WorldWideScience

Sample records for milkweed asclepias exaltata

  1. Temporal patterns of foliar ozone symptoms on tall milkweed (Asclepias exaltata L.) in Great Smoky Mountains National Park.

    Science.gov (United States)

    Chappelka, A H; Somers, G L; Renfro, J R

    2007-10-01

    Incidence and severity of ozone-induced foliar symptoms on tall milkweed (Asclepias exaltata L.) along selected trails in Great Smoky Mountains National Park (GRSM) were determined by two surveys/season conducted from 1992 through 1996. Overall incidence was 73%, and was 84%, 44%, 90%, 58%, and 82% for 1992-1996, respectively for the same clusters. Average incidence was 61% and 84% for the 1st and 2nd surveys, respectively. Seasonal comparisons showed two distinct injury groupings regarding incidence and severity of injury: 1992, 1994 and 1996 (high injury); 1993 and 1995 (low injury). No discernible patterns were observed between symptomatic and asymptomatic plants regarding height, herbivory or flowering. Regression analyses indicated no differentiation in foliar symptoms regarding topographic position, aspect, slope or elevation over the 5-year study period. Our findings indicate other micro-site or genetic factors may control ozone sensitivity of tall milkweed in GRSM.

  2. Seasonal development of ozone-induced foliar injury on tall milkweed (Asclepias exaltata) in Great Smoky Mountains National Park.

    Science.gov (United States)

    Souza, Lara; Neufeld, Howard S; Chappelka, Arthur H; Burkey, Kent O; Davison, Alan W

    2006-05-01

    The goals of this study were to document the development of ozone-induced foliar injury, on a leaf-by-leaf basis, and to develop ozone exposure relationships for leaf cohorts and individual tall milkweeds (Asclepias exaltata L.) in Great Smoky Mountains National Park. Plants were classified as either ozone-sensitive or insensitive based on the amount of foliar injury. Sensitive plants developed injury earlier in the season and to a greater extent than insensitive plants. Older leaf cohorts were more likely to belong to high injury classes by the end of each of the two growing seasons. In addition, leaf loss was more likely for older cohorts (2000) and lower leaf positions (2001) than younger cohorts and upper leaves, respectively. Most leaves abscised without prior ozone-like stippling or chlorosis. Failure to take this into account can result in underestimation of the effects of ozone on these plants.

  3. Temporal patterns of foliar ozone symptoms on tall milkweed (Asclepias exaltata L.) in Great Smoky Mountains National Park

    International Nuclear Information System (INIS)

    Chappelka, A.H.; Somers, G.L.; Renfro, J.R.

    2007-01-01

    Incidence and severity of ozone-induced foliar symptoms on tall milkweed (Asclepias exaltata L.) along selected trails in Great Smoky Mountains National Park (GRSM) were determined by two surveys/season conducted from 1992 through 1996. Overall incidence was 73%, and was 84%, 44%, 90%, 58%, and 82% for 1992-1996, respectively for the same clusters. Average incidence was 61% and 84% for the 1st and 2nd surveys, respectively. Seasonal comparisons showed two distinct injury groupings regarding incidence and severity of injury: 1992, 1994 and 1996 (high injury); 1993 and 1995 (low injury). No discernible patterns were observed between symptomatic and asymptomatic plants regarding height, herbivory or flowering. Regression analyses indicated no differentiation in foliar symptoms regarding topographic position, aspect, slope or elevation over the 5-year study period. Our findings indicate other micro-site or genetic factors may control ozone sensitivity of tall milkweed in GRSM. - Ground-level ozone has the potential to cause deleterious effects to tall milkweed growing in Great Smoky Mountains National Park

  4. Temporal patterns of foliar ozone symptoms on tall milkweed (Asclepias exaltata L.) in Great Smoky Mountains National Park

    Energy Technology Data Exchange (ETDEWEB)

    Chappelka, A.H. [School of Forestry and Wildlife Sciences, Auburn University, Auburn, AL 36849 (United States)], E-mail: chappah@auburn.edu; Somers, G.L. [School of Forestry and Wildlife Sciences, Auburn University, Auburn, AL 36849 (United States); Renfro, J.R. [USDI National Park Service, Resource Management and Science Division, Great Smoky Mountains National Park, Gatlinburg, TN 37738 (United States)

    2007-10-15

    Incidence and severity of ozone-induced foliar symptoms on tall milkweed (Asclepias exaltata L.) along selected trails in Great Smoky Mountains National Park (GRSM) were determined by two surveys/season conducted from 1992 through 1996. Overall incidence was 73%, and was 84%, 44%, 90%, 58%, and 82% for 1992-1996, respectively for the same clusters. Average incidence was 61% and 84% for the 1st and 2nd surveys, respectively. Seasonal comparisons showed two distinct injury groupings regarding incidence and severity of injury: 1992, 1994 and 1996 (high injury); 1993 and 1995 (low injury). No discernible patterns were observed between symptomatic and asymptomatic plants regarding height, herbivory or flowering. Regression analyses indicated no differentiation in foliar symptoms regarding topographic position, aspect, slope or elevation over the 5-year study period. Our findings indicate other micro-site or genetic factors may control ozone sensitivity of tall milkweed in GRSM. - Ground-level ozone has the potential to cause deleterious effects to tall milkweed growing in Great Smoky Mountains National Park.

  5. Population differences in self-fertility in the "self-incompatible" milkweed Asclepias exaltata (Asclepiadaceae).

    Science.gov (United States)

    Lipow, S R; Broyles, S B; Wyatt, R

    1999-08-01

    Individual plants of Asclepias exaltata (Asclepiadaceae) typically express an unusual self-incompatibility system under single-gene control. Hand-pollinations performed in six natural populations detected occasional self-fertile plants. The frequency of self-fertile individuals ranged from 0 to 34.0% and differed significantly among populations. Self-fertility appears to be under genetic control, as the ability of most plants (80.0 %) to set fruit following self-pollinations was identical under natural and greenhouse conditions. Seed- and fruit-set, however, were significantly lower from self- vs. cross-pollinations. Allozyme analysis of the population with the highest frequency of self-fertility revealed that adult plants were not significantly inbred. Finally, fruit-set following within-population cross-pollinations did not differ from that following wide, between-population cross-pollinations.

  6. Single gene control of postzygotic self-incompatibility in poke milkweed, Asclepias exaltata L.

    Science.gov (United States)

    Lipow, S R; Wyatt, R

    2000-02-01

    Most individuals of Asclepias exaltata are self-sterile, but all plants lack prezygotic barriers to self-fertilization. To determine whether postzygotic rejection of self-fertilized ovules is due to late-acting self-incompatibility or to extreme, early acting inbreeding depression, we performed three diallel crosses among self-sterile plants related as full-sibs. The full-sibs segregated into four compatibility classes, suggesting that late acting self-incompatibility is controlled by a single gene (S-locus). Crosses between plants sharing one or both alleles at the S-locus are incompatible. An additional diallel cross was done among full-sib progeny from a cross of a self-sterile and a self-fertile plant. These progeny grouped into two compatibility classes, and plants within classes displayed varying levels of self-fertility. This suggests that the occasional self-fertility documented in natural pollinations is caused by pseudo-self-fertility alleles that alter the functioning of the S-locus.

  7. Single gene control of postzygotic self-incompatibility in poke milkweed, Asclepias exaltata L.

    Science.gov (United States)

    Lipow, S R; Wyatt, R

    2000-01-01

    Most individuals of Asclepias exaltata are self-sterile, but all plants lack prezygotic barriers to self-fertilization. To determine whether postzygotic rejection of self-fertilized ovules is due to late-acting self-incompatibility or to extreme, early acting inbreeding depression, we performed three diallel crosses among self-sterile plants related as full-sibs. The full-sibs segregated into four compatibility classes, suggesting that late acting self-incompatibility is controlled by a single gene (S-locus). Crosses between plants sharing one or both alleles at the S-locus are incompatible. An additional diallel cross was done among full-sib progeny from a cross of a self-sterile and a self-fertile plant. These progeny grouped into two compatibility classes, and plants within classes displayed varying levels of self-fertility. This suggests that the occasional self-fertility documented in natural pollinations is caused by pseudo-self-fertility alleles that alter the functioning of the S-locus. PMID:10655239

  8. Seasonal development of ozone-induced foliar injury on tall milkweed (Asclepias exaltata) in Great Smoky Mountains National Park

    International Nuclear Information System (INIS)

    Souza, Lara; Neufeld, Howard S.; Chappelka, Arthur H.; Burkey, Kent O.; Davison, Alan W.

