG tri-nucleotide motif, a feature that was previously reported to be important for the primase activity of Orf904. This putative origin and the associated orf56 and orf904 were identified as the minimal replicon of pRN1 because transformants of plasmids lacking any of these three features were not recovered. Plasmids lacking orf904 and orf56 but harboring the putative origin were transformable when orf904 and orf56 were provided in-trans; a 75-bp region 5' of the orf904 start codon was found to be essential for this complementation. Detailed knowledge of the pRN1 origin of replication will broaden the application of the plasmid as a genetic tool for Sulfolobus species.

  5. "Liha on sõnaks saand, mitte sõna lihaks..." : [luuletused] / Tõnu Õnnepalu

    Index Scriptorium Estoniae

    Õnnepalu, Tõnu

    2001-01-01

    Tekst eesti ja inglise k. T. Õnnepalu lühibiograafia eesti ja inglise k. lk. 221. Sisu: "Liha on sõnaks saand, mitte sõna lihaks..." = "Flesh has become word, word has not become flesh..." ; "Minu hing on teele valmis..." = "My soul is ready for the journay..." ; "Selgel vihmajärgsel hommikul märtsis..." = "A clear morning after the rain in March..." ; "Vabadus pole kevadõhk..." = "There is no freedom spring air..."

  6. The impact of a good practice manual on professional practice associated with psychotropic PRN in acute mental health wards: an exploratory study.

    Science.gov (United States)

    Baker, J A; Lovell, K; Harris, N

    2008-10-01

    As required or pro re nata (PRN) psychotropic medicines are frequently used in acute mental health wards. PRN is known to contribute to polypharmacy and high doses of antipsychotic medication. Few studies have attempted to improve clinician's use of these potentially harmful drugs. The objectives of the study were to determine the impact and acceptability of a good practice manual on prescribing and administration practices of PRN psychotropic medication in acute mental health wards. The study used a pre-post exploratory design with two acute mental health wards in the NW of England. Over the total trial period of 10 weeks, 28 of 35 patients received 484 doses of PRN. Patients had a mean of 3.6 prescriptions of 14 different PRN medications in 34 different dose combinations prescribed. Medication errors beyond poor quality of prescribing occurred in 23 of the 35 patients (65.7%). Prescription quality improved following the introduction of the intervention but quality of nursing notes reduced. Acceptability of the manual to both nursing and medical staff was high. The introduction of the manual appeared to influence some of the practices associated with the prescribing and administration of PRN psychotropic medications. Further, larger, more robust studies are required in this area. In particular research is required to identify the reasons why professionals continue to rely so heavily on using PRN medication.

  7. Increased incidence of cervical intraepithelial neoplasia in young women in the Mitte district, Berlin, Germany.

    Science.gov (United States)

    Blohmer, J U; Schmalisch, G; Klette, I; Grineisen, Y; Kohls, A; Guski, H; Lichtenegger, W

    1999-01-01

    To investigate whether the incidence of cervical intraepithelial neoplasia (CIN), in particular of high grade CIN, increased in Berlin during the period 1970-1989 and whether the ages of women with CIN had decreased. In the former German Democratic Republic, which had a highly centralized public health system, all gynecologic operations performed on women living in the Mitte district of Berlin were carried out during the period 1970-1989 (when the Berlin Wall fell) in the gynecologic clinic of the Charité Hospital. The incidence of all CIN increased from year to year over the observation period: 0.04% (1970-1971), 0.10% (1980-1981), 0.39% (1988-1989). There was a particularly high increase in the incidence of high grade intraepithelial neoplasms (CIN 3): 0.016% (1970-1971), 0.056% (1980-1981), 0.25% (1988-1989). With a virtually unchanged age distribution for women in the Mitte district of Berlin, the median age of women with CIN 3 decreased significantly from 1970 to 1989, from 39.5 (1970) to 33 (1989) (P < .001). The increase in the incidence of CIN, especially of high grade CIN, as well as the reduction in age for onset of the disease, makes high participation in screening necessary, above all among young women.

  8. Riigikogulased ongi teistmoodi asendis. Aga mitte nii teistmoodi, kui nad hetkel arvavad / Rein Taagepera ; interv. Urmo Soonvald

    Index Scriptorium Estoniae

    Taagepera, Rein, 1933-

    2007-01-01

    Politoloog Rein Taagepera vastab Riigikogu suurust, tööd ning seaduseelnõu, mis vabastab parlamendiliikmed kuluhüvitiste avalikustamisest, puudutavatele küsimustele. Lisa: Soome parlamendist õpitakse kulutamist, mitte tööl käimist; Rein Taagepera: teadlane, presidendikandidaat, Res Publica looja

  9. The cellular wall role of Pleurozium schreberi (Brid.) Mitt. in sorbtion and lengthy retention of 137Cs

    International Nuclear Information System (INIS)

    Sobchenko, V.A.

    2001-05-01

    After tree month experiment desorption the 137 Cs content of moss was about 60% of initial one. It shown the possibility of 137 Cs lengthy retention in forest moss cover. In studying experiment with live and mortified mosses (Pleurozium schreberi (Brid.) Mitt.) had shown the cellular wall main role in 137 Cs sorption

  10. Polymorphisms within the prnD and pltC genes from pyrrolnitrin and pyoluteorin-producing Pseudomonas and Burkholderia spp

    NARCIS (Netherlands)

    Souza, J.T.; Raaijmakers, J.M.

    2003-01-01

    Pyrrolnitrin (PRN) and pyoluteorin (PLT) are broad-spectrum antibiotics produced by several strains of Pseudomonas and Burkholderia species. Both antibiotics play an important role in the suppression of multiple plant pathogenic fungi. Primers were developed from conserved sequences and amplified

  11. Oncogenic activation of JAK3-STAT signaling confers clinical sensitivity to PRN371, a novel selective and potent JAK3 inhibitor, in natural killer/T-cell lymphoma.

    Science.gov (United States)

    Nairismägi, M -L; Gerritsen, M E; Li, Z M; Wijaya, G C; Chia, B K H; Laurensia, Y; Lim, J Q; Yeoh, K W; Yao, X S; Pang, W L; Bisconte, A; Hill, R J; Bradshaw, J M; Huang, D; Song, T L L; Ng, C C Y; Rajasegaran, V; Tang, T; Tang, Q Q; Xia, X J; Kang, T B; Teh, B T; Lim, S T; Ong, C K; Tan, J

    2018-05-01

    Aberrant activation of the JAK3-STAT signaling pathway is a characteristic feature of many hematological malignancies. In particular, hyperactivity of this cascade has been observed in natural killer/T-cell lymphoma (NKTL) cases. Although the first-in-class JAK3 inhibitor tofacitinib blocks JAK3 activity in NKTL both in vitro and in vivo, its clinical utilization in cancer therapy has been limited by the pan-JAK inhibition activity. To improve the therapeutic efficacy of JAK3 inhibition in NKTL, we have developed a highly selective and durable JAK3 inhibitor PRN371 that potently inhibits JAK3 activity over the other JAK family members JAK1, JAK2, and TYK2. PRN371 effectively suppresses NKTL cell proliferation and induces apoptosis through abrogation of the JAK3-STAT signaling. Moreover, the activity of PRN371 has a more durable inhibition on JAK3 compared to tofacitinib in vitro, leading to significant tumor growth inhibition in a NKTL xenograft model harboring JAK3 activating mutation. These findings provide a novel therapeutic approach for the treatment of NKTL.

  12. Morphogenetic Studies and In vitro Propagation of Two Mosses: Philonotis thwaitesii Mitt. and Brachythecium plumosum (Hedw. B.S.G.

    Directory of Open Access Journals (Sweden)

    Vishal Awasthi

    2012-03-01

    Full Text Available Well differentiated gametophytes of Philonotis thwaitesii Mitt., an acrocarpous moss and Brachythecium plumosum (Hedw. B.S.G., a pleurocarpous moss have been raised in vitro by inoculating their spores into a range of concentrations of inorganic media. Half-strength Knop’s macronutrients + Nitsch’s trace elements with 10 ppm ferric citrate was found the most suitable for growth and multiplication of these species in continuous light of 4,000-5,500 lux and at 21 ± 2ºC temperature. Protonemal buds developed on caulonema in P. thwaitesii while on chloronema in B. plumosum. Sucrose stimulated caulonemal differentiation, abundant rhizoid production and a few but much robust gametophyte development. Emergence of hyaline rhizoids like filaments has been observed in P. thwaitesii upon contact of gametophores with solid substratum while true rhizoids all along the length of gametophytes of B. plumosum emerges upon placing them horizontally on culture medium. Variable growth forms (weft-like branched as well as erect unbranched habit have been observed in both species in culture conditions. Sub-culturing of P. thwaitesii gave rise to new population via passing through chloronemal and caulonemal stage while B. plumosum directly regenerated into new gametophytes by-passing protonemal stage. In vitro raised plants were acclimatized and transferred to soil in order to their further proliferation.

  13. Impacts of the removal of shrubs on the physiological and biochemical characteristics of Syntrichia caninervis Mitt: in a temperate desert.

    Science.gov (United States)

    Yin, Ben-Feng; Zhang, Yuan-Ming; Lou, An-Ru

    2017-04-04

    Moss crusts play important roles in biological soil crusts biomass and soil surface stabilization. However, because of increasingly intensive human activities, especially grazing, the growth and survival of shrubs are seriously threatened. This study aimed to test whether the presence of shrubs affects the physiological state of the bryophyte Syntrichia caninervis Mitt. in this desert ecosystem. We simulated animal-grazed shrubs at three levels in the Gurbantunggut Desert and compared these simulations to exposed areas, measuring the indicators of growth and stress tolerance exhibited by bryophytes. The results showed that the removal of shrubs significantly decreased chlorophyll fluorescence activity and soluble protein content in S. caninervis, especially under the total shrub removal treatment. The ratio between the total removal of shrubs and other treatments in antioxidative enzymes and in osmotic adjustment substances of S. caninervis exhibited two types of responses. With the exception of malonyldialdehyde (MDA) and superoxide dismutase (SOD), the variables examined fitted as downward parabolic then upward parabolic temporal dynamics. The removal of shrubs is harmful to the survival of S.caninervis. In resource-constrained conditions, SOD is an important antioxidant enzyme that of peroxidase (POD), catalase (CAT) and osmotic adjustment substances, for S. caninervis survival.

  14. Sume superbiam! / Linnar Priimägi

    Index Scriptorium Estoniae

    Priimägi, Linnar, 1954-

    2008-01-01

    Vabadussõja keskne mälestusmärk Tallinna Reaalkooli (autor Ferdi Sannamees) ees on emotsionaalses mälus niivõrd tugevasti seotud noorusega, et just see sisetunne takistab paljusid omaks võtmast uue monumendi ideed

  15. "Mina ei ole mitte kunagi elus kedagi jälgida tahtnud. Kati ütleb ka, et tal pole mingeid probleeme sellest." / Jaan Toots ; interv. Kirsti Vainküla

    Index Scriptorium Estoniae

    Toots, Jaan, 1957-

    2005-01-01

    Prokurör lõpetas kriminaalmenetluse World Wide Investi Eesti juhi Jaan Tootsi suhtes oportuniteedi alusel. Ärimees eitab salakaamerate abil Kati Tootsi jälgimist. Lisad: Kati Toots: "See summa on absurd!"; Prokurör: kuritegu oli, kurjategijat mitte

  16. 2017 AMcard prn.pmd

    Indian Academy of Sciences (India)

    Administrator

    2017-11-03

    Nov 3, 2017 ... Chairperson: M M Sarin, Physical Research laboratory, Ahmedabad. 1200–1220 Shailesh Nayak, Ministry of Earth Sciences, New Delhi. Towards the understanding of triggered earthquakes. 1225–1245 Gobinda Majumder, Tata Institute of Fundamental Research, Mumbai. A journey to the discovery of ...

  17. "Mitte kunagi enam!" / Heino Piirsalu

    Index Scriptorium Estoniae

    Piirsalu, Heino

    2007-01-01

    Refereering Norra Reservohvitseride Assotsiatsiooni presidendi brigaadikindral Sigurd Hellstromi ettekandest "The Norwegian Home Guard - vital coponent in Norway's Homeland Defence" ( Norra kodukaitse - Norra kodumaakaitse vitaalne komponent) Liitlaste Reservohvitseride Ühingu sümpoosionil 6. juulil 2006. aastal Viterbos. 1946. aastal loodud Norra kodukaitsest

  18. Mitte ainult ristirahvale / Erik Konze

    Index Scriptorium Estoniae

    Konze, Erik

    2009-01-01

    Kaasaegse arhitektuuriga puukirikutest. Soomes Turus asuvast Püha Henriku kirikust (arhitektid Matti Sanaksenaho, Pirjo Sanaksenaho, Enrico Garbin). Austrias Andelsbuchis asuvast kabelist (arhitekt Andreas Cukrowicz). Šveitsis St. Loupi külas asuvast kabelist (arhitekt Danilo Mondada)

  19. Doktor Ellamaa elutants / Linnar Priimägi

    Index Scriptorium Estoniae

    Priimägi, Linnar, 1954-

    2002-01-01

    Helle Karise kavandatava portreefilmide sarja "Contra mortem" esimene film "Dr. Andres Ellamaa" : operaatorid Peter Murdmaa ja Marko Piirsoo : monteerija Eero Karis : produtsendid Helle Karis ja Maret Hirtentreu : kasutatud Carl Orffi muusikat : Myth Film 2002

  20. WW - ajakirjanik, publitsist / Linnar Priimägi

    Index Scriptorium Estoniae

    Priimägi, Linnar, 1954-

    1998-01-01

    Wim Wendersi dokumentaalfilmist "Ülestähendustest riiete ja linnade kohta" ("Aufzeichnungen zu Kleidern und Städten") : Saksamaa 1989. Selles filmis intervjueerib ja portreteerib režissöör jaapani moeloojat Yohji Yamamotot

  1. Vääritu film / Linnar Priimägi

    Index Scriptorium Estoniae

    Priimägi, Linnar, 1954-

    2006-01-01

    Jüri Sillarti mängufilm "Kuldrannake". Kunagise retrobändi kokkutulekut kujutava filmi stsenarist on Hans Luik oma näidendi "Tõe hetk" põhjal, operaator on Mait Mäekivi, produtsendid Kristian Taska ja Hans H. Luik, tootjafirmaks Taska Productions

  2. Puuduv paradigma : klassitsism : koopia / Linnar Priimägi

    Index Scriptorium Estoniae

    Priimägi, Linnar, 1954-

    2005-01-01

    Näitusekataloog-artiklikogumikust "Meistriteoste lummus : koopia Eestis XIX sajandil : näitus Kadrioru Kunstimuuseumis" (Tallinn : Eesti Kunstimuuseum, 2005), Peeter Lauritsa kujundusest, Tiina Abeli ja Tiina-Mall Kreemi artiklitest

  3. Lavater ja Goethe / Linnar Priimägi

    Index Scriptorium Estoniae

    Priimägi, Linnar, 1954-

    2016-01-01

    Arvustus: Lavateri näoraamat : valgustusajastu pilk inimesele ja kunstile : toetudes Johann Caspar Lavateri menuteosele "Füsiognoomilisi fragmente inimesetundmise ja ligimesearmastuse edendamiseks" (1775-1778) / koostanud, kommenteerinud ja toimetanud Anu Allikvee ja Tiina-Mall Kreem ; fragmentide tõlge: Katrin Kaugver. Tallinn : Eesti Kunstimuuseum, Mikkeli Muuseum ; Tallinna Ülikool, Akadeemiline Raamatukogu. 2015

  4. 17oct AM posters prn.pmd

    Indian Academy of Sciences (India)

    Administrator

    2017-11-05

    Nov 5, 2017 ... Session 2E: Public Lecture. Chairperson: Ram Ramaswamy, Jawaharlal Nehru University, New Delhi. 1800–1900 Sanjoy Hazarika, Commonwealth Human Rights ... 0950–1010 Subhro Bhattacharjee, International Centre for ...

  5. 16nov Sadhana broch prn.cdr

    Indian Academy of Sciences (India)

    2 Springer. For more information, please contact the Editorial office: ... alternative technologies, etc. The journal ... that are relevant to more than one professional group, either ... Sādhanā brings out special issues on theme-based topics or in.

  6. acadAR2011 prn.pmd

    Indian Academy of Sciences (India)

    Administrator

    journals for the calendar year 2010 are given in Tables ..... Though it was originally called 'anti-hydrogen ...... supplied with ready made formulae and asked to ..... Plasmodium falciparum. 6. ..... ideal vaccines; endophytic fungi in various plants;.

  7. Aga miks mitte panustada teraviljale? / Tarvo Vaarmets

    Index Scriptorium Estoniae

    Vaarmets, Tarvo

    2007-01-01

    Üha populaarsust koguvate ETFide ehk börsil kaubeldavate fondide hulka on lisandunud ka viimaste variatsioonid ETCd ehk börsil kaubeldavad toorained, nende perspektiivikust tõstab tarbimise kasv maailmas. Tabel: Millistel börsidel tehakse tehinguid ETF-idega

  8. MRP - mitte ainult ajalugu / Elle Puusaag

    Index Scriptorium Estoniae

    Puusaag, Elle, 1945-2017

    2008-01-01

    mõtteid 23. augustist 1939, päevast, mil NSV Liit ja natsi-Saksamaa allkirjastasid kurikuulsa Molotov-Ribbentrop Pakti (MRP) ja selle salaprotokollid. Euroopa Parlamendi saadiku Marianne Mikko algatatud aktsioonist europarlamendis. Tunne Kelami kõnest 23. augustil toimunud Hirvepargi kõnekoosolekul

  9. Euroopa vajab mootorit, mitte telge / Jeroen Bult

    Index Scriptorium Estoniae

    Bult, Jeroen

    2007-01-01

    Euroopa Liidu poliitika arengust kirjutades leiab autor, et igatsus Saksamaa ja Prantsusmaa liidu kui sisuliste juhtide järele on iganenud, sest uusliikmed selliseid juhte ei usaldaks, ning Euroopa tõeliseks mootoriks peaks olema hoopis sügav mure maailma geopoliitiliste trendide, eriti võitluse pärast üha vähenevate energiatagavarade üle

  10. Mitt Romney’s power of sympathy

    NARCIS (Netherlands)

    van de Bilt, E.

    2012-01-01

    Harriet Beecher Stowe’s famous nineteenth-century anti-slavery novel Uncle Tom’s Cabin is not just an early example of modern management theory and public relations strategies and a vivid illustration of changes in America’s protestant tradition, but also the proper guide for understanding 2012

  11. Mitte ainult akadeemilisest kammermuusikast / Toomas Velmet

    Index Scriptorium Estoniae

    Velmet, Toomas, 1942-

    2005-01-01

    Eesti Interpreetide Liidu üldkoosolekust 25. IV ja kolmest kontserdist: Tubina ühingu muusikaõhtu Estonia Valges saalis (3. V), Estonia kammerkontsert talveaias (7. V) ja "Akadeemiline kammermuusika" Kadrioru lossis (8. V)

  12. Miks mitte parima hariduskorraldusega riigiks? / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2006-01-01

    Ilmunud ka: Pärnu Postimees, Meie Maa, Virumaa Nädalaleht 1. sept. lk. 15,2,13, Põhjarannik, Severnoje Poberezhje 2. sept. lk. 2, Valgamaalane, Järva Teataja, Virumaa Teataja, Võrumaa Teataja, Vooremaa 5. sept. lk. 2,2,11,2,2, Sõnumitooja 6. sept. lk. 2, Hiiu Leht 12. sept. lk. 2. Autori sõnul peaks majanduslike eesmärkide asemel esikohale asetama haridusalased eesmärgid, selleks pakub ta välja omapoolsed lahendused

  13. Kuula. Koduperenaine, kuid mitte meeleheitel / Mart Juur

    Index Scriptorium Estoniae

    Juur, Mart, 1964-

    2007-01-01

    Briti duost Everything but the Girl. Heliplaatidest: Niko "The Frozen Borderline: 1968 - 1970", "A Tribute to Joni Mitchell", "Quentin Tarantino's "Death Proof' OST", "Timbaland "Timbaland presents: Shock Value", Kaiser Chiefs "Yours Truly, Angry Mob"

  14. Igal pool ja mitte kuskil / Piibe Piirma

    Index Scriptorium Estoniae

    Piirma, Piibe

    2006-01-01

    Võrgu- ehk netikunsti ajaloost ja arengust. Korea kunstniku Nam June Paiki, Vene kunstnike Aleksei Shulgini ja Olja Ljalina, hollandi fotograafi Joan Heemskerk'i, belgia kunstniku Dirk Paesmans'i, sloveeni kunstnike Vuk Cosic'i ja Marko Pelijhan'i, kanada kunstniku Robert Adrian X-i, saksa kunstnike Wolfgang Staehle, Rena Tangens'i ja Cornelia Sollfranki tegevusest. Šveitsi kunstirühmituse "Etoy" performance'ist "Toywar". Lühidalt eesti võrgukunstist, Mare Tralla ja Tiia Johannsoni tegevusest. Repliigid Heie Treierilt ja Raivo Kelomehelt

  15. Philipp Ther: In der Mitte der Gesellschaft.

    Czech Academy of Sciences Publication Activity Database

    Gabrielová, Jarmila

    2008-01-01

    Roč. 45, 1–2 (2008), s. 200-203 ISSN 0018-7003 Institutional research plan: CEZ:AV0Z90580513 Keywords : opera houses * Central Europe * 1815–1914 Subject RIV: AL - Art, Architecture, Cultural Heritage

  16. IKEA : madalahinnaline, mitte odavamaiguline / Marge Rahu

    Index Scriptorium Estoniae

    Rahu, Marge

    2003-01-01

    Rootsi mööblitootja IKEA edu põhjuseks võib pidada kvaliteetse toote pakkumist võimalikult soodsa hinna eest. Autor kirjeldab IKEA juhi Ingvar Kampradi karjääri mööbliäri tippu. Lisa: Soodsa hinnaga kvaliteettoode - kuidas on see võimalik?

  17. Mitte-Augé mittekohad / Terje Toomistu

    Index Scriptorium Estoniae

    Toomistu, Terje

    2012-01-01

    Maailma tuntumaid antropolooge Marc Augé külastas seoses oma teose "Kohad ja mittekohad : sissejuhatus ülimodernsuse antropoloogiasse" (Tallinna Ülikooli Kirjastus, 2012, tlk. Anti Saar) eestikeelse tõlke ilmumise ja Tallinna Ülikooli humanitaarinstituudi ning kultuuriteaduste ja kunstide doktorikooli intensiivseminariga 12.-13. oktoobril Eestit

  18. Catcher’s Mitt Final Report

    Science.gov (United States)

    2011-08-30

    launch systems and procedures do not conform to and spacecraft (both satellites and rocket bodies) are not properly disposed of in accordance with...Concepts of this class include the use of whipple shields, aerogel panels or structures, large multi-hulled spheres, and layered open-cell foam

  19. Laulu, mitte püsside abil

    Index Scriptorium Estoniae

    2008-01-01

    refereering Kanada ajakirjaniku ja filmikriitiku Katherine Monki 11. juulil 2008 ajalehes Ottawa Citizen ilmunud artiklist "You say you want a revolution? Estonians sing for peace : Film chronicles revolt powered by song, not guns."

  20. Maailmavaade Eesti Kunsti Muuseumile / Linnar Priimägi, Raimo Poom

    Index Scriptorium Estoniae

    Priimägi, Linnar, 1954-

    2000-01-01

    Eestis pole riigivalitsejatel maailmavaatelisi põhimõtteid. Eesti Kunstimuuseumi uue hoone ehitamise küsimust puudutavad viis põhimõtet -- riik ehitagu, vali kestvam, eelista avalikku, omadega olla, rahva subjektsust. Projekt Uus Maailmavaade (North Park)

  1. Giorgione "Magav Venus" : inimene ja pildiruum / Linnar Priimägi

    Index Scriptorium Estoniae

    Priimägi, Linnar, 1954-

    2001-01-01

    Giorgione'i maali "Magav Veenus" (1508/10) analüüs, mõjud ja seosed hilisemate Venustega kunstiajaloos ; Leonardo da Vinci "Mona Lisa" (1503/06) pilgu lahtimõtestamine ; kurtisanikultuur ja selle kajastamine maalikunstis.

  2. Meie tipud 2006 : ¡Eesti kirjanduskriitika artikliauhinnast 2006. aastal / Linnar Priimägi

    Index Scriptorium Estoniae

    Priimägi, Linnar, 1954-

    2007-01-01

    Eesti kirjanduskriitika 2006. aasta artikliauhinna neljast nominendist Anne Lillest (Antiiktragöödia, esteetika paradoksid ja Mati Unt. Keel ja Kirjandus 2006, nr. 6), Toomas Haugist (A. H. T. surm Aafrikas. Lisandusi Leo Frobeniuse "Jumala külalise" kadunud tõlkele. Looming 2006, nr. 6), Märt Väljatagast (Orja teadvus varjus ja valguses. Looming 2006, nr. 12) ja Eneken Laanesest (Mäletamise lühis: Ene Mihkelsoni "Ahasveeruse uni". Keel ja Kirjandus 2006, nr. 6)

  3. IT-ettevõtted edust üllatunud / Katre Pilvinski ; kommenteerinud Linnar Viik

    Index Scriptorium Estoniae

    Pilvinski, Katre

    2010-01-01

    Äripäeva kiiresti kasvavate ettevõtete ehk gasellide edetabeli edukaimatest IT-ettevõtetest Sportradar OÜ, Sona Systems ja Hansson, Leego & Partner juhid ning maailma parimatest IT-gasellidest Research In Motion ja Sigma Designs. Ettevõtete juhtide kommentaare

  4. PRN 94-2: Recycling Empty Aerosol Pesticide Containers

    Science.gov (United States)

    This notice offers registrants use of an optional label statement permitting recycling as an alternative to instructions to dispose of aerosol pesticide containers. Registrants may add a label reference to recycling the empty aerosol pesticide container.

  5. PRN 2011-1: Residential Exposure Joint Venture

    Science.gov (United States)

    This PR Notice is to advise registrants of an industry-wide joint venture, titled the Residential Exposure Joint Venture (REJV), which has developed a national survey regarding residential consumer use/usage data for pesticides.

  6. PRN 73-4: Residual Insecticides in Food Handling Establishments

    Science.gov (United States)

    This notice provides a copy of a Federal Register notice published July 6, 1973, regarding certain insecticides used in food-handling establishments. It establishes certain definitions and requirements related to approval for crack and crevice treatment.

  7. PRN 88-2: Clustering of Quaternary Ammonium Compounds

    Science.gov (United States)

    This Notice announces that EPA has clustered the Quaternary Ammonium Compounds into four groups for the purpose of testing chemicals to build a database that will support continued registration of the entire family of quaternary ammonium compounds

  8. Börsile? Miks ka mitte! / Gea Velthut-Sokka

    Index Scriptorium Estoniae

    Velthut-Sokka, Gea, 1977-

    2004-01-01

    Infotehnoloogiakaupade hulgimüügifirma TD Baltic kavandab börsile minekut, et teenida raha Venemaa turule laienemiseks. Diagramm: TD Baltic ootab üle 15% kasvu. Lisa: Kuidas Computer 2000 Eestist TD Baltic sai. Kommentaarid Äripäeva toimetajalt Tõnis Ojalt ja konkureeriva arvutifirma GNT Eesti tegevjuhilt Anti Kuivalt

  9. Elektriturg peab avanema tegelikkuses, mitte vaid paberil / Juhan Parts

    Index Scriptorium Estoniae

    Parts, Juhan, 1966-

    2008-01-01

    Ilmunud ka: Delovõje Vedomosti 26. juuni lk. 8. 2013. aastaks on planeeritud Eesti elektrituru täielik avatus. Eesti Energia turuosa on üle 95% ning sel puhul on elektrihinna dikteerimise võimalus väga suur

  10. Mõista mitte hukka mõista / Mario Sootna

    Index Scriptorium Estoniae

    Sootna, Mario, 1962-

    2004-01-01

    Rahvaliidu põllumajandusministri Tiit Tammsaare tagasiastumisest seoses teraviljavarude vargusega ning rünnakutest siseminister Margus Leivo vastu julgeolekuvarude varguse avastamise ning tema poja narkoprobleemide tõttu

  11. Mitte ainult jätistele : fassaadid kodututele / Karin Paulus

    Index Scriptorium Estoniae

    Paulus, Karin, 1975-

    1999-01-01

    Festival 'Backdoor media'99' koondnimetusega 'Fassaadid kodututele' Tallinnas. Andres Kure heliinstallatsioon, performance Tammsaare monumendi juures (kuraator Hanno Soans), Peterburi kunstnike Natalja Jegorova ja Olga Jakimanskaja videod, Silja Saarepuu kerjamiskarbid, Raoul Kurvitza video, samizdat-ajakiri.

  12. Efektiivne, aga mitte väga innovatiivne / Villu Zirnask

    Index Scriptorium Estoniae

    Zirnask, Villu, 1966-

    2006-01-01

    World Economic Forumi (WEF) hinnangul kuulub Eesti nende üheksa riigi hulka, mis on teel efektiivsusel põhinevast arengustaadiumist innovatsioonil põhinevasse staadiumi. Eesti kohast WEF-i konkurentsivõime edetabelis. Lisad: Eesti innovatsiooninäitajad võrreldes Euroopa Liidu keskmise tasemega; Innovatsioon: Eesti 2014. aasta eesmärgid. Tabel

  13. Rilke nii ja ( : ) Rilke naa ; Anderseni mitte juubel

    Index Scriptorium Estoniae

    2008-01-01

    2. apr. kirjanduslikul kolmapäeval Tallinna Kirjanike Majas tutvustab Kivisildnik Rainer Maria Rilke luulekogu "Joosepi kahtlused" ; 2. apr. tähistatakse Eesti Lastekirjanduse Keskuses rahvusvahelist lasteraamatupäeva. Vt. ka Looming, nr. 5, 2008, lk. 790

  14. Mitte lõbu, vaid seksorjus / Marianne Mikko

    Index Scriptorium Estoniae

    Mikko, Marianne, 1961-

    2004-01-01

    Ilmunud ka: Vali Uudised, 19. märts 2004, lk. 2; Harjumaa, 19. märts 2004, lk. 2; Põhjarannik, 17. märts 2004, lk. 2; Severnoje Poberezhje, 17. märts 2004, lk. 2; Vooremaa, 18. märts 2004, lk. 2; Koit, 18. märts 2004, lk. 6; Nädaline, 20. märts 2004, lk. 4; Hiiu Leht, 23. märts 2004, lk. 2; Sakala, 24. märts 2004, lk. 2; Türi Rahvaleht, 26. märts 2004, lk. 4; Vesti Nedeli, 4. juuni 2004, lk. 8; Valgamaalane, 29. juuli 2004, lk. 2. Sotsiaaldemokraatlik Erakond peab vajalikuks võidelda prostitutsiooniga seadusandluse reguleerimise teel

  15. Vabaduse Risti vennad : surnud, kuid mitte unustatud / Jaak Pihlak

    Index Scriptorium Estoniae

    Pihlak, Jaak

    2008-01-01

    Detsembris 2005 ilmus ajakirjanduses üleskutse "Vabaduse Risti vennad - Eesti Wabariigi eliit", millele olid lisatud 361 teadmata saatusega Vabaduse Risti kavaleri nimed. Selle üleskutse tulemusena selgus 176 mehe saatus

  16. Peter Fisk : hoidke servale, mitte keskele / Kaido Einama

    Index Scriptorium Estoniae

    Einama, Kaido, 1971-

    2007-01-01

    Strateegi ja turundaja, Genius Worksi tegevjuhi Peter Fiski esinemisest Tallinna Lauluväljaku uues konverentsikeskuses toimunud innovatsioonikonverentsil InnoEstonia 2007. Vt. samas: Kes on Peter Fisk?

  17. Värdjatest, kui mitte muust / Karlo Funk

    Index Scriptorium Estoniae

    Funk, Karlo, 1971-

    1999-01-01

    Mängufilmid "Tantsija aeg" ("Vremja tantsora") : Stsenarist Aleksandr Mindadze : režissöör Vadim Abdrashitov : Venemaa 1997 ja "Värdjatest ja inimestest" ("Pro urodov i ljudei") : Stsenarist ja režissöör Aleksei Balabanov : Venemaa - Ameerika Ühendriigid 1998

  18. Korpusepoiste raamat on vajalik, kuid mitte ammendav / Tõnu Tannberg

    Index Scriptorium Estoniae

    Tannberg, Tõnu, 1961-

    2008-01-01

    Rets. rmt.: Korpusepoisid : Eesti sõjamehed 22. eesti territoriaalkorpuses ja 8. eesti laskurkorpuses Teises maailmasõjas aastatel 1940-45. Tallinn : Eesti Akadeemiline Sõjaajaloo Selts : Sentinel, 2007

  19. Kuidas mitte muutuda nendesarnaseks / Valle-Sten Maiste

    Index Scriptorium Estoniae

    Maiste, Valle-Sten, 1972-

    2007-01-01

    Autor leiab, et Lihula monumendi, Sakala keskuse ja pronksmehe kõrvaldamisel on Eestis valitsevat mentaliteeti iseloomustav ebameeldiv ühisosa. Eesti peab olema hoolivam, solidaarsem ja peab võtma kuulda kõiki ühiskonna liikmeid, arendama kodanikuühiskonda

  20. President Ilves : Eesti tuleb teha ahvatlevaks elukeskkonna, mitte maksukeskkonnana

    Index Scriptorium Estoniae

    2007-01-01

    13. augustil 2007 kogunes Paslepas Presidendi Mõttekoda, mis seekord keskendus teaduse, majanduse ja innovatsiooni küsimustele. President Toomas Hendrik Ilves rõhutas vajadust investeerida senisest rohkem arendusse, teadusesse ja laiemalt haridusse, et vähendada vahemaad Euroopa jõukamate riikidega. Ingl. k. ilmunud ka: Vaba Eesti Sõna 16. aug. 2007, lk. 12, pealk.: President Ilves: Estonia must be made into an attractive living environment, not a tax environment

  1. Videomuinasjutt algastme eesti keele tundi : miks ka mitte? / Ene Peterson

    Index Scriptorium Estoniae

    Peterson, Ene

    2002-01-01

    Rets. : Tungal, Leelo. Videomuinasjutt "Printsess Mari ja konn Konrad" [Videosalvestis] = A fairytale on video "Princess Mari and frog Konrad". - Tallinn : Elav Teadus, 1993. - 1 videokassett (VHS) (120 min) + 1 raamat (32 lk.)

  2. Tappa võib, pilgata mitte / Kaarel Tarand

    Index Scriptorium Estoniae

    Tarand, Kaarel, 1966-

    2006-01-01

    Kunsti ja Taani ajalehes "Jyllands-Posten" avaldatud prohvet Muhamedi pilapiltide jõust, poliitilisest kunstist. Euroopas ja muhameedlikus maailmas toimuv on karikatuurizhanri vajalikkuse indikaator, hea argument, et "Sirbis" uuesti karikatuure avaldada

  3. Õõvafilm on fun, aga mitte ainult / Tiina Lokk

    Index Scriptorium Estoniae

    Lokk, Tiina, 1955-

    2006-01-01

    PÖFF-i abiga toimub Haapsalus õudusfilmide festival. Selle sissejuhatuseks annab T. Lokk pikema sissevaate õudusfilmi kui žanri kujunemisse ja väärtustesse. Lisatud festivalil näidatavate filmide nimekiri

  4. Mitte siseneda, ohtlik! / Laurence Lumiére

    Index Scriptorium Estoniae

    Lumiére, Laurence

    2000-01-01

    Mängufilm "Üheksas värav" ("The Ninth Gate") : Stsenaristid John Brownjohn, Roman Polanski Arturo Pérez-Reverte rom. järgi : režissöör Roman Polanski : Peaosas Johnny Depp : Ameerika Ühendriigid - Hispaania - Prantsusmaa - Belgia 1999

  5. Ümberrivistumine mitte ainult paremal / Ivari Padar

    Index Scriptorium Estoniae

    Padar, Ivari, 1965-

    2004-01-01

    Eesti poliitikamaastikul toimuvast. Sotsiaaldemokraatlikust Erakonnast võib saada vasaktsentristlik koondav jõud, mis tõmbab endasse näiteks Res Publicas, Rahvaliidus ja Keskerakonnas pettunud liikmeid ja valijaid

  6. "Die Young 2" - tegelikult mitte eriti õppefilm / Maris Meiessaar

    Index Scriptorium Estoniae

    Meiessaar, Maris

    2007-01-01

    Tervise Arengu Instituudi algatusel valminud õppefilm HIV-viiruse ohtudest ja aidsist "Sure noorelt" : stsenarist Asko Künnap : Chalice'i, Sten Sheripovi ja Röövel Ööbiku muusika : osades Nele Kirsipuu, Julius Seljamaa : Eesti 2007

  7. Surmanuhtlus - õiglane või mitte / Kalev Kask

    Index Scriptorium Estoniae

    Kask, Kalev

    2007-01-01

    Artiklis käsitletakse küsimust, kas surmanuhtlust pidada õiglaseks karistuseks või pole selle täitmine demokraatlikus ühiskonnas küllaldaselt õigustatud. Ilmunud ka Meie Maa : Nädalalõpp 19-20. jaan. 2007, lk. 3

  8. "Hair" - laul ja tants, mitte kultusmuusikal / Andris Feldmanis

    Index Scriptorium Estoniae

    Feldmanis, Andris, 1982-

    2006-01-01

    Kultusmuusikal "Hair" Rock Cafés Georg Otsa nim. Tallinna Muusikakooli õpilaste esituses, lavastaja Ivo Eensalu, muusikajuhid Mare Väljataga, Meelis Punder, tantsujuht Ulrike Ustav, kunstnikud Kristel Viks, Liisi Suuroja

  9. The problem of the autocatalytic origin of culture in Juri Lotman's cultural philosophy / Linnar Priimägi

    Index Scriptorium Estoniae

    Priimägi, Linnar, 1954-

    2005-01-01

    Kultuuri ülesehitusest ja funktsioonidest Juri Lotmani kultuurifilosofias. Kultuuri autokatalüütilisuses on paradoks, mille kohaselt kultuur ei saa tekkida millegi muu kui kultuuri olemasolu eeldusel

  10. Cogeneration plant Mitte. Environmental-friendly energy geneation in the heart of Berlin; Heizkraftwerk Mitte. Umweltschonende Energieerzeugung im Herzen von Berlin

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2006-07-01

    In the past, Vattenfall Europe Generation set a good example by operating the 800/900 MW generating units from 1991 to 2000. The introduction of supercritical steam parameters made net efficiency factors of more than 40% possible, even for lignite-fired power plants. To be exact, levels of about 42% could be reached. The article presents examples for the heat cycle layout and offers solutions to problems of the turbo-generating set, the main-steam pipelines and the steam boiler. The next generation of coal-fired power plants will then reach efficiency factors of more than 50%, thanks to steam temperatures of about 700 C. (GL)

  11. PRN 2001-1: First Aid Statements on Pesticide Product Labels

    Science.gov (United States)

    This PR notice is intended to provide guidance for what the Agency believes is the most updated appropriate first aid language for pesticide product labels to ensure that they continue to adequately protect the public.

  12. PRN 98-1: Self-Certification of Product Chemistry Data with Attachments

    Science.gov (United States)

    The Office of Pesticide Programs has established a self-certification program for certain product chemistry data of manufacturing-use products and end-use products produced by a non-integrated formulation system.

  13. PRN 99-1: Import of Unregistered Pesticides Intended for Export

    Science.gov (United States)

    This PR notice clarifies EPA's interpretation of the scope of the FIFRA Section 17 (a)(1) for import of unregistered pesticides, devices or pesticide active ingredients when the importation is solely for the purpose of formulation or packaging for export.

  14. PRN 98-5: New Forms for the Certification with Respect to Citation of Data

    Science.gov (United States)

    In 1998, EPA established new forms for citation of data to support the registration or reregistration of pesticide products. These forms are EPA Form 8570-34 (“Certification with Respect to Citation of Data”) and 8570-35 (“Data Matrix”).

  15. PRN 2002-X Draft: False or Misleading Pesticide Product Brand Name

    Science.gov (United States)

    This notice provides guidance to registrants and distributors on pesticide product brand names that may be false or misleading, either by themselves or in association with particular company names or trademarks. It is a draft.

  16. Decree 2006-265/PRN of 18 August 2006 fixing the modalities of mining law application

    International Nuclear Information System (INIS)

    2006-01-01

    This decree fixes modalities of applying ordinance 93-16 of 2 march 1993 concerning mining law in Niger Republic and its subsequent modified text. Any petitioner, owner of mining title, prospecting authorization, opening and mining quarry, sub-leaser shall have an office in Niger Republic and notify it to the Minister of Mines and energy. each licence or lease is based on an agreement between the government and the society. Any change of status, capital or personnel of the company shall be noted to the Minister of Mines and energy. The company shall pay fiscal duties and respect rules and regulations concerning mines and quarries health and safety [fr

  17. Oodata võib Hiina kaupade uputust. Ja mitte ainult odavate / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2010-01-01

    Kui paljud eksperdid usuvad Hiina esiletõusu, siis mõnedel hinnangutel järgneb praegusele Hiina majanduse kiirele toibumisele majandusmulli lõhkemine. Nädalalehes The Economist käsitleti põhjusi, miks osa vaatlejaid tõmbab paralleele praeguse Hiina ja 1980-ndate lõpu Jaapani vahel

  18. Mitte rohkem kontrolli, vaid maksuanalüüs / Marek Helm

    Index Scriptorium Estoniae

    Helm, Marek, 1973-

    2005-01-01

    Maksedistsipliini parandamise eesmärgil liigub maksuhaldur seni valitsenud maksu järelkontrolli praktikalt järk-järgult ennetavate tegevusmeetodite rakendamisele ja otsib kahe meetodi vahel tasakaalu

  19. Ajude defitsiit : [kraadiõpe ei suuda katta isegi mitte prioriteetsete erialade vajadusi] / Jaan Laas

    Index Scriptorium Estoniae

    Laas, Jaan, 1938-

    2002-01-01

    Akadeemilise järelkasvu probleeme Eestis. Magistrite ja doktorite vähene koosseis ei vasta riigi majandusliku ja ühiskonna kultuurilise arengu vajadustele. 6.dets. 2001 Riigikogus heaks kiidetud dokumendis "Teadmistepõhine Eesti. Eesti teadus- ja arendustegevuse strateegia 2001-2006" prioriteedina märgitud erialad on kraadiõppega sama hästi kui katmata. Joon.: Teaduse finantseerimine 6 teadussuuna ja 59 teadusala lõikes a. 1998-2000

  20. Linnapea kutsus aastavahetuse peol üles mitte valimatult kritiseerima / Ester Vilgats

    Index Scriptorium Estoniae

    Vilgats, Ester

    2008-01-01

    Pärnu Postimehe lugejad valisid "Pärnu aasta teoks 2007" MTV muusikaauhindade jagamisel "Euroopa uute helide" kategoorias esikoha pälvinud pop-punkansambli Bedwetters. Aastalõpupeost Pärnu kontserdimajas

  1. Kella neljane loeng ei hakka mitte kunagi kella neljast / Kristina Lukk ; intervjueerinud Pirgita-Maarja Hallas

    Index Scriptorium Estoniae

    Lukk, Kristina

    2009-01-01

    Vestlus Tallinna Ülikoolis psühholoogia magistrantuuri lõpetanud Kristina Lukkiga, kes jätkab õpinguid doktoriõppeprogrammis Lõuna-Hispaanias Huelva ülikoolis, uurides sealseid integreerumisprotsesse. Muljeid Hispaania ülikooliõppest

  2. Uurida või mitte uurida, selles on küsimus ... / Heli Müristaja

    Index Scriptorium Estoniae

    Müristaja, Heli

    2011-01-01

    MTÜ Eesti Turismihariduse Liidu 25.-26. mail toimunud turismiettevõtjate, -õpetajate ja -õppurite ühisseminarist, kus arutati , millist rolli kannavad uuringud kvaliteetsete ja jätkusuutlike turismitoodete ja -teenuste arendamisel. Välisesinejateks olid Tony Harrison Glasgow Caledonia Ülikooli Moffat Centre for Travel & Tourism Business Development vanemkonsultant Šotimaalt ja Soomest Eva Holmberg ning Kaija Lindroth Haaga-Kelia Porvoo üksusest

  3. Jõhkrad mängud - meelelahutus või mitte? / Katrin Nigul

    Index Scriptorium Estoniae

    Nigul, Katrin

    2008-01-01

    Austria režissööri Michael Haneke 1997. aastal valminud psühhodraama "Jõhkrad mängud" ("Funny Games") Ameerikas sama lavastaja käe all valminud uusversioon ("Funny Games U.S") : Ameerika Ühendriigid 2007

  4. Tüüri ava(sta)mas, kuid mitte ainult / Igor Garšnek

    Index Scriptorium Estoniae

    Garšnek, Igor, 1958-

    2011-01-01

    Kahest kontserdist Estonia kontserdisaalis - 4. märtsil ERSO ja Herbert Schuch (klaver) Olari Eltsi dirigeerimisel, kavas Tüüri Sümfoonia nr 8, Pärdi "Nekroloog" ja Ullmanni Klaverikontsert ning 10. märtsil Erkki-Sven Tüüri autorikontsert, kus esinesid Eesti Filharmoonia Kammerkoor ja Sinfonietta Riga Daniel Reussi juhatusel

  5. Victoria suudlus teeb maapoisist printsi, kuid mitte tulevase kuninga / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2010-01-01

    Printsess Victoria tulevasest abikaasast Daniel Westlingist, printsess Madelaine'i kihluse lõpetamisest, Bernadotte'ide dünastia asutajast Jean Bernadotte'ist. Monarhia toetajate vähenemisest Rootsis. Printsess Victoria ja Daniel Westlingi pulmatseremooniast 19. juunil

  6. Kas me oleme üksi kogu universumis? Pigem siiski mitte / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister, 1977-

    2008-01-01

    See, et inimkond pole veel mujalt eluvorme leidnud, ei tähenda nende puudumist. Populaarteaduslike astronoomiateostega tuntust kogunud Stephen Hawking usub, et elu lihtsalt peab eksisteerima ka mujal maailmaruumis

  7. Tallink võttis kompromissi vastu, ametiühing mitte / Helga Koger

    Index Scriptorium Estoniae

    Koger, Helga, 1945-

    2008-01-01

    Tallink võttis vastu riikliku lepitaja kompromissettepaneku ja on valmis tõstma Eesti lipu all sõitvate laevade töötajate eelmises palgaleppes fikseeritud palka järgmisel kolmel aastal vastavalt 25,9 ja 6 protsendi võrra

  8. Kristjan Port: dopinguproovi võtjad ei kiusa mitte kedagi / intervjueerinud Aet Süvari

    Index Scriptorium Estoniae

    Port, Kristjan, 1960-

    2011-01-01

    Sihtasutuse Eesti Antidoping nõukogu liige, Tallinna ülikooli terviseteaduste ja spordi instituudi direktor dotsent Kristjan Port selgitab intervjuus sportlastelt dopinguproovide võtmise protsessist, ka Andrus Veerpalult dopinguproovi võtmisest

  9. Elu läheb kallimaks, mitte paremaks / Tarmo Mänd

    Index Scriptorium Estoniae

    Mänd, Tarmo, 1950-

    2007-01-01

    Ilmunud ka: Severnoje Poberezhje, 16. juuni 2007, lk. 2; Nädaline, 19. juuni 2007, lk. 2; Hiiu Leht, 19. juuni 2007, lk. 2; Vooremaa, 19. juuni 2007, lk. 2; Meie Maa, 19. juuni 2007, lk. 2; Lääne Elu, 26. juuni 2007, lk. 2; Oma Saar, 26. juuni 2007, lk. 5; Valgamaalane, 26. juuni 2007, lk. 2; Koit, 7. juuli 2007, lk. 6; Pärnu Postimees, 13. juuli 2007, lk. 15. Autori sõnul kergitab kavandatav maksureform kõikide tooterühmade hindu. Eestimaa Rahvaliit on seisukohal, et senisest rohkem raha tuleks suunata sisejulgeoleku kindlustamiseks, hariduse ja tervishoiu arendamiseks, pensionide tõstmiseks, kohaliku omavalitsuse tulubaasi suurendamiseks

  10. Sündmused leiavad aset ikka inimese peas, mitte rahakotis / Tiit Palu ; interv. Margot Visnap

    Index Scriptorium Estoniae

    Palu, Tiit, 1970-

    2008-01-01

    Endla teatri eesseisvast hooajast, teatri majanduslikust olukorrast. Riias Balti teatrifestivalil etendunud Kalju Komissarovi lavastusest "Kangelane", 4. oktoobril esietenduvast Andrzej Saramonowiczi komöödiast "Testosteroon" ja teistest uuslavastustest lühidalt

  11. Igavesti (mitte)lihtsad asjad = The (n)ever simple things / Maija Rudovska

    Index Scriptorium Estoniae

    Rudovska, Maija, 1982

    2015-01-01

    Läti Rahvusraamatukogu endises hoones toimunud nüüdiskunsti näitus kandis sel aastal nime "Survival K(n)it 7" (tlk. sõnamäng: ellujäämispakike/kudumine). Eestlastest osales Flo Kasearu tööga "Ülestõus"

  12. Mitte ainult spordihoone = More than a Gym / Tuuli Köller

    Index Scriptorium Estoniae

    Köller, Tuuli

    2009-01-01

    Tartus 2009. a. valminud Eesti Maaülikooli spordihoonest, mille arhitektid on Maarja Kask, Karli Luik ja Ralf Lõoke, projekteerija AB Salto, sisekujundajad Katrin Kaevats ja Jaan Frank Port. Projekt 2007

  13. Me vajame häid, mitte odavaid õpetajaid / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2006-01-01

    Õpetajate madal palk tingib olukorra, kus äsja ülikooli lõpetanud pedagoogi ettevalmistusega noored ei asu kooli tööle, olukorda aitaks leevendada sotsiaaldemokraatide eelnõu, mille alusel kõrgharidusega õpetajate alampalk normkoormusel algaks Eesti keskmisest palgast

  14. I skuggan av mitt forna jag : Unga kvinnors upplevelser av våldsutsatthet

    OpenAIRE

    Hellgren, Åsa; Nordström, Alexandra

    2016-01-01

    Bakgrund: Våld i parrelationer hos ungdomar har ökat de senaste åren och blivit ett stort problem. Våldet kan leda till att de utsatta unga kvinnorna kan få både fysiska och psykiska hälsoproblem som påverkar deras framtid. Teoretiskt perspektiv: Som teoretisk referensram används Kari Martinsens teori om omsorg, inkluderande Martinsens begrepp om det förnimmande och det registrerade ögat, samt begreppen skuld och skam. Syfte: Syftet med denna litteraturstudie var att beskriva de unga kv...

  15. Mitte uhke, vaid omanäoline ja hubane / Ell-Maaja Randküla

    Index Scriptorium Estoniae

    Randküla, Ell-Maaja, 1939-2016

    2005-01-01

    Tallinnas Aaviku elurajoonis asuva eramu sisekujundus. Sisearhitekt Tiiu Truus, AB Studio 3. Ehitaja: KMG Ehitus. Põrandad on betoonist, viimistlusmaterjalideks vineer, plekk ja mööblilinoleum. T. Truus on kavandanud ka osa mööblist. T. Truusist, tema tähtsamad tööd. Ill.: 2 plaani, 9 värv. vaadet

  16. Kinkaleri : teater peab tekitama küsimuse, mitte andma vastuse / Marco Mazzoni ; interv. Andres Keil

    Index Scriptorium Estoniae

    Mazzoni, Marco

    2008-01-01

    1995. a. Itaalias asutatud kuuest kunstnikust - Matteo Bambi, Luca Camilletti, Massimo Conti, Marco Mazzoni, Gina Monaco ja Cristina Rizzo - koosnevast eksperimentaalteatrist Kinkaleri ja Kanuti Gildi saalis 7. ja 8. nov. esiettekandele tulevast lavastusest "Yes, Sir!"

  17. Tallinn 2011 ... mitte ainult koorikonkurss / Aivar Leštšinski

    Index Scriptorium Estoniae

    Leštšinski, Aivar, 1958-

    2011-01-01

    Festivali avapäeval esitletud CD-komplektist "Läbilõige eesti koorimuusikast" ja mõtteid, et riigitelevisioonis võik olla koorimuusikat puudutav saade ning koorifestivali "Tallinn 2011" tulemused

  18. Elektroonilise side andmete säilitamise saaga sai lahenduse, Eestis siiski veel mitte / Uno Lõhmus

    Index Scriptorium Estoniae

    Lõhmus, Uno, 1952-

    2016-01-01

    Euroopa Liidu direktiivist 2006/24/EÜ, mis käsitleb elektrooniliste sideteenuste ja sidevõrkude pakkujate tegevusega kaasnevate või nende töödeldud andmete säilitamist. Euroopa Kohtu otsusest asjas Tele2 Sverige ja Watson jt. Euroopa Kohtu seisukohtadest liiklus- ja asukohaandmete säilitamise kohta. Asjakohasest õiguslikust raamistikust Eestis

  19. Edgar Savisaar : Mina ei anna mitte mingit hinnangut / Edgar Savisaar ; interv. Dannar Leitmaa, Holger Roonemaa

    Index Scriptorium Estoniae

    Savisaar, Edgar, 1950-

    2008-01-01

    Tallinna linnapea vastused linnavalitsuse pressikonverentsil küsimustele, mis puudutasid Keskerakonna suurrahastaja Oliver Kruuda omavolilist ehitamist Nõmmel. Vt. samas: Holger Roonemaa. Inspektorid ei pannud Kruuda tegevust tähele

  20. Norra teadlane: "Breiviki tegu on erakordne, kuid ideed mitte." / Lars Gule ; intervjueerinud Krister Kivi

    Index Scriptorium Estoniae

    Gule, Lars

    2011-01-01

    Intervjuu Oslo Ülikooli teaduri, äärmuslusküsimuste eksperdiga äärmuslusest Norras, debatist Anders Behring Breivikiga Internetis, Breiviki manifestist ja massimõrvast, teaduri suhtumisest islamisse ja mitmekultuurilisusesse ning tema seotusest terrorismiga 34 aastat tagasi

  1. Zakajev: Tšetšeenia on Euroopa, mitte Vene siseasi / Ahmed Zakajev ; interv. Kadri Liik

    Index Scriptorium Estoniae

    Zakajev, Ahmed

    2003-01-01

    Tšetšeenia presidendi Aslan Mashadovi esindaja Ahmed Zakajev vastab küsimustele, mis puudutavad tema kohtuasja, Vene-Tšetšeenia konflikti, tshetsheenide tungimist Dagestani 1999. aastal. Tema hinnangul saab püsiva rahu tuua vaid Tšetšeenia kuulutamine rahvusvaheliseks protektoraadiks. Vt. samas: Analüütik: aitaks rahvusvaheline sekkumine. Tšetšeenia sõdade kronoloogia

  2. Lapsed ja nende karistamine : kas lüüa või mitte? / Anu Uritam

    Index Scriptorium Estoniae

    Uritam, Anu, 1972-

    2007-01-01

    Ülevaade Eestis kehtivatest õigusaktidest, rahvusvahelistest lepetest ja Euroopa Inimõiguste Kohtu lahenditest, mis käsitlevad laste karistamist ja füüsilist väärkohtlemist. Õiguslikust olukorrast teistes Euroopa riikides

  3. Doonorfond on vaesuse, mitte Iraagi pärast / Jeffrey D. Sachs

    Index Scriptorium Estoniae

    Sachs, Jeffrey D.

    2003-01-01

    Autor leiab, et Iraagi pikaajaline ülesehitamine ei vaja finantsabi välismaalt, vaid poliitilist reguleerimist, mis pole võimalik niikaua, kui USA jääb Iraagis okupatsioonijõuks. USA taotletav raha tuleks aga suunata ülemaailmsete hädade, nagu AIDS ja nälg, vastu võitlemiseks.

  4. Sandy ja Hugh - paar või mitte? / Hugh Grant, Sandra Bullock

    Index Scriptorium Estoniae

    Grant, Hugh, 1960-

    2003-01-01

    Romantilises komöödias "Kaks nädalat armumiseks" ("Two Weeks Notice"), režissöör Marc Lawrence, mängivad kaks kuulsat näitlejat. Staarid oma suhetest : Hugh Grant : "Sandra on geenius"; Sandra Bullock : "Oleme temaga nagu kaksikud!"

  5. Laval võib teha kõike, ainult mitte valetada / Aare Toikka

    Index Scriptorium Estoniae

    Toikka, Aare

    1999-01-01

    Saksamaa teatribiennaal "Augenblick mal" Berliinis ja ASSITEJ 13. maailmakongress ning festival Tromsø's Norramaal. ASSITEJ Eesti Keskuse delegaatidena osalesid Ivo Eensalu ja Mart Kampus. Eestit esindas festivalil VAT Teatri lavastus "Tuudur, Plutt ja Magdaleena". Juttu lasteteatritest Saksamaal (GRIPS Teater, Halle nukuteater, Theater Junge Generation Dresdenist, Neubrandenburgi Kammerteater), Taanis (Paraply-teater, teatritrupp "Batida", Egnsteatret Gruppe 38), Hollandis (Teater "Artemis"), Rootsis (Unga Klara teatrikompanii Stockholmi Linnateatri juures) ja Austraalias (Zeal Theater)

  6. Kolme peaga lohe : Rimini protokoll - teater või mitte? / Madli Pesti

    Index Scriptorium Estoniae

    Pesti, Madli, 1980-

    2008-01-01

    Dokumentaalset teatrit viljelevast saksa - šveitsi vabakutseliste lavastajate ühendusest Rimini Protokoll, mis tegutseb aastast 2000. Vastuolulistest hinnangutest grupile ja viimaste aastate töödest. Pikemalt etendusest "Cargo Sofia", mida sai hiljuti näha ka Tallinnas

  7. Rauno Pukonen : Meie toodangut armastatakse, meid endid mitte / Rauno Pukonen ; interv. Svea Talving

    Index Scriptorium Estoniae

    Pukonen, Rauno

    2004-01-01

    Farmaatsiafirmast Eli Lilly, ravimifirmade madalast mainest. Eli Lilly filiaali juhi sõnul ei lase väike turg ja tagasihoidlik kompensatsioon võimalikku ravimivalikut Eestisse tuua. Lisa: Fakte ettevõttest

  8. Meediamagnaat Murdoch võitleb, aga vist veel mitte elu eest / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2011-01-01

    Häkkimisskandaali ohjeldamiseks sulges Rupert Murdoch väljaande News of the World ja loobus tasulise televõrgu BSkyB ülevõtmisest. Autori väitel Murdoch oma Briti ajaleheäri müüma ilmselt ei kiirusta. Murdoch on koos oma News Corpi asetegevjuhist poja James Murdochiga Briti parlamendi komitee ette kutsutud

  9. Tiigri seljas ratsutav Naan ei naase mitte ainult õhtuti / Rein Ruutsoo

    Index Scriptorium Estoniae

    Ruutsoo, Rein, 1947-

    2008-01-01

    Eesti Draamateatris 16. märtsil esietendunud Enn Vetemaa, Erki Aule ja Merle Karusoo dokumentaallavastusest "Sigma Tau-C705", lavastaja Merle Karusoo. Lavastuse kohta avaldavad arvamust ka Arvo Valton ja Teet Kallas

  10. Kahn jõudis Eestisse tagasi, Komendant mitte veel / Toivo Tammik

    Index Scriptorium Estoniae

    Tammik, Toivo

    2006-01-01

    Louis Kahni päevad Kuressaares 6. ja 7. X. Arhitekti tütar Alexandra Tyng kinkis Kuressaare linnale Louis Kahni portree. Philadelphia ülikooli arhiivide juhataja William Whitaker ja Ingrid Mald-Villandi korraldasid L. Kahni tööde näituse, kujundas Peeter Laurits. Kuressaare Linnateatris näidati 6. X arhitekti poja Nathaniel Kahni filmi "My architect", 7. X toimus konverents. Robert McCarteri, Anne Tyngi, Vilen Künnapu ja Thomas Leslie (L. Kahni ja August Komendandi suhted) ettekannetest

  11. Pirita klooster Eesti ajaloomälus : mitte ainult kloostri taga metsas / Linda Kaljundi

    Index Scriptorium Estoniae

    Kaljundi, Linda

    2007-01-01

    Pirita klooster on üks Eesti tuntumaid keskaja sümboolseid ja visuaalseid märke, mille roll on olnud Eesti ajaloomälus silmapaistev ja erakordselt mitmetahuline, olenevalt ajastute vajadustest ja taustsüsteemidest. Ta ühendab endas n.-ö. mälupaigana terve rea erinevaid sõnalisi, visuaalseid ja performatiivseid kihistusi

  12. Kas tegeleda uue töölepinguseadusega või mitte? / Väino Linde

    Index Scriptorium Estoniae

    Linde, Väino, 1959-

    2008-01-01

    Töölepingu seaduse eelnõust, kehtiva töölepingu puudustest ning kompromissi vajalikkusest. Ilmunud ka Sakala 23. jaan. 2008, lk. 2, pealkiri kujul: aeg otsida kompromisse ; Vali Uudised 23. jaan. 2008, lk. 2 ; Põhjarannik 22. jaan. 2008, lk. 4 ; Meie Maa 23. jaan. 2008, lk. 2 ; Hiiu Leht 25. jaan. 2008, lk. 2 ; Vooremaa 24. jaan. 2008, lk. 2 ; Võrumaa Teataja 24. jaan. 2008, lk. 2 ; Pärnu Postimees 25. jaan. 2008, lk. 15 ; Lääne Elu 26. jaan. 2008, lk. 2, Virumaa Teataja 29. jaan. 2008, lk. 11

  13. Arheoloog tunneb puudust ajast, mitte rahast / Aivar Kriiska ; interv. Erkki Bahovski

    Index Scriptorium Estoniae

    Kriiska, Aivar

    2005-01-01

    40. sünnipäeva puhul intervjuu arheoloog Aivar Kriiskaga, kes juhatab väljakaevamisi Narvas, kus üheks projektiks on keraamikalaager - Eesti Kunstiakadeemia, Tartu Ülikooli, Narva muuseumi ja Narva kolledzhi ühisprojekt. Valter Lang A. Kriiskast

  14. Draft PRN 2006-A: Use of Antimicrobial Pesticide Products in Heating, Ventilation, Air Conditioning and Refrigeration Systems (HVAC&R)

    Science.gov (United States)

    This draft notice provides guidance to registrants of EPA-registered antimicrobial products whose labels bear general directions related to hard, non-porous or porous surfaces, but which are not but which are not specifically registered for HVAC uses.

  15. Prayer and the Registered Nurse (PRN): nurses' reports of ease and dis-ease with patient-initiated prayer request.

    Science.gov (United States)

    Minton, Mary E; Isaacson, Mary; Banik, Deborah

    2016-09-01

    To explore nurse comfort with patient-initiated prayer request scenarios. Spiritual care is fundamental to patient care evidenced by Joint Commission requirement of a spiritual assessment on a patient's hospital admission. Prayer is an assessment component. Patients may seek solace and support by requesting prayer from the bedside nurse, the nurse may lack confidence in responding. Absent in the literature are reports specific to nurses' comfort when patients initiate prayer requests. Cross-sectional mixed methods study. Data were collected in early 2014 from 134 nurses in the USA via an online survey using QuestionPro. The qualitative results reported here were collated by scenario and analysed using thematic analysis. The scenario responses revealed patterns of ease and dis-ease in response to patient requests for prayer. The pattern of ease of prayer with patients revealed three themes: open to voice of calm or silence; physical or spiritual; can I call the chaplain. For these nurses, prayer is a natural component of nursing care, as the majority of responses to all scenarios demonstrated an overwhelming ease in response and capacity to pray with patients on request. The pattern of dis-ease of prayer with patients distinguished two themes: cautious hesitancy and whose God. These nurses experienced dis-ease with the patient's request no matter the situation. Educators and administrators must nurture opportunities for students and nurses to learn about and engage in the reflective preparation needed to respond to patient prayer requests. © 2016 John Wiley & Sons Ltd.

  16. Nii hindas võistlusfilme meie žürii

    Index Scriptorium Estoniae

    2006-01-01

    Toimetuse žürii koosseisus Linnar Priimägi, Marko Raat, Toomas Raudam, Marianne Kõrver, Stuart Sweeney hindab PÖFFil näidatavaid filme. Seekord kommenteerivad oma hinnanguid Linnar Priimägi, Toomas Raudam, Stuart Sweeney ja Marianne Kõrver

  17. Säästumarketi reklaam pahandab Selverit. Kas halvustab konkurenti või mitte? / Erik Prozes ; kommenteerinud Jana Koppel

    Index Scriptorium Estoniae

    Prozes, Erik, 1970-

    2011-01-01

    Selveri juht Andres Heinver on seisukohal, et Säästumarketi reklaam on tehtud seaduse piirimail. Tarbijakaitseameti esmasel hinnangul on Säästumarketi kaubamärgireklaam kooskõlas reklaamiseaduse põhinõuetega

  18. Yaşar Yakiş: see on Kairo 2011, mitte Teheran 1979 / intervjueerinud Priit Simson

    Index Scriptorium Estoniae

    Yakiş, Yaşar

    2011-01-01

    Intervjuu Türgi endise peaministri ja Egiptuse-suursaadikuga Egiptuse rahutuste taustast, president Hosni Mubarakist, asepresident Omar Suleimanist, Muslimi Vennaskonnast, sõjaväe positisioonist Egiptuses. Tema arvates on Egiptus jõudnud punkti, kust tagasipöördumist ei ole, kuid see uus ei tarvitse muutuda vastupidiseks võrreldes praeguse režiimiga

  19. Hukkamõist on mälu küsimus, mitte kättemaks / Andres Herkel

    Index Scriptorium Estoniae

    Herkel, Andres, 1962-

    2001-01-01

    Hinnangust nõukogude režiimile. Autor: Isamaaliit. Parlamendisaadik. Ilmunud ka: Koit, 14. juuni 2001, lk. 6; Lääne Elu, 14. juuni 2001, lk. 4; Meie Maa, 15. juuni 2001, lk. 2; Hiiu Leht, 15. juuni 2001, lk. 2; Järva Teataja, 16. juuni 2001, lk. 2; Valgamaalane, 16. juuni 2001, lk. 2; Pärnu Postimees, 14. juuni 2001, lk. 11; Nädaline, 14. juuni 2001, lk. 2

  20. Francis Fukuyama : edukas lõimumine toetub omakasule, mitte kultuurile / Francis Fukuyama ; tõlk. Marek Laane

    Index Scriptorium Estoniae

    Fukuyama, Francis

    2007-01-01

    Autor arutleb Huntingtoni tsivilisatsioonide kokkupõrke teooria üle ja väidab, et identiteetide konflikti aitavad ületada institutsioonidele ja reeglitele rajanev rahvusvaheline kord. Vt. samas: F. Fukuyama lühielulugu

  1. Tipus või mitte - see on küsimus : kohtumised Katmandus / Elisabeth Hawley ; vestelnud Jane Riga

    Index Scriptorium Estoniae

    Hawley, Elisabeth

    2014-01-01

    Elisabeth Hawley asutatud Himalayan Database kogub andmeid Himaalaja tipputõusude kohta. Elisabeth Hawley räägib lugusid legendaarsetest tippjõudjatest. Intervjuu Hawley assistendi Billi Bierlingiga andmebaasist

  2. Aas : pole vahet, kas odavalt korteri saajal on kinnisvara või mitte / Taavi Aas ; interv. Urmas Seaver

    Index Scriptorium Estoniae

    Aas, Taavi, 1966-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke, 2. märts 2007, lk. 8. Tallinna abilinnapea sõnul ei pea linn vajalikuks uurida, kas turuhinnast palju odavamalt kortereid saavatel inimestel on juba kinnisvara, sest nii hüvitatakse neile omandireformiga tehtud ülekohut

  3. Polli prügila rahastamise otsus vaidluste rägastikus. Kas riigiabi või mitte? / Koit Brinkmann

    Index Scriptorium Estoniae

    Brinkmann, Koit

    2011-01-01

    Keskkonnainvesteeringute Keskuse (KIK) otsusesse, millega eraldati OÜ Polli Prügilale toetus prügila rajamiseks Lõuna-Eestisse, lisati punkt, mille kohaselt peab Euroopa Komisjonilt saama kinnituse, et tegemist ei ole riigiabiga

  4. Igavese armastuse sõdalane : mitte just klassika, aga ajaloo verstapost küll / Ilmar Raag

    Index Scriptorium Estoniae

    Raag, Ilmar, 1968-

    2006-01-01

    Soome ja Hiina mütoloogiat ühendavast fantaasiafilmist "Igavese armastuse sõdalane - Jade Warrior" (Soome, Hiina, Hollandi, Eesti ühistöö) : stsenarist Iiro Küttner, režissöör Antti-Jussi Annila, võitluskunstide koreograaf Yu Yan Kai, osades - Tommi Eronen, Zhang Jingchu, Markku Peltola, Elle Kull

  5. Alati peab olema valmis mitte ainult plaan B, vaid ka C, D, E ... / Ülle Järv

    Index Scriptorium Estoniae

    Järv, Ülle, 1958-

    2008-01-01

    Ilmunud ka: Finansovõi Menedzhment : infovõpusk nr. 22 märts lk. 8-9. Baltika strateegiline pööre sisaldas kolme teemat: uue strateegia finantseerimine, uue finantsaruandlussüsteemi ülesehitamine ning riskide määratlemine ja juhtimine

  6. Palju kära, aga mitte kuigi palju villa = Talkin' loud and saying not that much / Mika Hannula

    Index Scriptorium Estoniae

    Hannula, Mika, 1967-

    2015-01-01

    Kunstikriitik analüüsib nüüdisaegse kunsti poliitiliste aktide õnnestumisi ja ebaõnnestumisi Kiasma rahvusvahelisel rühmanäitusel "Demonstrating minds - disagreements in contemporary art" (Meele avaldused - erimeelsused nüüdisaegses kunstis) eksponeeritud tööde näitel. Vaatluse all on Cristina Lucase, Tanja Boukali, Jonathan Meese, Cinthia Marselle'i & Tiago Mata Machado ning Kader Attia teosed

  7. Rein Randver : keskkonnaminister olen nüüd mina, mitte Villu Reiljan / Rein Randver ; interv. Rasmus Kagge

    Index Scriptorium Estoniae

    Randver, Rein, 1956-

    2006-01-01

    Ilmunud ka: Postimees : na russkom jazõke 19. okt. lk. 4. Uus keskkonnaminister Rein Randver räägib talle varem esitatud ministriametite pakkumistest, oma tööplaanidest, avaldab seisukoha looduskaitsealuste maade vahetamise kohta. Lisa: Rein Randveri CV; Viis esimest tööd

  8. UniCredit Bank Eesti juht: Meie võimalused on Venemaal ja Euroopas, mitte Hiinas / Taavi Laur

    Index Scriptorium Estoniae

    Laur, Taavi

    2010-01-01

    UniCredit Bank Eesti juht vastab küsimustele, kas kriis tõi Eesti majanduses kaasa struktuurimuutuse, mis on praegu ettevõtjatele suurim väljakutse, kas Eesti võiks olla Euroopa ja Venemaa vaheline transiidimaa

  9. Tundeid saab testida, kuid mitte hierarhiasse seada... / Hanno Soans, Raoul Kurvitz, Toomas Mikk...[jt.] ; interv. Reet Varblane

    Index Scriptorium Estoniae

    1998-01-01

    3.-12. juulini Moskvas Malõi Manezhi galeriis olnud rahvusvahelisest näitusest "Meelte testimise jaam" ("Senses Test Station"). Kuraator Georgi Nikitsh. Eesti kunstiprojektist "Hüljatud lahinguväljad". Kuraator Hanno Soans, osalejad Raoul Kurvitz, Toomas Mikk, Urmo Raus, Sven Saag, Jaan Toomik. Pikemalt R. Kurvitza ja T. Miku projektist.