    2006-01-01

    The goals of this study were to document the development of ozone-induced foliar injury, on a leaf-by-leaf basis, and to develop ozone exposure relationships for leaf cohorts and individual tall milkweeds (Asclepias exaltata L.) in Great Smoky Mountains National Park. Plants were classified as either ozone-sensitive or insensitive based on the amount of foliar injury. Sensitive plants developed injury earlier in the season and to a greater extent than insensitive plants. Older leaf cohorts were more likely to belong to high injury classes by the end of each of the two growing seasons. In addition, leaf loss was more likely for older cohorts (2000) and lower leaf positions (2001) than younger cohorts and upper leaves, respectively. Most leaves abscised without prior ozone-like stippling or chlorosis. Failure to take this into account can result in underestimation of the effects of ozone on these plants. - Leaf loss was not necessarily accompanied by symptoms of foliar ozone injury

  9. Seasonal development of ozone-induced foliar injury on tall milkweed (Asclepias exaltata) in Great Smoky Mountains National Park

    Energy Technology Data Exchange (ETDEWEB)

    Souza, Lara [Department of Biology, 572 Rivers Street, Appalachian State University, Boone, NC 28608 (United States)]. E-mail: lsouza@utk.edu; Neufeld, Howard S. [Department of Biology, 572 Rivers Street, Appalachian State University, Boone, NC 28608 (United States); Chappelka, Arthur H. [School of Forestry and Wildlife Sciences, 108 M White-Smith Hall, Auburn University, Auburn, AL 36849 (United States); Burkey, Kent O. [US Department of Agriculture, Agricultural Research Service, Plant Science Research Unit and Department of Crop Science, North Carolina State University, 3908 Inwood Road, Raleigh, NC 26703 (United States); Davison, Alan W. [School of Biology, Ridley Building, University of Newcastle, Newcastle Upon Tyne, NE1 7RU (United Kingdom)

    2006-05-15

    The goals of this study were to document the development of ozone-induced foliar injury, on a leaf-by-leaf basis, and to develop ozone exposure relationships for leaf cohorts and individual tall milkweeds (Asclepias exaltata L.) in Great Smoky Mountains National Park. Plants were classified as either ozone-sensitive or insensitive based on the amount of foliar injury. Sensitive plants developed injury earlier in the season and to a greater extent than insensitive plants. Older leaf cohorts were more likely to belong to high injury classes by the end of each of the two growing seasons. In addition, leaf loss was more likely for older cohorts (2000) and lower leaf positions (2001) than younger cohorts and upper leaves, respectively. Most leaves abscised without prior ozone-like stippling or chlorosis. Failure to take this into account can result in underestimation of the effects of ozone on these plants. - Leaf loss was not necessarily accompanied by symptoms of foliar ozone injury.

  10. Evaluation of ozone injury on foliage of black cherry (Prunus serotina) and tall milkweed (Asclepias exaltata) in Great Smoky Mountains National Park.

    Science.gov (United States)

    Chappelka, A; Renfro, J; Somers, G; Nash, B

    1997-01-01

    The incidence and severity of visible foliar ozone injury on black cherry (Prunus serotina) seedlings and saplings and tall milkweed (Asclepias exaltata) plants in Great Smoky Mountains National Park (GRSM) were determined by surveys along selected trails conducted during late summer 1992. The incidence (% injured plants) of ozone injury on black cherry was 47% and the percent injured leaves/injured plant and average leaf area injured were 43 and 6%, respectively. Maximum severity (avg. leaf area of the most severely injured leaf) was 12%. Black cherry seedlings and saplings exhibiting ozone injury were taller than non-injured plants. When insect feeding was present, it occurred 96% of the time on plants with ozone injury. Significantly more injury (p=0.007) on black cherry (% injured leaves/injured black cherry) occurred in the NW section of GRSM compared with the other Park sections. Regression analyses showed no relationships in ozone injury with respect to aspect, slope or elevation. Tall milkweed was evaluated twice during August for ozone injury. The incidence (% injured plants) of ozone injury was 74 and 79% for the first and second survey, respectively. The percentage of injured leaves per plant from the first to second survey was 63 to 79%, respectively. Tall milkweeds showing ozone injury were taller than the non-injured plants. The percentage of insect-damaged plants was 50% among plants without ozone injury and 60% among ozone-injured plants. Non-injured tall milkweed had fewer flowers and/or pods than the injured plants. Mean leaf area injured increased over time, and mean maximum leaf area injured increased from 8 to 11% during the same period. Regression analyses showed no differences in ozone injury regarding aspect, slope or elevation. Our findings indicate that ozone injury is widespread throughout the Park on sensitive vegetation.

  11. Differential pollinator effectiveness and importance in a milkweed (Asclepias, Apocynaceae) hybrid zone.

    Science.gov (United States)

    Stoepler, Teresa M; Edge, Andrea; Steel, Anna; O'Quinn, Robin L; Fishbein, Mark

    2012-03-01

    Exceptions to the ideal of complete reproductive isolation between species are commonly encountered in diverse plant, animal, and fungal groups, but often the causative ecological processes are poorly understood. In flowering plants, the outcome of hybridization depends in part on the effectiveness of pollinators in interspecific pollen transport. In the Asclepias exaltata and A. syriaca (Apocynaceae) hybrid zone in Shenandoah National Park, Virginia, extensive introgression has been documented. The objectives of this study were to (1) determine the extent of pollinator overlap among A. exaltata, A. syriaca, and their hybrids and (2) identify the insect taxa responsible for hybridization and introgression. We observed focal plants of parental species and hybrids to measure visitation rate, visit duration, and per-visit pollinia removal and deposition, and we calculated pollinator effectiveness and importance. Visitation rates varied significantly between the 2 yr of the study. Overall, Apis mellifera, Bombus sp., and Epargyreus clarus were the most important pollinators. However, Bombus sp. was the only visitor that was observed to both remove and insert pollinia for both parent species as well as hybrids. We conclude that Bombus may be a key agent of hybridization and introgression in these sympatric milkweed populations, and hybrids are neither preferred nor selected against by pollinators. Thus, we have identified a potential mechanism for how hybrids act as bridges to gene flow between A. exaltata and A. syriaca. These results provide insights into the breakdown of prezygotic isolating mechanisms.

  12. The common milkweed (Asclepias syriaca): A new industrial crop

    Science.gov (United States)

    Asclepias syriaca L. (the common milkweed) is a perennial plant occurring east of the Rockies in the United States, but particularly east of the Mississippi River and from Southern Canada to Mexico. The plant has many unsavory given names by frustrated farmers including “the Wheat Farmers Nightmare...

  13. Beneficial Insect Attraction to Milkweeds (Asclepias speciosa, Asclepias fascicularis) in Washington State, USA

    OpenAIRE

    David G. James; Lorraine Seymour; Gerry Lauby; Katie Buckley

    2016-01-01

    Native plant and beneficial insect associations are relatively unstudied yet are important in native habitat restoration programs for improving and sustaining conservation biological control of arthropod pests in agricultural crops. Milkweeds (Asclepias spp.) are currently the focus of restoration programs in the USA aimed at reversing a decline in populations of the milkweed-dependent monarch butterfly (Danaus plexippus); however, little is known of the benefits of these plants to other bene...

  14. Milkweed Matters: Monarch Butterfly (Lepidoptera: Nymphalidae) Survival and Development on Nine Midwestern Milkweed Species.