  10. Lapsed väärivad head teatrit, mitte haltuurapalagani / Toomas Tross, Hiie Fluss ; intervjueerinud Meeli Parijõgi

    Index Scriptorium Estoniae

    Tross, Toomas, 1966-

    2014-01-01

    Tallinnas Vaba Lava teatrimajas toimub 28.-30. oktoobrini festival „Teater noorele vaatajale”. ASSITEJ (Association Internationale du Theatre pour l'Enfance et la Jeunesse) Eesti keskuse juhatuse esimees Toomas Tross ja juhatuse liige Hiie Fluss arutlevad lastele suunatud teatri kvaliteedi üle

  11. Senine juhtimine ei tööta : inimeste otsuste taga on emotsioon, mitte loogika / Veigo Kell

    Index Scriptorium Estoniae

    Kell, Veigo

    2012-01-01

    Ebaratsionaalsest käitumisest otsustamisel, efektiivsusest, motivatsioonist. Ülevaateid Adam Smithi, Pete Lunni, David Rocki, Dan Ariely, Greg Smithi, Gary Hameli, Charles Jacobsi ja Daniel Kahnemani juhtimisraamatutest

  12. Miks ühel õnnestub ja teisel mitte? / Amy Edmonson, Richard Bohmer, Gary Pisano ; tõlk. Kadre Vaik

    Index Scriptorium Estoniae

    Edmonson, Amy

    2003-01-01

    16 meditsiinikeskuses läbi viidud uuringust eesmärgiga jälgida kirurgimeeskondade tööd ning kohanemist uute töömeetoditega. Kommenteerivad Toomas-Andres Sulling, Tiit Ojaveski ja Ela Velström. Vt. samas: Uus meetod murtud südame parandamiseks; Kahe haigla lugu. Lisa: Õppiv liider

  13. Decree no. 2013-490/PRN from 4 December 2013 provides for the creation, organisation, attributions and operation of the Nigerian High Authority for Atomic Energy

    International Nuclear Information System (INIS)

    Issoufou, Mahamadou; Brigi, Rafin; Gandou, Zakara

    2013-01-01

    This decree concerns the creation, attributions, organization and operation of The Nigerian High Authority Atomic Energy (HANEA). The HANEA is a public service under the Office of President of the Republic. Its main tasks of supervision, coordination and promotion of all peaceful nuclear applications, including nuclear power and ionizing radiation in relation to all departments and other structures concerned. The HANEA is headed by a President to the rank of Minister and includes the following components: a cabinet of President, Secretary General, six Departments and Private Secretary. [fr

  14. PRN 97-3: Guidelines for Expedited Review of Conventional Pesticides under the Reduced-Risk Initiative and for Biological Pesticides

    Science.gov (United States)

    EPA encourages the development, registration and use of lower-risk pesticide products which would result in reduced risks to human health and the environment. This Pesticide Registration notice and the related web page explain the process and criteria.

  15. Decree no 2005-92/PRN/MME from April 22, 2005 providing for the organizational structure of the Ministry of Mines and Energy

    International Nuclear Information System (INIS)

    2005-01-01

    This Decree provides for the organisational structure of the Ministry of Mines and of Energy.which consists of a central administration, adjunct services and decentralized services. The central administration includes the cabinet of the Minister, the general Secretariat, the General Inspection of services, national directorates and consultatives organs. Decentralized services includes regional directorates departmental directorates, and communal services of Mines and energy. Adjunct Services include services under the supervision of the Minister of Mines and and Energie. This decree is engaged in cabinets [fr

  16. PRN 94-9: Announcing the Formation of Two Industry-Wide Task Forces: Agricultural Reentry Task Force and Outdoor Residential Exposure Task Force

    Science.gov (United States)

    This Notice announces two industry-wide Task Forces being formed in response to generic exposure data requirements. It contains EPA's policy on a registrant's options for, and responsibilities when joining Task Force as a way to satisfy data requirements.

  17. Decree no 2013-496/PRN/ME/P from December 04, 2013 provides for the organization of the Ministry of Energy and Oil

    International Nuclear Information System (INIS)

    Issoufou, Mahamadou; Brigi, Rafini; Foumakoye, Gado

    2013-01-01

    This decree provides for the organization of the Ministry of Energy and Oil. Thus the Ministry of Energy and Oil is composed of: the central administration, deconcentrated services and piecing services, administrations and decentralized services, programs and public projects. [fr

  18. PRN 2007-2: Guidance on Small-Scale Field Testing and Low-level Presence in Food of Plant-Incorporated Protectants (PIPs)

    Science.gov (United States)

    This notice clarifies how EPA ensures the safety of residues of PIPs possibly present in food or feed and when a tolerance or tolerance exemption would be required for field tests for biotechnology-derived food and feed crop plants containing PIPs.

  19. Thermal expansion and magnetostriction in Pr(n+2)(n+1)Nin(n-1)+2Sin(n+1) compounds

    International Nuclear Information System (INIS)

    Jiles, D.C.; Song, S.H.; Snyder, J.E.; Pecharsky, V.K.; Lograsso, T.A.; Wu, D.; Pecharsky, A.O.; Mudryk, Ya.; Dennis, K.W.; McCallum, R.W.

    2006-01-01

    Thermal expansion and magnetostriction of members of a homologous series of compounds based on the alloy series Pr (n+2)(n+1) Ni n(n-1)+2 Si n(n+1) have been measured. The crystal structures of these compounds are closely interrelated because they form trigonal prismatic columns in which the number of trigonal prisms that form the base of the trigonal columns is determined by the value of n in the chemical formula. Two compositions were investigated, Pr 5 Ni 2 Si 3 and Pr 15 Ni 7 Si 10 , corresponding to n=3 and n=4, respectively. The results were analyzed and used to determine the location of magnetic phase transitions by calculating the magnetic contribution to thermal expansion using the Gruneisen-Debye theory. This allowed more precise determination of the magnetic transition temperatures than could be achieved using the total thermal expansion. The results show two phase transitions in each material, one corresponding to the Curie temperature and the other at a lower temperature exhibiting characteristics of a spin reorientation transition

  20. Euroopa unelm / Jeremy Rifkin ; tõlk. Marek Laane

    Index Scriptorium Estoniae

    Rifkin, Jeremy

    2006-01-01

    Autori hinnangul võiksid ameeriklased eurooplastelt õppida solidaarsust, kaasatust, elukvaliteeti, jätkusuutlikku arengut ja rahu, eurooplased aga ameeriklastelt isiklikku vastutamist, lootusetunnet, optimismi ning riskimist. Vt. samas lk. 34-37 Linnar Viigi ja Jeremy Rifkini diskussiooni

  1. The challenge of three books of essays / Jüri Talvet

    Index Scriptorium Estoniae

    Talvet, Jüri, 1945-

    1997-01-01

    Arvustus: Kaplinski, Jaan. See ja teine. Tartu : TÜ Kirjastus, 1996; Priimägi, Linnar. Kommentaarium. Tln. : Perioodika, 1997. (Loomingu Rmtk.; nr. 1-3); Krull, Hasso. Katkestuse kultuur. Tln. : Vagabund, 1996

  2. Koddo-tohtri awwitamise nõuu kuddamoddi sinna ennese ruttoliste ärra tappa sad : [vested] / Veiko Märka

    Index Scriptorium Estoniae

    Märka, Veiko, 1964-

    2002-01-01

    Autorist lk 141, ka foto. Sisu: Koddo-tohtri awwitamise nõuu kuddamodi sinna ennese ruttoliste ärra tappa sad : 1. jaggo ; 2. jaggo ; 3. jaggo ; 4. jaggo ; 5. jaggo ; 6. jaggo ; Linnar maine-kujjondaja

  3. Kuidas hindab võistlusfilme meie žürii

    Index Scriptorium Estoniae

    2006-01-01

    Toimetuse žürii koosseisus Linnar Priimägi, Marko Raat, Toomas Raudam, Marianne Kõrver, Stuart Sweeney hindab PÖFFil näidatavaid filme. Seekord kommenteerivad oma hinnanguid Marko Raat ja Stuart Sweeney

  4. Kuidas hindab võistlusfilme meie žürii

    Index Scriptorium Estoniae

    2006-01-01

    Toimetuse žürii koosseisus Linnar Priimägi, Marko Raat, Toomas Raudam, Marianne Kõrver, Stuart Sweeney hindab PÖFFil näidatavaid filme. Seekord kommenteerivad oma hinnanguid Toomas Raudam ja Stuart Sweeney

  5. Kik in der Kok / J. R.

    Index Scriptorium Estoniae

    J. R.

    2007-01-01

    Von Krahli teatris toimunud esimesest kunstiliste pornofilmide festivalist Kik in der Kok, millele andsid mõtteainet Teet Veispaku, Tõnis Kahu ja Linnar Priimäe loengud pornograafiast nii ajaloolisest kui teoreetilisest aspektist

  6. "If it works, you can break it" / Joshua Levine

    Index Scriptorium Estoniae

    Levine, Joshua

    2004-01-01

    Ülevaade Eesti infotehnoloogilisest arengust ning edusammudest: mobiilteenused, e-valitsus, edukamad tarkvaraarendusprojektid. Arvamust avaldavad Linnar Viik, Niklas Zennström, Allan Martinson, Steve Jürvetson jt. Tabel. Kaart

  7. 1) Mis teile praeguses eesti kirjanduses ei meeldi? 2) Mida tuleks teha, et asi läheks nii, nagu teile meeldib? : [küsitlus

    Index Scriptorium Estoniae

    2002-01-01

    Vastavad : Vaapo Vaher, Elo Lindsalu, Olev Remsu, Jüri Ehlvest, François Serpent, Sven Kivisildnik, Linnar Priimägi, Aino Pervik, Mati Unt, Contra, Fagira D. Morti, Aapo Ilves, Aarne Ruben, Juku-Kalle Raid

  8. Kuidas hindab võistlusfilme meie žürii

    Index Scriptorium Estoniae

    2006-01-01

    Toimetuse žürii koosseisus Linnar Priimägi, Marko Raat, Toomas Raudam, Marianne Kõrver, Stuart Sweeney hindab PÖFFil näidatavaid filme. Seekord kommenteerivad oma hinnanguid Toomas Raudam ja Marianne Kõrver

  9. Die Keuzzüge in Livland Mitte des 13. Jahrhunderts und das dänische Königshaus / Anti Selart

    Index Scriptorium Estoniae

    Selart, Anti, 1973-

    2004-01-01

    Varauusaegsed kroonikad taanlaste rollist Liivimaal 13. sajandil. Kas 1240-41, 1242 aasta ettevõtmistes osales ka Taani kuningakoja esindajaid? Ajaloolise õigusjärgsuse probleemi tähtsustumisest 16. sajandil, Liivi sõja perioodil

  10. Mikko Fritze : sa lihtsalt ei saa staariks, kui oled näitekirjanik, isegi mitte Saksamaal / Mikko Fritze ; interv. Mari Kolle

    Index Scriptorium Estoniae

    Fritze, Mikko, 1963-

    2003-01-01

    Saksakeelsete näidendite lugemismaratoni eesmärgist. 15. nov. saab Tallinna Saksa Kultuuriinstituudi/Goethe Instituudi, Eesti Teatriliidu Teabekeskuse/Rahvusvahelise Teatriinstituudi Eesti Keskuse, Eesti Näitemänguagentuuri, 4 teatri ja EMA Kõrgema lavakunstikooli 21. lennu koostöös teoks saksa keeleruumist pärit näidendite lugemismaraton Von Krahli Teatris

  11. Muutumismäng 2010. 1.-5. osa / tekst Kerttu Soans ; kommenteerinud Tõnis Elling, Maiu Herzmann, Reet Martinson, Marek Sildoja, Pille Mitt, Marko Vilipson

    Index Scriptorium Estoniae

    Soans, Kerttu, 1961-

    2010-01-01

    Ajakirja Üks Muutumismäng 2010 jälgib nende käekäiku, kes soovivad langetada kaalu osaledes spordiklubi Artic Sport XL-treeningprogrammis. Tutvustatakse ka inimest, kes on eeskujuks teistele treenijatele ja kaalulangetajatele

  12. ÜEKN-i esimees Juhansoo : "Ostke ESTO 2009 pass, kas olete sellele sõitmas või mitte!" / Jaak Juhansoo ; interv. Jüri Estam

    Index Scriptorium Estoniae

    Juhansoo, Jaak, 1942-2017

    2009-01-01

    Tallinnas 3. ja 4. aprillil 2009 toimunud Ülemaailmse Eesti Kesknõukogu sümpoosionist ja täiskogust räägib ÜEKN juhatuse esimehe kohale tagasivalitud Jaak Juhansoo, kes muuhulgas tunnustab president Toomas Hendrik Ilvese kõnet sümpoosionil. Ilmunud ka: Vaba Eesti Sõna 16. apr. 2009, lk. 3,10; Meie Kodu 22. apr. 2009, lk. 4; Eesti Päevaleht (Stockholm) 22. apr. 2009, lk. 4, pealk.: Ülemaailmne Eesti Kesknõukogu debüteeris istungiga Eestis; Eesti Rada, 2009, nr. 3, lk. 1,3, pealk.: Intervjuu ÜEKNi esimehe Jaak Juhansooga

  13. Rivo Veski : väiksest kohast päritolemist tuleb väärtustada, mitte tõrjuda / Rivo Veski ; interv. Tiia Allas

    Index Scriptorium Estoniae

    Veski, Rivo

    2008-01-01

    Põlva noorte filmifestivali "Flash!" idee autor ja üks läbiviija, kes esitleb Ruusal peetaval arengukonverentsil "Miks ja mida väärtustan?" dokumentaalfilmi Põlvamaa ja Tartu inimeste väärtushinnangutest

  14. Rein Veidemann: meil oli valida - nüüd või mitte kunagi / Rein Veidemann ; küsitles Tõnu Prei

    Index Scriptorium Estoniae

    Veidemann, Rein, 1946-

    2007-01-01

    Intervjuu Rein Veidemanniga, kes oli üks 1991.a. augustiputši päevil Eesti iseseisvust kinnitava otsuse poolt hääletanud 69 rahvasaadikust. Ülemnõukogu 20. augusti otsust peab ta sama tähtsaks kui Eesti Vabariigi väljakuulutamist 1918. aastal

  15. Mitte lihtsalt ära kaduda = Не пропасть даром / Maria Privalova

    Index Scriptorium Estoniae

    Privalova, Maria

    2011-01-01

    Hollandi valitsusvälise organisatsiooni Russian Justice Initiative õigusdirektor Rumer Lemaitre räägib juriidilise abi osutamisest õigusrikkumiste ohvritele Põhja-Kaukaasias. Abiks on Euroopa Inimõiguste Kohus Strasbourgis. Peamised kliendid on piinamiste ohvrid ja teadmata kadunute sugulased

  16. Hamilton on surnud, tema mõju mitte : in memoriam Richard Hamilton (24. II 1922 - 13. IX 2011) / Kadri Karro ; kommenteerinud Eha Komissarov, Sirje Helme, Jaak Kangilaski

    Index Scriptorium Estoniae

    Karro,Kadri

    2011-01-01

    Briti kunstniku Richard Hamiltoni (1922 - 2011) loomingust eesti kunstiteadlaste Eha Komissarovi, Sirje Helme ja Jaak Kangilaski pilgu läbi. Lähemalt 1956. aastal valminud kollaažist "Mis teeb tänapäeva kodud nii eriliseks, nii meeldivaks?"

  17. Kohanenud kirjandus : tänase kirjaniku - ja ka tema lugeja elu sisu määravad majanduslikud argumendid, mitte moraalsed valikud / Kärt Hellerma

    Index Scriptorium Estoniae

    Hellerma, Kärt, 1956-

    2005-01-01

    Arvustus: Delerm, Philippe. Väikesed naudingud. Tallinn : Varrak, 2004 ; Nothomb, Amélie. Jumala lapsepõlv. Tallinn : Varrak, 2004 ; Darrieussecq, Marie. Minu beebi. Tallinn : Varrak, 2005. Ilmunud ka kogumikus: Hellerma, Kärt. Kohanenud kirjandus : valik kirjanduskriitikat 1987-2006. Eesti Keele Sihtasutus : Tallinn, 2006. Lk. 189-195, pealk. Kohanenud kirjandus

  18. Nitrogen content, 15N natural abundance and biomass of the two pleurocarpous mosses Pleurozium schreberi (Brid.) Mitt. and Scleropodium purum (Hedw.) Limpr. in relation to atmospheric nitrogen deposition

    International Nuclear Information System (INIS)

    Solga, A.; Burkhardt, J.; Zechmeister, H.G.; Frahm, J.-P.

    2005-01-01

    The suitability of the two pleurocarpous mosses Pleurozium schreberi and Scleropodium purum for assessing spatial variation in nitrogen deposition was investigated. Sampling was carried out at eight sites in the western part of Germany with bulk deposition rates ranging between 6.5 and 18.5 kg N ha -1 yr -1 . In addition to the effect of deposition on the nitrogen content of the two species, its influence on 15 N natural abundance (δ 15 N values) and on productivity was examined. Annual increases of the mosses were used for all analyses. Significant relationships between bulk N deposition and nitrogen content were obtained for both species; δ 15 N-values reflected the ratio of NH 4 -N to NO 3 -N in deposition. A negative effect of nitrogen input on productivity, i.e. decreasing biomass per area with increasing N deposition due to a reduction of stem density, was particularly evident with P. schreberi. Monitoring of N deposition by means of mosses is considered an important supplement to existing monitoring programs. It makes possible an improved spatial resolution, and thus those areas that receive high loads of nitrogen are more easily discernible. - Mosses are useful as monitors of nitrogen deposition

  19. Kadrioru skandaali võtmetegelane: Ma olen ühiskonnast välja heidetud, aga mitte väljaheide / Peeter Ernits

    Index Scriptorium Estoniae

    Ernits, Peeter, 1953-

    2006-01-01

    Eesti presidendi residentsis toimunud noortepidude tagamaadest ja meediaskandaalist. Vt. ka intervjuud uurimist juhtinud ülemkomissari Margus Kotteriga: Ülemkomissar Kotter: Paulson valetas avalikkusele

  20. Har världshistorien ett kön? Familj och släkt i världspolitikens mitt

    Directory of Open Access Journals (Sweden)

    Maria Sjöberg

    2015-10-01

    Full Text Available In recent decades, gender perspectives have been adopted and elaborated in almost all research areas of history, apart from world history. A review of articles published in the Journal of World History during 2001–13 demonstrates a general pattern of gender blindness in the journal, with a few important exceptions. Several explanations for why world history neglects gender history are examined in this article. First, it has been claimed that world history has a strong materialist tradition, while gender historians work mostly with cultural perspectives. However, the articles in the Journal of World History show that world history is not unfamiliar with cultural issues or methodologies. Secondly, gender historians emphasize the complexity of gender relations, which do not accord well with prevailing explanations within world history that stress macro theories and general patterns. Thirdly, gender historians concentrate their research on women in their own countries, and this is of minor interest to scholars of world history. Fourthly, the absence of women and gender relations in writing and teaching on world history reflects the fact that almost every society in world history has had a gender order that discriminates against women in favour of men. What is lacking is a consciousness of this order. This opinion is easy to agree with, but it does not suggest ways of improving the gender consciousness of world historians. Fifthly, one opinion stresses that most women in history have lived their lives in families, while families do not play an important role in world history. This opinion relies on a view of gender history as exclusively women’s history. In order to emphasize and clarify gender as a structuring principle at the general level of societies, this article ends with an overview of a similarity of significance in almost all early modern political regencies. Dynastic thinking was established all over the world, from principalities to empires, and was everywhere constructed in terms of imagined family and kinship relations with superior masculinity and subordinated femininity. How can research in world history overlook this world-wide structure? 

  1. 76 FR 55653 - Notice of Intent To Prepare an Environmental Impact Statement/Overseas Environmental Impact...

    Science.gov (United States)

    2011-09-08

    ... Command, Pacific. Attention: MITT EIS/OEIS, 258 Makalapa Drive, Suite 100, Building 258, Floor 3, Pearl... Command, Pacific, 258 Makalapa Drive, Suite 100, Pearl Harbor, HI 96869-3134, Attention: MITT EIS/OEIS...

  2. 78 FR 56682 - Notice of Public Meetings for the Draft Environmental Impact Statement/Overseas Environmental...

    Science.gov (United States)

    2013-09-13

    ... U.S. Postal Service to Naval Facilities Engineering Command Pacific, Attention: MITT EIS/OEIS... Facilities Engineering Command Pacific, Attention: MITT EIS/OEIS Project Manager, 258 Makalapa Drive, Suite... Command Pacific, Attention: MITT EIS/OEIS Project Manager, 258 Makalapa Drive, Suite 100, Pearl Harbor, HI...

  3. Order no 000040/M/DIRCAB/PRN from December 03,2014 provides for composition, assignments and modes of the working of the technical and scientist advice consultative of the high Nigerian Autority of the Atomic Energy

    International Nuclear Information System (INIS)

    Saidou, Sidibe

    2014-01-01

    this Order provides for composition, assignments and modes of the working of the technical and scientist advice consultative of the high Nigerian Autority of the Atomic Energy, this consultative advice composed of forty member and a president (president of HANEA) and a reporter (general secretary of HANEA) is placed under the authority of the HANEA. It constitutes a national committee of nuclear security, to this title it orients the activities and assure the follow-up: - of the built-in plan of national nuclear security (IAEA-NIGER) - the plan of the stake doesn't work of the resolution 1540 (ONU-NIGER) - of strategies for the attenuation of chemical and biologic nuclear risk NRBC [fr

  4. Order no 000004/PRN/ME/P/DS from January 21, 2014 provides for the organization and attributions of divisions and departments of the Statistics Directorate of the Ministry of Energy and Oil

    International Nuclear Information System (INIS)

    Foumakoye, Gado

    2014-01-01

    This order provides for the organization and attributions of divisions and departments of the Statistics Directorate of the Ministry of Energy and Oil. This direction has two divisions namely Division for Energy Statistics and Division for Oil Statistics . Energy Statistics Division includes the following services: Service collection and data analysis for energy statistics and the service of production, dissemination and conservation of energy statics. The division for Oil Statistics includes the Service collection and data analysis for energy statistics and the service of production, dissemination and conservation of energy statistics. [fr

  5. Televiisorit kaissu ei võta, kuid raamatut küll : raamatupoe letilt võib leida mitte lihtsalt häid, vaid lausa suurepäraseid lasteraamatuid / Vaapo Vaher

    Index Scriptorium Estoniae

    Vaher, Vaapo, 1945-

    2001-01-01

    Sisu : Lloyd Alexander. Llyri loss; Lloyd Alexander. Rändur Taran; Skomantas. Teutoonide vang. Lühidalt ka Otfried Preussleri, Thorbjırn Egneri, Vitezlav Nezvali, Jỉi Trnka, Aino Perviku ja Ellen Niidu raamatutest

  6. Research and development results of the demonstration projects for comparative evaluation QP 71 Berlin-Marzahn and P2 Berlin-Centre; Forschungs- und Entwicklungsergebnisse der Demonstrations- und Vergleichsbauvorhaben QP 71 Berlin - Marzahn und P2 Berlin - Mitte

    Energy Technology Data Exchange (ETDEWEB)

    Prange, C. [Assmann Beraten und Planen GmbH, Berlin (Germany)

    1997-12-31

    Comparative data submitted for the two finalized prove that sustainable energy conservation is achieved in addition to the remediation of structural damage. For both buildings, the initial situation is described. Energy consumption figures prior to and after redevelopment are shown in tabulated form. Measures which have an effect on energy consumption are also indicated in tabulated form. The types of structural damage, their investigation in terms of building materials and structural engineering, and their remediation, in this case crack removal and drying-out of the external wall elements, are described. (MSK) [Deutsch] Fuer die beiden abgeschlossenen Vorhaben werden Vergleichsdaten, die den Nachweis der nachhaltigen Energieeinsparung bei gleichzeitiger Bauschadensbeseitigung erbringen vorgelegt. Fuer beide Gebaeude wird die Ausgangssituation dargelegt. Es werden die Energieverbrauchszahlen vor und nach der Sanierung tabellarisch aufgefuehrt. Ebenso sind die energetisch wirksamen Massnahmen in einer Tabelle aufgezeigt. Die Bauschaeden, ihre baustoffliche und bautechnische Untersuchung sowie ihre Beseitigung, in diesem Fall Rissbeseitigung und die Austrocknung der Ausswandelemente wird beschrieben.

  7. Graphical User Interface and Microprocessor Control Enhancement of a Pseudorandom Code Generator

    National Research Council Canada - National Science Library

    Kos, John

    1999-01-01

    .... This thesis addresses the issue of providing automated computer control to previously built, manually controlled hardware incorporating the Stanford Telecom STEL-1032 Pseudo-Random Number (PRN) Coder...

  8. Mall Hellam leiab, et ideaalidesse on vaja uskuda / Mall Hellam ; interv. Koit Luus

    Index Scriptorium Estoniae

    Hellam, Mall

    2005-01-01

    Avatud Eesti Fondi juhataja Eesti ühiskonna arengust, kodanikuühiskonnast, kodaniku mõistest ning Avatud Eesti Fondi tegevusest. Lisa: Mall Hellam. Kommenteerivad: Balti-Ameerika Partnerlusprogrammi juht Katrin Enno, Eesti Mittetulundusühingute ja Sihtasutuste Liidu juhataja Kristina Mänd ning IT Kolledzhi õppejõud, Avatud Fondi nõukogu esimees Linnar Viik

  9. Selgusid Betti Alveri preemia nominendid

    Index Scriptorium Estoniae

    2005-01-01

    Betti Alveri kirjandusauhinna nominendid: Sass Henno "Mina olin siin", Andrei Hvostovi "Lombakas Achilleus", Mart Kanguri, Jaak Ranna ja Ivar Ravi "Jaak Rand ja teisi jutte", Diana Leesalu "2 grammi hämaruseni", Jaan Pehki "Sisukord", Linnar Priimäe "Kelle tee on varjul", Leo de Sixtuse "Skarabeuse tsivilisatsioon". Vt. ka Eesti Päevaleht, 16. nov., lk. 15

  10. Betti Alveri sünniaastapäeval kuulutatakse välja järjekordne Alveri kirjandusauhinna saaja...

    Index Scriptorium Estoniae

    2005-01-01

    Kirjandusauhinna nominendid: Sass Henno. Mina olin siin ; Andrei Hvostov. Lombakas Achilleus ; Mart Kangur, Jaak Rand ja Ivar Ravi. Jaak Rand ja teisi jutte ; Diana Leesalu. 2 grammi hämaruseni ; Jaan Pehk. Sisukord ; Linnar Priimägi. Kelle tee on varjul ; Leo de Sixtus. Skarabeuse tsivilisatsioon

  11. Kohustuslik lektüür anno 1996 : Kümme raamatut, mis väärivad ostmist ja lugemist / Ülo Tonts

    Index Scriptorium Estoniae

    Tonts, Ülo, 1931-2016

    1996-01-01

    Sisu: Kross, Jaan. Mesmeri ring; Raud, Rein. Kägude öö; Veisserik, Artur. Ma armastasin Eestit; Trummal, Mart. Korduskatse; Toomet, Tiia. Kaltsutitt ja puuhobune; Tuglas, Elo. Tartu päevik; Linda Rummo elust ja lavaelust/ Koost. Lilian Vellerand; Meri, Lennart. Presidendikõned; Priimägi, Linnar. Mälestusi Euroopast; Unt, Mati. Vastne argimütoloogia

  12. Turism rikastab : rahvusvaheline turismikonverents

    Index Scriptorium Estoniae

    2006-01-01

    28. septembril toimus Tallinnas Rahvusraamatukogus rahvusvaheline turismikonverents"Turism rikastab". Ülevaade majandus- ja kommunikatsiooniministeeriumi majandusarengu asekantsleri Maria Värtoni, Graham Mckenzie, Linnar Viigi, Nick Skelloni, Mario Ascencao (Haagi ülikool), David Carsoni (Ulsteri ülikool), Vesa Heikkineni ja Imre Sooääre ettekannetest

  13. Kõrge majandusauhind Mart Laarile / Martin Hanson

    Index Scriptorium Estoniae

    Hanson, Martin, 1984-

    2006-01-01

    Cato instituut premeeris Mart Laari majandusteadlase Milton Friedmani nimelise auhinnaga ja üle 6 miljoni krooniga. Vt. samas: Mart Laari varasemad autasud; Milton Friedmani auhind anti kätte kolmandat korda. Kommenteerivad: Ivari Padar, Tiit Vähi, Tiit Tammsaar, Linnar Viik ja Andres Lipstok

  14. Maria Avdjuško väntab Priimäest filmi / Verni Leivak

    Index Scriptorium Estoniae

    Leivak, Verni, 1966-

    2009-01-01

    Näitlejanna debüteerib režissöörina, vändates lühimängufilmi, kus Linnar Priimägi peategelasena kehastab iseennast. Operaatoriks on Istvan Borbas Rootsist, näitlejateks veel M. Avdjuško ja Taavi Eelmaa

  15. Soovahetus, Priimägi ja Baudrillard / Kadi Herkül

    Index Scriptorium Estoniae

    Herkül, Kadi

    1999-01-01

    Dieter Lesage'i "Pärast orgiat" raadioteatris, režissöör Tamur Tohver, helirežissöör Küllike Valdma, osatäitjana Linnar Priimägi, esietendus Klassikaraadios 11. apr. ja Vikerraadios 18. apr.

  16. Mobi Solutions pürib M-äri Skype'iks / Raigo Neudorf

    Index Scriptorium Estoniae

    Neudorf, Raigo

    2005-01-01

    OÜ Mobi Solutions loomisest, ettevõtte poolt pakutavatest mobiilside teenustest ning firma tulevikuplaanidest. Vt. samas: Käive kasvas üle kahe korra; Linnar Viik lööb kaasa Mobi suuremates projektides; Hannes Astok: Mobi vennad ei karda riski. Diagramm: Miljon kasumit

  17. Kes keda - valimatult / Koit Brinkmann

    Index Scriptorium Estoniae

    Brinkmann, Koit

    2006-01-01

    Seekordsete presidendivalimiste kampaanias pole vahendeid valitud. Vt. samas: Airi Ilisson. Otsustava lahingu ootel. Kommenteerivad Silmet Grupp ASi juhatuse esimees Tiit Vähi, Koger & Partnerid omanik Andres Koger, Mobi Solutionsi juhatuse liige Linnar Viik, Kalevi suuromanik Oliver Kruuda, Falck Eesti omanik Urmas Sõõrumaa ja ettevõtja Jüri Mõis

  18. 11 : olematult teatrist (II) / Ott Karulin

    Index Scriptorium Estoniae

    Karulin, Ott, 1980-

    2006-01-01

    Eesti teater on Baltoscandalil koondatud olematu teatri mõiste alla. Andres Härma "Cooking and Shitting", Sven Kuntu "Miks Eesti mehed ei tantsi?", Linnar Priimäe "Inimese lõhn", Patrick Süskindi teose "Parfüüm" järgi

  19. Baltoscandal on lõppenud, uued mõtted on saadud / Andres Keil

    Index Scriptorium Estoniae

    Keil, Andres, 1974-

    2006-01-01

    Eesti teater oli Baltoscandalil koondatud olematu teatri mõiste alla. Andres Noormetsa "Reunioon", Mart Kangro ja Ansambel U "Mäng", Marco Laimre "Vangistus", Asko Künnapi "Säälpool jõge", Anders Härmi "Cooking and Shitting", Sven Kuntu "Miks Eesti mehed ei tantsi?", Linnar Priimäe "Inimese lõhn"

  20. Effects of pre- and postnatal litter size reduction on development and behavior of rat offspring.

    Science.gov (United States)

    Milković, K; Paunović, J; Joffe, J M

    1976-07-01

    Litter size was reduced to 2-5 rat pups either prenatally by unilateral maternal oviduct ligation (Group PRN) or postnatally by removing pups (Group PST). Normal size litters (8-10 pups) of sham ligated (SHM) and intact (CON) mothers served as controls. Weights at 30 days were increased by prenatal or postnatal reduction and reduced by prenatal stress (SHM); the sex difference in weight was most pronounced in PRN rats. At 75 days PRN rats were heaviest, with no differences between the other groups. Relative ovarian weights were reduced in PRN females and absolute testes weights increased in PST males. The PRN and SHM females had smaller relative adrenal weights than CON and PST females. Open-field activity was generally increased by prior avoidance conditioning and effects of treatments were found only in groups tested after avoidance-conditioning: PRN and SHM rats were more active than PST and CON rats, particularly on Days 1 (SHM) and 4 (SHM and PRN) of testing. Passive-avoidance behavior of PRN rats was also more susceptible to previous test experience: they emerged more slowly if they had prior open-field experience. The PST animals, in contrast, emerged more rapidly after prior test experience. Plasma corticosterone levels and shuttlebox conditioning and extinction were unaffected by treatments.

  1. Auction based spectrum management of cognitive radio networks

    DEFF Research Database (Denmark)

    Chang, H. B.; Chen, K.-C.; Prasad, Ramjee

    2009-01-01

    (PS-MSs), and we therefore construct a cognitive radio network (CRN) consisting of a PRN with multiple CR-MSs. We propose a spectrum management policy framework such that CR-MSs can compete in utilization of the PRN spectrum bands available to opportunistic transmission of CR-MSs by Vickrey auction...... to the PRN, the overall spectrum utilization, the profit of the service provider, the spectrum access opportunity of the CR-MSs are increased to achieve cowin situation for every party in cognitive radio networks.......Cognitive radio (CR) technology is considered as an effective solution to enhance overall spectrum efficiency, especially primary radio network (PRN) typically having relatively low spectrum utilization. However, to realize CR concept, it is essential to provide enough incentives to PRN and extra...

  2. Korean Military Advisory Group: Insights for Future Security Force Assistance Efforts

    Science.gov (United States)

    2011-06-10

    Battalion MiTT Rank Brigade MiTT Rank Division MiTT Rank Team Chief Maneuver, Fires, and Effects ( MFE ) Major Lieutenant Colonel Lieutenant...Colonel (Promotable) or Colonel Staff Maneuver Trainer MFE Captain Major Lieutenant Colonel Intelligence Trainer Operational Support (OS...Field Artillery Effects Advisor MFE Captain Captain Major Intelligence NCO Trainer OS Master Sergeant Master Sergeant Master Sergeant Logistics NCO

  3. Valaste joa vaateplatvorm ja teenindav kompleks

    Index Scriptorium Estoniae

    1999-01-01

    Projekteerija AS Kommunaalprojekt. Projektijuht Rain Nigul. Arhitektid Ilmo Liive, Kristi Mitt. Metallkonstruktsioonid projekteeris Kalju Loorits. Ehitas Facio Ehitus. Projekt 1998, valmis 1999. 3 illustratsiooni. Kommunaalprojekt

  4. Eksperimendid animatsioonis ja liikuvad pildid = Experiments in Animation and Moving Pictures / Mari-Liis Rebane

    Index Scriptorium Estoniae

    Rebane, Mari-Liis, 1988-

    2011-01-01

    Tallinna XV graafikatriennaal "Armastuse, mitte raha pärast" Kumu Kunstimuuseumis. Triennaalil eksponeeritud animafilmidest, autorid Edmunds Jansons, Stacey Steers, Wojciech Bakowski, Urte Budinaite, Martin Arnold)

  5. Muutunud, kuid lootuseta / Edward McBride

    Index Scriptorium Estoniae

    McBride, Edward

    2011-01-01

    USA presidendivalimiste kampaaniast. President Barack Obama võimalusest saada tagasivalituks, vabariiklaste kandidaatidest Rick Perryst ja Mitt Romneyst. Demokraatide tervishoiureformist ja tervishoiuseadusest

  6. Mihhail Voitenko: Arctic Sea vedas salajast saadetist / Mihhail Voitenko ; intervjueerinud Jaanus Piirsalu

    Index Scriptorium Estoniae

    Voitenko, Mihhail

    2009-01-01

    Kaubalaeva Arctic Sea kadumise avalikustanud Venemaa laevandusajakirjaniku hinnangul oli laeval salajane, mitte kriminaalne kaup. Ta ei usu, et kaheksa piraatideks nimetatud meest tungisid laevale ja kaaperdasid selle

  7. Pictorial Estonia / Peeter Linnap

    Index Scriptorium Estoniae

    Linnap, Peeter, 1960-

    2003-01-01

    Eesti pildilisest kujutamisest albumites, postkaartidel, kodulehekülgedel ja filmides, kus domineerib "fassaadi-imagoloogia", mille raamkonstruktsiooniks on utoopiline, mitte heterotoopoline ruumi mõiste

  8. Maainimesed ja kodanikud / Roy Strider

    Index Scriptorium Estoniae

    Strider, Roy, 1974-

    2010-01-01

    Autor hindab kriitiliselt kodanikuühiskonna tekkimise võimalusi kampaaniate korras. Regionaalarengu projektide finantseerimisel tuleks rohkem arvestada kohalikke vajadusi, mitte projektikirjutaja oskusi

  9. Kaadrid otsustavad kõik / Jarno Laur

    Index Scriptorium Estoniae

    Laur, Jarno, 1975-

    2002-01-01

    Noored Mõõdukad taotlesid neli aastat tagasi valimisliitude kaotamist Riigikogu valimistel ja toetavad praegugi Eesti poliitika selgemaks muutumist, kuid see peaks toimuma loomulikul teel, mitte sunniga

  10. The importance of Bordetella pertussis strains which do not produce virulence factors in the epidemiology of pertussis

    Directory of Open Access Journals (Sweden)

    Maciej Polak

    2017-05-01

    Full Text Available Bordetella pertussis strains, which have lost the ability to produce antigens, such as pertactin - Prn, pertussis toxin - Ptx, filamentous haemagglutinin - FHA, fimbriae type 2 and 3 - Fim 2 and 3, tracheal colonization factor - TcfA, have recently been isolated in countries with a high vaccination coverage. The emergence of such isolates might have resulted from B. pertussis natural evolution course or adaptive mechanisms, allowing increased circulation of the pathogen in vaccinated populations. So far, the majority of described mutants were deficient in the Prn production. Prn deficient isolates were found in countries which use acellular pertussis vaccines (aP in routine immunization programmes. The increase of frequency of Prn¯ strains isolation was correlated with the period of routine vaccination with aP vaccines. In most countries, the spread of these isolates has resulted from independent mutations rather than from the expansion of a single clone. Prn¯ isolates were collected from patients showing typical clinical symptoms of pertussis found for Prn+ strains. Results of in vitro and in vivo studies have shown that Prn¯, Ptx¯ and FHA¯ isolates retain cytotoxic properties, and besides Ptx¯ isolates, were lethal in intranasally infected mice. Further explanation of the impact of antigen deficiencies on virulence and transmission of B. pertussis in the context of the continuous increase of pertussis incidence is necessary to develop a new, optimized strategy of pertussis prevention.

  11. Riskikapital vajab riigi kehtestatud mängureegleid / Peeter Saks

    Index Scriptorium Estoniae

    Saks, Peeter

    2004-01-01

    AS-i Suprema Securities juhatuse esimehe sõnul on Euroopa riskikapitali turul selge nõudlus sobiva seadusliku raamistiku ja hea mainega riigi või piirkonna järele, Eestil on praegu võimalus kujuneda Euroopa üheks riskikapitali keskuseks. Autori arvates peaks esimeseks sammuks olema eraldi riskikapitali seaduse loomine. Vt. samas: Andrus Ansip, Taavi Veskimägi ja Linnar Viik vastavad küsimusele, kas Eesti vajab riiklikku riskikapitali fondi

  12. Eestlased rabelevad 52 miljardi krooni jagamise pärast / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2006-01-01

    Eesti saab aastatel 2007-2013 EL-i struktuurifondidelt 52 miljardit krooni, rahandusministeerium koostab riiklikku struktuurivahendite kasutamise strateegiat. Res Publica esimees Taavi Veskimägi kavatseb esitada seaduseparanduse, mille kohaselt peaks struktuurivahendite strateegia kinnitama Riigikogu. Struktuurivahendite jagamine loob EAS-i juhataja Alar Kolgi sõnul Eestis seniolematu majandusharu: projektijuhtimissektori. Lisa: EL-i raha loob uue majandussektori. Vt. samas: Andrus Ansip, Valdo Kalm, Heido Vitsur, Leev Kuum ja Linnar Viik vastavad küsimusele, mis on innovatsioon

  13. Playtech ja Skype tõmbavad Eesti turu IT-spetsidest tühjaks / Liis Kängsepp

    Index Scriptorium Estoniae

    Kängsepp, Liis, 1981-

    2005-01-01

    Lähiajal tahavad nii Skype kui ka Playtech värvata juurde üle saja töötaja, mis tekitab Eestis tarkvaraspetsialistide põua. Diagramm: Majandusnäitajad. Kommenteerib Linnar Viik. Vt. samas: Skype pakub motiveerimiseks optsioone; Suured kontsernid saavad lüüa palgaga; Uue töötaja leidja saab preemiat; Pärast väljaõpet lahkutakse erasektorisse

  14. Rate.ee värbab EMT-le uusi teismelisi kliente / Lauri Linnamäe

    Index Scriptorium Estoniae

    Linnamäe, Lauri

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 27. märts lk. 4. Suhtlusportaali Rate.ee ostmine viis EMT langeva kõnekaardimüügi tõusuteele, portaal on EMT-le juurde toonud üle 35 000 noore kliendi. Ratemobiili ärijuhi Riho Jürvetsoni kinnitusel on investeering end õigustanud. IT-spetsialisti Linnar Viigi ettepanekust portaal sulgeda

  15. Siserände rahvuserinevused / Alis Tammur

    Index Scriptorium Estoniae

    Tammur, Alis

    2003-01-01

    Uuringu tulemustest selgus, et eestlaste rändeaktiivsus oli 1990. aastatel oluliselt suurem kui mitte-eestlastel. Kui eestlaste rändes valitses linnastumine, siis mitte-eestlaste vastulinnastumine on uus protsess ja näitab, et nende asustusala on Eestis laienemas. Tabelid. Diagramm. Kaardid

  16. Kammitsais mälestused / Masha Lipman

    Index Scriptorium Estoniae

    Lipman, Masha

    2007-01-01

    Moskva lähedal Stalini-aegsete massimõrvade toimumispaigas peetud tseremoonia paljastas autori hinnangul Vene valitsuse soovi mitte juhtida avalikku tähelepanu terrorile ja selle toimepanijaile, tseremooniat juhtinud Vene õigeusu kirik keskendus tapetute kannatustele, mitte aga kuritegudele ega nende toimepanijatele

  17. Perspectives of formation of collective identities of Estonian Russians in post-Soviet Estonia / Triin Vihalemm, Anu Masso

    Index Scriptorium Estoniae

    Vihalemm, Triin, 1968-

    2005-01-01

    Mitte-eestlaste meediaeelistustest ning nii globaalse, päritolumaa kui kohaliku (st Eesti) meedia mõjust vähemusrahvuste hoiakutele. Üleminekuperioodi mõjust eestlaste ja mitte-eestlaste enesemääratlusele. Tabelid. Diagrammid

  18. A light weight secure image encryption scheme based on chaos & DNA computing

    Directory of Open Access Journals (Sweden)

    Bhaskar Mondal

    2017-10-01

    Full Text Available This paper proposed a new light weight secure cryptographic scheme for secure image communication. In this scheme the plain image is permuted first using a sequence of pseudo random number (PRN and encrypted by DeoxyriboNucleic Acid (DNA computation. Two PRN sequences are generated by a Pseudo Random Number Generator (PRNG based on cross coupled chaotic logistic map using two sets of keys. The first PRN sequence is used for permuting the plain image whereas the second PRN sequence is used for generating random DNA sequence. The number of rounds of permutation and encryption may be variable to increase security. The scheme is proposed for gray label images but the scheme may be extended for color images and text data. Simulation results exhibit that the proposed scheme can defy any kind of attack.

  19. El liberalismo conservador y la ideología del Proceso de Reorganización Nacional

    Directory of Open Access Journals (Sweden)

    Sergio Morresi

    2010-06-01

    Full Text Available This article aims to show that the political ideas of the selfnamed "National Reorganization Process -Proceso de Reorganización Nacional [PRN]" -were structured within the ideological frame offered by conservative-liberalism. Through the study of some of the ideologicalpromoters of the PRN, it is argued that conservative-liberalism served as merger of the different types of argentinian rights and laid the foundations for the neoliberal ideas that were impelled afer the dictatorship period

  20. Tolerance development in Listeria monocytogenes-Escherichia coli dual-species biofilms after sublethal exposures to pronase-benzalkonium chloride combined treatments.

    Science.gov (United States)

    Rodríguez-López, Pedro; Cabo, Marta López

    2017-10-01

    This study was designed to assess the effects that sublethal exposures to pronase (PRN) and benzalkonium chloride (BAC) combined treatments have on Listeria monocytogenes-Escherichia coli dual-species biofilms grown on stainless steel in terms of tolerance development (TD) to these compounds. Additionally, fluorescence microscopy was used to observe the changes of the biofilm structure. PRN-BAC exposure was carried out using three different approaches and TD was evaluated treating biofilms with a final 100 μg/ml PRN followed by 50 μg/ml BAC combined treatment. Results showed that exposure to PRN-BAC significantly decreased the number of adhered L. monocytogenes (P reduction values were generally lower in L. monocytogenes compared to E. coli. Additionally, microscopy images showed an altered morphology produced by sublethal PRN-BAC in exposed L. monocytogenes-E. coli dual-species biofilms compared to control samples. Results also demonstrated that L. monocytogenes-E. coli dual-species biofilms are able to develop tolerance to PRN-BAC combined treatments depending on way they have been previously exposed. Moreover, they suggest that the generation of bacterial tolerance should be included as a parameter for sanitation procedures design. Copyright © 2017 Elsevier Ltd. All rights reserved.

  1. Problema neravnomernogo rosta v Jevrope / Melvyn Krauss

    Index Scriptorium Estoniae

    Krauss, Melvyn

    2007-01-01

    Saksa majandus kasvab kiiremini kui teised suured majandused eurotsoonis. Autori sõnul peaks Prantsusmaa ja Itaalia reforme ellu viima kiiremas tempos kui Saksamaa, mitte ootama, et Saksamaa aeglustaks reforme

  2. Latvian minister wants to jump-start economy

    Index Scriptorium Estoniae

    2008-01-01

    Mõned Läti majandussektorid, eriti ehitussektor kannatavad meetmete pärast, mis valitsus võttis vastu majandusarengu aeglustamiseks. Peaminister Godmanise arvates peaks olema prioriteet majanduskasv, mitte madalamad hinnad

  3. Plaadid / Maris Meiesaar, Tui Hirv, Veiko Pesur...[jt.

    Index Scriptorium Estoniae

    2008-01-01

    Uutest heliplaatidest Elbow "The Seldom Seen Kid", Bonzo "Ei saa mitte vaiki olla", Cavalera Conspiracy "Inflikted", Tiit Kaluste Jump Band "Prantsuse spetsaliteet", Gnarls Barkley "The Odd Couple", Counting Crows "Saturday Nights & Sunday Mornings"

  4. Küsimus pole MRP-s, vaid agressioonis / Enn Soovik

    Index Scriptorium Estoniae

    Soovik, Enn, 1933-2010

    2005-01-01

    Autor leiab, et on vajalik esitada Venemaale pretensioon Nõukogude Liidu poolt Eesti vastu 1939/40 toime pandud agressiooni ja selle järelmite suhtes ning mitte laskuda MRP-ga seotud viljatusse vaidlusse

  5. Eesti välispoliitiliste orientatsioonide sisepoliitilisest taustast esimesel iseseisvusajal / Toomas Karjahärm

    Index Scriptorium Estoniae

    Karjahärm, Toomas, 1944-

    2005-01-01

    Peamine tegur, mis destabiliseeris olukorda Eestis 1939. aasta sügisest, ei tuleneud mitte Eesti sisepoliitikast ja võimul olnud valitsusest, vaid rahvusvahelisest kriisist, millest Balti riikidel ei õnnestunud eemale jääda, leiab autor. Tabelid

  6. Sõnavabadus või sõnavabandus? / Merilyn Merisalu

    Index Scriptorium Estoniae

    Merisalu, Merilyn

    2015-01-01

    Toetusest prantsuse nädalalehe Charlie Hebdo toimetuses toimunud rünnaku tagajärjel hukkunud ajakirjanikele. Siiski - ei saa kuritarvitada oma vabadust teiste inimeste arvel, ka mitte halvustada ega naeruvääristada

  7. Eneserefleksiooni seosed sotsiaalse toimetulekuga ühe- ja mitmekeelsete õpilaste hulgas / Grete Arro

    Index Scriptorium Estoniae

    Arro, Grete, 1982-

    2014-01-01

    Mitte-eesti populatsiooniga piirkondade põhikoolides läbi viidud pikiuuringust, milles keskendutakse eneserefleksioonivõime, ühe- ja mitmekeelsuse ning sotsiaalse ja psühholoogilise kohanemise näitajate vahelistele seostele

  8. Zapatero tõrjus Bushi üleskutse jääda Iraaki / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2004-01-01

    Hispaania tulevane peaminister Jose Luis Zapatero kavatseb väed Iraagist ära tuua, hoolimata USA presidendi George W. Bushi üleskutsest seda mitte teha. Avalikkuse negatiivsest arvamusest USA suhtes

  9. Pro Patria advised Rüütel to stay home / Berit Teeäär

    Index Scriptorium Estoniae

    Teeäär, Berit

    2005-01-01

    Isamaaliidu juhtpoliitiku, Europa Parlamendi saadiku Tunne Kelami arvates annab president Arnold Rüütli otsus mitte sõita 9. maiks Moskvasse Eestile hea võimaluse selgitada oma ajalugu tervele maailmale

  10. Alamprogramm "Ühiskonnapädevus" = Sub-programme "Social competence"

    Index Scriptorium Estoniae

    2003-01-01

    Alamprogrammi "Ühiskonnapädevus" ülesanneteks on teadvustada mitte-eestlaste potentsiaali ja kaasata neid teadlikult otsustamisse ning arendusprogrammidesse, rakendada Eestis mitmekultuurilise ühiskonna kontseptsiooni

  11. Milline on Eesti kõige edukam reklaamiagentuur? / Andres Eilart

    Index Scriptorium Estoniae

    Eilart, Andres

    2003-01-01

    Eesti Reklaamiagentuuride Liidu arvestuse järgi on agentuuritulult edukaim reklaamifirma Eestis Kontuur Leo Burnett, Kuldmuna reklaamikonkursil oli aga edukaim reklaamiagentuuride liitu mitte kuuluv Zoom Ogilvy. Tabelid: Kuldmuna 2002 konkursi võitjad erinevates kategooriates ; reklaamiagentuuride pingerida agentuuritulu alusel.

  12. Super-plus - karpi pandud äike, mis tervistab / Tõnu Kalvet

    Index Scriptorium Estoniae

    Kalvet, Tõnu

    1999-01-01

    Venemaal toodetud õhupuhastist. Õhupuhasti ei piirdu mitte ainult õhu puhastamisega, vaid küllastab õhku ka osooniga ning eluks ülioluliste negatiivsete ioonidega, mis suurendavad organismi immuunsust ja likvideerivad alalise kurnatuse sündroomi

  13. Adamkus says security agencies should examine Brazauskas' family business / Milda Seputyte

    Index Scriptorium Estoniae

    Seputyte, Milda

    2005-01-01

    Leedu president Valdas Adamkus teatas oma kõnes, et peaminister Algirdas Barzauskase pereäri ümber tekkinud skandaali tagamaid ja süüdistusi peaksid uurima õiguskaitse institutsioonid, mitte poliitikud

  14. Kuidas kirjutada kunstiajalugu? / Kristina Jõekalda

    Index Scriptorium Estoniae

    Jõekalda, Kristina

    2011-01-01

    Kaunase ülikoolis 14. ja 15. oktoobril toimunud Eesti, Läti ja Leedu kunstiteadlaste konverentsist "(Un)Blocked Memory : Writing Art History in Baltic Countries" ("(Mitte)blokeeritud mälu : kunstiajaloo kirjutamine Baltimaadel")

  15. Visuaalne uurimus ja uued jutustusviisid graafikas = Visual Analysis and a New Means of Narration in the Graphic Arts / Martin Rünk

    Index Scriptorium Estoniae

    Rünk, Martin, 1982-

    2011-01-01

    Tallinna XV graafikatriennaal "Armastuse, mitte raha pärast" Kumu Kunstimuuseumis. Peapreemia Edmunds Jansonsi tööle "Väikese linnukese päevik". Andrew Raftery suureformaadilistest vasegravüüridest

  16. Bez Arafata vzrõvat ne budut

    Index Scriptorium Estoniae

    2004-01-01

    Palestiina peaminister Ahmed Kurei pöördus Hamasi juhtide poole palvega mitte korraldada Iisraeli vastu terroriakte Yasser Arafati eemaloleku ajal. Täpsed andmed Arafati tervisliku seisundi kohta puuduvad

  17. Toetame Valgevenet / Kalev Kallemets

    Index Scriptorium Estoniae

    Kallemets, Kalev, 1979-

    2006-01-01

    Autor arvab, et demokraatia võiduletulekule Valgevenes aitaks kaasa Aleksandr Lukashenko mitte tunnustamine Valgevene presidendina, samuti tuleks toetada moraalselt ja aineliselt Valgevene opositsiooni. Valgevene majanduslik ning poliitiline toetamine Venemaa poolt tuleks muuta võimalikult ebemugavaks

  18. Börs nutab taga Eesti Energia loobumist / Jaana Pikalev ; kommenteerinud Jürgen Ligi, Sandor Liive

    Index Scriptorium Estoniae

    Pikalev, Jaana

    2010-01-01

    SEB privaatpanganduse osakonna strateeg Peeter Koppel, LHV Panga analüütik Sten Pisang, investor Stefan Andresson avaldavad arvamust seoses otsusega Eesti Energia veel mitte börsile viia. Majandus- ja kommunikatsiooniminister Juhan Partsi arvamus

  19. Mihkel Oviiril jääb sotside ja IRLi toetus saamata / Helga Koger

    Index Scriptorium Estoniae

    Koger, Helga, 1945-

    2008-01-01

    Isamaa ja Res Publica Liidu parlamendifraktsioon otsustas mitte toetada president Toomas Hendrik Ilvese poolt esitatud Mihkel Oviiri kandidatuuri riigikontrolöri ametikohale. Reformi- ja Keskerakonna üksmeel aga kindlustab Mihkel Oviirile riigikontrolöri teise ametiaja

  20. Tšernobõli tähendus / Julia Tõmošenko ; tõlkinud Külli-Riin Tigasson

    Index Scriptorium Estoniae

    Tõmošenko, Julia, 1960-

    2011-01-01

    Ukraina endise peaministri sõnul ei olnud Tšernobõli peamine õppetund mitte tuumajaamade turvalisus, vaid ametiisikute ülbus, ükskõiksus kannatanute vastu ja saladusekultus, mis lubas infot jagada vaid kitsale eliidile

  1. Voters shrug off upcoming EP ballot / Aleksei Gunter

    Index Scriptorium Estoniae

    Gunter, Aleksei, 1979-

    2004-01-01

    Emor'i uuring näitab, et europarlamendi valimistel osaleb kõigest 33 protsenti valijatest ning valik toimub isikute, mitte erakondade järgi. Soosikuteks ennustatakse Toomas Hendrik Ilvest ning Reformierakonda. Tabel

  2. Liberalismusest / Heido Vitsur

    Index Scriptorium Estoniae

    Vitsur, Heido, 1944-

    2008-01-01

    Liberalismist seoses eesti keeles ilmunud Ludwig von Misese raamatuga "Liberalism". Artikli autor oletab, et lähiaastail ei oota meid ees liberalismi positsioonide tugevnemine, vähemalt majanduses mitte

  3. EHL-i juhatuse arvamus töölepingu seaduse eelnõu kohta / Sven Rondik

    Index Scriptorium Estoniae

    Rondik, Sven

    2008-01-01

    Eesti Haridustöötajate Liidu juhatus tegi TALO-le ettepaneku mitte kooskõlastada töölepingu seaduse (TLS) eelnõu esitatud kujul ja sotsiaalministeeriumile ettepaneku koostada uus eelnõu, kaasates sotsiaalpartnereid

  4. MPs place ban on Paksas / Milda Seputyte

    Index Scriptorium Estoniae

    Seputyte, Milda

    2004-01-01

    Leedus jõustus presidendivalimiste seaduse parandus, mis keelab presidendiametist tagandatud isikul viie aasta jooksul riigipeaks pürgimise. Leedu keskvalimiskomisjon otsustas mitte registreerida presidendikandidaadiks endist riigipead Rolandas Paksast

  5. Analüütikud soovitavad Amazonist hoiduda / Annika Matson

    Index Scriptorium Estoniae

    Matson, Annika, 1976-

    2004-01-01

    Hansapank Marketsi, Ühispanga ja LHV maaklerid soovitavad jälgida turu arenguid ja USA online-kaubamaja Amazon.com aktsiatesse lähiajal mitte investeerida. Diagramm: Osta Amazon.com-i aktsiat 40 dollari tasemelt

  6. Intelit kahtlustatakse konkurentsiseaduse rikkumises / Lauri Matsulevitsh

    Index Scriptorium Estoniae

    Matsulevitsh, Lauri

    2005-01-01

    Juunis esitas Inteli konkurent Advanced Micro Devices (AMD) USAs kohtule kaebuse, mille kohaselt on Intel ebakohaste meetoditega veennud arvutifirmasid mitte kasutama AMD toodangut. Inteli kontrolli all on 90% Windowsi tarkvaral töötavate personaalarvutite mikroprotsessorite turust

  7. BBC rajab üleilmset internetibrändi / Andrew Edgecliffe-Johnson

    Index Scriptorium Estoniae

    Edgecliffe-Johnson, Andrew

    2006-01-01

    Suurbritannias on riik mitte ainult toetanud, vaid ka nõudnud BBC kujunemist Suurbritannia tugevaimaks kodumaiseks internetibrändiks. BBC võrguväljaande kasvust. Tabel: Maailma populaarseimad uudisteportaalid jaanuaris 2006

  8. Islam ja sõnavabadus - Euroopa lõhestajad / Jeroen Bult ; tõlkinud Marek Laane

    Index Scriptorium Estoniae

    Bult, Jeroen, 1971-

    2008-01-01

    Autor võrdleb Taani karikatuuriskandaali tagajärgi Hollandis valminud islamiteemalise filmi "Fitna" põhjustatud pahameelega ja leiab, et mitte kõik Euroopa poliitikud ei ole veendunud sõnavabaduse kaitsmise vajaduses

  9. Linn võiks Eesti koolivõrgu laastamise lõpetada / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2007-01-01

    Parlamendiliikme hinnangul on laste koolitusraha nõudmine teistelt omavalitsustelt väär. Autor kutsub Tallinna linnavalitsust mitte kasutama kahjuks veel kehtivat võimalust rahalisteks nõueteks teiste omavalitsuste vastu

  10. 78 FR 65302 - Notice of Public Meetings for the Draft Environmental Impact Statement/Overseas Environmental...

    Science.gov (United States)

    2013-10-31

    ... FURTHER INFORMATION CONTACT: Ms. Nora Macariola-See, Naval Facilities Engineering Command, Pacific. Attention: MITT EIS/OEIS, 258 Makalapa Drive, Suite 100, Building 258, Floor 3, Pearl Harbor, Hawaii 96860...

  11. Kas Merrillis õnnestub korrata New Yorgi börsi edu? / Matthew Goldstein, Emily Thornton

    Index Scriptorium Estoniae

    Goldstein, Matthew

    2007-01-01

    Juhivahetusest ja tulevikuperspektiividest Merill Lynchi investeerimispangas. Vt. samas: Mara Der Hovanesian. Miks mitte Larry Fink?; Karen Young. Kuldsed langevarjud. Lisa: Kui nad täna lahkuksid (kümne tuntud tippjuhi lahkumispaketid)

  12. Nägemine piltide kaudu : Fotograafia antropoloogiast / Jay Ruby

    Index Scriptorium Estoniae

    Ruby, Jay, 1935-

    2010-01-01

    Fotograafia ja sotsiaalteaduste suhtest visuaalse etnograafia seisukohalt. Uurimisprojektist, mille sihiks on mõista kõikide fotograafia liikide kultuurilist rolli ja funktsioone inimeste elus antropoloogilisest vaatenurgast, olles huvitatud kultuurilisest ja kommunikatiivsest, mitte hinnangulisest algest

  13. Rahvussuhted ja ebavõrdne kohtlemine = Interethnic relations and unequal treatment = Mezhetnitsheskije otnoshenija i neravnoje obrashtshenije / Vadim Poleshtshuk, Aleksei Semjonov

    Index Scriptorium Estoniae

    Poleshtshuk, Vadim

    2006-01-01

    Eestlaste ja mitte-eestlaste suhtumine etnilisse diskrimineerimisse, seda nii rahvusgruppidega seonduvalt kui ka isikliku kogemuse taustal. Hinnang olukorrale Eesti ühiskonnas, rahvussuhetele, rahvus- ja integratsioonipoliitikale, ajaloo tajumine ja ühiskonna arengu mudelite valik. Lisa: Tabelid

  14. H. C. Andersen ja tema romaanid / Anu Saluäär

    Index Scriptorium Estoniae

    Saluäär, Anu, 1948-

    2008-01-01

    Anderseni romaanidest "Improvisaator" (1835), "O.T" (1836), "Ainult viiuldaja" (1837), "Kaks parunessi" (1848), "Olla või mitte olla" (1857) ja "Peer Õnneseen" (1870). - Varem ilmunud: Loomingu Raamatukogu 2005, nr. 11/12

  15. MPs question reports of citizenship bribery / Ksenia Repson

    Index Scriptorium Estoniae

    Repson, Ksenia

    2005-01-01

    Reformierakonna väitel on alusetu seostada rahvastikuminister Paul-Erik Rummo ettepanekut anda teenete eest kodakondsus ärimeestele Sergei Sergejenkovile ja Aleksandr Frolovile ning viimaste soovi ühineda Reformierakonnaga. Mitte-eestlaste osakaal Reformierakonnas

  16. Müütiline miljardipaanika / Edgar Savisaar

    Index Scriptorium Estoniae

    Savisaar, Edgar, 1950-

    2008-01-01

    Tallinna linnapea selgitab linna eelarve seisu ja taotlust 500 miljoni krooni laenamiseks (mitte miljardi) ning kinnitab, et Tallinna eelarve seis on parem kui eelarvekärbet tegeval riigil, andes nõu valitsusele ja peaminister Andrus Ansipile

  17. Man bites dog / Olesya Turkina, Viktor Mazin

    Index Scriptorium Estoniae

    Turkina, Olesya

    1998-01-01

    Kaasaegsest vene kunstist. Autorid ei ole nõus Ando Keskküla hinnanguga Oleg Kulikule kui vene kunsti silmapaistvale esindajale. Oleg Kulik ei esinda mitte millegagi vene kultuuri, vaid ainult koera ئ tegemist on meediamulliga

  18. Ei geneetiliselt muundatud toidule! / Roy Strider

    Index Scriptorium Estoniae

    Strider, Roy, 1974-

    2007-01-01

    Jätkates mõttevahetust geneetiliselt muundatud toidu kahjulikkuse või ohutuse üle, kirjutab autor, et teadus pole tänapäeval enam mitte inimeste teenistuses, vaid korporatsioonide ja riikide palgalehel

  19. Dicty_cDB: SHA109 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available *r**smyc*flr*lnwllqysnqchvpsmpvlnqqvllipqsm*miit nvqlihvpkkvv*lilqsilmitmpvplipah...hqlvfpipq*tvmiiinvl*ihvqtqlv v*ilqltvtivihvp*thaiiqlvv*tlqsmlmiiihvpsmpvpnqqvllipqsm*mitt nvqlmhvpkxvv*lipqsilmitm...pvqlmhvqkkvg*lilqsilmitmlvpltscspstw rfphpqltxmixihvpxthvpnstglvxtlpsmvxgxxthxp--- ---sytnqyr***qmyirc

  20. Radikaalne realism ehk üleelusuurune ... = Large than life: radical realism as ... / Kalle Komissarov

    Index Scriptorium Estoniae

    Komissarov, Kalle, 1976-

    2011-01-01

    Linnade ajastust. Linnaehitusest ja arhitektuurist. Utoopiatest. Narva utoopiast. Autori sõnul tuleks planeerida protsesse, mitte ruumi, sest protsessid kujundavad iseendale ruumi, mis oleks kohalikele suunatud. Robustsusest, mis sobib väljendama eestilikku linnakeskkonda

  1. Strannaja gibel multikulturizma / Ian Buruma ; tõlk. Jevgenija Unanjants

    Index Scriptorium Estoniae

    Buruma, Ian

    2007-01-01

    Ilmunud ka: Delovõje Vedomosti, 2. mai 2007, lk. 10. Autor leiab, et tuleb teha kõik, et ergutada islamiusuliste assimilatsiooni Euroopa ühiskonda, sest meeldib see eurooplastele või mitte, on nad osa Euroopast

  2. Granitsõ liberalizma / Alan Wolfe ; tõlk. Nikolai Zhdanovitsh

    Index Scriptorium Estoniae

    Wolfe, Alan

    2007-01-01

    Lääneriikides valitsevatest immigratsiooniprobleemidest, ühtse liberaalse immigratsioonipoliitika puudumisest. Liberaalses ühiskonnas tuleks tähelepanu pöörata sellele, kuidas immigrant võiks riigile kasulik olla, mitte vastupidi. Autori arvamus

  3. Õigusharidus kaalukausil : kuidas tagada paindlikkus? / Jan Klabbers ; tõlkija Rain Liivoja

    Index Scriptorium Estoniae

    Klabbers, Jan

    2008-01-01

    Õigusteaduse õppekavade kolmest arengusuunast, milleks on õigusteooria, praktilised oskused ja rahvusvaheline avalik õigus, mis seavad esikohale üliõpilaste ja mitte nende tööandjate vajadused

  4. Verba volant, scripta manent / Milvi Tedremaa

    Index Scriptorium Estoniae

    Tedremaa, Milvi, 1937-2012

    1999-01-01

    Rets. rmt.: Meie õppisime raamatukogundust Tartu Ülikoolis / koost. Maare Kümnik, Kaja Noodla. Tartu, 1998. Vastukaja: Peep, Laine. Mitte ainult Milvi Tedremaale // Raamatukogu (1999) nr. 4, lk. 44

  5. Probleem pole pronkssõduris / Ester Shank, Jüri Kaljuvee

    Index Scriptorium Estoniae

    Šank, Ester, 1956-

    2006-01-01

    Vt. ka Postimees : na russkom jazõke 22. juuni lk. 7. Autorid esitavad oma nägemuse mitte-eestlaste integratsiooniprobleemist ning kutsuvad kaasmaalasi üles mõistma pronkssõdurit kui eestlaste suuremeelsuse proovikivi

  6. Kui parimast ei piisa, siis piisab erinevast / Gustav Hafren

    Index Scriptorium Estoniae

    Hafren, Gustav

    2003-01-01

    Autor leiab, et turul, kus ei võida mitte kvaliteetsemad tooted, vaid tooted, mis omavad kindlat kohta klientide teadvuses, on kõige olulisem eristuda konkurentidest. Lisa: Milline on kliendi teadvus? Kokkuvõte autori ettekandest turunduskonverentsil "Password 2003".

  7. Morten Kirckhoff / Morten Kirckhoff ; interv. Oksana Kostina

    Index Scriptorium Estoniae

    Kirckhoff, Morten

    2006-01-01

    Maailma üks hinnatumaid internetiturunduse gurusid ütleb, et tähtis pole mitte kulutada suuri summasid reklaamikampaaniatele, vaid uurida sihtrühma, et teada saada, kuidas selle tähelepanu äratada

  8. Vastased üritavad koos Haloneni lüüa / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Soome presidendivalimistel teise vooru mitte pääsenud Koonderakonna kandidaat Matti Vanhanen, Rootsi rahvapartei kandidaat Henrik Lax ja kristlike demokraatide kandidaat Bjarne Kallis toetavad teise vooru pääsenud Koonderakonna kandidaati Sauli Niinistöd

  9. Venelastele kulub kümnendik rahast / Katrin Rohtla

    Index Scriptorium Estoniae

    Rohtla, Katrin, 1966-

    2007-01-01

    Venekeelse meedia osakaal eelmise aasta meediareklaamiturul oli vaid umbes 170 miljonit ehk 12,5% koguturust. Vt. samas: Mitte-eestlaste reklaamides on otstarbekas kombineerida võimalikult erinevaid kanaleid. Kommenteerivad Kristjan Seema ja Toomas Pärna

  10. Hudoi mir lutshshe dobroi ssorõ / Allan Soon

    Index Scriptorium Estoniae

    Soon, Allan, 1968-

    2007-01-01

    Eestlaste ja venelaste vahelistest suhetest pärast pronkssõduri teisaldamisega toimunud sündmusi. Autori arvates peaksid nii eestlased kui ka venelased astuma samme konflikti lahendamiseks, mitte jääma passiivselt ootama

  11. Neutraalne kaasabi ja kaasaaitamise ebaõigussisu. Riigikohtu kriminaalkolleegiumi otsus 3-1-1-4-12 / Jaan Sootak

    Index Scriptorium Estoniae

    Sootak, Jaan, 1948-

    2012-01-01

    Riigikohtu otsusest 3-1-1-4-12, mis selgitab, et mitte igasugune objektiivselt põhitegu soodustav ja subjektiivselt tahtlikult toime pandud tegu ei ole kaasaaitamine. Ründamise teooriast, riskiteooriast ning deliktilise olemusseose ja professionaalse adekvaatsuse teooriatest

  12. Trükieelse ajajärgu online-haridus / Andrei Babitski

    Index Scriptorium Estoniae

    Babitski, Andrei

    2012-01-01

    Autori arvates ei asenda Internetis tuimalt ette kantud loengud kõrgetasemelisi ja huvitavalt esitatud ülikooliloenguid, mistõttu pole online-haridus oma olemuselt mitte innovatsioon vaid hoopis tagasiminek kirjasõnaeelsesse aega

  13. Rahvastiku tervis - reaalsus ja võimalused / Anu Kasmel

    Index Scriptorium Estoniae

    Kasmel, Anu

    2005-01-01

    Inimeste terviseseisundi parandamiseks ei ole vaja mitte niivõrd suuri rahalisi vahendeid, kuivõrd just olulisi poliitilisi, tervist toetavaid otsuseid ja pädevaid inimesi, leiab autor. Skeemid. Diagrammid

  14. Euroopa : laienemisprotsess versus süvendumine / Jürgen Schröder

    Index Scriptorium Estoniae

    Schröder, Jürgen

    1999-01-01

    Euroopa peab uuesti defineerima mitte ainult oma kultuurilised ja geograafilised piirid vaid ka materiaalsed ja institutsionaalsed piirangud ning käituma vastavalt sellele, leiab Euroopa Parlamendi Euroopa Rahvapartei fraktsiooni liige

  15. Partneritele tõmmati labase skeemiga müts pähe / Kadri Jakobson, Hannes Sarv ; kommenteerinud Olavi Israel, Asso Ladva

    Index Scriptorium Estoniae

    Jakobson, Kadri, 1970-

    2010-01-01

    Riigihanke võitnud ehitusettevõtted Wolmreks Ehitus ja Kristiine Ehitus sundisid alltöövõtjaid sõlmima lepinguid mitte enda, vaid kolmanda ettevõtte Merkton Ehitusega, mis on praegu likvideerimisel

  16. Academics protest election ploys / Joel Alas

    Index Scriptorium Estoniae

    Alas, Joel

    2006-01-01

    Üle 200 Eesti haritlase kirjutasid alla avalikule kirjale, milles kutsutakse üles presidenti Riigikogus valima, samuti osalema praegust presidenti Arnold Rüütlit mitte ainult presidendivalimistel valimiskogus. Allakirjutanute seas oli ka TLÜ rektor Rein Raud

  17. 500 miljardi eurone abipakett eurotsoonile / Katri Soe-Surén

    Index Scriptorium Estoniae

    Soe-Surén, Katri

    2011-01-01

    Euroopa Stabiilsusfondi maht on vähemalt 500 mld. eurot, sellele võivad lisanduda vabatahtlikud maksed eurotsooni mitte kuuluvatelt EL-i liikmesriikidelt. Konkurentsivõime parandamise pakti osas on veel suuri lahkarvamusi

  18. Ühendriikide endise presidendi juudikriitika vihastab ameeriklasi / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2007-01-01

    USA endise presidendi Jimmy Carteri raamatus "Palestiina: rahu, mitte apartheid" kirjutab autor Lähis-Ida rahosobitamisest ja peab rahukõneluste takerdumises süüdlaseks Iisraeli. Lisa: Katke Jimmy Carteri raamatust; Arvustus

  19. Vene president Putin otsib endale sobivat mantlipärijat / Heiki Suurkask

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2006-01-01

    Venemaa president Vladimir Putin kavatseb 2008. aastal enam mitte presidendiks kandideerida ning otsib järgmist presidenti. Telekanal CNN pakkus kandidaatidena asepeaminister Dmitri Medvedjevit ja kaitseminister Sergei Ivanovi. Lisa: President ise küsib, ise vastab

  20. Austraalia ilusaim rannikutee sõjaohvrite mälestuseks / Eneli Ivask

    Index Scriptorium Estoniae

    Ivask, Eneli

    2006-01-01

    Vt. ka Delovõje Vedomosti : Vkuss Zhizni 13. sept., lk. 4-5. Austraalia lõunarannikul, mitte kaugel Melbourneist on maailma kauneimaks peetav 400 km pikkune hingematvalt lummavate ja erinäoliste vaadetega rannikutee - Great Ocean Road

  1. Õpetajate streik oleneb järgmisest nädalast / Matis Song

    Index Scriptorium Estoniae

    Song, Matis, 1978-

    2003-01-01

    Valitsusdelegatsioon sai 30. oktoobri kohtumisel ametiühingutega nädal aega otsustamiseks, kas nõustuda TALO esitatud palganõuetega või mitte. Kommentaarid TALO juhatuse esimehelt Toivo Roosimaalt

  2. Meri on mereriigi majanduskasvu eeldus / Aare-Maldus Uustalu

    Index Scriptorium Estoniae

    Uustalu, Aare-Maldus, 1935-

    2005-01-01

    Eesti majanduskasvu edukus merenduse ja siseveetranspordi arendamise valdkonnas sõltub mitte üksnes teadlaste panusest, vaid suurel määral riigiametnike töö kvaliteedist, nende suutlikkusest ja vastutustundest, leiab autor. Tabelid. Kaart

  3. Geneetiliselt muundatud? / Epp Petrone

    Index Scriptorium Estoniae

    Petrone, Epp, 1974-

    2006-01-01

    Ameerikas on geneetiliselt muundatud toitu kasvatatud 20 ja ulatuslikult toodetud kaheksa aastat, ning juba mõni aeg tagasi kadus kontroll selle üle, mis supermarketites müüdavast tavatoidust on GMO-vaba ja mis mitte

  4. Liiga vara Euroopa Liitu pääsenud Bulgaarias ja Rumeenias vohab ohjeldamatu korruptsioon / George Parker, Kerin Hope, Christopher Condon ; tõlk. Erik Aru

    Index Scriptorium Estoniae

    Parker, George

    2007-01-01

    Balkanimaade ebaturvaline keskkond seab küsimärgi Euroopa Liidu laienemisele. Uute riikide korralekutsumiseks ei ole Euroopa Liidul peale ähvarduste mitte midagi muud kasutada. Vt. samas: EL-i laienemine läheb keerulisemaks

  5. Milline saab olema uuenenud WTO põllumajandusleping? / Ruve Schank

    Index Scriptorium Estoniae

    Šank, Ruve, 1954-

    2003-01-01

    Uuenenud WTO põllumajanduslepinguga hakkab riiklik toetus üha vähem olema seotud tootmisega, selle asemel toetatakse lihtsalt maal elamist ja seal töötamist põllumajandusega mitte otseselt seotud aladel

  6. Eestile sobib pigem mittetehniline innovatsioon / Robert Foster

    Index Scriptorium Estoniae

    Foster, Robert

    2011-01-01

    Mitmed maailma edukamad innovatsiooniprojektid on seotud mitte tehnoloogiaga, vaid hoopis äriprotsesside uuendamise või organisatsioonikultuuri muutmisega. Paljudele Eesti ettevõtetele võib mittetehniline innovatsioon olla sobilikum ja taskukohasem

  7. Välisfirmade filiaalid jäävad Eestis riigihangete uste taha / Gea Velthut-Sokka

    Index Scriptorium Estoniae

    Velthut-Sokka, Gea, 1977-

    2003-01-01

    Oracle'i Eesti filiaal kaebas riigikohtusse ringkonnakohtu otsuse mitte lubada välisfirma filiaalil Tallinna linna riigihankekonkursil osaleda. Ringkonnakohtu arvates ei tohiks filiaal ka kohtumenetluses osaleda. Diagramm: Pretsedent puudutab 362 filiaali. Oracle Eesti kohtutee.