    Science.gov (United States)

    Pocius, V M; Debinski, D M; Pleasants, J M; Bidne, K G; Hellmich, R L; Brower, L P

    2017-10-01

    The population of monarch butterflies east of the Rocky Mountains has experienced a significant decline over the past 20 yr. In order to increase monarch numbers in the breeding range, habitat restoration that includes planting milkweed plants is essential. Milkweeds in the genus Asclepias and Cynanchum are the only host plants for larval monarch butterflies in North America, but larval performance and survival across nine milkweeds native to the Midwest is not well documented. We examined development and survival of monarchs from first-instar larval stages to adulthood on nine milkweed species native to Iowa. The milkweeds included Asclepias exaltata (poke milkweed) (Gentianales: Apocynaceae), Asclepias hirtella (tall green milkweed) (Gentianales: Apocynaceae), Asclepias incarnata (swamp milkweed) (Gentianales: Apocynaceae), Asclepias speciosa (showy milkweed) (Gentianales: Apocynaceae), Asclepias sullivantii (prairie milkweed) (Gentianales: Apocynaceae), Asclepias syriaca (common milkweed) (Gentianales: Apocynaceae), Asclepias tuberosa (butterfly milkweed) (Gentianales: Apocynaceae), Asclepias verticillata (whorled milkweed) (Gentianales: Apocynaceae), and Cynanchum laeve (honey vine milkweed) (Gentianales: Apocynaceae). In greenhouse experiments, fewer larvae that fed on Asclepias hirtella and Asclepias sullivantii reached adulthood compared with larvae that fed on the other milkweed species. Monarch pupal width and adult dry mass differed among milkweeds, but larval duration (days), pupal duration (days), pupal mass, pupal length, and adult wet mass were not significantly different. Both the absolute and relative adult lipids were different among milkweed treatments; these differences are not fully explained by differences in adult dry mass. Monarch butterflies can survive on all nine milkweed species, but the expected survival probability varied from 30 to 75% among the nine milkweed species. © The Author 2017. Published by Oxford University Press on behalf

  15. Transesterified milkweed (Asclepias) seed oil as a biodiesel fuel

    Energy Technology Data Exchange (ETDEWEB)

    Ronald Alan Holser; Rogers Harry-O' Kurua [United States Department of Agriculture, Peoria, IL (United States). Agricultural Research Service, National Center for Utilization Research

    2006-10-15

    The methyl and ethyl esters of milkweed (Asclepias) seed oil were prepared and compared to soybean esters in laboratory tests to determine biodiesel fuel performance properties. The pour points of the methyl and ethyl milkweed esters measured -6{sup o}C and -10{sup o}C, respectively, which is consistent with the high levels of unsaturation characteristic of milkweed seed oil. The oxidative stabilities measured by OSI at 100{sup o}C were between 0.8 and 4.1 h for all samples tested. The kinematic viscosities determined at 40{sup o}C by ASTM D 445 averaged 4.9 mm{sup 2}/s for milkweed methyl esters and 4.2 mm{sup 2}/s for soybean methyl esters. Lubricity values determined by ASTM D 6079 at 60{sup o}C were comparable to the corresponding soybean esters with average ball wear scar values of 118 {mu}m for milkweed methyl esters and 200 {mu}m for milkweed ethyl esters.

  16. Beneficial Insect Attraction to Milkweeds (Asclepias speciosa, Asclepias fascicularis in Washington State, USA

    Directory of Open Access Journals (Sweden)

    David G. James

    2016-06-01

    Full Text Available Native plant and beneficial insect associations are relatively unstudied yet are important in native habitat restoration programs for improving and sustaining conservation biological control of arthropod pests in agricultural crops. Milkweeds (Asclepias spp. are currently the focus of restoration programs in the USA aimed at reversing a decline in populations of the milkweed-dependent monarch butterfly (Danaus plexippus; however, little is known of the benefits of these plants to other beneficial insects. Beneficial insects (predators, parasitoids, pollinators attracted to two milkweed species (Asclepias speciosa, Asclepias fascicularis in central Washington State, WA, USA were identified and counted on transparent sticky traps attached to blooms over five seasons. Combining all categories of beneficial insects, means of 128 and 126 insects per trap were recorded for A. speciosa and A. fascicularis, respectively. Predatory and parasitic flies dominated trap catches for A. speciosa while parasitic wasps were the most commonly trapped beneficial insects on A. fascicularis. Bees were trapped commonly on both species, especially A. speciosa with native bees trapped in significantly greater numbers than honey bees. Beneficial insect attraction to A. speciosa and A. fascicularis was substantial. Therefore, these plants are ideal candidates for habitat restoration, intended to enhance conservation biological control, and for pollinator conservation. In central Washington, milkweed restoration programs for enhancement of D. plexippus populations should also provide benefits for pest suppression and pollinator conservation.

  17. Beneficial Insect Attraction to Milkweeds (Asclepias speciosa, Asclepias fascicularis) in Washington State, USA.

    Science.gov (United States)

    James, David G; Seymour, Lorraine; Lauby, Gerry; Buckley, Katie

    2016-06-29

    Native plant and beneficial insect associations are relatively unstudied yet are important in native habitat restoration programs for improving and sustaining conservation biological control of arthropod pests in agricultural crops. Milkweeds (Asclepias spp.) are currently the focus of restoration programs in the USA aimed at reversing a decline in populations of the milkweed-dependent monarch butterfly (Danaus plexippus); however, little is known of the benefits of these plants to other beneficial insects. Beneficial insects (predators, parasitoids, pollinators) attracted to two milkweed species (Asclepias speciosa, Asclepias fascicularis) in central Washington State, WA, USA were identified and counted on transparent sticky traps attached to blooms over five seasons. Combining all categories of beneficial insects, means of 128 and 126 insects per trap were recorded for A. speciosa and A. fascicularis, respectively. Predatory and parasitic flies dominated trap catches for A. speciosa while parasitic wasps were the most commonly trapped beneficial insects on A. fascicularis. Bees were trapped commonly on both species, especially A. speciosa with native bees trapped in significantly greater numbers than honey bees. Beneficial insect attraction to A. speciosa and A. fascicularis was substantial. Therefore, these plants are ideal candidates for habitat restoration, intended to enhance conservation biological control, and for pollinator conservation. In central Washington, milkweed restoration programs for enhancement of D. plexippus populations should also provide benefits for pest suppression and pollinator conservation.

  18. Identification of triterpenes from milkweed (Asclepias syriaca).

    Science.gov (United States)

    Háznagy-Radnai, Erzsébet; Wéber, Edit; Czigle, Szilvia; Máthé, Imre

    2012-09-01

    The chloroform extract of Asclepias syriaca stem were investigated. Three triterpenes were isolated by TLC, VLC, and preparative chromatography, and their structures established by one and two-dimensional NMR spectroscopy. Lupenyl acetate has been isolated for the first time from A. syriaca; this is thefirst representative of a triterpene bearing a lupane skeleton in this species. In addition, alpha-amyrin acetate and alpha-amyrin butyrate were isolated.

  19. Cytotoxic principles from the formosan milkweed, Asclepias curassavica.

    Science.gov (United States)

    Roy, Michael C; Chang, Fang-Rong; Huang, Hsiao-Chu; Chiang, Michael Y-N; Wu, Yang-Chang

    2005-10-01

    A series of cardenolides and related compounds have been isolated from the aerial parts and roots of the ornamental milkweed, Asclepias curassavica. Their structures were determined by spectroscopic and chemical methods. Among them, three derivatives of calactinic acid methyl ester (13-15), 19-nor-16 alpha-acetoxy-10 beta-hydroxyasclepin (16), 20 beta,21-dihydroxypregna-4,6-dien-3-one (19), and 3,4-seco-urs-20(30)-en-3-oic acid (22) are new compounds. The relative configuration of calactinic acid methyl ester (12) has been confirmed by X-ray diffraction analysis on its derivative 13. Most of the cardenolides obtained showed pronounced cytotoxicity against four cancer cell lines (IC(50) 0.01 to 2.0 microg/mL).

  20. Novel synthetic products from the common milkweed (Asclepias syriaca L) and their potential in the rural farm economy

    Science.gov (United States)

    The common milkweed is of the family Asclepiadaceae which comprises over 200 genera and 2500 species including Asclepias syriaca L and its near relatives, A. speciosa and A. tuberosa. Asclepias syriaca, or the common milkweed, is a perennial that is native to the Americas and is so named because of...