  8. Rootsi kindral oli hooletu porno ja saladustega / Evelyn Höglund

    Index Scriptorium Estoniae

    Höglund, Evelyn

    2006-01-01

    Rootsi kindralmajori Tony Stigssoni kodus avastati uurimise käigus umbes 300 salajast dokumenti, samas otsustas ülemprokurör kindralmajori vastu süüdistust mitte esitada. Rootsis nõutakse uurimise jätkamist

  9. Hiinas tunda krahhi hõngu / Romet Kreek

    Index Scriptorium Estoniae

    Kreek, Romet, 1972-

    2010-01-01

    Hiinas ei tohi pangad anda laenu kolmanda eluaseme ostuks. Pankadele on soovitatud mitte anda kinnisvaralaenu mitteresidentidest maksutuludeta inimestele ja neile, kel ei ole tõendit sotsiaalmaksu tasumise kohta. Euroopas langesid lennifirmade aktsiad umbes 5%

  10. Oskar-2005 : snova bez Rossii / Maria Tsheskis

    Index Scriptorium Estoniae

    Tsheskis, Maria

    2005-01-01

    Intriigidest Venemaa kinoladvikus, mille tulemusena saadetakse Venemaalt Oscarit "püüdma" erapoolikult valitud sugugi mitte parim film. Ka selle aastasest Oscari-gala juhi Chris Rock'i solvavast käitumisest ürituse eel

  11. Rask: ministry to blame for payment scandal

    Index Scriptorium Estoniae

    2009-01-01

    Riigikohtu esimees Märt Rask tõstatas küsimuse, kuidas kõrgemate riigiametnike töötasu on aastaid arvutatud ebaseaduslikult - mitte eelmise aasta keskmisest palgast, vaid jooksva aasta kvartali keskmisest palgast

  12. Slesers says spend, spend, spend

    Index Scriptorium Estoniae

    2011-01-01

    5. augustil kinnitas Läti Esimene Partei/Läti Tee parlamendivalimiste valimisplatvormi, mille peamine mõte seisneb selles, et raha tuleb teenida, mitte säästa. Zatlersi Reformierakond on samuti oma valimisplatvormi kinnitanud

  13. Social Inequality and Assessments of Democracy and the Market: evidence from Central and Eastern Europe / Stephen Whitefield, Matthew Loveless

    Index Scriptorium Estoniae

    Whitefield, Stephen

    2013-01-01

    Kasutades 12 post-kommunistliku riigi (sh Eesti) andmeid, leidsid autorid sotsiaalsete, ebavõrdsusest tingitud konfliktide tekitajana seoseid turumajanduse, mitte demokraatiaga ja toetust ennem "kõvakäelisele" majanduspoliitikale kui anti-demokraatlikule riigijuhtimisele. Tabelid

  14. New and Noteworthy Records of Mosses from Doi (Mt. Inthanon, Chiang Mai, Chom Tong District, Northern Thailand

    Directory of Open Access Journals (Sweden)

    Printarakul Narin

    2013-07-01

    Full Text Available Mosses new to Thailand (35 species in 29 genera and new to Doi Inthanon (6 species in 6 genera are reported based on collections made by the authors. Austinia tenuinervis var. micholitzii W. R. Buck & H. A. Crum, Brotherella nictans (Mitt. Broth., Chionostomum hainanensis B. C. Tan & Y. Jia, Clastobryopsis muelleri (Dixon Tixier, Trichosteleum stigmosum Mitt., Micralsopsis complanata (Dixon W. R. Buck, and Fissidens schwabei Nog. are fully illustrated.

  15. India vabadusliikumine / Karl Ast Rumor

    Index Scriptorium Estoniae

    Ast Rumor, Karl

    2007-01-01

    Vastuhakkamisest Inglise võimudele 1857. ja 1930. aastal. Liikumine, mille eesotsas seisab Gandhi, põlvneb igivanast hindu enesetundest, selle eesmärgiks on enesemääramine, mitte ainult poliitiliset, vaid ka kultuuriliselt, usuliselt ja lõpuks ka majanduslikult, rippumatus mitte ainult Inglismaast, vaid Euroopast ning Läänest üldse. Varem ilmunud : "Nool" 31. mai, 7., 14., 21. juuni 1930, nr. 27-30

  16. Gazprom hoiatas euroliitu gaasi kinnikeeramisega / Erkki Bahovski

    Index Scriptorium Estoniae

    Bahovski, Erkki, 1970-

    2006-01-01

    Gazprom manitses Euroopa Liitu mitte blokeerima ettevõtte ärihuve, ähvardades vastasel korral suunata oma gaasitarned mujale, teatas Briti majandusleht Financial Times. Euroopa Komisjon vastas Gazpromi ähvardustele, et kompanii peaks oma lepinguid täitma ning mitte ähvardama Euroopa gaasitarnete ümbersuunamisega. Samas möönis eurokomisjon taas, et euroliit sõltub välismaistest energiahiidudest

  17. Lam lam o lam (6/4 e)

    OpenAIRE

    2011-01-01

    Laulun sanat: Lam, lam o lam, Så undersan, Förtryckt, försökt; Dock likväl älskadt högt! Mitt hjerta är ej mitt, Men ditt: Din lön, Guds Lam, För hån och skam, För sårens flod Och för ditt kors och blod.

  18. Ultrasound-guided continuous interscalene block: the influence of local anesthetic background delivery method on postoperative analgesia after shoulder surgery: a randomized trial.

    Science.gov (United States)

    Hamdani, Mehdi; Chassot, Olivier; Fournier, Roxane

    2014-01-01

    Automated bolus delivery has recently been shown to reduce local anesthetic consumption and improve analgesia, compared with continuous infusion, in continuous sciatic and epidural block. However, there are few data on the influence of local anesthetic delivery method on local anesthetic consumption following interscalene blockade. This randomized, double-blind trial was designed to determine whether hourly automated perineural boluses (4 mL) of local anesthesia delivered with patient-controlled pro re nata (PRN, on demand) boluses would result in a reduction in total local anesthesia consumption during continuous interscalene blockade after shoulder surgery compared with continuous perineural infusion (4 mL/h) plus patient-controlled PRN boluses. One hundred one patients undergoing major shoulder surgery under general anesthesia with ultrasound-guided continuous interscalene block were randomly assigned to receive 0.2% ropivacaine via interscalene end-hole catheter either by continuous infusion 4 mL/h (n = 50) or as automated bolus 4 mL/h (n = 51). Both delivery methods were combined with 5 mL PRN boluses of 0.2% ropivacaine with a lockout time of 30 minutes. Postoperative number of PRN boluses, 24- and 48-hour local anesthetic consumption, pain scores, rescue analgesia (morphine), and adverse events were recorded. There were no significant differences in either the number of PRN ropivacaine boluses or total 48 hour local anesthetic consumption between the groups (18.5 [11-25.2] PRN boluses in the continuous infusion group vs 17 [8.5-29] PRN boluses in the automated bolus group). Postoperative pain was similar in both groups; on day 2, the median average pain score was 4 (2-6) in the continuous infusion group versus 3 (2-5) in the automated bolus group (P = 0.54). Nor were any statistically significant intergroup differences observed with respect to morphine rescue, incidence of adverse events, or patient satisfaction. In continuous interscalene blockade under

  19. Kommunikatsioon eeldab keeleoskust / Reet Varblane

    Index Scriptorium Estoniae

    Varblane, Reet, 1952-

    2008-01-01

    Religiooni ja demokraatia suhteid käsitlevast rahvusvahelisest näitusest "Obscurum per obscurius" Tallinna Kunstihoones. Avatud kuni 06.07.2008. Kuraatorid Ilja Sundelevitsh ja Reet Varblane, kujundaja Liina Siib. 28 osalejat loetletud. Eestist osalevad: Anu Juurak, Leonhard Lapin, Peeter Laurits, Raul Meel, Tatjana Muravskaja, Jüri Ojaver, Terje Ojaver, Anne-Daniela Rodgers & Paul Rodgers, Liina Siib, Jaan Toomik. 28. V toimunud seminarist, kus pikemate ettekannetega esinesid Toomas Paul ja Linnar Priimägi, ning ümarlaua arutelust

  20. Resistance to changing practice from pro re nata prescriptions to patient group directions in acute mental health settings.

    Science.gov (United States)

    Price, O; Baker, J A

    2013-09-01

    Poor practice associated with pro re nata (PRN) prescriptions in mental health is known to be common and can increase the risk of serious and potentially fatal side effects. A contributing factor to poor practice is the lack of a clear chain of accountability between the decision to prescribe and administer PRN prescriptions. To address this problem, a patient group direction (PGD) for acute behavioural disturbance (lorazepam 0.5-2 mg) and staff training materials were developed. The intention was to replace PRN prescriptions with the PGD in two mental health trusts. One of the potential benefits of this would be the removal of the contribution of PRN to high and combined dose antipsychotic prescriptions. This proposal, however, was met with significant resistance in both trusts and did not replace PRN as a result. A series of interviews and focus groups were conducted with 16 RMNs working in the two trusts, to explore the reasons why the PGD was met with resistance. Senior nurses perceived resistance to be associated with anxieties over increased responsibility for decision making. Junior nurses reported concerns regarding the medicalization of the nursing role, the paperwork associated with the PGD and the training approach used. Future efforts to implement PGDs in mental health settings must carefully consider the methods for engaging effectively with participating organizations, in terms of managing change and completing the necessary groundwork for successful implementation. © 2012 John Wiley & Sons Ltd.

  1. Quantifying the combined effects of pronase and benzalkonium chloride in removing late-stage Listeria monocytogenes-Escherichia coli dual-species biofilms.

    Science.gov (United States)

    Rodríguez-López, Pedro; Puga, Carmen H; Orgaz, Belén; Cabo, Marta L

    2017-09-01

    This work presents the assessment of the effectivity of a pronase (PRN)-benzalkonium chloride (BAC) sequential treatment in removing Listeria monocytogenes-Escherichia coli dual-species biofilms grown on stainless steel (SS) using fluorescence microscopy and plate count assays. The effects of PRN-BAC on the occupied area (OA) by undamaged cells in 168 h dual-species samples were determined using a first-order factorial design. Empirical equations significantly (r 2 = 0.927) described a negative individual effect of BAC and a negative interactive effect of PRN-BAC achieving OA reductions up to 46%. After treatment, high numbers of remaining attached and released viable and cultivable E. coli cells were detected in PRN-BAC combinations when low BAC concentrations were used. Therefore, at appropriate BAC doses, in addition to biofilm removal, sequential application of PRN and BAC represents an appealing strategy for pathogen control on SS surfaces while hindering the dispersion of live cells into the environment.

  2. Protective levels of canine distemper virus antibody in an urban dog population using plaque reduction neutralization test

    Directory of Open Access Journals (Sweden)

    O.I. Oyedele

    2004-11-01

    Full Text Available Blood samples from 50 dogs were collected at three veterinary clinics in Ibadan and Abuja, Nigeria and the serum from each sample was evaluated serologically for neutralizing antibodies against canine distemper virus (CDV by the highly sensitive plaque reduction (PRN neutralization assay. Thirteen dogs had plaque reduction neutralization titres of 0-100, seven had titres of 100-1 000 while 30 had titres ranging from 1 000-6 000. The PRN titres of vaccinated dogs were found to be significantly higher than unvaccinated dogs. The widespread use of the highly reproducible PRN test for the evaluation of antibody response to CDV may be very important in the generation of international CDV positive serum standards that should help to improve pre-and post-vaccination testing of dogs worldwide.

  3. El silencio bajo la última Dictadura Militar en la Argentina

    Directory of Open Access Journals (Sweden)

    Mercedes María Barros

    2009-12-01

    Full Text Available This paper explores the issue of silence under the last military dictatorship in Argentina (1976-1983. Silence spread rapidly in Argentine society during the first years of the so called National Reorganization Process (PRN and it became crucial for the maintenance of the illegal regime, This silence was actually assured not only by the action of the military government, but also by the clear identification of the political and social forces with the aims and values of the Proceso. However, this prevailing silence and the resulting failure of the existing discourses to articulate the effects of the dirty war resulted in a temporal suspension of meaning within the reality of the PRN. Silence became then the instance that would finally put into question the apparently smooth functioning of the PRN and would force the emergence and constitution of a new social movement and a new language of human rights in the country.

  4. Comparative efficacy of tadalafil once daily in men with erectile dysfunction who demonstrated previous partial responses to as-needed sildenafil, tadalafil, or vardenafil.

    Science.gov (United States)

    Kim, Edward; Seftel, Allen; Goldfischer, Evan; Baygani, Simin; Burns, Patrick

    2015-02-01

    Phosphodiesterase type-5 inhibitors (PDE5Is) are first-line therapies for erectile dysfunction (ED). Sildenafil (SIL) and vardenafil (VAR) are approved for as-needed (PRN) dosing; tadalafil (TAD) is approved for both PRN and once-a-day (OaD) dosing for ED. Recent evidence suggests that TAD-OaD may be effective as therapy in men with an incomplete response to PRN-PDE5I therapy. This study evaluated whether TAD-OaD provides similar efficacy in men with ED who had previously demonstrated a partial response to PRN-PDE5I therapy. In this randomized, double-blind, placebo-controlled trial, men with a ≥3 month ED history received SIL 100 mg, TAD 20 mg, or VAR 20 mg during a 4 week open-label lead-in period. Those with International Index of Erectile Function - Erectile Function (IIEF-EF) domain scores TAD 2.5 mg up-titrated to 5 mg, TAD 5 mg, or placebo (PBO) OaD for 12 weeks. MAIN OUTCOME MEASURES obtained from patients treated with TAD-OaD were compared to PBO-treated patients. Additionally, results of treatment with TAD-OaD were compared to results obtained from 4 week PRN-PDE5I therapy to determine whether OaD and PRN regimens provided comparable efficacy. NCT01130532. International Index of Erectile Function (IIEF) domain scores; Sexual Encounter Profile (SEP) questions 2-5. Endpoint data was obtained from 590 men (391 TAD; 199 PBO). RESULTS for all IIEF and SEP measures were significantly better for TAD-OaD (p TAD 2.5 mg and TAD 5 mg OaD therapy were safe and generally well tolerated. Tadalafil once daily is a viable alternative to as-needed PDE5I therapy in men with ED. Key limitations include the lack of a PRN PDE5I study group during the double-blind period, and that many more patients took tadalafil than sildenafil or vardenafil during the PRN period.

  5. Interpreting trial results following use of different intention-to-treat approaches for preventing attrition bias: a meta-epidemiological study protocol.

    Science.gov (United States)

    Dossing, Anna; Tarp, Simon; Furst, Daniel E; Gluud, Christian; Beyene, Joseph; Hansen, Bjarke B; Bliddal, Henning; Christensen, Robin

    2014-09-26

    When participants drop out of randomised clinical trials, as frequently happens, the intention-to-treat (ITT) principle does not apply, potentially leading to attrition bias. Data lost from patient dropout/lack of follow-up are statistically addressed by imputing, a procedure prone to bias. Deviations from the original definition of ITT are referred to as modified intention-to-treat (mITT). As yet, the impact of the potential bias associated with mITT has not been assessed. Our objective is to investigate potential bias and disadvantages of performing mITT and evaluate possible concerns when executing different mITT approaches in meta-analyses. Using meta-epidemiology on randomised trials considered less prone to bias (ie, good internal validity) and assessing biological or targeted agents in patients with rheumatoid arthritis, we will meta-analyse data from 10 biological and targeted drugs based on collections of trials that would correspond to 10 individual meta-analyses. This study will enhance transparency for evaluating mITT treatment effects described in meta-analyses. The intended audience will include healthcare researchers, policymakers and clinicians. Results of the study will be disseminated by peer-review publication. In PROSPERO CRD42013006702, 11. December 2013. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.

  6. Frequency, Levels and Predictors of Potential Drug-Drug ...

    African Journals Online (AJOL)

    HP

    administration to carry out this study in hospital. The following information items were collected: patient's age, gender, date of admission, date of discharge, diagnosis and detail of medication therapy provided in the hospital. All regular and. PRN (pro-re-nata, means as required) medications were included, however, topical.

  7. Existence and multiplicity of weak solutions for a class of degenerate nonlinear elliptic equations

    Directory of Open Access Journals (Sweden)

    Mihai Mihăilescu

    2006-02-01

    Full Text Available The goal of this paper is to study the existence and the multiplicity of non-trivial weak solutions for some degenerate nonlinear elliptic equations on the whole space RN. The solutions will be obtained in a subspace of the Sobolev space W1/p(RN. The proofs rely essentially on the Mountain Pass theorem and on Ekeland's Variational principle.

  8. Temporal Trends in Analgesic Use in Long-Term Care Facilities: A Systematic Review of International Prescribing.

    Science.gov (United States)

    La Frenais, Francesca L; Bedder, Rachel; Vickerstaff, Victoria; Stone, Patrick; Sampson, Elizabeth L

    2018-02-01

    To explore global changes in the prescription of analgesic drugs over time in the international long-term care (LTC) population. Systematic review. We included original research articles in English, published and unpublished, that included number of participants, country and year(s) of data collection, and prescription of analgesics (analgesics not otherwise specified, opioids, acetaminophen; scheduled only, or scheduled plus as needed (PRN)). LTC residents. We searched PubMed, EMBASE, CINAHL, International Pharmaceutical Abstracts, PsycINFO, Cochrane, Web of Science, Google Scholar, using keywords for LTC facilities and analgesic medication; hand-searched references of eligible papers; correspondence. Studies were quality rated using an adapted Newcastle-Ottawa scale. Pearson correlation coefficients were generated between percentage of residents prescribed an analgesic and year of data collection. If available, we investigated changes in acetaminophen and opioid prescriptions. Forty studies met inclusion criteria. A moderate correlation (0.59) suggested that scheduled prescription rates for analgesics have increased over time. Similar findings were reflected in scheduled prescriptions for acetaminophen and opioids. No increase was seen when analyzing scheduled plus PRN analgesics. Use of opioids (scheduled plus PRN) appears to have increased over time. Worldwide, use of opioids and acetaminophen has increased in LTC residents. Research is needed to explore whether this reflects appropriate pain management for LTC residents and if PRN medication is used effectively. © 2017 The Authors. Journal of the American Geriatrics Society published by Wiley Periodicals, Inc. on behalf of The American Geriatrics Society.

  9. Download this PDF file

    African Journals Online (AJOL)

    Mr Olusoji

    Symptomatic and improve lung maturity, pethidine/pentazocine supportive care was the modality of management. injection PRN because of severe pain, sitz bath with Judicious analgesics and anxiolytics wererequired chlohexidine solution and Chymoral, an antitypsin because of pain and anxiety. Mechanical drainage.

  10. Detección de Anticuerpos IgG Específicos para Sarampión mediante la Técnica de Inmunofluorescencia Indirecta

    Directory of Open Access Journals (Sweden)

    Mónica Nieto Z

    2000-01-01

    Full Text Available La técnica de ínmunofluorescencia indirecta para detectar anticuerpos IgG específicos a sarampión (IFI-IgG fue evaluada con la prueba de neutralización por reducción de placas (PRN con 128 muestras de suero de personas con edades entre 0 y 15 años, 64 con antecedente de vacunación y 64 sin éste antecedente. El IFI-IgG alcanzó una sensibilidad de 80,4% y una especificidad de 100,0%, mostrando ser una prueba sencilla, reproducible, y tener correlación con PRN, aunque menos sensible que ésta última, especialmente cuando la PRN estimó títulos bajos de anticuerpos. Se concluye que la técnica IFI-IgG puede ser usada como método de rutina para la confirmación de sarampión en muestras de fase aguda y convalesciente de la enfermedad (sueros pareados, así como para estudios de prevalencia de anticuerpos en la comunidad, aunque no reemplazaría a la PRN.

  11. Analysis, modeling, and simulation (AMS) testbed development and evaluation to support dynamic mobility applications (DMA) and active transportation and demand management (ATDM) programs — evaluation report for ATDM program. [supporting datasets - Pasadena Testbed

    Science.gov (United States)

    2017-07-26

    This zip file contains POSTDATA.ATT (.ATT); Print to File (.PRN); Portable Document Format (.PDF); and document (.DOCX) files of data to support FHWA-JPO-16-385, Analysis, modeling, and simulation (AMS) testbed development and evaluation to support d...

  12. Records of Lead and Other Heavy Metal Inputs to Sediments of the Ala Wai Canal, Oahu, HI

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Four cores are given: G8, G8B, M21, and M3. For each core, a printable table file (.PRN) and a spreadsheet (.WK3) are provided. The file names reflect the sediment...

  13. Bordetella pertussis pertactin knock-out strains reveal immunomodulatory properties of this virulence factor.

    NARCIS (Netherlands)

    Hovingh, Elise Sofie; Mariman, Rob; Solans, Luis; Hijdra, Daniëlle; Hamstra, Hendrik-Jan; Jongerius, Ilse; van Gent, Marjolein; Mooi, Frits; Locht, Camille; Pinelli, Elena

    2018-01-01

    Whooping cough, caused by Bordetella pertussis, has resurged and presents a global health burden worldwide. B. pertussis strains unable to produce the acellular pertussis vaccine component pertactin (Prn), have been emerging and in some countries represent up to 95% of recent clinical isolates.

  14. Carbon Dioxide Induced Alkene Extrusion from Bis(pentamethylcyclopentadienyl)titanium(III) Alkyls

    NARCIS (Netherlands)

    Luinstra, Gerrit A.; Teuben, Jan H.

    1987-01-01

    Reaction of titanium(III) alkyls, (η5-C5Me5)2TiR (R = Et or Prn), in toluene solution with CO2 proceeds at room temperature with formation of the titanium formate (η5-C5Me5)2TiO2CH, and the corresponding alkene (ethene or propene).

  15. Quantitative detection and diversity of the pyrrolnitrin biosynthetic locus in soil under different treatments

    NARCIS (Netherlands)

    Garbeva, P; Voesenek, K; van Elsas, JD

    The prevalence of antibiotic production loci in soil is a key issue of current research aimed to unravel the mechanisms underlying the suppressiveness of soil to plant pathogens. Pyrrolnitrin (PRN) is a key antibiotic involved in the suppression of a range of phytopathogenic fungi. Therefore, field

  16. Quanitative detection and diversity of the pyrrolnitrin biosynthetic locus in soil under different treatments.

    NARCIS (Netherlands)

    Garbeva, P.; Voesenek, K.; Elsas, van J.D.

    2004-01-01

    The prevalence of antibiotic production loci in soil is a key issue of current research aimed to unravel the mechanisms underlying the suppressiveness of soil to plant pathogens. Pyrrolnitrin (PRN) is a key antibiotic involved in the suppression of a range of phytopathogenic fungi. Therefore, field

  17. Cost-effectiveness of ranibizumab versus aflibercept in the treatment of visual impairment due to diabetic macular edema: a UK healthcare perspective

    Directory of Open Access Journals (Sweden)

    Régnier SA

    2015-05-01

    Full Text Available Stephane A Régnier,1 William Malcolm,2 Jennifer Haig,3 Weiguang Xue41Novartis Pharma AG, Basel, Switzerland; 2Novartis Pharmaceuticals UK Ltd, Frimley Business Park, UK; 3Optum, Burlington, ON, Canada; 4Optum, Uxbridge, UKBackground: Ranibizumab and aflibercept are alternative anti-vascular endothelial growth factor agents approved for the treatment of visual impairment (VI due to diabetic macular edema (DME.Objective: To estimate, from a UK healthcare perspective, the cost-effectiveness of ranibizumab 0.5 mg pro re nata (PRN and ranibizumab 0.5 mg treat and extend (T&E compared with aflibercept 2 mg every 8 weeks after five initial monthly doses (2q8 in the treatment of VI due to DME.Methods: A Markov model previously reviewed by the National Institute for Health and Care Excellence was used to simulate the long-term outcomes and costs of treating DME. Health states were defined by increments of ten letters in best-corrected visual acuity (BCVA, with a 3-month cycle length. Patients could gain (or lose a maximum of two health states between cycles. A 3-year treatment time frame and a lifetime horizon were used. Future costs and health outcomes were discounted at 3.5% per annum. Patient baseline characteristics and the efficacy of ranibizumab PRN were derived using data from the RESTORE study. The relative efficacies of ranibizumab PRN, ranibizumab T&E, and aflibercept were assessed with a network meta-analysis. Different utilities were assigned based on BCVA and whether the treated eye was the better- or the worse-seeing eye. Sensitivity analyses tested the robustness of the model.Results: Lifetime costs per patient of treating DME were £20,019 for ranibizumab PRN, £22,930 for ranibizumab T&E, and £25,859 for aflibercept 2q8. Ranibizumab was dominant over aflibercept, with an incremental gain of 0.05 quality-adjusted life-years (QALYs and cost savings of £5,841 (PRN and £2,930 (T&E compared with aflibercept. Ranibizumab PRN and

  18. Curriculum and instructional methods for drug information, literature evaluation, and biostatistics: survey of US pharmacy schools.

    Science.gov (United States)

    Phillips, Jennifer A; Gabay, Michael P; Ficzere, Cathy; Ward, Kristina E

    2012-06-01

    The drug information curriculum in US colleges of pharmacy continues to evolve. The American College of Clinical Pharmacy (ACCP) Drug Information Practice and Research Network (DI PRN) published an opinion paper with specific recommendations regarding drug information education in 2009. Adoption of these recommendations has not been evaluated. To assess which recommendations made in the ACCP DI PRN opinion paper are included in US pharmacy school curricula and characterize faculty qualifications, educational methods, and recent changes in drug information education. An electronic survey was designed using the ACCP DI PRN opinion paper and the Accreditation Council for Pharmacy Education standards and guidelines for accreditation of PharmD programs in the US. Survey questions addressed curricular content within the following categories: drug information, literature evaluation, and biostatistics. A letter including the online survey link was sent via email to the dean of each US college/school of pharmacy (N = 128). Recipients were instructed to forward the email to the individual at their institution who was the most knowledgeable about the content and methodology used for didactic drug information education. Sixty-four responses were included in the final analysis. Of the 19 ACCP DI PRN minimum core concepts, 9 (47%) were included in curricula of all responding institutions; 14 of 19 (74%) were included in curricula for all but 1 institution. In contrast, 5 of 16 concepts (31%) were not formally taught by a number of institutions. Many respondents noted an increased focus on evidence-based medicine, medication safety, and informatics. Although a survey of drug information curricula documented substantial inclusion of the essential concepts presented in the ACCP DI PRN opinion paper, room for improvement remains in drug information curricula in US colleges of pharmacy.

  19. Switching from pro re nata to treat-and-extend regimen improves visual acuity in patients with neovascular age-related macular degeneration.

    Science.gov (United States)

    Kvannli, Line; Krohn, Jørgen

    2017-11-01

    To evaluate the visual outcome after transitioning from a pro re nata (PRN) intravitreal injection regimen to a treat-and-extend (TAE) regimen for patients with neovascular age-related macular degeneration (AMD). A retrospective review of patients who were switched from a PRN regimen with intravitreal injections of bevacizumab, ranibizumab or aflibercept to a TAE regimen. The best corrected visual acuity (BCVA), central retinal thickness (CRT) and type of medication used at baseline, at the time of changing treatment regimen and at the end of the study were analysed. Twenty-one eyes of 21 patients met the inclusion criteria. Prior to the switch, the patients received a mean of 13.8 injections (median, 10; range, 3-39 injections) with the PRN regimen for 44 months (range, 3-100 months), which improved the visual acuity in five patients (24%). After a mean of 6.1 injections (median, 5; range, 3-14 injections) with the TAE regimen over 8 months (range, 2-16 months), the visual acuity improved in 12 patients (57%). The improvement in visual acuity during treatment with the TAE regimen was statistically significant (p = 0.005). The proportion of patients with a visual acuity of 0.2 or better was significantly higher after treatment with the TAE regimen than after treatment with the PRN regimen (p = 0.048). No significant differences in CRT were found between the two treatment regimens. Even after prolonged treatment and a high number of intravitreal injections, switching AMD patients from a PRN regimen to a strict TAE regimen significantly improves visual acuity. © 2017 Acta Ophthalmologica Scandinavica Foundation. Published by John Wiley & Sons Ltd.

  20. Euro-scepticism as party strategy: persistence and change in party-based opposition to European integration

    OpenAIRE

    Sitter, Nick

    2003-01-01

    'Parteien, die eine grundsätzlich oder bedingt ablehnende Haltung der europäischen Integration gegenüber vertreten, sind im gesamten politischen Spektrum zu finden. Ein kursorischer Blick auf die europäische Parteienlandschaft zeigt, dass Mitte-Links- und Mitte-Rechts-Parteien eher nicht zur Übernahme einer grundsätzlich euro-skeptischen Position tendieren, obwohl sie bestimmte Aspekte der europäischen Integration ablehnen mögen, wenn diese programmatischen Zielen zuwiderlaufen. Bis auf einig...

  1. Branding av en reality-tv-serie i Finland : Fallstudie Maajussille morsian

    OpenAIRE

    Rautiainen, Laura

    2016-01-01

    Mitt examensarbete handlar om reality-tv serien Maajussille morsian och dess framgång i Finland. Jag undersöker brandingens roll inom medievärlden och mer specifikt de brandingverktygen som används i lokalisering samt fenomenalisering av Maajussille morsian. Jag inleder mitt examensarbete med en teoridel som behandlar branding på en mer allmän nivå varefter jag går djupare in på brandkapitalets betydelse för succé. Förutom branding behandlar jag i teorin också fenomenet reality-tv. Som grund ...

  2. Interpreting trial results following use of different intention-to-treat approaches for preventing attrition bias: a meta-epidemiological study protocol

    OpenAIRE

    Dossing, Anna; Tarp, Simon; Furst, Daniel E; Gluud, Christian; Beyene, Joseph; Hansen, Bjarke B; Bliddal, Henning; Christensen, Robin

    2014-01-01

    Introduction When participants drop out of randomised clinical trials, as frequently happens, the intention-to-treat (ITT) principle does not apply, potentially leading to attrition bias. Data lost from patient dropout/lack of follow-up are statistically addressed by imputing, a procedure prone to bias. Deviations from the original definition of ITT are referred to as modified intention-to-treat (mITT). As yet, the impact of the potential bias associated with mITT has not been assessed. Our o...

  3. Interpreting trial results following use of different intention-to-treat approaches for preventing attrition bias

    DEFF Research Database (Denmark)

    Dossing, Anna; Tarp, Simon; Furst, Daniel E

    2014-01-01

    10 biological and targeted drugs based on collections of trials that would correspond to 10 individual meta-analyses. ETHICS AND DISSEMINATION: This study will enhance transparency for evaluating mITT treatment effects described in meta-analyses. The intended audience will include healthcare...... concerns when executing different mITT approaches in meta-analyses. METHODS AND ANALYSIS: Using meta-epidemiology on randomised trials considered less prone to bias (ie, good internal validity) and assessing biological or targeted agents in patients with rheumatoid arthritis, we will meta-analyse data from...

  4. Political attitudes bias the mental representation of a presidential candidate's face.

    Science.gov (United States)

    Young, Alison I; Ratner, Kyle G; Fazio, Russell H

    2014-02-01

    Using a technique known as reverse-correlation image classification, we demonstrated that the face of Mitt Romney as represented in people's minds varies as a function of their attitudes toward Mitt Romney. Our findings provide evidence that attitudes bias how people see something as concrete and well learned as the face of a political candidate during an election. Practically, our findings imply that citizens may not merely interpret political information about a candidate to fit their opinion, but also may construct a political world in which they literally see candidates differently.

  5. LHV töötajad jäid USA börsil vahele salajase info hankimisega / Aivar Reinap, Aleksei Günter

    Index Scriptorium Estoniae

    Reinap, Aivar, 1968-

    2005-01-01

    USA väärtpaberijärelevalve (SEC) ametnike andmetel varastasid Investeerimisfirma Lõhmus, Haavel & Viisemann (LHV) töötajad Oliver Peek ja Kristjan Lepik arvutiprogrammi abil USA börsiettevõtete veel avaldamata pressiteateid, teenides selle abil USA börsidel vähemalt 7,8 miljonit dollarit kasumit. SEC andis LHV ja tema kaks töötajad petuskeemi korraldamise süüdistusega kohtusse. Lisa: LHV tehingud. Vt. samas: Hindrek Riikoja, Aivar Reinap. Skandaal LHV äri Eestis veel ohtu ei sea. Kommenteerivad: ettevõtja Heldur Meerits, Eesti Panga nõukogu esimees Mart Sõrg, IT-spetsialist Linnar Viik, Tallinna Börsi juht Kaidi Oone

  6. Estofiili mõtteid / Edward Lucas ; tõlk. Erik Aru

    Index Scriptorium Estoniae

    Lucas, Edward

    2008-01-01

    Ajakirja The Economist ajakirjanik on seisukohal, et pronkssõdurit kasutati parteipoliitilistel eesmärkidel ning see oli mäng tulega. Lääs tuli appi, kuid mitte tänu Eesti välisministeeriumile, vaid Venemaa jämedate vigade tõttu

  7. Erakordne aeg või valed mudelid? / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2008-01-01

    Paul De Grauwe, Leonardo Iania ja Pablo Rovira Kaltwasser arvutasid välja börsidel erakordsemate päevade esinemise tõenäosuse. Nende järelduse kohaselt ei ole mitte praegune aeg erakordne, vaid finantsmudelid on valed. Lisa: Indeks Dow Jones Industrial Average oktoobrikuus

  8. USAs avati suurim Balti kunsti näitus / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2002-01-01

    New Jerseys Rutgersi ülikooli kunstimuuseumis on väljas 190 Eesti, Läti ja Leedu kunstniku tööd Norton ja Nancy Dodge'i mitte-konformistliku nõukogude kunsti kollektsioonist, mille omanikud ülikoolile kinkisid. Näitusekataloogi artiklid on kirjutanud Juta Kivimäe, Eha Komissarov, Sirje Helme ja kanadalane Eha Sepp

  9. Bridging the ideological space: a cross-national analysis of the distance of party switching / Ruth Dassonneville, Yves Dejaeghere

    Index Scriptorium Estoniae

    Dassonneville, Ruth

    2014-01-01

    Artikkel keskendub selget eelistust mitteomavatele (volatiilsetele) valijatele, küsides, kas valimistulemuste ettearvamatus sõltub rohkem haritud valijate hästi läbimõeldud valikutest või on tulemus mitte nii haritud ja selget eelistust mitteomavate valijate kätes. Aluseks. valimissüsteemide võrdlevuuring, sh Eesti 2011. aasta valimiste kohta.