  1. Coexistence of three specialist aphids on common milkweed, Asclepias syriaca.

    Science.gov (United States)

    Smith, R A; Mooney, K A; Agrawal, A A

    2008-08-01

    Coexistence of host-specific herbivores on plants is believed to be governed by interspecific interactions, but few empirical studies have systematically unraveled these dynamics. We investigated the role of several factors in promoting coexistence among the aphids Aphis nerii, Aphis asclepiadis, and Myzocallis asclepiadis that all specialize on common milkweed (Asclepias syriaca). Competitive exclusion is thought to occur when interspecific competition is stronger than intraspecific competition. Consequently, we investigated whether predators, mutualists, or resource quality affected the strength of intra- vs. interspecific competition among aphids in factorial manipulations of competition with exposure to predation, ants, and variable plant genotypes in three separate experiments. In the predation x competition experiment, predators reduced aphid per capita growth by 66%, but the strength of intra- and interspecific competition did not depend on predators. In the ants x competition experiment, ants reduced per capita growth of A. nerii and M. asclepiadis (neither of which were mutualists with ants) by approximately one-half. In so doing, ants ameliorated the negative effects of these competitors on ant-tended A. asclepiadis by two-thirds, representing a novel benefit of ant-aphid mutualism. Nevertheless, ants alone did not explain the persistence of competitively inferior A. asclepiadis as, even in the presence of ants, interspecific competition remained stronger than intraspecific competition. In the plant genotype x competition experiment, both A. asclepiadis and M. asclepiadis were competitively inferior to A. nerii, with the strength of interspecific competition exceeding that of intraspecific competition by 83% and 23%, respectively. Yet these effects differed among milkweed genotypes, and there were one or more plant genotypes for each aphid species where coexistence was predicted. A synthesis of our results shows that predators play little or no role in

  2. The untold story of the common Milkweed (Asclepias syriaca): A new industrial crop

    Science.gov (United States)

    The common milkweed (Asclepias syriaca L.) is a perennial shrub that is native to the Americas from coast to coast, but particularly abundant east of the Mississippi River and from Southern Canada to Mexico. The plant has been given many nonglamorous names by frustrated farmers including “The Wheat...

  3. Demography and monitoring of Welsh's milkweed (Asclepias welshii) at Coral Pink Sand Dunes

    Science.gov (United States)

    Brent C. Palmer; L. Armstrong

    2001-01-01

    Results are presented of a 12-year monitoring program on the Coral Pink Sand Dunes and Sand Hills populations of the threatened Welsh's milkweed, Asclepias welshii N & P Holmgren. The species is an early sera1 member of the dune flora, colonizing blowouts and advancing with shifting dunes. When an area stabilizes and other vegetation encroaches, A. welshii is...

  4. Reciprocal interactions between native and introduced populations of common milkweed, Asclepias syriaca, and the specialist aphid, Aphis nerii

    NARCIS (Netherlands)

    Bukovinszky, T.; Gols, R.; Agrawal, A.A.; Roge, C.; Bezemer, T.M.; Biere, A.; Harvey, J.A.

    2014-01-01

    Following its introduction into Europe (EU), the common milkweed (Asclepias syriaca) has been free of most specialist herbivores that are present in its native North American (NA) range, except for the oleander aphid Aphis nerii. We compared EU and NA populations of A. nerii on EU and NA milkweed

  5. Isolation and characterization of microsatellite loci in the common milkweed, Asclepias syriaca (Apocynaceae).

    Science.gov (United States)

    Kabat, Susan M; Dick, Christopher W; Hunter, Mark D

    2010-05-01

    Microsatellite primers were developed for the common milkweed, Asclepias syriaca L., to assist in genet identification and the analysis of spatial genetic structure. Using an enrichment cloning protocol, eight microsatellite loci were isolated and characterized in a Michigan population of A. syriaca. The primers amplified di- and trinucleotide repeats with 4-13 alleles per locus. The primers will be useful for studies of clonality and gene flow in natural populations.

  6. Common milkweed (Asclepias syriaca L. response to sulcotrione

    Directory of Open Access Journals (Sweden)

    Gajić-Umiljendić Jelena

    2017-01-01

    Full Text Available A laboratory bioassay was conducted to investigate common milkweed response to sulcotrione. Sulcotrione was applied in concentration series of 0.15-0.90 kg a.i./ha without a surfactant and with Dash® at 1 L/ha. Plants grew for 14 days, upon which period morphological (height and fresh weight and physiological parameters (content of carotenoids, chlorophyll a and chlorophyll b were measured. Visual crop injury was estimated 7 and 14 days after treatment. Sulcotrione caused leaf bleaching and reduction in pigments content in common milkweed leaves and the degree of change depended on application rates and whether it was applied with or without the surfactant. Inhibition was slightly higher in plants which were treated with a combination of herbicide and surfactant. Based on the findings in this study, common milkweed showed moderate susceptibility to the recommended field rates of sulcotrione.

  7. Intoxication of sheep exposed to ozark milkweed (Asclepias viridis Walter).

    Science.gov (United States)

    Smith, R A; Scharko, P; Bolin, D; Hong, C B

    2000-12-01

    Some 20 sheep died 1 at a time on a farm in Fleming County, KY, in late July of 1999 after consumption of Asclepias viridis Walter. Major histological lesions were mild multifocal nonsuppurative myocarditis. Gross pathology revealed wet and heavy lungs. Many affected animals had a hunched appearance, and marked posterior paresis was also observed.

  8. Phylogenetic ecology of leaf surface traits in the milkweeds (Asclepias spp.): chemistry, ecophysiology, and insect behavior.

    Science.gov (United States)

    Agrawal, Anurag A; Fishbein, Mark; Jetter, Reinhard; Salminen, Juha-Pekka; Goldstein, Jessica B; Freitag, Amy E; Sparks, Jed P

    2009-08-01

    The leaf surface is the contact point between plants and the environment and plays a crucial role in mediating biotic and abiotic interactions. Here, we took a phylogenetic approach to investigate the function, trade-offs, and evolution of leaf surface traits in the milkweeds (Asclepias). Across 47 species, we found trichome densities of up to 3000 trichomes cm(-2) and epicuticular wax crystals (glaucousness) on 10 species. Glaucous species had a characteristic wax composition dominated by very-long-chain aldehydes. The ancestor of the milkweeds was probably a glaucous species, from which there have been several independent origins of glabrous and pubescent types. Trichomes and wax crystals showed negatively correlated evolution, with both surface types showing an affinity for arid habitats. Pubescent and glaucous milkweeds had a higher maximum photosynthetic rate and lower stomatal density than glabrous species. Pubescent and glaucous leaf surfaces impeded settling behavior of monarch caterpillars and aphids compared with glabrous species, although surface types did not show consistent differentiation in secondary chemistry. We hypothesize that pubescence and glaucousness have evolved as alternative mechanisms with similar functions. The glaucous type, however, appears to be ancestral, lost repeatedly, and never regained; we propose that trichomes are a more evolutionarily titratable strategy.

  9. Variation in pollinator effectiveness in swamp milkweed, Asclepias incarnata (Apocynaceae).

    Science.gov (United States)

    Ivey, Christopher T; Martinez, Pocholo; Wyatt, Robert

    2003-02-01

    The contribution of a pollinator toward plant fitness (i.e., its "effectiveness") can determine its importance for the plant's evolutionary ecology. We compared pollinators in a population of Asclepias incarnata (Apocynaceae) for several components of pollinator effectiveness over two flowering seasons to evaluate their importance to plant reproduction. Insects of the order Hymenoptera predominate in A. incarnata pollination, but there appears to be no specialization for pollination within this order. Pollinators varied significantly in nearly every component of effectiveness that we measured, including pollen load, removal and deposition of pollen, pollination efficiency (deposition/removal), flower-handling time, and potential for geitonogamy (fractional pollen deposition). The visitation rate of pollinators also varied significantly between years and through time within years. Pollination success and percentage fruit-set of unmanipulated plants in the population also varied significantly between years, and pollination success varied among sample times within years. Most components of effectiveness were weakly correlated, suggesting that the contributions of visitor species toward pollination varied among effectiveness components. Mean flower-handling time, however, was strongly correlated with several components, including pollen removal and deposition, pollination efficiency, and fractional pollen deposition. These findings highlight the significance of pollination variability for plant reproduction and suggest that time-dependent foraging behaviors may play an important role in determining pollinator effectiveness.

  10. Building a model: developing genomic resources for common milkweed (Asclepias syriaca with low coverage genome sequencing

    Directory of Open Access Journals (Sweden)

    Weitemier Kevin

    2011-05-01

    Full Text Available Abstract Background Milkweeds (Asclepias L. have been extensively investigated in diverse areas of evolutionary biology and ecology; however, there are few genetic resources available to facilitate and compliment these studies. This study explored how low coverage genome sequencing of the common milkweed (Asclepias syriaca L. could be useful in characterizing the genome of a plant without prior genomic information and for development of genomic resources as a step toward further developing A. syriaca as a model in ecology and evolution. Results A 0.5× genome of A. syriaca was produced using Illumina sequencing. A virtually complete chloroplast genome of 158,598 bp was assembled, revealing few repeats and loss of three genes: accD, clpP, and ycf1. A nearly complete rDNA cistron (18S-5.8S-26S; 7,541 bp and 5S rDNA (120 bp sequence were obtained. Assessment of polymorphism revealed that the rDNA cistron and 5S rDNA had 0.3% and 26.7% polymorphic sites, respectively. A partial mitochondrial genome sequence (130,764 bp, with identical gene content to tobacco, was also assembled. An initial characterization of repeat content indicated that Ty1/copia-like retroelements are the most common repeat type in the milkweed genome. At least one A. syriaca microread hit 88% of Catharanthus roseus (Apocynaceae unigenes (median coverage of 0.29× and 66% of single copy orthologs (COSII in asterids (median coverage of 0.14×. From this partial characterization of the A. syriaca genome, markers for population genetics (microsatellites and phylogenetics (low-copy nuclear genes studies were developed. Conclusions The results highlight the promise of next generation sequencing for development of genomic resources for any organism. Low coverage genome sequencing allows characterization of the high copy fraction of the genome and exploration of the low copy fraction of the genome, which facilitate the development of molecular tools for further study of a target species

  11. Building a model: developing genomic resources for common milkweed (Asclepias syriaca) with low coverage genome sequencing.

    Science.gov (United States)

    Straub, Shannon C K; Fishbein, Mark; Livshultz, Tatyana; Foster, Zachary; Parks, Matthew; Weitemier, Kevin; Cronn, Richard C; Liston, Aaron

    2011-05-04

    Milkweeds (Asclepias L.) have been extensively investigated in diverse areas of evolutionary biology and ecology; however, there are few genetic resources available to facilitate and compliment these studies. This study explored how low coverage genome sequencing of the common milkweed (Asclepias syriaca L.) could be useful in characterizing the genome of a plant without prior genomic information and for development of genomic resources as a step toward further developing A. syriaca as a model in ecology and evolution. A 0.5× genome of A. syriaca was produced using Illumina sequencing. A virtually complete chloroplast genome of 158,598 bp was assembled, revealing few repeats and loss of three genes: accD, clpP, and ycf1. A nearly complete rDNA cistron (18S-5.8S-26S; 7,541 bp) and 5S rDNA (120 bp) sequence were obtained. Assessment of polymorphism revealed that the rDNA cistron and 5S rDNA had 0.3% and 26.7% polymorphic sites, respectively. A partial mitochondrial genome sequence (130,764 bp), with identical gene content to tobacco, was also assembled. An initial characterization of repeat content indicated that Ty1/copia-like retroelements are the most common repeat type in the milkweed genome. At least one A. syriaca microread hit 88% of Catharanthus roseus (Apocynaceae) unigenes (median coverage of 0.29×) and 66% of single copy orthologs (COSII) in asterids (median coverage of 0.14×). From this partial characterization of the A. syriaca genome, markers for population genetics (microsatellites) and phylogenetics (low-copy nuclear genes) studies were developed. The results highlight the promise of next generation sequencing for development of genomic resources for any organism. Low coverage genome sequencing allows characterization of the high copy fraction of the genome and exploration of the low copy fraction of the genome, which facilitate the development of molecular tools for further study of a target species and its relatives. This study represents a first

  12. Cardenolides, induced responses, and interactions between above- and belowground herbivores of milkweed (Asclepias spp.).

    Science.gov (United States)

    Rasmann, Sergio; Agrawal, Anurag A; Cook, Susan C; Erwin, Alexis C

    2009-09-01

    Theory has long predicted allocation patterns for plant defense against herbivory, but only recently have both above- and belowground plant defenses been considered simultaneously. Milkweeds in the genus Asclepias are a classic chemically defended clade of plants with toxic cardenolides (cardiac glycosides) and pressurized latex employed as anti-herbivore weapons. Here we combine a comparative approach to investigate broadscale patterns in allocation to root vs. shoot defenses across species with a species-specific experimental approach to identify the consequences of defense allocational shifts on a specialist herbivore. Our results show phylogenetic conservatism for inducibility of shoot cardenolides by an aboveground herbivore, with only four closely related tropical species showing significant induction; the eight temperate species examined were not inducible. Allocation to root and shoot cardenolides was positively correlated across species, and this relationship was maintained after accounting for phylogenetic nonindependence. In contrast to long-standing theoretical predictions, we found no evidence for a trade-off between constitutive and induced cardenolides; indeed the two were positively correlated across species in both roots and shoots. Finally, specialist root and shoot herbivores of common milkweed (A. syriaca) had opposing effects on latex production, and these effects had consequences for caterpillar growth consistent with latex providing resistance. Although cardenolides were not affected by our treatments, A. syriaca allocated 40% more cardenolides to shoots over roots. We conclude that constitutive and inducible defenses are not trading off across plant species, and shoots of Asclepias are more inducible than roots. Phylogenetic conservatism cannot explain the observed patterns of cardenolide levels across species, but inducibility per se was conserved in a tropical clade. Finally, given that above- and belowground herbivores can systemically

  13. Phylogenetic trends in phenolic metabolism of milkweeds (Asclepias): evidence for escalation.

    Science.gov (United States)

    Agrawal, Anurag A; Salminen, Juha-Pekka; Fishbein, Mark

    2009-03-01

    Although plant-defense theory has long predicted patterns of chemical defense across taxa, we know remarkably little about the evolution of defense, especially in the context of directional phylogenetic trends. Here we contrast the production of phenolics and cardenolides in 35 species of milkweeds (Asclepias and Gomphocarpus). Maximum-likelihood analyses of character evolution revealed three major patterns. First, consistent with the defense-escalation hypothesis, the diversification of the milkweeds was associated with a trend for increasing phenolic production; this pattern was reversed (a declining evolutionary trend) for cardenolides, toxins sequestered by specialist herbivores. Second, phylogenetically independent correlations existed among phenolic classes across species. For example, coumaric acid derivatives showed negatively correlated evolution with caffeic acid derivatives, and this was likely driven by the fact that the former are used as precursors for the latter. In contrast, coumaric acid derivatives were positively correlated with flavonoids, consistent with competition for the precursor p-coumaric acid. Finally, of the phenolic classes, only flavonoids showed correlated evolution (positive) with cardenolides, consistent with a physiological and evolutionary link between the two via malonate. Thus, this study presents a rigorous test of the defense-escalation hypothesis and a novel phylogenetic approach to understanding the long-term persistence of physiological constraints on secondary metabolism.

  14. GEOMORPHOLOGICAL ECOGEOGRAPHICAL VARIABLES DEFINIG FEATURES OF ECOLOGICAL NICHE OF COMMON MILKWEED (ASCLEPIAS SYRIACA L.

    Directory of Open Access Journals (Sweden)

    O. M. Kunah

    2016-04-01

    Full Text Available The role of geomorphological ecogeographical variables have been shown, which are received by means of the digital elevation model created on the basis of remote sensing data as markers of an ecological niche of weeds on an example common milkweed (Asclepias syriaca L.. The research range chooses territory which is in settlement Vovnjanka district (the Poltava region. The range has the linear sizes of 26 kilometres in a direction from the east on the west and 15 kilometres in a direction from the north on the south, the range total area makes 390 км2. As geomorphological variables the topographical wetness index, topographic position index, mass balance index, erosion LS-factor, direct and disseminated insolation, altitude above channel network, multiresolution valley bottom flatness, multiresolution ridge top flatness index, vector ruggedness measure have been considered. It is established, that on set of the geomorphological indicators received by means of digital model of a relief, it is possible to assert, that within a separate agricultural field a wide variety of microconditions which is caused by relief features is formed. Possibly, the variation of thermal and water modes, moisture redistribution, and also productivity mechanical processings of soil and efforts under the control of number of weeds make a background in which limits there is possible a moving of weed plants, including common milkweed.