  10. Õiendus

    Index Scriptorium Estoniae

    2004-01-01

    Parandades ajalehes 16. apr. 2004 ilmunud sõnumit "Pärdi muusikaga preemiafilmid", teatab ajaleht, et Cesariga pärjatud filme, kus kõlas A. Pärdi muusika, oli sel aastal kolm, mitte kuus, nagu sõnumis väideti

  11. Ärge eelistage kodumaist! / Stefan Andersson

    Index Scriptorium Estoniae

    Andersson, Stefan

    2010-01-01

    Autor arvab, et tarbija ülesanne on vaadata ka toote hinda ja kvaliteeti, mitte lihtsalt tootja geograafilist asukohta. Nii saame tarbijatena selliseid tootjaid, keda väärime, hind ja kvaliteet paraneb, majanduse efektiivsus kasvab. Riigi ülesanne on tagada õiglane konkurents ja reguleerida turgu

  12. Eesmärk ei pühenda iga abinõu. Eetiline investor tunneb vastutust / Kadri Bank

    Index Scriptorium Estoniae

    Bank, Kadri

    2011-01-01

    ÜRO vastutustundliku investeerimise programmiga liitunud Limestone Fundsi investeerimispõhimõte on mitte finantseerida ettevõtteid, kelle tegevus on ühiskonna jätkusuutliku arenguga vastuolus. Selle juht Alvar Roosimaa ei näe n.-ö. tavalise ja eetilise investeeringu pikkuse ja kasumlikkuse juures mingit erinevust

  13. Ühiskondlik lepe keskendugu peaeesmärgile / Märt Rask

    Index Scriptorium Estoniae

    Rask, Märt, 1950-

    2003-01-01

    Eesti arengu iseärasustest ja ühiskondliku leppe tähendusest kogu ühiskonnale. Kuni ühiskondliku leppe protsessis ei osale valijatelt mandaadi saanud erakonnad, saab ühiskondlikust leppest rääkida üksnes kui algatusest, mitte aga kui ühiskonna põhisuundumusi määravast foorumist

  14. Kellele kuulub inimese elu? / Daniele Monticelli

    Index Scriptorium Estoniae

    Monticelli, Daniele, 1970-

    2010-01-01

    Eutanaasiaga seotud probleemide tuumikust - kellele kuulub inimelu, kellel on õigus otsustada inimese elu ja surma üle, kuidas hinnata enesetappu ning kuidas nüüdisaegse meditsiini areng neid küsimusi mõjutab. Teemat on vaadeldud mitte niivõrd (bio)eetilise, kuivõrd (bio)poliitilise probleemina

  15. Eesti parim robottantsija : breik on mind hullemast päästnud / Kristel Kirss

    Index Scriptorium Estoniae

    Kirss, Kristel, 1967-

    2003-01-01

    Breiktantsu festivali Battle of the East 2003 Balti alavoorus electric boogies teiseks jäänud breikar Joel Juht endast ja breiktantsust. Lisa : sõnum "Tants, mitte sportvõimlemine" ja "Breiktantsu "Battle of the Year 2003" Balti alavooru võitjad

  16. Mõõdulindiga õnne ja edu kallal / Anneli Aasmäe

    Index Scriptorium Estoniae

    Aasmäe, Anneli, 1973-

    2000-01-01

    Juhtimiskonsultant Mait Raava kinnitusel on edukus 70 protsenti kaasasündinud omadus, Eesti edukatel on tegutsemisvajadus veres, nad võivad toetuda Iisraeli päritolu juhtimisteoreetiku Eliyahu M. Goldratti õpetusele, mitte eduretsepte ja õnnevalemeid pakkuvaile autorite rivile Dale Carnegie'st Ben Furmanini. Kommentaarid: Aune Past, Mait Raava

  17. Sotsiaalne kapital, poliitiliste institutsioonide mõjutamisvõimaluste tunnetamine ja usaldus võimuinstitutsioonide vastu / Tõnis Saarts

    Index Scriptorium Estoniae

    Saarts, Tõnis

    2002-01-01

    Autor vaatleb kuivõrd mõjutab sotsiaalne kapital ja poliitiliste institutsioonide töö mõjutamise võimaluse tunnetamine mitte-eestlaste ja eestlaste usaldust nende poliitiliste institutsioonide vastu nii kohalikul kui ka keskvõimu tasandil. Tabelid. Bibliogr. 8 nim. Kokkuvõte ingl. k.

  18. Innovatsiooniosak tuleb appi / Marika Popp

    Index Scriptorium Estoniae

    Popp, Marika

    2008-01-01

    Innovatsiooniosak ( innovation vouchers) kujutab endast kinkekaarti ettevõtjale, selle alusel avaneb eriti väike- ja keskmise suurusega ning seni vähe või üldse mitte teadus- ja arendustööga kokku puutunud ettevõtteil saada esimene kogemus ning tekitada juurdepääs teadmiste allikale

  19. Things as companions : a Peircean approach to urban place / Susann Vihma

    Index Scriptorium Estoniae

    Vihma, Susann

    2003-01-01

    Inimtegevuse, keskkonna ja asjade analüüs Peirceþilikus võtmes. Püütakse eritleda tootekekkonna ja disainiprotsessiga seotud inimkogemust. Artefakti käsitletakse kui vastastikuses koostöös toimivat asja, mitte pelgalt passiivset objekti

  20. 10522 ASSESSMENT OF AFLATOXINS B1, B2, G1 AND G2 ...

    African Journals Online (AJOL)

    user

    2013-04-13

    Apr 13, 2013 ... occurs when high concentrations of aflatoxins are consumed. Symptoms of acute aflatoxicosis include vomiting, weight loss, abdominal pain, jaundice, liver damage and ..... Pitt JI Application of the food safety objective concept to the problem of aflatoxins in peanuts. Mitt. Lebensm. Hyg, 2004; 95: 52-58. 19.

  1. Lavakad, 23. lend / Eva Kübar

    Index Scriptorium Estoniae

    Kübar, Eva

    2008-01-01

    Eesti Muusika- ja Teatriakadeemia lavakunstikooli XXIII lennu lõpetajatest - näitlejad Marek Tammets, Ago Soots, Agnes Aaliste, Martin Mill, Andres Oja, Juss Haasma, Maarja Mitt, Meelis Põdersoo, Jekaterina Novosjolova, Elina Pähklimägi ja Kristo Viiding, dramaturgid Marion Jõepera, Mart Kase ja Maria Lee Liivak ning lavastajad Robert Annus ja Uku Uusberg

  2. Kasahstani nafta : närvide mäng / Steve LeVine

    Index Scriptorium Estoniae

    LeVine, Steve

    2008-01-01

    Nafta ja gaasi väljaveost Kasahstanist ja Kesk-Aasiast. USA naftakompanii Chevroni naftaekspordile on tõkkeid seadnud Venemaa pidevad jõudemonstratsioonid ning kohalike riikide soov Venemaale mitte vastu astuda, samuti 2008. aasta suvel toimunud Vene-Gruusia sõda, mis raskendas nafta jõudmist Euroopasse. Kaart

  3. Trachypodaceae. A critical revision

    NARCIS (Netherlands)

    Zanten, van B.O.

    1959-01-01

    1. Trachypus. 1. T. bicolor Reinw. et Hornsch. is divided into 4 varieties: a. var. bicolor, b. var. hispidus (C. Muell.) Card., c. var. viridulus (Mitt.) Zant. comb. nov., d. var. scindifolius (Sak.) Nog. 2. T. humilis Lindb. is divided into 2 varieties: a. var. humilis, b. var. tenerrimus (Herz.)

  4. Teise samba värinad / Aivar Sõrm

    Index Scriptorium Estoniae

    Sõrm, Aivar

    2009-01-01

    Autori hinnangul ei tähenda II samba maksete külmutamine mitte süsteemi lõppu ega võimalust sellest loobuda, vaid lihtsalt lühiajalist aja mahavõtmist arupidamiseks ja hingetõmbeks. Joonised: 1. Erinevate pensionifondide keskmised tootlused; 2. Teise samba käekäik 2002-2009

  5. Uvidet zad Dzheka Nikolsona i ne umeret! / Jevgeni Levik

    Index Scriptorium Estoniae

    Levik, Jevgeni

    2004-01-01

    Komöödiafilm "Parem hilja kui mitte kunagi" ("Something's Gotta Give") : režissöör Nancy Meyers : Ameerika Ühendriigid 2003 ja mängufilm "Tõlkes kaduma läinud" ("Lost In Translation") : režissöör Sofia Coppola : Ameerika Ühendriigid 2003

  6. Eestlane tahab muulase lahkumist : eestlane ihkab rahvusriiki / Rein Sikk

    Index Scriptorium Estoniae

    Sikk, Rein, 1961-

    2000-01-01

    Järg Sep/12;13;14 lk. 4. Saar Polli integratsioonimonitooring. Ligi pooled eestlastest peavad muulaste riigist lahkumist Eestile kasulikuks. Diagr.: Mitte-eestlaste osakaal väheneb. Geneetiline mitmekesisus on rahvale kasulik. Muulaste lahkumise järel peaks Eesti tööjõudu sisse tooma hakkama. Diagr.: Kas tahate elada kiratsevas Eestis

  7. Knut i prjanik v kulture / David Vseviov ; tõlk. Tatjana Nikitina

    Index Scriptorium Estoniae

    Vseviov, David, 1949-

    2006-01-01

    Põhjamaade ja Baltimaade kultuurisituatsioonidest pärast Teist maailmasõda. Piitsa ja prääniku poliitikast kultuuris. Võimalusest, et eestlased seisavad praegu sama valiku ees kui etruskid 2000 aastat tagasi, kuna ohtu osatakse näha ainult piitsas, mitte präänikus

  8. Tüli Robert Smithsoni "Spiraalse muuli" taastamise ümber / Rael Artel

    Index Scriptorium Estoniae

    Artel, Rael, 1980-

    2004-01-01

    Ameerika maakunstniku Robert Smithsoni (1938-1973) töö "Spiral Jetty" / "Spiraalne muul", mis on ligi 30 aastat seisnud nähtamatult Utah' osariigis Suure Soolajärve põhjas, on praegu kogu ulatuses näha. Teose omanik Dia kunstikeskus on dilemma ees, kas muul restaureerida või mitte

  9. Ethnisierung von Armut in estnishen Transformationsprozess = Vaesuse etniseerumine Eesti siirdeprotsessis / Maie Toimet

    Index Scriptorium Estoniae

    Toimet, Maie

    2004-01-01

    Lühiülevaade muutustest Eesti etnilises koosseisus, siirdeperioodil toimunud tööhõivemuutustest, eestlaste ja mitte-eestlaste toimetulekust tööturul, nende majanduslikust kindlustatusest Eestis. Tabelid. Ettekanne Leipzigi Ülikoolis 27. novembril 2003. aastal 17. Leipzigi maailmamajanduse seminaril. Autorist = About the author lk. 31

  10. Saaremaalt saab heinaseemet igale maitsele / Jana Rand ; kommenteerinud Hindrek Older

    Index Scriptorium Estoniae

    Rand, Jana, 1963-

    2016-01-01

    Saaremaal Laadjala külas tegutsev OÜ Saaremaa Seeme on Eesti suurim heinaseemne kasvataja, aga mitte erakordselt head looduslikud tingimused pole ettevõtte edu taganud, vaid aastakümnetega omandatud kogemused ja terve Sauna pere pühendunud töö. Vestlusest Arli Saunaga

  11. Miks USA ründab Iraani? / Gwynne Dyer

    Index Scriptorium Estoniae

    Dyer, Gwynne

    2006-01-01

    Ilmunud ka: Molodjozh Estonii 6. märts lk. 12. 20. märtsil avab Iraan uue börsi, kus kõik maad saavad osta ja müüa naftat ja gaasi mitte ainult dollarite, vaid ka eurode eest, selle mõju USA finantspositsioonile

  12. Kaubamaja "Lemon" - Arco Ärikeskus : Estonia pst. 1, Tallinn

    Index Scriptorium Estoniae

    2002-01-01

    1958. a. valminud hoone rekonstrueerimine. Projekteerija: EA Reng. Arhitekt Martin Aunin. Ehituskonstruktsioonid: Riho Märtson. Insenertehnilised osad: Karmo Pajo, Maarika Kurvits, Eha Treial. Valgusinstallatsioon: Meeli Kõiva. Kaupluste mööbel, kohtvalgustus: Priit Põldme, Ants Tolli, Ruth-Helene Kaasik, Hugo Mitt, Mart Vesker, Tarmo Piirmets. Projekt 2001, valmis 2002. I korruse põhiplaan, 4 vaadet

  13. Keelekontakti mõju eesti sihitiskäänete kasutamisele / Martin Ehala

    Index Scriptorium Estoniae

    Ehala, Martin, 1963-

    2009-01-01

    Analüüsitakse eesti keele sihitise käändevaliku varieerumist, et välja selgitada, milline osa on selles eesti keelt mitte emakeelena rääkijatel, ning kas see mõju ulatub ka tagasi emakeelsete keelekasutajateni

  14. "Kui tehnoloogiline üleolek" kõlab õõnsalt

    Index Scriptorium Estoniae

    2003-01-01

    Kaanel nr. 4 2003/nr. 1 2004. Artiklis refereeritakse Ameerika Ühendriikide armee reservkolonel-leitnandi R. Scott Moore'i artiklit "When "technological superiority" rings hollow". Oma kirjutises hoiatab autor liigse usu eest kõrgtehnoloogiasse ja rõhutab, et tehnoloogia aitab võita lahinguid, kuid mitte sõdu

  15. The star-bright hour : [luuletused] / Betti Alver

    Index Scriptorium Estoniae

    Alver, Betti, 1906-1989

    2006-01-01

    Sisu: The star-bright hour ; Not a dream ; The Piper ; Corals in an ancent river. Luuletused pärinevad kogumikust "Tuulelaeval valgusest on aerud = Windship with Oars of Light. (Tallinn : Huma, 2001). Orig.: Tähetund ; Mitte viirastus, meelepett ; Vilepuhuja ; Korallid Emajões

  16. Rail Baltic - дорогой и рискованный проект / Микк Салу

    Index Scriptorium Estoniae

    Салу, Микк, 1975-

    2011-01-01

    Rail Balticu puhul on tähtsaim küsimus, kas uut raudteeühendust on üldse vaja, mitte aga see, kas tee läheb läbi Tartu või Pärnu. Konsutatsioonifirma AECOM koostatud raportist Rail Balticu tasuvuse kohta

  17. Unistuste Rail Baltic - ilus ja kallis / Mikk Salu

    Index Scriptorium Estoniae

    Salu, Mikk, 1975-

    2011-01-01

    Rail Balticu puhul on tähtsaim küsimus, kas uut raudteeühendust on üldse vaja, mitte aga see, kas tee läheb läbi Tartu või Pärnu. Konsutatsioonifirma AECOM koostatud raportist Rail Balticu tasuvuse kohta

  18. Ameerikalikust kultuuriturundusest / Bonita Kolb

    Index Scriptorium Estoniae

    Kolb, Bonita

    2005-01-01

    Ilmunud ka: International cultural marketing conference : November 3-4, 2005, Tartu : a collection of speeches. Autori sõnul on Ameerika kultuurikorraldusele iseloomulik turunduse vaatlemine protsessi mitte sündmusena, keskendumine rohkem psühhograafilisele ja vähem demograafilisele segmenteerimisele, suure tähelepanu pööramine tehnilise kvaliteedi kõrval funktsionaalsele kvaliteedile

  19. Res Publica seisab vastu homse arvel elamisele / Siim Männik

    Index Scriptorium Estoniae

    Männik, Siim

    2005-01-01

    Ilmunud ka: Vabariik (venek.) 30. august lk. 1. Res Publica koostab praegu kohalikeks valimisteks nimekirju. Erakond ei plaani korraldada mitte ühte üleriigilist valimiskampaaniat, vaid 120 kohalikku kampaaniat, peale selle on kavas üleriigiline n.-ö. foonikampaania. Lisa: Miks valida Res Publica? Vt. samas: Sisevalimised 1.-3. septembrini

  20. Siis, kui lõpeb lähiminevik ja algab retro / Andreas Trossek

    Index Scriptorium Estoniae

    Trossek, Andreas, 1980-

    2006-01-01

    2006. aasta presidendivalimiste kampaania kajastamine meedias. Kunstiteosed Arnold Rüütlist. 2006. a. presidendikampaaniat kajastav ja kujundav meedia ei kontsentreerunud mitte niivõrd tulevase presidendi maailmavaadetele, vaid puudutas läbi kandidaatide isikukesksuse kogu eesti kui niinimetatud postkommunistliku rahva lähimineviku problemaatikat

  1. Estonian parties face internal struggles / Helga Kalm

    Index Scriptorium Estoniae

    Kalm, Helga

    2010-01-01

    2011. aasta parlamendivalimiste eel on Eestimaa Rahvaliit, Erakond Eestimaa Rohelised ja Sotsiaaldemokraatlik Erakond keerulises olukorras. Parteides on probleeme juhatustega. Kahe esimese partei puhul ei ole üldse kindel, kas nad saavad parlamendis kohti või mitte. Tõnis Saartsi, Rein Toomla ja Andres Tarandi arvamusi

  2. Narkoriigi muutmine kartulivabariigiks / Andrei Hvostov

    Index Scriptorium Estoniae

    Hvostov, Andrei, 1963-

    2009-01-01

    USA sõdurid püüavad tabada Afganistanis narkoparuneid. Autori sõnul ei tule moonipõldudelt mitte ainult Talibani sissetulek, vaid ka kõrgemate ametnike rikkus, kahtlusaluste hulgas on isegi president Hamid Karzai. President on vastu moonipõldude hävitamisele herbitsiididega

  3. Jüri Käo: Eesti Energia jääb isegi börsil poliitikute kontrolli alla / Jüri Käo ; intervjueerinud Sulev Vedler

    Index Scriptorium Estoniae

    Käo, Jüri, 1965-

    2010-01-01

    Eesti Energia nõukogu esimees ei poolda mitte Eesti Energia suuremahulist börsile viimist, vaid vähemusaktsiate börsil noteerimist. Tema sõnul on IPO suurim oht, et sellest saab poliitilise valimisvõitluse objekt ning unustatakse, et energeetikas tehakse otsuseid 30 ja 50 aasta perspektiivis

  4. Kuningas on surnud. Elagu kuningas! / Marco Montanari

    Index Scriptorium Estoniae

    Montanari, Marco

    2008-01-01

    Autor leiab Itaalia peaministri Romano Prodi hiljutise tagasiastumise taustal, et tegemist ole mitte järjekordse poliitilise kriisi, vaid süsteemirevolutsiooniga. Riigis on tekkinud inimeste komiteed movimenti'd, mida hoiab koos vajadus lahendada probleeme, millega riik ei suuda tegelda

  5. Arnold Rüütel: e-hääletamine tuleb niikuinii / Arnold Rüütel ; intervjueerinud Kai Kalamees

    Index Scriptorium Estoniae

    Rüütel, Arnold, 1928-

    2005-01-01

    President Arnold Rüütel vastab küsimustele, mis on seotud tema otsusega mitte kuulutada välja e-hääletamist lubavat seadust. Presidendi sõnul ei mõjuta tema otsus kuidagi e-hääletuse tänavust toimumist

  6. Unelmate pulm? Jama! / Marco Evers ; tõlkinud Külli-Riin Tigasson

    Index Scriptorium Estoniae

    Evers, Marco

    2011-01-01

    Autor leiab, et Briti kuningakoda on oma aja ära elanud ning et prints Williami ja Kate Middletoni laulatus on kurb vaatemäng, nad ei abiellu mitte nii, nagu nad ise tahaksid, vaid nii, nagu nõuab palee, protokoll ja vanaema

  7. Suurbritannias toob iga uus päev uue häda / Romet Kreek

    Index Scriptorium Estoniae

    Kreek, Romet, 1972-

    2008-01-01

    Kinnisvaralaenude põhjustatud kriis Suurbritannia panganduses jätkub. Väljaüürimiseks mõeldud kinnisvara laenude andmisele spetsialiseerunud pank Bradforg & Bingley, mis on viie kuuga kaotanud aktsiahinnas, andis kasumihoiatuse. Vt. samas: Pank on kasvanud, kasum mitte. Diagramm: Bradford & Bingley aktsia hinnad

  8. President Ilves : we can agree upon a common future : TV address, 2 May 2007 / Toomas Hendrik Ilves

    Index Scriptorium Estoniae

    Ilves, Toomas Hendrik, 1953-

    2008-01-01

    President Toomas Hendrik Ilves ütleb oma avalduses, et Euroopas on kombeks lahendada erimeelsusi diplomaatide ja poliitikute kaudu, mitte tänavatel ja arvutisõjas. President kutsub üles kõiki kaasmaalasi Eesti riiki enda omaks pidama ning Venemaad tsiviliseeritult käituma

  9. Trebujetsja hladnokrovnõi Vinni-Puhh / interv. Jana Toom

    Index Scriptorium Estoniae

    2008-01-01

    Kesk-Euroopa Ülikooli rahvusvaheliste suhete professor Aleksandr Astrov ja Eesti Ekspressi ajakirjanik Andrei Hvostov räägivad pronkssõduri teisaldamisega kaasnenud Venemaa meediahuvist ja integratsioonist. A. Astrov võrdles mitte-eestlaste integreerimist Eestis juutide inkvisitsiooniga keskaegses Hispaanias ning seostas eestimeelsuse nõuet muulaste inkvisitsiooniga

  10. Shved v kontse tonnelja / Bo Kragh ; interv. Jana Toom

    Index Scriptorium Estoniae

    Kragh, Bo

    2008-01-01

    Intervjuu Svenska Handelsbankeni asepresidendiga, kes vastab küsimustele, mis puudutavad Euroopa majanduse praegust seisu. Hetkel on tähtsaim töökohtade säilitamine ja see, et riik hoolitseks ennekõike inimeste, mitte ettevõtete eest, arvab ta. Lisad

  11. Kõige tähtsam on, et inimesed ei kannataks liiga palju! / Bo Kragh ; interv. Jana Toom

    Index Scriptorium Estoniae

    Kragh, Bo

    2008-01-01

    Intervjuu Svenska Handelsbankeni asepresidendiga, kes vastab küsimustele, mis puudutavad Euroopa majanduse praegust seisu. Hetkel on tähtsaim töökohtade säilitamine ja see, et riik hoolitseks ennekõike inimeste, mitte ettevõtete eest, arvab ta

  12. Kas Eestil on lootust? / Jüri Sepp, Erik Terk

    Index Scriptorium Estoniae

    Sepp, Jüri, 1952-

    2007-01-01

    Autorid vaatlevad mitmete edetabelite põhjal, kuidas Eestil on läinud teiste riikidega võrreldes, ning nimetavad probleeme Eesti edasiliikumisel. Nende hinnangul ei seisne Eesti ühiskonna tulevikuprobleem mitte selles, kas ohverdada sotsiaalsust liberaalsusele või vastupidi, vaid selles, kuidas neid kahte asja ühendada. Artikli alus on "Eesti inimarengu aruanne 2006"

  13. Kas Eestil on lootust? / Jüri Sepp, Erik Terk

    Index Scriptorium Estoniae

    Sepp, Jüri, 1952-

    2012-01-01

    Autorid vaatlevad mitmete edetabelite põhjal, kuidas Eestil on läinud teiste riikidega võrreldes, ning nimetavad probleeme Eesti edasiliikumisel. Nende hinnangul ei seisne Eesti ühiskonna tulevikuprobleem mitte selles, kas ohverdada sotsiaalsust liberaalsusele või vastupidi, vaid selles, kuidas neid kahte asja ühendada. Artikli alus on "Eesti inimarengu aruanne 2006"

  14. Kelle silmast otsida palki? : [essee] / Karl Ast Rumor

    Index Scriptorium Estoniae

    Rumor, Karl, pseud., 1886-1971

    2009-01-01

    Essee on ajendatud ametlikust teadaandest, mis lubab kuni olümpiamängude lõpuni viisavabalt Soome siseneda. Autor muretseb võimaluse pärast samamoodi vabalt riigist lahkuda, mitte sattuda Nõukogude raudeesriide taha. Käsitletakse ka Soome saatust ja hoiakuid üldisemalt

  15. Teadlased katsetavad ettevõtlusega / Väinu Rozental

    Index Scriptorium Estoniae

    Rozental, Väinu, 1957-

    2004-01-01

    Tartu Ülikoolist välja kasvanud teadusmahukad spin-off-ettevõtted on üldjuhul edukad vaid siis, kui firmat juhib majandusharidusega tegevjuht, mitte teadlane. Diagramm. Vt. samas: Ärimehed toetavad meditsiinitehnikat. Tartu Ülikoolist võrsunud teadusmahukad ettevõtted

  16. Eesti teadlaste äri : professorite taskufirmadest rahvusvaheliste korporatsioonideni / Mikk Salu

    Index Scriptorium Estoniae

    Salu, Mikk, 1975-

    2008-01-01

    Ilmunud ka: Vesti Dnja 24. märts lk. 5. Eesti teadlastest on viimaste aastatega saanud edukad ärimehed ja kõrgkoolidest on välja kasvanud mitmed tunnustatud ettevõtted. Vt. samas: Spin-off või mitte-spin-off

  17. Poliitika eitamise poliitikast / Janno Reiljan

    Index Scriptorium Estoniae

    Reiljan, Janno, 1951-2018

    2001-01-01

    Eitada poliitikat tähendab mitte mõelda oma elu probleemidele ja võimalikele lahendustele. Autor: ERL. Parlamendisaadik. Ilmunud ka: Koit, 24. mai 2001, lk. 6; Molodjozh Estonii, 23. mai 2001, lk. 3; Valgamaalane, 26. mai 2001, lk. 2; Virumaa Teataja, 30. mai 2001, lk. 7; Nädaline, 29. mai 2001, lk. 4

  18. Lugeda kunsti / Mieke Bal ; inglise keelest tõlkinud Ingrid Ruudi

    Index Scriptorium Estoniae

    Bal, Mieke, 1946-

    2011-01-01

    Uuritakse kujutiste lugemisviise, mis ei tugineks lingvistilistele sekkumistele visuaalsusse, samuti kuidas antakse erinevate kunstiteoste analüüsimisel neis leiduvatele sõnumitele ikoonilisi tähendusi ja semiootika panusest mõista kunsti mitte kui piiratud kogumit pühaks peetud objekte, vaid kui jätkuvat, elavat protsessi

  19. Eesti NATO ukselävel / Mari-Ann Kelam

    Index Scriptorium Estoniae

    Kelam, Mari-Ann, 1946-

    2002-01-01

    Seda, et NATO liitumisläbirääkimistele kutsutavate seas on ka Eesti, saab veel tänagi pidada üheks meie iseseisva riikluse suursaavutuseks, kui mitte imeks, kirjutab Riigikogu liige Mari-Ann Kelam. Autor: Isamaaliit. Parlamendisaadik

  20. Tšetšeenias kõik jälle otsast peale / George Shabad ; tõlk. Teet Kallas

    Index Scriptorium Estoniae

    Shabad, George

    2004-01-01

    Autori hinnangul on Moskval võimalus nüüd, pärast Ahmad Kadõrovi hukkumist alustada n.-ö. puhtalt lehelt; tekib võimalus panustada Tšetšeenia üldsuse laiadele kihtidele, mitte üheleainsale välikomandörile

  1. VP Market spreads its wings further

    Index Scriptorium Estoniae

    2004-01-01

    Jaekaubandusettevõte VP Market süüdistab ehituskaupade firmat Senukai tarnijatele surve avaldamises mitte müüa oma tooteid Ermitazas'es, mis on VP Marketi poolt asutatud ehitus- ja majapidamiskaupade poe kett. VP Market'i Eesti esindaja sõnul kaalub ettevõte mõne kohaliku keti ostmist

  2. Abraham Lincolni nähtamatud käed / Marek Tiits

    Index Scriptorium Estoniae

    Tiits, Marek

    2005-01-01

    Eesti probleem pole mitte inimeste vähene ettevõtlikkus, arvab autor, vaid majanduskeskkond, mis soosib pigem tarbimist kui ekspordile orienteeritud tegevuste arendamist. Eesti vajab Ameerika ühendamise aegset poliitikat, mille keskmes oli sotsiaalne mobiilsus ning majanduse struktuuri ajakohastamine

  3. Mis jääb kunstist lõpuks sõelale? / Tanel Veenre

    Index Scriptorium Estoniae

    Veenre, Tanel, 1977-

    2011-01-01

    15. Tallinna graafikatriennaalist "Armastuse, mitte raha pärast" Kumu Kunstimuuseumis. Triennaali kuraatorid: Simon Rees, Eve Kask, Eha Komissarov, kujundajad: Neeme Külm, Ralf Lõoke. Óskar Muñoze (Colombia), Ellie Daviesi (Suurbritannia), Andrew Raftery (USA), Kai Kuusingu ja Anu Kalmu töödest

  4. "Die Nato hat einen grossen Fehler begangen" / Toomas Hendrik Ilves ; interv. Ansgar Graw

    Index Scriptorium Estoniae

    Ilves, Toomas Hendrik, 1953-

    2008-01-01

    Eesti president räägib sõjalistest kokkupõrgetest Gruusias, vajadusest uue rahvusvahelise julgeolekustruktuuri järele, ootustest rahvusvahelise üldsuse suhtes, Balti riikide julgeolekust ning kritiseerib NATO otsust mitte anda Gruusiale NATO liikmelisuse tegevuskava

  5. Välismaalaste seaduses sätestatud töö- ja ettevõtlusrände regulatsiooni väärkasutamine Eestis ja äriseadustiku muudatuste mõju töö- ja ettevõtlusrände regulatsiooni väärkasutamisele : [magistritöö] / Laura Sofia Annus ; Tartu Üliko

    Index Scriptorium Estoniae

    Annus, Laura Sofia

    2012-01-01

    Välismaalase mõistest ja tähtajalise elamisloa regulatsioonist, ettevõtte asutamise regulatsioonist, töö- ja ettevõtlusrände regulatsiooni mitte-eesmärgipärasest kasutamisest ja lahendustest selle peatamiseks

  6. Mõte / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2008-01-01

    Riigikogu liige on arvamusel, et Euroopa haridus ei vaja mitte niivõrd omavahelist võistlust kuivõrd koostöö tugevdamist, ühtse haridusruumi loomist. Siiski peaks iga riik panustama endale sobiva hariduspoliitika ja haridussüsteemi määratlemisse

  7. Peeter Kreitzberg välistab koostöö reformiparteiga / Toomas Sildam

    Index Scriptorium Estoniae

    Sildam, Toomas, 1961-

    2003-01-01

    Peeter Kreitzberg nimetab ERL-i valitsusest lahkumise otsust arusaadavaks. Ta ei välista, et pärast Res Publica ja Reformierakonna vähemusvalitsuse lagunemist moodustub koalitsioon, kuhu võivad kuuluda mis tahes erakonnad, aga mitte Reformierakond

  8. Andrus Ansipi-Edgar Savisaare õppekava / Peeter Kreitzberg

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2005-01-01

    Ilmunud ka: Virumaa Nädalaleht 7. oktoober lk. 5. Riigikogu liige on seisukohal, et valitsuse juht ei tohi olla ankurdatud võimaliku mineviku külge, mis teeb võimatuks eetilise hinnangu andmise oma kabinetiliikmete tegudele. Autor rõhutab, et Eesti poliitiline areng ei sõltu mitte niivõrd õigusest, kuivõrd õiglusest, aususest ja otsekohesusest

  9. Uuring mõtestas usaldust poliitika vastu / Peeter Kreitzberg ; vahendas Argo Ideon

    Index Scriptorium Estoniae

    Kreitzberg, Peeter, 1948-2011

    2001-01-01

    Eesti elanike madal usaldus poliitika vastu ei käi mitte lihtsalt mõne isiku ja partei kohta, vaid hõlmab poliitikat kogu ulatuses, järeldasid sotsiaalteadlased septembris-oktoobris küsitletud tuhande inimese vastuseid analüüsides

  10. Enam kui pool eestlastest peab Rüütli otsust õigeks

    Index Scriptorium Estoniae

    2005-01-01

    President Arnold Rüütli otsust mitte sõita 9. mail Moskvasse peab õigeks 61 protsensti eestlastest ja kõigest 6,1 protsensti mitteeestlastest. Kommentaarid Tartu Ülikooli politoloogiaosakonna teadurilt Vello Pettai'lt ja sotsioloog Andrus Saar'elt

  11. Concordia pankrot selgub kuu lõpus

    Index Scriptorium Estoniae

    2003-01-01

    Harju maakohus otsustas 14. aprillil, et teatab 29. aprillil, kas kuulutab Concordia ülikooli pidanud osaühingu Concordia Varahaldus pankrotis olevaks või mitte. Concordia ülikool jätkas alates eilsest õppetööd Tallinna Pedagoogikaülikooli ruumides

  12. Presidendi mõjukus avaliku arvamuse silmade läbi / Marti Taru

    Index Scriptorium Estoniae

    Taru, Marti, 1970-

    2002-01-01

    Uuringu tulemusena selgus, et avaliku arvamuse silmis eristub president teistest riigijuhtidest just riigimehelikkuse poolest - president peaks olema ametiisik, kes seisab kogu ühiskonna arengu ja heaolu eest, mitte aga ei tegutse kitsaste kildkondade huve esindades. Tabelid. Lisa: Valimi sotsiaal-demograafiline kirjeldus lk. 253-256

  13. Rüütel declines May 9 Moscow invitation / Arnold Rüütel

    Index Scriptorium Estoniae

    Rüütel, Arnold, 1928-

    2005-01-01

    President Arnold Rüütli avaldus 7. märtsil 2005, milles ta teatab oma otsusest mitte vastu võtta kutset osaleda selle aasta 9. mail Suures Isamaasõjas saavutatud võidu 60. aastapäeva pidustustel Moskvas

  14. Tipptasemel infotehnoloogia, iidsete paleede ja kerjuste vabariik / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2005-01-01

    India majanduskasv oli 2003. aastal 8%, kuid sellest saavad osa vaid vähesed India elanikud. Põllumajanduse osakaalu vähenedes ei ole selle asemele tulnud mitte tööstus, vaid teenuste sektor. Riigi üks suurimaid probleeme on infrastruktuuri nõrkus. Andmeid kirjaoskuse, keskmise vanuse kohta. Lisa: Tata trügib sõiduautoturule

  15. Töökeskkonna ja nn leebe õiguse probleemid uutes liikmesriikides / Charles Woolfson

    Index Scriptorium Estoniae

    Woolfson, Charles

    2006-01-01

    Autori hinnangul sunnib Baltimaade elanikke välismaalt tööd otsima mitte ainult kõrgem palk, vaid kohalik töökeskkond, mida kujundavad kehval tasemel sotsiaalne dialoog ning halvad tööandjate ja -võtjate suhted

  16. Avalik kiri Euroopa tulevikust / Anthony Giddens, Ulrich Beck

    Index Scriptorium Estoniae

    Giddens, Anthony

    2005-01-01

    Autorid kutsuvad üles mõtlema Euroopa Liidust mitte kui "lõpetamata (rahvus)riigist" või "poolikust föderaalriigist", vaid pigem kui uuelaadsest kosmopoliitsest projektist. Kui Euroopa soovib, et teda maailmas kuulda võetaks, siis ei saa me deklareerida laienemise lõppemist ega loobuda EL-i juhtimismudeli muutmisest

  17. The path to railway liberalization / Vladimir Solomatin

    Index Scriptorium Estoniae

    Solomatin, Vladimir

    2005-01-01

    Autori arvates on Läti Raudtee restruktureerimise üheks eesmärgiks moodustada ettevõttest kolm kasu teenivat struktuuri. Kuigi ettevõtte restruktureerimine on majanduslikult kasulik võib see kaasa tuua inimeste vallandamise ning kasumit mitte teenivate osade kaotamise