  15. Impairment of leaf photosynthesis after insect herbivory or mechanical injury on common milkweed, Asclepias syriaca.

    Science.gov (United States)

    Delaney, K J; Haile, F J; Peterson, R K D; Higley, L G

    2008-10-01

    Insect herbivory has variable consequences on plant physiology, growth, and reproduction. In some plants, herbivory reduces photosynthetic rate (Pn) activity on remaining tissue of injured leaves. We sought to better understand the influence of leaf injury on Pn of common milkweed, Asclepias syriaca (Asclepiadaceae), leaves. Initially, we tested whether Pn reductions occurred after insect herbivory or mechanical injury. We also (1) examined the duration of photosynthetic recovery, (2) compared mechanical injury with insect herbivory, (3) studied the relationship between leaf Pn with leaf injury intensity, and (4) considered uninjured leaf compensatory Pn responses neighboring an injured leaf. Leaf Pn was significantly reduced on mechanically injured or insect-fed leaves in all reported experiments except one, so some factor(s) (cardiac glycoside induction, reproductive investment, and water stress) likely interacts with leaf injury to influence whether Pn impairment occurs. Milkweed tussock moth larval herbivory, Euchaetes egle L. (Arctiidae), impaired leaf Pn more severely than mechanical injury in one experiment. Duration of Pn impairment lasted > 5 d to indicate high leaf Pn sensitivity to injury, but Pn recovery occurred within 13 d in one experiment. The degree of Pn reduction was more severe from E. egle herbivory than similar levels of mechanical tissue removal. Negative linear relationships characterized leaf Pn with percentage tissue loss from single E. egle-fed leaves and mechanically injured leaves and suggested that the signal to trigger leaf Pn impairment on remaining tissue of an injured leaf was amplified by additional tissue loss. Finally, neighboring uninjured leaves to an E. egle-fed leaf had a small (approximately 10%) degree of compensatory Pn to partly offset tissue loss and injured leaf Pn impairment.

  16. Different rates of defense evolution and niche preferences in clonal and nonclonal milkweeds (Asclepias spp.).

    Science.gov (United States)

    Pellissier, Loïc; Litsios, Glenn; Fishbein, Mark; Salamin, Nicolas; Agrawal, Anurag A; Rasmann, Sergio

    2016-02-01

    Given the dual role of many plant traits to tolerate both herbivore attack and abiotic stress, the climatic niche of a species should be integrated into the study of plant defense strategies. Here we investigate the impact of plant reproductive strategy and components of species' climatic niche on the rate of chemical defense evolution in the milkweeds using a common garden experiment of 49 species. We found that across Asclepias species, clonal reproduction repeatedly evolved in lower temperature conditions, in species generally producing low concentrations of a toxic defense (cardenolides). Additionally, we found that rates of cardenolide evolution were lower for clonal than for nonclonal species. We thus conclude that because the clonal strategy is based on survival, long generation times, and is associated with tolerance of herbivory, it may be an alternative to toxicity in colder ecosystems. Taken together, these results indicate that the rate of chemical defense evolution is influenced by the intersection of life-history strategy and climatic niches into which plants radiate. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.

  17. Specificity of herbivore-induced hormonal signaling and defensive traits in five closely related milkweeds (Asclepias spp.).

    Science.gov (United States)

    Agrawal, Anurag A; Hastings, Amy P; Patrick, Eamonn T; Knight, Anna C

    2014-07-01

    Despite the recognition that phytohormonal signaling mediates induced responses to herbivory, we still have little understanding of how such signaling varies among closely related species and may generate herbivore-specific induced responses. We studied closely related milkweeds (Asclepias) to link: 1) plant damage by two specialist chewing herbivores (milkweed leaf beetles Labidomera clivicolis and monarch caterpillars Danaus plexippus); 2) production of the phytohormones jasmonic acid (JA), salicylic acid (SA), and abscisic acid (ABA); 3) induction of defensive cardenolides and latex; and 4) impacts on Danaus caterpillars. We first show that A. syriaca exhibits induced resistance following monarch herbivory (i.e., reduced monarch growth on previously damaged plants), while the defensively dissimilar A. tuberosa does not. We next worked with a broader group of five Asclepias, including these two species, that are highly divergent in defensive traits yet from the same clade. Three of the five species showed herbivore-induced changes in cardenolides, while induced latex was found in four species. Among the phytohormones, JA and ABA showed specific responses (although they generally increased) to insect species and among the plant species. In contrast, SA responses were consistent among plant and herbivore species, showing a decline following herbivore attack. Jasmonic acid showed a positive quantitative relationship only with latex, and this was strongest in plants damaged by D. plexippus. Although phytohormones showed qualitative tradeoffs (i.e., treatments that enhanced JA reduced SA), the few significant individual plant-level correlations among hormones were positive, and these were strongest between JA and ABA in monarch damaged plants. We conclude that: 1) latex exudation is positively associated with endogenous JA levels, even among low-latex species; 2) correlations among milkweed hormones are generally positive, although herbivore damage induces a

  18. Effects of seed preparation and oil pressing on milkweed (Asclepias spp.) protein functional properties

    Science.gov (United States)

    The effects of seed cooking and oil processing conditions on functional properties of milkweed seed proteins were determined to identify potential value-added uses for the meal. Milkweed seeds were flaked and then cooked in the seed conditioner at 82°C for 30, 60 or 90 min. Oil was extracted by scre...

  19. Seasonal and diurnal gas exchange differences in ozone-sensitive common milkweed (Asclepias syriaca L.) in relation to ozone uptake.

    Science.gov (United States)

    Bergweiler, Chris; Manning, William J; Chevone, Boris I

    2008-03-01

    Stomatal conductance and net photosynthesis of common milkweed (Asclepias syriaca L.) plants in two different soil moisture regimes were directly quantified and subsequently modeled over an entire growing season. Direct measurements captured the dynamic response of stomatal conductance to changing environmental conditions throughout the day, as well as declining gas exchange and carbon assimilation throughout the growth period beyond an early summer maximum. This phenomenon was observed in plants grown both with and without supplemental soil moisture, the latter of which should theoretically mitigate against harmful physiological effects caused by exposure to ozone. Seasonally declining rates of stomatal conductance were found to be substantial and incorporated into models, making them less susceptible to the overestimations of effective exposure that are an inherent source of error in ozone exposure indices. The species-specific evidence presented here supports the integration of dynamic physiological processes into flux-based modeling approaches for the prediction of ozone injury in vegetation.

  20. Attenuation of the jasmonate burst, plant defensive traits, and resistance to specialist monarch caterpillars on shaded common milkweed (Asclepias syriaca).

    Science.gov (United States)

    Agrawal, Anurag A; Kearney, Emily E; Hastings, Amy P; Ramsey, Trey E

    2012-07-01

    Plant responses to herbivory and light competition are often in opposing directions, posing a potential conflict for plants experiencing both stresses. For sun-adapted species, growing in shade typically makes plants more constitutively susceptible to herbivores via reduced structural and chemical resistance traits. Nonetheless, the impact of light environment on induced resistance has been less well-studied, especially in field experiments that link physiological mechanisms to ecological outcomes. Accordingly, we studied induced resistance of common milkweed (Asclepias syriaca, a sun-adapted plant), and linked hormonal responses, resistance traits, and performance of specialist monarch caterpillars (Danaus plexippus) in varying light environments. In natural populations, plants growing under forest-edge shade showed reduced levels of resistance traits (lower leaf toughness, cardenolides, and trichomes) and enhanced light-capture traits (higher specific leaf area, larger leaves, and lower carbon-to-nitrogen ratio) compared to paired plants in full sun. In a field experiment repeated over two years, only milkweeds growing in full sun exhibited induced resistance to monarchs, whereas plants growing in shade were constitutively more susceptible and did not induce resistance. In a more controlled field experiment, plant hormones were higher in the sun (jasmonic acid, salicylic acid, abscisic acid, indole acidic acid) and were induced by herbivory (jasmonic acid and abscisic acid). In particular, the jasmonate burst following herbivory was halved in plants raised in shaded habitats, and this correspondingly reduced latex induction (but not cardenolide induction). Thus, we provide a mechanistic basis for the attenuation of induced plant resistance in low resource environments. Additionally, there appears to be specificity in these interactions, with light-mediated impacts on jasmonate-induction being stronger for latex exudation than cardenolides.

  1. PHYSICOCHEMICAL PROPERTIES OF THE PROTEOLYTIC ENZYME FROM THE LATEX OF THE MILKWEED, ASCLEPIAS SPECIOSA TORR. SOME COMPARISONS WITH OTHER PROTEASES

    Science.gov (United States)

    Winnick, Theodore; Davis, Alva R.; Greenberg, David M.

    1940-01-01

    1. A study has been made of the properties of a hitherto unreported proteolytic enzyme from the latex of the milkweed, Asclepias speciosa. The new protease has been named asclepain by the authors. 2. The results of chemical, diffusion, and denaturation tests indicate that asclepain is a protein. 3. Like papain, asclepain dots milk and digests most proteins, particularly if they are dissolved in concentrated urea solution. Unlike papain, asclepain did not clot blood. 4. The activation and inhibition phenomena of asclepain resemble those of papain, and seem best explained on the assumption that free sulfhydryl in the enzyme is necessary for proteolytic activity. The sulfhydryl of asclepain appears more labile than that of papain. 5. The measurement of pH-activity curves of asclepain on casein, ovalbumin, hemoglobin, edestin, and ovovitellin showed no definite digestion maxima for most of the undenatured proteins, while in urea solution there were well defined maxima near pH 7.0. Native hemoglobin and ovovitellin were especially undigestible, while native casein was rapidly attacked. 6. Temperature-activity curves were determined for asclepain on hemoglobin, casein, and milk solutions. The optimum temperature was shown to increase with decreasing time of digestion. PMID:19873154

  2. Seasonal and diurnal gas exchange differences in ozone-sensitive common milkweed (Asclepias syriaca L.) in relation to ozone uptake

    International Nuclear Information System (INIS)

    Bergweiler, Chris; Manning, William J.; Chevone, Boris I.

    2008-01-01

    Stomatal conductance and net photosynthesis of common milkweed (Asclepias syriaca L.) plants in two different soil moisture regimes were directly quantified and subsequently modeled over an entire growing season. Direct measurements captured the dynamic response of stomatal conductance to changing environmental conditions throughout the day, as well as declining gas exchange and carbon assimilation throughout the growth period beyond an early summer maximum. This phenomenon was observed in plants grown both with and without supplemental soil moisture, the latter of which should theoretically mitigate against harmful physiological effects caused by exposure to ozone. Seasonally declining rates of stomatal conductance were found to be substantial and incorporated into models, making them less susceptible to the overestimations of effective exposure that are an inherent source of error in ozone exposure indices. The species-specific evidence presented here supports the integration of dynamic physiological processes into flux-based modeling approaches for the prediction of ozone injury in vegetation. - Temporal variation in physiological processes underlying diurnal and seasonal ozone uptake are described for a key ozone bioindicator species of North America

  3. Seasonal and diurnal gas exchange differences in ozone-sensitive common milkweed (Asclepias syriaca L.) in relation to ozone uptake

    Energy Technology Data Exchange (ETDEWEB)

    Bergweiler, Chris [Department of Plant, Soil, and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States)], E-mail: bergweiler@nre.umass.edu; Manning, William J. [Department of Plant, Soil, and Insect Sciences, University of Massachusetts, Amherst, MA 01003 (United States); Chevone, Boris I. [Department of Plant Pathology, Physiology, and Weed Science, Virginia Polytechnic Institute and State University, Blacksburg, VA 24061 (United States)

    2008-03-15

    Stomatal conductance and net photosynthesis of common milkweed (Asclepias syriaca L.) plants in two different soil moisture regimes were directly quantified and subsequently modeled over an entire growing season. Direct measurements captured the dynamic response of stomatal conductance to changing environmental conditions throughout the day, as well as declining gas exchange and carbon assimilation throughout the growth period beyond an early summer maximum. This phenomenon was observed in plants grown both with and without supplemental soil moisture, the latter of which should theoretically mitigate against harmful physiological effects caused by exposure to ozone. Seasonally declining rates of stomatal conductance were found to be substantial and incorporated into models, making them less susceptible to the overestimations of effective exposure that are an inherent source of error in ozone exposure indices. The species-specific evidence presented here supports the integration of dynamic physiological processes into flux-based modeling approaches for the prediction of ozone injury in vegetation. - Temporal variation in physiological processes underlying diurnal and seasonal ozone uptake are described for a key ozone bioindicator species of North America.

  4. Study on the seed production and germination dynamic of common milkweed (Asclepias syriaca L.).

    Science.gov (United States)

    Sárkány, S E; Lehoczky, E; Nagy, P

    2008-01-01

    The common milkweed causes considerable damages on the agricultural and nature conservation areas. The area occupied by this weed is continuously bigger. The common milkweed is spread over North-America between the 35th and 50th degree of western Latitude and 60th 103rd degree of longitude. Millions of hectares are polluted by this weed in the United States. Important is its spread also in Asia (Iraq), in Europe (Carpathian Basin, Poland, Bulgaria, Switzerland, France, Austria, Germany), as well as in the area of the former Soviet Union (Belorussia, The Baltic Countries, Caucasus, and the Ukraine). Though the basic biological characters of this plant are well known, still its control is a significant problem, the damages increase on the areas occupied by this weed. We collect seed samples from several Hungarian areas in 2007. After the sampling we determined the average sprout length and the number of follicle as well as the average seed numbers in the follicle. We determined also the weight of thousand seeds of the resultant seed samples. At natural circumstances the seedlings appear at a soil temperature of 15 degrees C during the end of April and first week of May. Under Laboratory circumstances the dormancy of the seeds ceases continuously from November on, germinate at a temperature of 20-30 degrees C, the maximum germination can be achieved in the first part of April. At January we started germination examinations with the seeds in Petri dish, among laboratory condition.

  5. Self-pollination rate and floral-display size in Asclepias syriaca (Common Milkweed) with regard to floral-visitor taxa.

    Science.gov (United States)

    Howard, Aaron F; Barrows, Edward M

    2014-06-23

    Animals fertilize thousands of angiosperm species whose floral-display sizes can significantly influence pollinator behavior and plant reproductive success. Many studies have measured the interactions among pollinator behavior, floral-display size, and plant reproductive success, but few studies have been able to separate the effects of pollinator behavior and post-pollination processes on angiosperm sexual reproduction. In this study, we utilized the highly self-incompatible pollinium-pollination system of Asclepias syriaca (Common Milkweed) to quantify how insect visitors influenced male reproductive success measured as pollen removal, female reproductive success measured as pollen deposition, and self-pollination rate. We also determined how floral-display size impacts both visitor behavior and self-pollination rate. Four insect taxonomic orders visited A. syriaca: Coleoptera, Diptera, Hymenoptera, and Lepidoptera. We focused on three groups of visitor taxa within two orders (Hymenoptera and Lepidoptera) with sample sizes large enough for quantitative analysis: Apis mellifera (Western Honey Bee), Bombus spp. (bumble bees) and lepidopterans (butterflies and moths). Qualitatively, lepidopterans had the highest pollinator importance values, but the large variability in the lepidopteran data precluded meaningful interpretation of much of their behavior. The introduced A. mellifera was the most effective and most important diurnal pollinator with regard to both pollen removal and pollen deposition. However, when considering the self-incompatibility of A. syriaca, A. mellifera was not the most important pollinator because of its high self-pollination rate as compared to Bombus spp. Additionally, the rate of self-pollination increased more rapidly with the number of flowers per inflorescence in A. mellifera than in the native Bombus spp. Apis mellifera's high rate of self-pollination may have significant negative effects on both male and female reproductive successes

  6. PHYSICOCHEMICAL PROPERTIES OF THE PROTEOLYTIC ENZYME FROM THE LATEX OF THE MILKWEED, ASCLEPIAS SPECIOSA TORR. SOME COMPARISONS WITH OTHER PROTEASES

    Science.gov (United States)

    Winnick, Theodore; Davis, Alva R.; Greenberg, David M.

    1940-01-01

    1. The kinetics of milk clotting by asclepain, the protease of Asclepias speciosa, were investigated. At higher concentrations of enzyme, the clotting time was inversely proportional to the enzyme concentration. 2. The digestion of casein and hemoglobin in 6.6 M urea by asclepain follows the second order reaction rate. The rate was roughly second order for casein in water. 3. Evaluation of the nature of the enzyme-substrate intermediate indicates that one molecule of asclepain combines with one molecule of casein or hemoglobin in urea solution. 4. Inhibition by the reaction products was deduced from the fact that the digestion velocity of hemoglobin in urea solution varied with the asclepain concentration in agreement with the Schütz-Borissov rule. PMID:19873155

  7. Learning in two butterfly species when using flowers of the tropical milkweed Asclepias curassavica: No benefits for pollination.