  18. Uus sajand kulgeb keskkonnatähe all / Tarmo Virki

    Index Scriptorium Estoniae

    Virki, Tarmo

    2000-01-01

    Washingtonis asuva World-Watch-instituudi uusim aastaraport "State of the World 2000". Täna Tallinnas viibiv Worldwatch-instituudi juht Lester Brown on kindel, et 21. sajand kulgeb keskkonnaküsimuste, mitte majanduskasvu tähe all

  19. August välja küll, aga kunas ja kuidas? / Andres Arrak

    Index Scriptorium Estoniae

    Arrak, Andres, 1958-2017

    2009-01-01

    USA majandustsüklite uurija Victor Zarnowitz väidab, et järsule majanduslangusele järgneb kiire tõus. Autor leiab, et Eestit võimaldavad majanduskriisist välja tuua mitte ainult õiged otsused valitsussektoris, vaid ka erasektoris

  20. Kolleegide tunnustus

    Index Scriptorium Estoniae

    2010-01-01

    Teatri Vanemuine draamatrupp valis kolleegipreemiate laureaadid 2010. a. tööde põhjal. Naispeaosa auhinna sai Külliki Saldre, meespeaosa auhinna Aivar Tommingas, naiskõrvalosa auhinna Maarja Mitt, meeskõrvalosa auhinna Margus Jaanovits. Parim lavastus - Ingo Normeti "Huntluts"

  1. Eesti transpordi infrastruktuuri arendamise võimalused Soome lahe kasvukolmnurgas / Aare-Maldus Uustalu

    Index Scriptorium Estoniae

    Uustalu, Aare-Maldus, 1935-

    2002-01-01

    Kasut. kirj. lk. 80. - Kokkuvõte ingl. k. lk. 81-82. Soome lahe kasvukolmnurga rakendamise edukus Eestis sõltub mitte üksnes teadlaste panusest, vaid suurel määral riigiametnike töö kvaliteedist, nende suutlikkusest ja vastutustundest

  2. Läbi tantsu kasvame suureks pereks / Steven Toomela, Gert Erik ; interv. Regina Lilleorg

    Index Scriptorium Estoniae

    Toomela, Steven

    2006-01-01

    Vabariikliku noorte tantsijate X suvelaagri lõputööna etendub vabaõhumuusikal "Kaua võib" (stsenarist Rünno Karna, muusika autor ja projektijuht Kalle Erm, kunstnik Rait Potisepp, dirigent Hirvo Surva). Püünsi põhikooli tantsulapsed sellest, mis laagris meeltmööda ja mis mitte. Vastab ka laste õpetaja Hele Pomerants

  3. Vene meestel ei tasu eesti keele õppimine ära / Mikk Salu

    Index Scriptorium Estoniae

    Salu, Mikk, 1975-

    2011-01-01

    Tartu Ülikooli majandusteaduskonna vanemteaduri Ott Toometi poolt läbiviidud analüüsist selgub, et vene naistele toob eesti keele oskamine palgalisa, aga meestele mitte. Vastav teadusartikkel on ilmunud ka ajakirjas American Economic Review. Riigikogu liikme Jevgeni Ossinovski arvamus

  4. Русским мужчинам не резон учить эстонский / Микк Салу

    Index Scriptorium Estoniae

    Салу, Микк, 1975-

    2011-01-01

    Tartu Ülikooli majandusteaduskonna vanemteaduri Ott Toometi poolt läbiviidud analüüsist selgub, et vene naistele toob eesti keele oskamine palgalisa, aga meestele mitte. Vastav teadusartikkel on ilmunud ka ajakirjas American Economic Review. Riigikogu liikme Jevgeni Ossinovski arvamus

  5. Iraagis on surma saanud juba 2000 USA sõjaväelast / Kaivo Kopli

    Index Scriptorium Estoniae

    Kopli, Kaivo

    2005-01-01

    USA-s suri 2000. sõjaväelane Iraagis saadud haavadesse. Kui USA juhitud välismaiste relvajõudude esindaja Bagdadis kutsus meediat seda arvu mitte üle tähtsustama, siis USA meedia seevastu pidas seda just oluliseks märgiks. Diagrammid: Iraagi sõja inimkaotused

  6. Eesti venekeelsete noorte etniline identiteet / Elvira Küün

    Index Scriptorium Estoniae

    Küün, Elvira, 1980-

    2009-01-01

    Artiklis on kirjeldatud noorte mitte-eestlaste identiteedi kujunemise seost keelekeskkonna ja keelelise päritoluga. Võrreldud on üks- ja kakskeelsest perest pärit vene õppekeelega kooli lõpetanud noorte etnilist identiteeti Tallinnas ja Ida-Virumaal. Artikkel toetub autori magistritöö materjalile

  7. Collection Development "Mormonism": A Perfect Storm

    Science.gov (United States)

    Huff, Suzanne; Wadley, Laura

    2008-01-01

    This article talks about Mormonism, which has been sensationalized more often than most other religions. Since before the 2002 Winter Olympics in Salt Lake City and through Mitt Romney's run for the U.S. Presidency, an unprecedented number of news stories have been published about the Mormon faith. Historian Richard Bushman has termed the last…

  8. Rõivas: õppused tagavad rahu

    Index Scriptorium Estoniae

    2016-01-01

    Rahvusvahelise suurõppuse Saber Strike lõpurivistusel tunnustas peaminister Taavi Rõivas 10 000 liitlasväelase koostööd ning rõhutas, et nende kohalolek ja ühised õppused tähendavad Eesti rahva jaoks rahu tagamist, mitte sõja õhutamist

  9. OECD hinnang : Eestis ei ole kõigil võrdset ligipääsu kõrgharidusele / Kadri Ibrus

    Index Scriptorium Estoniae

    Ibrus, Kadri

    2007-01-01

    OECD eksperdid tegid ettepaneku, et Eesti võiks juurutada süsteemi, mille kohaselt maksavad kõik üliõpilased ise poole oma õppemaksust ja riik poole. Riik peaks rahalist tuge jaotama vastavalt vajadusele, mitte üksnes heade õppetulemuste eest. Haridus- ja teadusminister Tõnis Lukase seisukoht

  10. Review Essay: Spiegelneuronen in der sozialwissenschaftlichen Diskussion

    OpenAIRE

    Pätzold, Henning

    2010-01-01

    Seit ihrer Entdeckung Mitte der 1990er Jahre sind Spiegelneuronen kontinuierlicher Gegenstand neuro- wie sozialwissenschaftlicher Debatten. Das besondere Interesse von Wissenschaftler/innen außerhalb der biologischen Disziplinen beruht auch darauf, dass Spiegelneuronen nicht nur allgemeine erkenntnistheoretische Bedeutung haben, sondern auch im Zusammenhang mit fundamentalen sozialen Erkenntnis- und Empfindungsformen wie Empathie eine wichtige Rolle zu spielen scheinen. Mit dem Buch von Nadia...

  11. Saddam poodi muslimite mõnitamiseks / Ravil Khair Al-Din

    Index Scriptorium Estoniae

    Al-Din, Ravil Khair

    2007-01-01

    Autor avaldab arvamust, et Saddam Husseini kohtuotsuse eesmärk ei olnud mitte karistada kurjategijat, vaid näidata radikaalsete shiiitide võimu kogu islami kogukonna üle, Saddami hukkamisega rikuti usupüha tahtlikult, et provotseerida muslimeid

  12. Lõimumisega seotud hoiakud Eestis = Attitudes toward integration in Estonia / Eva-Maria Asari

    Index Scriptorium Estoniae

    Asari, Eva-Maria

    2009-01-01

    2008. aasta immigrantrahvastiku uuringu ning 2000., 2002., 2005. ja 2008. aasta integratsioonimonitooringu alusel antakse ülevaade mitte-eestlaste arusaamadest koostööks ja suhtlemiseks eestlastega, ustavusest Eesti riigile, osavõtust riigi juhtimises, identiteedist ja kodumaast. Joonised

  13. Head töötajad lahkuvad? / Timothy Butler, James Waldroop

    Index Scriptorium Estoniae

    Butler, Timothy

    2006-01-01

    Harvardi Ärikooli ärijuhtimisprogrammi juhid avaldasid 1999. aastal artikli "Job sculpting: the art of retaining your best people", milles väljendavad veendumust, et ärialal tegelevaid inimesi motiveerib tegutsema mitte raha, vaid eelkõige nende loomuomased vajadused

  14. USA andis Gruusiale vastakaid signaale / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2008-01-01

    USA välisministri Condoleezza Riceþi saabumisest Thbilisisse, et avaldada Gruusiale toetust. USA poolt antud soovitustest Gruusia president Mihhail Saakashvilile mitte jõudu kasutada ega alluda Venemaa provokatsioonidele ning hoiatustest sõjalise konflikti tagajärgede eest. USA analüütikute arvamusi

  15. Saksa abituurium Eestis : [Tallinna Saksa Gümnaasium] / Clemens Krause

    Index Scriptorium Estoniae

    Krause, Clemens Hermann, 1943-

    2002-01-01

    Gümnaasiumis on saksakeelne osakond, mille eesmärk on saksa abituurium. Komplitseeritud süsteemis, mis koosneb kohustuslikest ja valikainetest, kahe viimase aasta hinnetest ja eksamihinnetest, antakse punkte, mis kokku arvestatuna määravad, kas abituurium on sooritatud või mitte. See on kogu Euroopas ainulaadne mudel : eesti ja saksa abituurium on omavahel seotud

  16. Kapo nuusib moslemiperesid / Kattri Ezzoubi ; intervjueerinud Tiina Jõgeda ; kommenteerinud Andres Kahar

    Index Scriptorium Estoniae

    Ezzoubi, Kattri, 1969-2011

    2010-01-01

    Kaitsepolitsega koostööd teinud araabia keele ja islamimaade kultuuri õpetaja sõnul ei hoia kaitsepolitsei Eestisse abielu kaudu jõudnud moslemitel mitte ainult silma peal, vaid kutsub neid ka vestlusele kaitsepolitseiametisse. Tema hinnangul on kaitsepolitsei huviorbiidis kindlasti need, kellel on olnud pikemaajalisem kokkupuude mõne araabia riigiga

  17. Vaid "rikas" tallinlane saab toitu valida / Vesta Reest

    Index Scriptorium Estoniae

    Reest, Vesta, 1971-

    1999-01-01

    Eestis toodetud kaupa ostavad Eesti keskmisest jõukamad Tallinna elanikud, mitte kõik eestlased. Ilmunud ka: Molodjozh Estonii, 3. juuli 1999, lk. 10; Den za Dnjom, 9. juuli 1999, lk. 14-15; Vesti : Nedelja Pljuss, 1. juuli 1999, lk. 11

  18. Müügi õpetamine hoiab koolitajaid vee peal / Martin Hanson

    Index Scriptorium Estoniae

    Hanson, Martin, 1984-

    2008-01-01

    Koolitusfirmade juhtide sõnul ei ole majanduslangus koolitusfirmade tegevust mõjutanud, nõudlus müügikoolituse järgi on pigem suurenenud. Tabel: Koolitusfirmade käive on tõusmas. Vt. samas: Suurettevõtete kulud koolitusele on samad; Konverentsidele registreerutakse üksi, mitte gruppidega

  19. Rahvuse või kodanike riik? / Timothy Garton Ash ; intervjueerinud Ahto Lobjakas

    Index Scriptorium Estoniae

    Garton Ash, Timothy, 1955-

    2009-01-01

    Briti ajaloolane ja politoloog ei usu, et Euroopa Liidu mõistet saaks või tuleks eraldada Euroopa ajaloolisest, geograafilisest ja kultuurilisest järjepidevusest, ta eelistab eripartnerlust nii Türgi kui ka Venemaa puhul, aga mitte liikmestaatust

  20. Vabale turule pole alternatiivi / Johnny Munkhammar ; interv. Lillemägi, Peep

    Index Scriptorium Estoniae

    Munkhammar, Johnny

    2008-01-01

    Konverentsil Restart esinenud Rootsi majandusanalüütik ja kommentaator võrdleb praegust kriisi 1929. aasta omaga, tema arvates on tegu poliitikute möödalaskmistega, mitte turumajanduse läbikukkumistega. Nüüd oli vaja valitsuste sekkumist, kuid kaugemas perspektiivis pole valitsuste sekkumine turumehhanismide toimimisse õige

  1. The star-bright hour : [poems] / Betti Alver

    Index Scriptorium Estoniae

    Alver, Betti, 1906-1989

    2003-01-01

    Autori lühitutvustus lk. 231. Sisu: The star-bright hour ; The debt ; Not a dream ; Fog-bound ; Corals in an Ancient river ; Frou-frou 1-3. Orig.: Tähetund ; Vilepuhuja ; Võlg ; "Mitte viirastus, meelepett..." ; Udus ; Korallid Emajões ; Froufrou 1-3

  2. Kultuuritus : kultuurivaba päev : Tallinn 20.11

    Index Scriptorium Estoniae

    Aas, Mart

    2009-01-01

    Lühivisiit Sloveenia väikelinna Pirani, kus kultuurielus midagi ei toimu, ajendas autori mõttele kultuurivabast päevast Tallinnas 2011. a., et teadvustada loomingulisuse ja kultuuri vajalikkust mitte pseudo- või asendustegevusena, vaid loomuliku inimtegevusena

  3. Directori ülesanne : Kangekaelsed alluvad / Marko Rillo

    Index Scriptorium Estoniae

    Rillo, Marko

    2007-01-01

    Ettevõtte juhi ja alluvate vahelistest probleemidest. Lahendusi kaasusele pakuvad Kalev Chocolate Factory AS-i juhatuse esimees Kati Kusmin: Rohkem usku iseendasse; firma Meeskonnakoolituse juhtimistreener-konsultant Ülo Vihma: Varem või hiljem saavutame ikka oma ebakompetentsuse taseme!; internetifirma Bookinghouse asutaja ja juht Andres Liinat: Oskused on õpitavad - isikuomadused mitte

  4. Kullapalavik naftaturul / Tõnis Oja

    Index Scriptorium Estoniae

    Oja, Tõnis, 1957-

    2006-01-01

    Ilmunud ka: Delovõje Vedomosti 26. apr. lk. 25. Nafta hinna seitsmekordne tõus seitsme aasta jooksul on tingitud mitte niivõrd nõudlusest füüsilise nafta järele, vaid nõudlusest nafta kui investeerimisobjekti ehk virtuaalnafta järele. Vt. samas: Toormehinna lagi on üsna madal

  5. Milles avaldub uus haldusjuhtimine? / Jaanus Kiili

    Index Scriptorium Estoniae

    Kiili, Jaanus, 1958-

    2003-01-01

    Uus juhtimise (haldamise) paradigma vaatleb kaost ja komplekssust mitte lahendamist vajava probleemina, vaid selle protsessi sisulise aspektina, millega elussüsteemid kohastuvad, uuenevad, säilitavad ja ületavad neid läbi iseorganiseerumise, väidab autor

  6. Performance Characteristics of Plane Wall Two Dimensional Diffusers

    Science.gov (United States)

    1953-02-01

    die Umsetzung von Wässergeschwindigkeit in Druck . Mitt. Forsch.-Arb. Geb. Ing.-Wes., Heft 76, 1909. k6 NACA TN 2888 12. Hochschild, Heinrich...Wi 0 2/ .75 ■ /5.2s A //.00 D 7.75 • 5. 3D & \\\\ /2 /e Z d, &&3 20 24 Figure 15.- Variation of pressure efficiency with divergence angle

  7. Päästke mööbel! / Marko Rillo

    Index Scriptorium Estoniae

    Rillo, Marko

    2006-01-01

    Näide üle-eestilise juhtimiskonkursi "Juhtimisaju 2006" ühest ülesandest ning võistkonna "Mõistuse hääl" probleemilahendus. Lisa: Ülesanne; Vt. samas: Kas tankis põlenud poiste aeg pole mitte läbi? Lisa: Teinto Furniture'i SWOT analüüs

  8. Musgos pleurocárpicos dos fragmentos de Mata Atlântica da Reserva Ecológica da Michelin, município de Igrapiúna, BA, Brasil: II - Hypnales (Bryophyta: Bryopsida Pleurocarpous mosses from Atlantic Forest fragments at the Michelin Ecological Reserve, Igrapiúna County, Bahia State Brazil: II - Hypnales (Bryophyta: Bryopsida

    Directory of Open Access Journals (Sweden)

    Silvana B. Vilas Bôas-Bastos

    2009-09-01

    Full Text Available Durante os estudos brioflorísticos realizados na Reserva Ecológica da Michelin, foram identificadas 37 espécies de Hypnales pertencentes a 10 famílias. Sematophyllaceae e Pylaisiadelphaceae contribuíram com o maior número de espécies, 10 e sete, respectivamente, seguidas de Neckeraceae com seis. Taxithelium planum (Brid. Mitt. e Sematophyllum subsimplex (Hedw. Mitt. foram as espécies com maior ocorrência na área de estudo, 78 e 54 ocorrências, respectivamente. Estão sendo apresentadas chaves de identificação para os gêneros, distribuição geográfica, espectro ecológico e comentários para as espécies.During a bryofloristic study at the Michelin Ecological Reserve, 37 species were identified belonging to 10 families. Sematophyllaceae and Pylaisiadelphaceae were the most species-rich families, 10 and seven, respectively, followed by Neckeraceae with six species. Taxithelium planum (Brid. Mitt. and Sematophyllum subsimplex (Hedw. Mitt. were common, with 78 and 54 occurrences, respectively. An identification key to the genera, geographic distribution, ecological spectrum and comments on the species are provided.

  9. Näljane vaim : sihi otsimine kaasaegses maailmas / Charles Handy

    Index Scriptorium Estoniae

    Handy, Charles

    2002-01-01

    Kapitalistlik ühiskond ja raha on vahendid, mitte eesmärgid; eesmärgid peaks iga inimene püstitama endale ise, lähtuvalt oma sisetunnetusest. Lühendatud tõlge Charles Handy raamatust - "The Hungry Spirit Beyond Capitalism - a Quest of Purpose in the Modern World"

  10. Järgmisel aastal pannakse mehitamata autode võimed linnas proovile / Erik Aru

    Index Scriptorium Estoniae

    Aru, Erik

    2006-01-01

    Defense Advanced Research Projects Agency korraldab 2007. aastal kolmandat korda ilma juhita autode võistluse. Projekti Grand Challenge raames pannakse ilma juhita autod sõitma esmakordselt linnas, küll mitte reaalses, vaid USA lääneosas loodud tehislinnas

  11. Haiti ja saatan / Mihhail Lotman

    Index Scriptorium Estoniae

    Lotman, Mihhail, 1952-

    2010-01-01

    Haiti maavärinas on süüdistatud nii USA-d kui ka üleloomulikke jõude. Vastuseks Abdul Turay artiklile "Kustutage haitilaste võlg!" ütleb autor, et päästetööd Haitil takerduvad mitte valitsuse rahapuudusesse, vaid olematusse infrastruktuuri

  12. Palts ja Peek seljatasid maksuameti / Lauri Linnamäe

    Index Scriptorium Estoniae

    Linnamäe, Lauri

    2007-01-01

    Riigikohtu otsus maksuameti edasikaebust mitte arutada ja jätta jõusse Tallinna ringkonnakohtu otsus võttis Tõnis Paltsult ja Toomas Peegilt maksupetturluse süüdistuse seoses sidefirma AS Levicomi müügiga Tele2 kontsernile. Lisatud: kas teate?

  13. Palts ja Peek kulutasid advokaatidele ligi miljoni

    Index Scriptorium Estoniae

    2007-01-01

    Riigikohtu otsus maksuameti edasikaebust mitte arutada ja jätta jõusse Tallinna ringkonnakohtu otsus võttis Tõnis Paltsult ja Toomas Peekilt maksupetturluse süüdistuse seoses sidefirma AS Levicomi müügiga Tele 2 AB kontsernile

  14. Estonian sugar mountain turns sour / Alec Charles

    Index Scriptorium Estoniae

    Charles, Alec

    2005-01-01

    Eesti valitsus jätkab võitlust Euroopa Komisjoniga, et mitte maksta 55 miljonit eurot trahvi suhkru ladustamise eest. Peaminister Juhan Parts saatis Euroopa Komisjoni presidendile Jose Manuel Barrosole kirja, milles palus trahvi nõudmise suhtes järele mõelda.

  15. Theorien der Videokunst

    DEFF Research Database (Denmark)

    Decker-Phillips, Edith; Lemke, Inga; Bruns, Karin

    ¨ sterreich und der Schweiz, die seit Mitte der 1980er Jahre entstanden sind und den Begriff des Mediums Video bestimmen, erweitern, die spezifische Leistung der Videokunst deuten oder ihre Systematik und Historisierung versuchen. Es finden Texte Ber¨ ucksichtigung, die den sich ver¨andernden Gebrauch des...

  16. Rebenev Euroopa / Petra Pinzler

    Index Scriptorium Estoniae

    Pinzler, Petra

    2005-01-01

    Ajalehe Die Zeit korrespondendi sõnul ei ole EL-i kodanikud mitte kunagi varem olnud EL-i suhtes nii tõrjuvad kui praegu, hävitavalt mõjub ühise identiteedi puudumine, paljudele ei meeldi suund, mille Euroopa on võtnud

  17. Puukunst meelitas toksijad mini-Pärnusse / Grete Naaber

    Index Scriptorium Estoniae

    Naaber, Grete, 1942-

    2001-01-01

    Pärnus Vallkikääru taga valmistasid viie riigi esindajad puuskulptuure: inglane Mark Croxford, ukrainlane Petro Komantshuk, lätlane Juris Osis, eestlased Heiki Kongi, Kuldar Moor, Igor Kurov, Ormar Tamm, Toomas Mitt, külalisi oli ka Venemaalt ja Leedust. 29. juunil korraldatakse skulptuuride oksjon

  18. Argument ÜRO vastu / Joshua Muravchik

    Index Scriptorium Estoniae

    Muravchik, Joshua

    2004-01-01

    ÜRO rollist Somaalias, Rwandas ja Bosnias, Iisraeli eristaatusest. ÜRO silmakirjalikkusest inimõiguste alal, terrorismi legaliseerimisest, Kofi Annani juhtimisstiilist. Maailmas on pärast 1945. aastat valitsenud suhteline rahu mitte tänu ÜRO-le, vaid peamiselt USA tegevusele, leiab autor

  19. Naiste staatus meie meeles ja igapäevases keeles / Ülle-Marike Papp

    Index Scriptorium Estoniae

    Papp, Ülle-Marike

    2003-01-01

    Autor leiab, et inimõiguste sisu on viimase 50 aasta jooksul muutunud ja meie noorel ühiskonnal on raske aru saada, et eksisteerivad naiste inimõigused, mida järjekindlalt rikutakse patriarhaalse ühiskonnakorralduse, mitte konkreetsete meeste poolt

  20. Viimane valik / Malcolm Bull ; tõlk. Märt Väljataga

    Index Scriptorium Estoniae

    Bull, Malcolm

    2006-01-01

    Genotsiidi defineerimisest, Michael Manni ja Marc Levene'i definitsioonidest, "Sündsast genotsiidist", "seadusevastastest" rahvastest, "ülimast eriolukorrast". Genotsiidist kui uusaegsest nähtusest, genotsiidi toimumise tingimustest, demokraatia ja genotsiidi seostest, inimkonna "egalitaarsest revolutsioonist". Kuna kohustuste omamine ilma õigusteta paistab olevat parim kaitse genotsiidi vastu, võib orjus või genotsiid olla viimane, ehkki kaugeltki mitte ahvatlev valik

  1. Res Publica nõuab rea võimulubaduste täitmist / Rasmus Kagge

    Index Scriptorium Estoniae

    Kagge, Rasmus, 1977-

    2005-01-01

    Res Publica lubas koalitsioonipartneritele mitte minna koalitsioonileppe kallale, kui nad toetavad toppama jäänud lubaduste täitmist - haridusreformi, presidendi otsevalimiste seadustamist, riigikontrollile ka omavalitsuste kontrollimiseks õiguse andmist ja lapsevanema tulumaksuvaba miinimumi kahekordistamist alates pere teisest lapsest. Lisa: Võimuliitlaste soovid

  2. Outlooki grupitöö ühendab ka eri kontorid / Kuldar Kullasepp

    Index Scriptorium Estoniae

    Kullasepp, Kuldar, 1980-

    2004-01-01

    Microsofti Internet Free/Busy Service võimaldab koosoleku aega planeerides töökaaslaste kalendrist näha, millal nad on hõivatud ja millal mitte. Skeem: Veebiliides ühendab arvutid. Lisa: Outlooki grupitöölahenduse plussid; Outlooki grupitöölahenduse miinused

  3. Kas praktikant on ettevõttes teretulnud? / Valev Mägi, Hedi Hepner, Aku Sorainen ... [jt.

    Index Scriptorium Estoniae

    2009-01-01

    Küsimusele vastavad: Mainori Kõrgkooli üliõpilasesinduse esimees Valev Mägi, Tartu Ülikooli õigusteaduskonna üliõpilane Hedi Hepner, Advokaadibüroo Sorainen juhtiv partner Aku Sorainen, Swedbanki personali planeerimise ja arendamise osakonna juhataja Signe Vaks-Saareoja, Lääne maasekretär Epp Mitt

  4. Bush mõistis hukka moslemite vägivaldsed meeleavaldused / Kaarel Kaas

    Index Scriptorium Estoniae

    Kaas, Kaarel, 1978-

    2006-01-01

    USA president Georg W. Bush ja välisminister Condoleezza Rice mõistavad hukka moslemite vägivaldsed meeleavaldused, kuid mitte nende ajendiks olnud Muhamedi pilavad karikatuurid ning leiavad, et Iraan ja Süüria kasutavad pilapiltide skandaali oma poliitiliste eesmärkide saavutamiseks

  5. Läti kultuurileht ilmub siiski!

    Index Scriptorium Estoniae

    2002-01-01

    Pärast veebruari alguses Läti Kultuuriministeeriumi ja Kultuurkapitali Fondi tehtud otsust, mitte rahastada kultuurilehte Literatura un Maksla Latvija, puhkes väljaande ilmumist pooldav toetuste laine. 14. veebruari leht tänab toetuse eest ja teatab edasiilmumisest.

  6. Editorial

    Directory of Open Access Journals (Sweden)

    Gregor Busslinger

    2010-12-01

    Anmerkung 1 Das EPZ existierte bis Mitte 2005. Zur Wegrationalisierung des EPZ vgl. Schär Sall und Burtscher (2006: Ethnopsychoanalyse im EthnologischPsychologischen Zentrum (EPZ der AsylOrganisation Zürich. Ein ethnopsychologischer Selbstversuch im Journal für Psychoanalyse, 47: 67–85. Journal für Psychoanalyse 51

  7. Investori otsimist tuleb käsitleda turundusprojektina

    Index Scriptorium Estoniae

    2009-01-01

    Väike- ja keskmist ettevõtlust edendav organisatsioon SME Financing Data Initiative hinnangul ei tohiks investorit otsivad ettevõtjad keskenduda mitte üksnes oma ettevõtte finants- või majandusnäitajatele, vaid peaksid investori otsimisse suhtuma kui turunduslikku projekti ning käsitlema potentsiaalseid investoreid kui tarbijaid

  8. Поиск инвестора надо рассматривать как маркетинговый проект

    Index Scriptorium Estoniae

    2009-01-01

    Väike- ja keskmist ettevõtlust edendav organisatsioon SME Financing Data Initiative hinnangul ei tohiks investorit otsivad ettevõtjad keskenduda mitte üksnes oma ettevõtte finants- või majandusnäitajatele, vaid peaksid investori otsimisse suhtuma kui turunduslikku projekti ning käsitlema potentsiaalseid investoreid kui tarbijaid

  9. Kes teid toidab, kui olete üle 60? / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister, 1977-

    2004-01-01

    Euroopa elanikkond võib vaatamata sellele, et inimesed elavad kauem, aastaks 2050 väheneda praeguselt 455 miljonilt 430 miljonile. Paindlik pensionileminek aitaks tõrjuda vanurite sotsiaalset marginaliseerumist, anda üle aastakümnetepikkusi kogemusi ning valmistada ettevõtteid ette põlvkondade vahetuseks. Lisad: Pensionäride ülalpidamine kallineb; Elatustase; Vanadus; Mitte ainult raha...

  10. Piraatlus Guinea lahes ja Nigeerias / Eero Tepp

    Index Scriptorium Estoniae

    Tepp, Eero

    2013-01-01

    Guinea lahes lokkava piraatluse põhjused ja tegurid, mis seda soodustavad: seaduselüngad, looduslikud tingimused, ebapädev korrakaitse, poliitiline olustik, kultuuriline vastuvõetavus, majanduslik tasuvus. Sõjalised ja mittesõjalised meetmetest, mida rakendatakse piraatlusevastases võitluses

  11. Pahupidi presidendikampaania / Jaak Allik

    Index Scriptorium Estoniae

    Allik, Jaak, 1946-

    2006-01-01

    Autor leiab, et Tarvastu vallavolikogu koalitsiooni otsus presidendivalimistel Arnold Rüütlit mitte toetada on teatud erakondade negatiivne valimiskampaania. Ilmunud ka Põhjarannik, 2006/Apr/20, lk. 2 ; Meie Maa, 2006/Apr/20, lk. 2 ; Vooremaa, 2006/Apr/20, lk. 2 ; Sakala, 2006/Apr/18, lk. 2 ; Severnoje Poberezhje, 2006/Apr/20, lk. 2

  12. Araabia isad ja pojad / Volker Perthes

    Index Scriptorium Estoniae

    Perthes, Volker

    2005-01-01

    Ilmunud ka: Molodjozh Estonii 11. jaan. lk. 11. Ühe põlvkonna eliidi järkjärguline vahetumine teisega võib olla üks võtmefaktoreid otsustamaks, kas araabia maailmas leiavad aset tõhusad reformid või mitte. Erinevatest põlvkondadest ja liidritest. Lisa: Riigijuhtide generatsioonid

  13. Eliidi kesksusest / Fredo Arias-King ; tõlk. Riita-Ilona Märka

    Index Scriptorium Estoniae

    Arias-King, Fredo

    2003-01-01

    Eliidi- ja juhtimisteooria ei pruugi seletada, miks ühes riigis tekkis demokraatia ja teises mitte, kuid ta näitab põhjuseid, miks mõnes postkommunistlikus riigis toimus edukas üleminek demokraatiale või turumajandusele, teises see aga ebaõnnestus. Tabelid. Tõlgitud käsikirjast "The centrality of elites"

  14. Partsi otsus Langi kohta määrab valitsuse saatuse / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli

    2005-01-01

    Peaministri otsus, kas esitada Rein Lang välisministri kandidaadiks või mitte, osutub valitsuskriisi võtmeküsimuseks. Peaminister peab vajalikuks veel kord kandidaadiga kohtuda. Vt. samas lühiintervjuud Rein Langiga. Kommenteerivad politoloog Kaido Jaanson, MK Estonija peatoimetaja Pavel Ivanov ja Euroopa Parlamendi liige Marianne Mikko

  15. Villu Reiljan sekkub Looduse Fondi projektide rahastamisse / Tarmo Õuemaa

    Index Scriptorium Estoniae

    Õuemaa, Tarmo, 1975-

    2003-01-01

    Keskkonnaministeerium soovitab Keskkonnainvesteeringute Keskusel (KIK) mitte rahastada 7 Eestimaa Looduse Fondi (ELF) projekti, mis on saanud KIK ekspertidelt kõrge hinnangu, ja 2 Rohelise Liikumise projekti. ELF-i tegevjuht Toomas Trapido näeb selle põhjusena ELF-i ja Rohelise Liikumise aktiivset tegevust

  16. Kahtlejate osakaal on kasvanud 44 protsendile / Kärt Anvelt ; kommenteerinud Kalev Petti

    Index Scriptorium Estoniae

    Anvelt, Kärt, 1973-

    2011-01-01

    Autor käsitleb viimaseid valimiste-eelseid küsitlusuuringuid ning märgib, et kahtlejaid on enim endiste Reformierakonna toetajate seas ning valimiste tulemuse seisukohalt näib olevat võtmeküsimus, kas Reformierakonna valija taastab oma eelistuse ja tuleb valima või mitte. Diagrammid, graafikud

  17. Uus Eesti lugu: heade uudisteta? / Edward Lucas ; tõlkinud Janek Salme

    Index Scriptorium Estoniae

    Lucas, Edward, 1962-

    2009-01-01

    Autor leiab, et Eesti peab pärast eurotsooniga liitumist keskenduma rohkem elukvaliteedile, mitte raha hulgale. Tuleb panna rõhku Eestile kui riigile, mis on avatud väljastpoolt tulevatele talentidele ja ideedele, ning lõpetada avaliku teenistuse politiseerimine

  18. The hard reality of soft privatisations : social responsibility in a shifting industry / Stephan Cludts

    Index Scriptorium Estoniae

    Cludts, Stephan

    2001-01-01

    Ühiskondlikust vastutusest äris: ettevõtete sotsiaalne kohus on taotleda maksimaalset heaolu, mitte maksimaalset kasumit. Belgacomi näitel tõestatakse, et riik ei ole hea omanik, sest sel juhul ei täida ta järelvalve funktsiooni

  19. Putini ja Medvedevi vahele tekib järjest rohkem ruumi / Jaanus Piirsalu

    Index Scriptorium Estoniae

    Piirsalu, Jaanus, 1973-

    2010-01-01

    Vene politoloogi Olga Krõštanovskaja hinnangul tunnetatakse Venemaal, et tekkimas on n.-ö. toetusgrupp nimelt Dmitri Medvedevile, mitte Putini-Medvedevi tandemile. Poliitikavaatleja Nikolai Svanidze hinnangul on ajakirjandus Venemaal muutunud veidi vabamaks. Märgata on avalikku kriitikat Vladimir Putini ja võimupartei Ühtne Venemaa kohta

  20. Mõnede eesti sõnajärjemallide psühholingvistilisest reaalsusest / Annekatrin Kaivapalu

    Index Scriptorium Estoniae

    Kaivapalu, Annekatrin, 1963-

    2010-01-01

    Eesti vahekeele korpuse põhjal selgitatakse, milliseid sõnajärjemalle peetakse loomulikeks ja milliseid mitte, et tulemuste põhjal kirjeldada mõnede eesti keele sõnajärjemallide psühholingvistilist reaalsust ning määratleda sõnajärjevigade prioriteetsus

  1. Hüdroenergia pole roheline / Toomas Kukk

    Index Scriptorium Estoniae

    Kukk, Toomas, 1971-

    2007-01-01

    Euroopa Komisjonile sisevete kalanduse osas nõu andev organ EIFAC soovitas 2006. aastal väikesemahulist hüdroenergia tootmist mitte käsitleda rohelise energiana, samasse kategooriasse kuuluvad kõik Eesti hüdroelektrijaamad

  2. Kas töötukassa soovitab lapsed CV-st välja jätta? / Mari Kodres

    Index Scriptorium Estoniae

    Kodres, Mari

    2010-01-01

    Karjäärinõustaja Tiina Saare väitel selgus vestlusest töötukassa ühe konsultandiga, et töötukassa klientidel soovitatakse lapsi elulookirjeldusse mitte märkida. Töötukassa nõustamisteenuste ala teenustejuhi Lana Randaru selgitus

  3. Saksamaal võidab toetust utoopia : raha jagamine ilma tööta / Külli-Riin Tigasson

    Index Scriptorium Estoniae

    Tigasson, Külli-Riin, 1975-

    2007-01-01

    Saksamaal toetavad mitmed poliitikud utoopilist ideed: ära kaotada kõik sotsiaaltoetused ning asendada need 700-1500-eurose riikliku kuusissetulekuga, mida makstaks kõigile Saksa kodanikele, sõltumata sellest, kas nad töötavad või mitte. Vt. samas: Kas Milton Friedman eksis?

  4. Visioon Eestist / Ramon Loik

    Index Scriptorium Estoniae

    Loik, Ramon

    2006-01-01

    Autor leiab, et Eestis tuleb presidendivalimiste eel vastutustundlikult arutleda sisuliste väärtuste ja visioonide, mitte aga võimalike hääletuskombinatsioonide üle. Presidendikandidaatide mõtete baasil on võimalik kujundada ühiskonnale humanistlik ja tasakaalustatud visioon, millest tulevane president oma töös võiks lähtuda

  5. Kuupäev ja ajastu / David Vseviov

    Index Scriptorium Estoniae

    Vseviov, David, 1949-

    2009-01-01

    11. septembri sündmustest. Mentaliteeti ja inimsuhteid kardinaalselt muutvad sündmused ei leia aset mitte kindlatel kuupäevadel, vaid kümnete ja mõnikord isegi sadade aastate jooksul. Oluline põhimõtteline muutus toimus 19. sajandi lõpus kui tapmise ainsaks "mõistlikuks" põhjenduseks sai ideoloogia

  6. The cellular wall role of different mosses species in Cs 137 sorption

    International Nuclear Information System (INIS)

    Sobchenko, V.A.; Khramchenkova, O.M.; Perevolockij, A.N.

    2001-01-01

    In studying experiment with live and modified mosses (Pleurozium schreberi (Brid.) Mitt., Dicranum polysetum Sw., Hylocomium splendens (Hedw.) B.S.G. and Ptilium crista-castrensis (Hedw.) De Not.) had shown the cellular wall main role in Cs 137 sorption

  7. 1914. aasta "oleskid" / Robert Cowley

    Index Scriptorium Estoniae

    Cowley, Robert

    2003-01-01

    Esimesest Maailmasõjast, mis pidanuks jääma toimumata. Samal teemal : Chace, James. Bismarcki impeerium sünnib surnult, lk. 288-289 ; Large, David Clay. Tänan, ainult mitte sigarit, lk. 290-291 ; Showalter, Dennis E. Meeleheitevaherahu, lk. 292-293

  8. Reality show'd : teletööstuse päästerõngas / Neeme Raud

    Index Scriptorium Estoniae

    Raud, Neeme, 1969-

    2005-01-01

    Formaaditelevisioon tagab teleärimeestele praegustel majanduslikult ebakindlatel aegadel, kus reklaamiraha hulk teletööstuses on vähenenud ja telekanalite hulk suurenenud, suuri tulusid. Tõsielutelevisiooni arengust USA-s, selle populaarsuse põhjustest. Lisad: Fakte. Vt. samas: Eurosaavutus : seekord mitte Ameerikast!

  9. Pobeda s pomoshtshju opija v Afganistane / Raymond Kendall, Norine MacDonald ; tõlk. Jevgenija Unanjants

    Index Scriptorium Estoniae

    Kendall, Raymond

    2007-01-01

    Autorid on seisukohal, et oopiumi hävitamine Afganistanis ei too probleemile lahendust. Oopiumi litsentseeritud tootmine ei võimaldaks lahendada mitte üksnes vaesuse ja nälja probleemi riigi lõunaosas, vaid ka stabiliseeriks kohalikke struktuure

  10. Mosses new to Hong Kong (4)

    OpenAIRE

    So, M.L.

    1995-01-01

    Sixteen moss species - Eurhynchium asperisetum (C. Muell.) Tak.; Rhynchostegium pallidifolium (Mitt.) Jaeg.; Bryum argenteum Hedw.; Bryum caespiticium Hedw.; Bryum capillare Hedw.; Platyhynidium riarioides (Hedw.) Dix.; Dicranella varia (Hedw.) Schimp.;Entodon virudulus Card.; Fissidens strictulus C. Muell.; Ectropothecium obtusulum (Card.) Iwats.; Caduciella guangdongensis Enroth.; Plagiomnium cuspidatum (Hedw.) T. Kop.; Plagiomnium vesicatum (Besch.) T. Kop.; Pyrrhobryum spiniforme (Hedw.) ...

  11. Meeskonnakoolitus vs individuaalkoolitus / Mariel Gregor

    Index Scriptorium Estoniae

    Gregor, Mariel

    2007-01-01

    Ülo Vihma ja Kristel Jalak individuaalsest ja meeskondlikust koolitusest. Mis räägib meeskondliku koolituse kasuks. K. Jalaku hinnangul peaks hea koolitusprogramm olema kombineeritud mõlemast koolitusviisist, kus üks täiendab teist, mitte ei asenda

  12. President Ilves andis iseseisvuse taastamise mälestuskivi kunstnik Heinz Valgule / Kristel Peterson

    Index Scriptorium Estoniae

    Peterson, Kristel

    2007-01-01

    President Toomas Hendrik Ilves andis 20. augustil 2007 Kadriorus kultuuritegelastele korraldatud vastuvõtul Eesti iseseisvuse taastamise mälestuskivi kunstnik Heinz Valgule. Riigipea rõhutas oma kõnes, et 20. augustit tuleks nimetada just iseseisvuse taastamise aastapäevaks ja mitte taasiseseisvumise päevaks

  13. Majade igavik = Perpetuity of buildings / Tõnu Õnnepalu

    Index Scriptorium Estoniae

    Õnnepalu, Tõnu, 1962-

    2012-01-01

    Majade juures ei ole igavene mitte maja ise, vaid tema asukoht ja otstarve. Stiil, kui rääkida majadest, on autori sõnul koha ja otstarbe ajatuse tunnetamine. Kõik, mis langeb stiilist välja, langeb või lükatakse varem või hiljem kokku

  14. Pakistan vajab abi - kas maailma tõesti ei huvita? / Urmas Jaagant

    Index Scriptorium Estoniae

    Suurkask, Heiki, 1972-

    2010-01-01

    Pakistan saab igal aastal suurt rahvusvahelist abi. Mitmed riigid on üleujutustes Pakistani toetanud nüüdki kümnete miljonite dollaritega, kuid riikide tahe annetada on erinev, sest mitte iga abidollarit ei suunata Pakistanis sinna, kus seda tegelikult vajatakse

  15. Gaasitoru rajaja Nord Stream : jätkame läbirääkimisi Soomega / Tuuli Koch

    Index Scriptorium Estoniae

    Koch, Tuuli

    2007-01-01

    Eesti valitsuse otsus mitte anda Nord Streamile uurimisluba tekitas Soome keskkonnaametnikes pahameelt. Nord Stream AG esindaja Jens D. Mülleri sõnul jätkatakse torujuhtme projekti. Välispoliitika Instituudi direktori Andres Kasekampi arvates laskis Eesti käest kaasarääkimise õiguse

  16. [Immunogenicity and protective efficacy of pertactin recombinants against Bordetella bronchiseptica challenge].

    Science.gov (United States)

    Zhao, Zhanqin; Wang, Chen; Xue, Yun; Ding, Ke; Zhang, Chunjie; Cheng, Xiangchao; Li, Yinju; Liu, Yichen; Wu, Tingcai

    2010-09-01

    In this study we showed the immunogenicity and protective efficacy of five pertactin recombinants against Bordetella bronchiseptica (Bb) challenge. The complete coding sequence (2040 bp) of the prn gene (PRN) and its fragments,5'-terminal 1173 bp fragment (PN),3'-terminal 867 bp fragment (PC), two copies of region I (654 bp; PR I) in PN, and 2 copies of region II (678 bp; PR II) in PC, were separately cloned into the prokaryotic expression vector pGEX-KG, and expressed in the Eschierichia coli BL21 (DE3) using induction by isopropyl-beta-D-thiogalactopyranoside. The recombinant proteins were named GST-PRN, GST-PN, GST-PC, GST-2PR I and GST-2PR II. All five recombinant proteins showed immunological reactivity in the Western-blot analysis. Mice, immunized subcutaneously with two doses of the purified proteins mixed with an equal volume of Freund's adjuvant,produced robust PRN-specific IgG antibody levels. When challenged, 6 of 9 mice in GST-2PR I group and all 9 mice in the other groups survived intranasal challenge with three times the 50% lethal dose (LD50) of virulent Bb HH0809. After challenge with 10 LD50 7/9,3/9,6/9,1/10 and 6/10 of the mice survived. Furthermore, complete protection against intraperitoneal (i.p.) challenge with 10 LD50 of HH0809 was observed in mice that were injected i.p. with 0.5 ml rabbit anti-GST-PRN, GST-PN,GST-PC or GST-2PR II serum. Only 1 of 10 mice survived in the group of mice that received anti-GST-2PR I, and no survivors were noted in the group of mice that received PRN-absorbed rabbit antiserum (0/5). In this study,we showed that all of five pertactin recombinants had differential immunogenicity and protective efficacy against Bb challenge. Mice immunized with GST-PC had better survival against fatal Bb challenge than did those immunized with GST-PN. In addition, GST-2PR II and GST-2PR I provided the similar results These data may have implications for the development of safe and efficacious subunit vaccines for the prevention of

  17. Comparison of indirect immunofluorescence test for measles antibodies with haemagglutination inhibition and plaque neutralization tests Comparação da reação de imunofluorescência indireta para o vírus do sarampo com as reações de inibição da hemaglutinação e neutralização por redução de placas

    Directory of Open Access Journals (Sweden)

    Vanda Akico Ueda Fick de Souza

    1990-10-01

    Full Text Available Indirect Immunofluorescence (IFA, Plaque Reduction Neutralization (PRN and Haemagglutination Inhibition (HI tests for measles antibodies were carried out in 197 sera obtained from umbilical cord and vaccinated children. The IFA was also applied to blood samples collected with filter paper. IFA results demonstrated that the test is relatively simple to perform, with good reproducibility for different antigen lots. Good correlation was obtained between IFA, PRN and HI antibody titers. Better correlation was demonstrated with IFA and PRN than with HI and PRN tests. Sensitivity of IFA in detecting antibody was less effective than PRN, however more effective than HI using rhesus monkey red blood cells. PRN antibody titers over 100 were detected by IFA but not by HI (9.7% with negative results. IFA may be of considerable practical use and able to substitute HI in Seroepidemiological surveys and to evaluate vaccine efficacy. It also can be simplified by employing filter paper collected samples.As reações de imunofluorescência indireta (RIF, neutralização por redução de placas (RNP e inibição da hemaglutinação (RIH para detecção de anticorpos para o vírus do sarampo foram aplicadas a 197 soros provenientes de cordão umbilical e de crianças vacinadas contra o sarampo. Avaliou-se ainda a aplicação da RIF em amostras colhidas em papel de filtro. A RIF apresentou-se como uma prova de execução relativamente simples, de boa reprodutibilidade com diferentes partidas de antígeno. Observou-se boa correlação entre os títulos de anticorpos obtidos por RIF, RNP e RIH. Com a RNP, a RIF apresentou maior correlação que a RIH. A sensibilidade da RIF na detecção de anticorpos contra o sarampo foi menor que RNP, porém superior à da RIH com hemácias de macaco rhesus. Anticorpos com títulos superiores a 100 pela RNP foram sistematicamente detectados pela RIF, mas não por RIH (9,7% de resultados negativos. A RIF pode ser de grande utilidade

  18. Unprecedented Proline-Based Heterogeneous Organocatalyst for Selective Production of Vanillin

    Directory of Open Access Journals (Sweden)

    Farveh Saberi

    2018-04-01

    Full Text Available An organocatalytic system based on an unprecedented proline analogue and iron oxide magnetic nanoparticles (Prn/Fe2O3@SiO2 was designed and employed in vanillin production from isoeugenol and vanillyl alcohol. Full characterization of the obtained catalyst revealed the successful functionalization of the nanoparticle surface with the organic moieties. The activity of the magnetic bifunctional material was compared with its proton-unexchanged counterpart. Interestingly, the oxidation of isoeugenol resulted in being highly dependent on the acidic functionalities of the organocatalyst. Nonetheless, the catalytic performance of the proton-unexchanged catalyst suggested that the acidic and basic sites of the Prn/Fe2O3@SiO2 exhibited a synergic effect, giving rise to higher conversion and selectivity. The presence of bifunctional groups in the proline analogue, together with the magnetic properties of the iron oxide nanoparticles, could lead to high efficiency, versatility, recoverability, and reusability.

  19. The effect of geomagnetic storm on GPS derived total electron content (TEC) at Varanasi, India

    International Nuclear Information System (INIS)

    Kumar, Sanjay; Singh, A K

    2010-01-01

    In this paper we studied the effect of geomagnetic storm on Global Positioning System (GPS) derived total electron content (TEC) at low latitude Varanasi (Geomagnetic lat 14 0 , 55' N, geomagnetic long 154 0 E) during the period of May 2007 to April 2008. During this period 2 storms were found, which were occurred on 20 November 2007 and 9 March 2008. In this study vertical total electron content (VTEC) of single Pseudorandom Noise (PRN) and average of VTEC of same PRN before 10 days of storm, which is called background TEC, were used to see the effect of these storms on the variation of TEC. From this study this is found that during the storm of March 2008 the TEC increases in main phase of storm while in the case of November 2007 storm, TEC decreases during the main phase of storm but increases in the recovery phase (next day) of storm.

  20. Things That Go Boom!: Noise and Toxic Exposures Associated with Weapon Systems

    Science.gov (United States)

    2010-06-17

    Munitions Pyrotechnics Tracers Spot ing Charges Oxidizers Delay Elements Propellatl s Fuses De· onators Pr~n1ers Constituent of Concern BariL ...r11 chromate Potassium perchlorate lead oxide BariL m chromate P a tass ~L m perch I o r,ate l e ad chromate An1n1onil tll perch lara e P a

  1. Drug-related problems and changes in drug utilization after medication reviews in nursing homes in Oslo, Norway.

    Science.gov (United States)

    Fog, Amura Francesca; Kvalvaag, Gunnar; Engedal, Knut; Straand, Jørund

    2017-12-01

    We describe the drug-related problems (DRPs) identified during medication reviews (MRs) and the changes in drug utilization after MRs at nursing homes in Oslo, Norway. We explored predictors for the observed changes. Observational before-after study. Forty-one nursing homes. MRs performed by multidisciplinary teams during November 2011 to February 2014. In all, 2465 long-term care patients. DRPs identified by explicit criteria (STOPP/START and NORGEP) and drug-drug interaction database; interventions to resolve DRPs; drug use changes after MR. A total of 6158 DRPs were identified, an average of 2.6 DRPs/patient, 2.0 for regular and 0.6 for pro re nata (prn) drugs. Of these patients, 17.3% had no DRPs. The remaining 82.7% of the patients had on average 3.0 DRPs/patient. Use of unnecessary drugs (43.5%), excess dosing (12.5%) and lack of monitoring of the drug use (11%) were the most frequent DRPs. Opioids and psychotropic drugs were involved in 34.4% of all DRPs. The mean number of drugs decreased after the MR from 6.8 to 6.3 for regular drugs and from 3.0 to 2.6 for prn drugs. Patients with DRPs experienced a decrease of 1.1 drugs after MR (0.5 for regular and 0.6 for prn drugs). The reduction was most pronounced for the regular use of antipsychotics, antidepressants, hypnotics/sedatives, diuretics, antithrombotic agents, antacid drugs; and for prn use of anxiolytics, opioids, hypnotics/sedatives, metoclopramide and NSAIDs. The medication review resulted in less drug use, especially opioids and psychotropic drugs.

  2. Experimental technique of neutron reflection

    International Nuclear Information System (INIS)

    Chen Bo; Huang Chaoqiang; Li Xinxi

    2006-12-01

    It is presented that the classifications, structures and components of neutron reflectometer (NR), as well s functions and parameters of each components, detailed characters of NR facility 'PRN-2M'. Based on the practical experiments, the basic experimental techniques, the measurement and the related experimental settings are described, including the choice of experimental conditions, adjustments of polarized neutron beam line, basic experimental technique and approach of measurement. The above can be an instruction for NR experiments and a reference for NR construction. (authors)

  3. Determination of Precise Satellite Orbital Position Using Multi-Band GNSS Signals

    Science.gov (United States)

    2017-10-16

    occultation and overhead ray paths provide some improvement in the inversion , especially at high altitudes. Insofar as the analysis of the VELOX...Shows an example of cycle slip detection and correction for PRN 17 on 2016-02-26/27. The algorithm performs multiple iterations of simultaneous ...sharp inversion layers. The IGRA detected PBLHs are more affected by the nearby terrain and are generally higher/larger compared to the PBLHs from

  4. The Methods of Implementation of the Three-dimensional Pseudorandom Number Generator DOZEN for Heterogeneous CPU/GPU /FPGA High-performance Systems

    Directory of Open Access Journals (Sweden)

    Nikolay Petrovich Vasilyev

    2015-03-01

    Full Text Available The paper describes the scope of information security protocols based on PRN G in industrial systems. A method for implementing three-dimensional pseudorandom number generator D O Z E N in hybrid systems is provided. The description and results of studies parallel CUDA-version of the algorithm for use in hybrid data centers and high-performance FPGA-version for use in hardware solutions in controlled facilities of SCADA-systems are given.

  5. Comparison of Effects and Side Effects of Two Naloxone-Based Regimens in Treatment of Methadone Overdose

    Directory of Open Access Journals (Sweden)

    Arash Yazdanbakhsh

    2015-11-01

    Full Text Available Background: Acute opioid overdose is a common cause of admission in emergency department. In spite of the fact that naloxone is the main therapy for decades, there are controversies about the proper way of its use. This study aimed to compare two most recommended administration modes for naloxone. Methods: In this single-blind clinical trial, 80 patients with methadone overdose syndrome were randomly divided into two equal groups. The patients in infusion group received a constant infusion of naloxone preparation; while in the patients in PRN group, naloxone was administered only if needed clinically. Severity of withdrawal syndrome was evaluated after 30 min, 3 h, and 12 h of the treatments in both groups. Results: Eighty patients completed the study (10 women and 70 men. Both groups were similar in terms of mean age, sex ratio, and the severity of intoxication. The severity of withdrawal symptom was significantly lower in the PRN group (P<0.001. Conclusion: Naloxone administration as PRN mode lowers the rate and severity of withdrawal syndrome. It is recommended as the preferred mode of naloxone administration.

  6. Effect of visual art on patient anxiety and agitation in a mental health facility and implications for the business case.

    Science.gov (United States)

    Nanda, U; Eisen, S; Zadeh, R S; Owen, D

    2011-06-01

    There is a growing body of evidence on the impact of the environment on health and well-being. This study focuses on the impact of visual artworks on the well-being of psychiatric patients in a multi-purpose lounge of an acute care psychiatric unit. Well-being was measured by the rate of pro re nata (PRN) medication issued by nurses in response to visible signs of patient anxiety and agitation. Nurses were interviewed to get qualitative feedback on the patient response. Findings revealed that the ratio of PRN/patient census was significantly lower on the days when a realistic nature photograph was displayed, compared to the control condition (no art) and abstract art. Nurses reported that some patients displayed agitated behaviour in response to the abstract image. This study makes a case for the impact of visual art on mental well-being. The research findings were also translated into the time and money invested on PRN incidents, and annual cost savings of almost $US30,000 a year was projected. This research makes a case that simple environmental interventions like visual art can save the hospital costs of medication, and staff and pharmacy time, by providing a visual distraction that can alleviate anxiety and agitation in patients. © 2010 Blackwell Publishing.

  7. Calibration of Correlation Radiometers Using Pseudo-Random Noise Signals

    Directory of Open Access Journals (Sweden)

    Sebastián Pantoja

    2009-08-01

    Full Text Available The calibration of correlation radiometers, and particularly aperture synthesis interferometric radiometers, is a critical issue to ensure their performance. Current calibration techniques are based on the measurement of the cross-correlation of receivers’ outputs when injecting noise from a common noise source requiring a very stable distribution network. For large interferometric radiometers this centralized noise injection approach is very complex from the point of view of mass, volume and phase/amplitude equalization. Distributed noise injection techniques have been proposed as a feasible alternative, but are unable to correct for the so-called “baseline errors” associated with the particular pair of receivers forming the baseline. In this work it is proposed the use of centralized Pseudo-Random Noise (PRN signals to calibrate correlation radiometers. PRNs are sequences of symbols with a long repetition period that have a flat spectrum over a bandwidth which is determined by the symbol rate. Since their spectrum resembles that of thermal noise, they can be used to calibrate correlation radiometers. At the same time, since these sequences are deterministic, new calibration schemes can be envisaged, such as the correlation of each receiver’s output with a baseband local replica of the PRN sequence, as well as new distribution schemes of calibration signals. This work analyzes the general requirements and performance of using PRN sequences for the calibration of microwave correlation radiometers, and particularizes the study to a potential implementation in a large aperture synthesis radiometer using an optical distribution network.

  8. Pro re nata prescribing in a population receiving palliative care: a prospective consecutive case note review.

    Science.gov (United States)

    Russell, Bethany J; Rowett, Debra; Currow, David C

    2014-09-01

    To document pro re nata (PRN) prescribing practices and to identify patterns with respect to clinical characteristics and the medications prescribed. Prospective consecutive case note review. Two interrelated consultative hospice and palliative care services in regional Victoria, Australia. Terminally ill inpatients and community-based individuals (N = 203) at the time of referral to a hospice or palliative care service. Number of medications that the referring physician prescribed on a PRN basis and on a regular basis for symptom control; comorbid disease, performance status, comorbidity burden, disease phase, and survival. Mean number of PRN medications prescribed was 3.0, with significantly higher rates in the last week of life (rate ratio (RR) = 1.30, 95% confidence interval (CI) = 1.07-1.59) and during the terminal phase of disease (RR = 1.36, 95% CI = 1.09-1.68). One-quarter of prescriptions were for medications that met the Beers consensus criteria for potentially inappropriate medication use in elderly persons. These descriptive baseline data are new. A mean of three different medications allows responsiveness to a variety of fluctuating symptoms, but there was a large range within the sample, indicating that some individuals and their caregivers have a high burden of administration-related decision-making. © 2014, Copyright the Authors Journal compilation © 2014, The American Geriatrics Society.

  9. Implementation of Trauma-Informed Care and Brief Solution-Focused Therapy: A Quality Improvement Project Aimed at Increasing Engagement on an Inpatient Psychiatric Unit.

    Science.gov (United States)

    Aremu, Babatunde; Hill, Pamela D; McNeal, Joanne M; Petersen, Mary A; Swanberg, Debbie; Delaney, Kathleen R

    2018-03-14

    Addressing tense and escalating situations with noncoercive measures is an important element of inpatient psychiatric treatment. Although restraint rates are frequently monitored, the use of pro re nata (PRN) intramuscular (IM) injections to address agitation is also an important indicator. In 2015, at the current study site, a significant increase was noted in PRN IM medication use despite unit leadership's efforts to build a culture of trauma-informed care (TIC). The purpose of the current quality improvement project was to educate staff on methods to incorporate TIC into daily practice and the use of brief solution-focused therapy techniques in escalating situations. Measurement of attitudes toward patient aggression and engagement with patients followed two waves of staff education. Upon completion of the project, a decrease in PRN IM medications, improvement in staff attitudes toward patient aggression, and improved sense of staff competency in handling tense situations were noted. [Journal of Psychosocial Nursing and Mental Health Services, xx(x), xx-xx.]. Copyright 2018, SLACK Incorporated.

  10. Enzyme-linked immunosorbent assay (ELISA for measles antibody: a comparison with haemagglutination inhibition, immunofluorescence and plaque neutralization tests Reação imunoenzimática (ELISA para detecção de anticorpos para o vírus do sarampo: comparação com reações de inibição da hema-glutinação, imunofluorescência indireta e neutralização de placas

    Directory of Open Access Journals (Sweden)

    Vanda Akico Ueda Fick de Souza

    1991-02-01

    Full Text Available An enzyme-linked immunosorbent assay (ELISA for measles antibodies was compared with Plaque Neutralization (PRN, Haemagglutination inhibition (HI and Fluorescent antibody (IFA tests in 181 sera from vaccinated children and umbilical cord. Of 179 positive samples by the sensitive PRN, only two, with titers of 8, were negative by ELISA (copositivity of 98.9%. IFA and HI presented, respectively, copo-sitivities of 93.3% and 82.7%. The ELISA presented a high sensitivity as well as a good reproducibility and represents an alternative for the time consuming PRN for detection of low measles antibodies.A reação imunoenzimática (ELISA para determinação de anticorpos para o vírus do sarampo foi comparada com a reação de neutralização de placas (RNP, inibição da hemaglutinação (RIH e imunofluorescência indireta (RIF. Das 179 amostras positivas pela RNP, somente 2, com títulos iguais a 8, se apresentaram negativas por ELISA (copositividade de 98.9%. A RIF e RIH apresentaram, respectivamente, copositividade de 93.3 e 82.7%. ELISA apresentou sensibilidade equivalente à complexa RNP, boa reprodutibilidade e representa uma alternativa para a detecção de baixos títulos de anticorpos contra o sarampo.

  11. A preliminary study of the moss genus Isopterygium in Latin America A preliminary study of the moss genus Isopterygium in Latin America

    Directory of Open Access Journals (Sweden)

    Ireland Robert R.

    1991-06-01

    Full Text Available Se presenta el estudio taxonómico preliminar del género Isopterygium (Hypnaceae, musgo pleurocárpico, en Latinoamérica. Se localizaron y examinaron 78 ejemplares tipo de los 92 taxa reconocidos, de acuerdo con el Index Muscorum, para México, Centro y Sur América. El detallado estudio nomenclatural permitió reconocer para la región siete especies: Isopterygium affusum Mitt., I. byssobolax (C. Müll. Par, I. miradoricum (C. Müll. Jaeg. & Sauerb, I. subbrevisetum (Hampe Broth., I. sobglobosum Herz., I. tenerifolium Mitt. e I. tenerum (Sw. Mitt. Se provee una clave para la identificación de las especies, su distribución conocida y la lista de sinónimos para cada una de ellas.  Algunos taxa anteriormente ubicados en Isopterygium fue necesario transferirlos a otros taxa, lo cual requiere las siguientes combinaciones nuevas: Wijkia alstonii (Bartr. Irel. (Isopterygium alstonii Bartr., Pseudotaxiphyllum homomallifolium (Redf. Irel. (Isopereygium homomallifolium Redf., Pseudotaxiphyllum machrisianum (Crum Irel. (Taxiphyllum machrisianum Crum, Pseudotaxiphyllum richardsii (Bartr. Irel. (Isopterygium richardsii Bartr. A preliminary taxonomic study was conducted on the pleurocarpous moss genus Isopterygium in Latin America. The types of 78 the 92 taxa recognized for Mexico, Central and South America by Index Muscorum were located and examined. Synonymy was found to be extensive with only seven species presently being recognized for the region, including Isopterygium affusum Mitt., I. byssobolax (C. Müll. Par .. I. miradoricum (C. Müll. Jaeg. & Sauerb., I. subbrevisetum (Hampe Broth., I. subglobosum Herz., I. tenerifolium Mitt. and I. tenerum (Sw. Mitt. A key to the identification of the species, their known distribution and a list of synonyms for each species is provided. It was necessary to transfer some of the taxa formerly placed in Isopterygium into other genera which required the following new combinations: Wijkia alstonii (Bartr. Irel

  12. A Prediction Model to Help with the Assessment of Adenopathy in Lung Cancer: HAL.

    Science.gov (United States)

    O'Connell, Oisin J; Almeida, Francisco A; Simoff, Michael J; Yarmus, Lonny; Lazarus, Ray; Young, Benjamin; Chen, Yu; Semaan, Roy; Saettele, Timothy M; Cicenia, Joseph; Bedi, Harmeet; Kliment, Corrine; Li, Liang; Sethi, Sonali; Diaz-Mendoza, Javier; Feller-Kopman, David; Song, Juhee; Gildea, Thomas; Lee, Hans; Grosu, Horiana B; Machuzak, Michael; Rodriguez-Vial, Macarena; Eapen, George A; Jimenez, Carlos A; Casal, Roberto F; Ost, David E

    2017-06-15

    Estimating the probability of finding N2 or N3 (prN2/3) malignant nodal disease on endobronchial ultrasound-guided transbronchial needle aspiration (EBUS-TBNA) in patients with non-small cell lung cancer (NSCLC) can facilitate the selection of subsequent management strategies. To develop a clinical prediction model for estimating the prN2/3. We used the AQuIRE (American College of Chest Physicians Quality Improvement Registry, Evaluation, and Education) registry to identify patients with NSCLC with clinical radiographic stage T1-3, N0-3, M0 disease that had EBUS-TBNA for staging. The dependent variable was the presence of N2 or N3 disease (vs. N0 or N1) as assessed by EBUS-TBNA. Univariate followed by multivariable logistic regression analysis was used to develop a parsimonious clinical prediction model to estimate prN2/3. External validation was performed using data from three other hospitals. The model derivation cohort (n = 633) had a 25% prevalence of malignant N2 or N3 disease. Younger age, central location, adenocarcinoma histology, and higher positron emission tomography-computed tomography N stage were associated with a higher prN2/3. Area under the receiver operating characteristic curve was 0.85 (95% confidence interval, 0.82-0.89), model fit was acceptable (Hosmer-Lemeshow, P = 0.62; Brier score, 0.125). We externally validated the model in 722 patients. Area under the receiver operating characteristic curve was 0.88 (95% confidence interval, 0.85-0.90). Calibration using the general calibration model method resulted in acceptable goodness of fit (Hosmer-Lemeshow test, P = 0.54; Brier score, 0.132). Our prediction rule can be used to estimate prN2/3 in patients with NSCLC. The model has the potential to facilitate clinical decision making in the staging of NSCLC.

  13. Pyrrolnitrin and Hydrogen Cyanide Production by Pseudomonas chlororaphis Strain PA23 Exhibits Nematicidal and Repellent Activity against Caenorhabditis elegans.

    Directory of Open Access Journals (Sweden)

    Munmun Nandi

    Full Text Available Pseudomonas chlororaphis strain PA23 is a biocontrol agent able to suppress growth of the fungal pathogen Sclerotinia sclerotiorum. This bacterium produces an arsenal of exometabolites including pyrrolnitrin (PRN, phenazine (PHZ, hydrogen cyanide (HCN, and degradative enzymes. Production of these compounds is controlled at both the transcriptional and posttranscriptional levels by the Gac-Rsm system, RpoS, PsrA, and the Phz quorum-sensing system. Beyond pathogen-suppression, the success of a biocontrol agent is dependent upon its ability to establish itself in the environment where predation by bacterivorous organisms, including nematodes, may threaten persistence. The focus of this study was to investigate whether PA23 is able to resist grazing by Caenorhabditis elegans and to define the role played by exoproducts in the bacterial-nematode interaction. We discovered that both PRN and HCN contribute to fast- and slow-killing of C. elegans. HCN is well-established as having lethal effects on C. elegans; however, PRN has not been reported to be nematicidal. Exposure of L4 stage nematodes to purified PRN reduced nematode viability in a dose-dependent fashion and led to reduced hatching of eggs laid by gravid adults. Because bacterial metabolites can act as chemoattractants or repellents, we analyzed whether PA23 exhibited attractant or repulsive properties towards C. elegans. Both PRN and HCN were found to be potent repellents. Next we investigated whether the presence of C. elegans would elicit changes in PA23 gene activity. Co-culturing the two organisms increased expression of a number of genes associated with biocontrol, including phzA, hcnA, phzR, phzI, rpoS and gacS. Exoproduct analysis showed that PHZ and autoinducer signals were upregulated, consistent with the gene expression profiles. Collectively, these findings indicate that PA23 is able to sense the presence of C. elegans and it is able to both repel and kill the nematodes, which

  14. Musik – En viktig del i förskolan : Fyra förskollärares perspektiv på musikverksamheten i förskolan

    OpenAIRE

    Almgren, Josefin

    2016-01-01

    Syftet med min studie är att undersöka hur fyra förskollärare, verksamma i en musikförskola, uppfattar musikens funktion i förskolan och hur betydelsefull de anser att musikverksamheten är för barn i förskolan. Jag valde att genomföra en semistrukturerad gruppintervju där fyra förskollärare deltog. Jag har valt Vygotskijs sociokulturella perspektiv som teoretisk utgångspunkt i mitt arbete. I mitt resultat kunde jag se ett mönster av samarbete, gemenskap och barns inflytande som något som är v...

  15. Barbröstade grabbar, med färgat hår och litervis med öl : En analys av Aftonbladets skildring av herr- och damfotboll i Herr-VM 2006 och Dam-VM 2007

    OpenAIRE

    Mårtensson, Henning

    2012-01-01

    I den här uppsatsen har jag undersökt hur män och kvinnor framställs i bild och text i Aftonbladets rapportering från herrarnas fotbolls-VM i Tyskland 2006 och damernas fotbolls-VM i Kina 2007. Mitt syfte var att titta på hur konstrueringen av en nationell diskurs skiljer sig åt i texterna om dam- och herrfotboll, om det finns någon tydlig manlig och kvinnlig diskurs på bilderna, samt hur väl min undersökning stämmer in på beprövade genusteorier. För att kunna besvara mitt syfte använde jag m...

  16. Serbia lubab jätta iseseisvuse valinud Montenegro karistamata / Krister Paris

    Index Scriptorium Estoniae

    Paris, Krister, 1977-

    2006-01-01

    Tallinnas viibinud Serbia ja Montenegro ühisriigi välisministri Vuk Drashkovici hinnangul võis Serbia sanktsioonidest Montenegro vastu rääkida mõni poliitik või ajakirjanik ekspresident Slobodan Milosevitshi leerist, mitte aga Serbia valitsus. Drashkovic rõhutas, et Montenegro eraldumist ei tohi võrrelda Kosovo küsimusega, kuna Kosovo on Serbia provints ja pole kunagi olnud Jugoslaavia täieõiguslik vabariik

  17. Kas Vene kapital on ohtlik? / Jaanus Rahumägi

    Index Scriptorium Estoniae

    Rahumägi, Jaanus, 1963-

    2006-01-01

    Autori sõnul pole Eesti julgeolekurisk mitte anonüümne kapital, vaid poliitik, kes suudab seaduste ning suunatud konkurentsi kaudu sõbralikele ettevõtetele teiste turul osalejate või turule tulla soovijate ees eelispositsiooni kinnistada. Ametnike ja poliitikute korrumpeerumise vältimiseks on tähtis täita EL-i ootusi. Lühendatult J. Rahumäe ettekandest NATO konverentsil "Euro-Atlantic integration: new challenges and possibilities"

  18. Evaluation of an early step-down strategy from intravenous anidulafungin to oral azole therapy for the treatment of candidemia and other forms of invasive candidiasis: results from an open-label trial.

    Science.gov (United States)

    Vazquez, Jose; Reboli, Annette C; Pappas, Peter G; Patterson, Thomas F; Reinhardt, John; Chin-Hong, Peter; Tobin, Ellis; Kett, Daniel H; Biswas, Pinaki; Swanson, Robert

    2014-02-21

    Hospitalized patients are at increased risk for candidemia and invasive candidiasis (C/IC). Improved therapeutic regimens with enhanced clinical and pharmacoeconomic outcomes utilizing existing antifungal agents are still needed. An open-label, non-comparative study evaluated an intravenous (i.v.) to oral step-down strategy. Patients with C/IC were treated with i.v. anidulafungin and after 5 days of i.v. therapy had the option to step-down to oral azole therapy (fluconazole or voriconazole) if they met prespecified criteria. The primary endpoint was the global response rate (clinical + microbiological) at end of treatment (EOT) in the modified intent-to-treat (MITT) population (at least one dose of anidulafungin plus positive Candida within 96 hours of study entry). Secondary endpoints included efficacy at other time points and in predefined patient subpopulations. Patients who stepped down early (≤ 7 days' anidulafungin) were identified as the "early switch" subpopulation. In total, 282 patients were enrolled, of whom 250 were included in the MITT population. The MITT global response rate at EOT was 83.7% (95% confidence interval, 78.7-88.8). Global response rates at all time points were generally similar in the early switch subpopulation compared with the MITT population. Global response rates were also similar across multiple Candida species, including C. albicans, C. glabrata, and C. parapsilosis. The most common treatment-related adverse events were nausea and vomiting (four patients each). A short course of i.v. anidulafungin, followed by early step-down to oral azole therapy, is an effective and well-tolerated approach for the treatment of C/IC. ClinicalTrials.gov: NCT00496197.

  19. Derzhat nelzja devalvirovat / Aleksandr Tshaplõgin

    Index Scriptorium Estoniae

    Tšaplõgin, Aleksandr, 1964-

    2007-01-01

    Janek Mäggi väitest krooni devalveerumise kohta, Lätis vallandunud dollari- ja euroostupaanikast seoses juttudega lati võimalikust devalvatsioonist. Eesti Panga pressiteenistuse juht Janno Toots on seisukohal, et J. Mäggi ei valda teemat, ning soovitab sellele kõigele mitte tähelepanu pöörata. Heido Vitsur leiab, et nii lati kui ka krooni devalvatsiooni juttude taga on spekulandid

  20. Paranoilisi mõtteid / Slavoj Zhizhek ; tõlk. Märt Väljataga

    Index Scriptorium Estoniae

    Zhizhek, Slavoj

    2003-01-01

    Autori arvates peaksime olema valvsad, et mitte võidelda vales lahingus: vaidlused selle üle, kui halb on Saddam või kui palju sõda maksma läheb, on valevaidlused. Tähelepanu tuleb pöörata sellele, mis toimub meie ühiskonnas, missugune kultuur on tekkimas Läänes "terrorivastase" sõja tulemusena