    Science.gov (United States)

    Ramos, Bruna de Cássia Menezes; Rodríguez-Gironés, Miguel Angel; Rodrigues, Daniela

    2017-08-08

    The ability of insect visitors to learn to manipulate complex flowers has important consequences for foraging efficiency and plant fitness. We investigated learning by two butterfly species, Danaus erippus and Heliconius erato , as they foraged on the complex flowers of Asclepias curassavica , as well as the consequences for pollination. To examine learning with respect to flower manipulation, butterflies were individually tested during four consecutive days under insectary conditions. At the end of each test, we recorded the number of pollinaria attached to the body of each butterfly and scored visited flowers for numbers of removed and inserted pollinia. We also conducted a field study to survey D. erippus and H. erato visiting flowers of A. curassavica , as well as to record numbers of pollinaria attached to the butterflies' bodies, and surveyed A. curassavica plants in the field to inspect flowers for pollinium removal and insertion. Learning improves the ability of both butterfly species to avoid the nonrewarding flower parts and to locate nectar more efficiently. There were no experience effects, for either species, on the numbers of removed and inserted pollinia. Heliconius erato removed and inserted more pollinia than D. erippus . For both butterfly species, pollinium removal was higher than pollinium insertion. This study is the first to show that Danaus and Heliconius butterflies can learn to manipulate complex flowers, but this learning ability does not confer benefits to pollination in A. curassavica . © 2017 Botanical Society of America.

  8. Cercosporoid leaf pathogens from whorled milkweed and spineless safflower in California

    NARCIS (Netherlands)

    Koike, S.K.; Baameur, A.; Groenewald, J.Z.; Crous, P.W.

    2011-01-01

    Two cercosporoid species are respectively described from Mexican whorled milkweed (Asclepias fascicularis), and spineless safflower (Carthamus tinctorius) from California. Passalora californica represents a new pathogen on Asclepias fascicularis, while Ramularia cynarae is confirmed on Carthamus

  9. Ecogeographical determinants of the ecological niche of the common milkweed (Asclepias syriaca on the basis of indices of remote sensing of land images

    Directory of Open Access Journals (Sweden)

    O. M. Kunah

    2016-03-01

    Full Text Available The patterns of variation in vegetative indices received by means of data of remote land sensing are described as being dependant on geomorphological predictors and the sizes of agricultural fields in an experimental polygon within Poltava region. The possibilities of application of vegetative indices have been explored through ecogeographical determinants of the ecological niche of the common milkweed (Asclepias syriaca L. and other weeds. On the basis of images of the land surface taken on 23 March and 27 August 2015 by the sensor control Operational Land Imager (OLI, installed on the satellite Landsat 8, vegetative indices have been calculated (AC-Index – aerosol/coastal index, Hydrothermal Composite, NDTI – Normalized Difference Tillage Index, NDVI – Normalized Difference Vegetation Index, VI – Vegetation Index, MNDW – Modified Normalized Difference Water Index, LSWI – Land Surface Water Index, NBR – Normalized Burn Ratio, M15. The data obtained have been subjected to principal component analysis and the revealed principal components have been interpreted with the help of regression analysis, in which geomorphological variables have been applied as predictors. It was possible to explain the trends of variability of the vegetative cover, formalized in the form of the principal component, by means of indices which quantitatively characterise features of relief. The various aspects of variation of vegetative cover have been shown to be characterised by the specificity of the influence of relief factors. A prominent aspect of the variation of the vegetative cover of agroecosystems is variability within a field. The degree of a variation of conditions is proportional to the size of a field. Large fields occupy level plain positions. In turn, within small fields sources of variation are changes in ecological conditions which arise owing to unevenness of relief, which increases in proximity to gullies and ravines. We have identified

  10. Effects of Cooking and Screw-Pressing on Functional Properties of Protein in Milkweed (Asclepias spp.) Seed Meals and Press Cakes

    Science.gov (United States)

    This study determined the effects of oil processing conditions on functional properties of milkweed seed proteins to evaluate their potential for value-added uses. Flaked milkweed seeds were cooked at 82 degrees C (180 degrees F) for 30, 60 or 90 min in the seed conditioner, and then screw-pressed ...

  11. Propagating native milkweeds for restoring monarch butterfly habitat

    Science.gov (United States)

    Thomas D. Landis; R. Kasten. Dumroese

    2015-01-01

    The number of monarch butterflies, charismatic nomads of North America, is rapidly declining. Milkweeds (Asclepias spp.), which are the sole food source for monarch caterpillars, have also experienced a decline throughout the breeding range of this butterfly. Milkweeds can be grown from seeds or vegetatively from root cuttings or rhizomes. Seed germination is often...

  12. Floral function: effects of traits on pollinators, male and female pollination success, and female fitness across three species of milkweeds (Asclepias).

    Science.gov (United States)

    La Rosa, Raffica J; Conner, Jeffrey K

    2017-01-01

    Central questions in plant reproductive ecology are whether the functions of floral traits in hermaphrodites create conflict between sexes that could slow evolution, and whether individual floral traits function in pollinator attraction, efficiency, or both. We studied how floral traits affect pollinator visitation and efficiency, and how they affect male and female function and female fitness within and across three Asclepias species that differ in floral morphology. Using separate multiple regressions, we regressed pollen removal, deposition, and fruit number onto six floral traits. We also used path analyses integrating these variables with pollinator visitation data for two of the species to further explore floral function and its effects on fruit production. Most traits affected male pollination success only, and these effects often differed between species. The exception was increased slit length, which increased pollinia insertion in two of the species. There were no interspecific differences in the effects of the traits on female pollination success. All traits except horn reach affected pollination efficiency in at least one species, and horn reach and two hood dimensions were the only traits to affect pollinator attraction, but in just one species. Traits tended to function in only one sex, and more traits affected function through pollinator efficiency than through attraction. There was no significant link between female pollination success and female fitness in any of the three species; this pattern is consistent with fruit production not being limited by pollen deposition. © 2017 Botanical Society of America.

  13. Cercosporoid leaf pathogens from whorled milkweed and spineless safflower in California.

    Science.gov (United States)

    Koike, Steven T; Baameur, Aziz; Groenewald, Johannes Z; Crous, Pedro W

    2011-06-01

    Two cercosporoid species are respectively described from Mexican whorled milkweed (Asclepias fascicularis), and spineless safflower (Carthamus tinctorius) from California. Passalora californica represents a new pathogen on Asclepias fascicularis, while Ramularia cynarae is confirmed on Carthamus tinctorius and Cynara cardunculus (Asteraceae), and an epitype designated. Pathogenicity is also established for both pathogens based on Koch's postulate.

  14. Synthesis, rheological characterization, and constitutive modeling of polyhydroxy triglycerides derived from milkweed oil.

    Science.gov (United States)

    Harry-O'kuru, R E; Carriere, C J

    2002-05-22

    Asclepias syriaca L., the common milkweed, is a new industrial crop. The seed contains about 20-30 wt % of a highly unsaturated oil having unusual fatty acids. Exploring value-added products from the oil, milkweed triglycerides have been oxidized by in situ performic acid to the polyoxirane and polyhydroxy triglycerides (PHTG). The rheological properties of milkweed PHTG were characterized in various shear flows. Milkweed PHTG displayed nonlinear viscoelastic behavior at applied strains greater than 1%. Milkweed PHTG was found to obey time-strain separability. A nonlinear Wagner constitutive model was used successfully to qualitatively predict the behavior of milkweed PHTG in both start-up and cessation of steady-state shear flow.

  15. Antioxidation behavior of milkweed oil 4-hydroxy-3-methyoxycinnamate esters in phospholipid bilayers

    Science.gov (United States)

    Milkweed (Asclepia syriaca) has seed oil that is rich in polyunsaturated triacylglycerides that contain olefinic groups. The olefinic groups can be chemically oxidized to form either epoxy or polyhydroxy triacylglycerides that can be esterified with trans-4-hydroxy-3-methoxoycinnamic acid, commonly...

  16. Interspecific variation within the genus Asclepias in response to herbivory by a phloem-feeding insect herbivore.

    Science.gov (United States)

    Zehnder, Caralyn B; Hunter, Mark D

    2007-11-01

    Induced plant responses to leaf-chewing insects have been well studied, but considerably less is known about the effects of phloem-feedings insects on induction. In a set of laboratory experiments, we examined density-dependent induction by the milkweed-oleander aphid, Aphis nerii, of putative defenses in four milkweed species (Asclepias incarnata, Asclepias syriaca, Asclepias tuberosa, and Asclepias viridis). We hypothesized that high aphid density would lead to increased cardenolide expression in species with low constitutive levels of cardenolides (e.g., A. tuberosa), but that there would be no induction in high constitutive cardenolide species (e.g., A. viridis). Based on previous studies, we did not expect cardenolide induction in A. incarnata. Contrary to our predictions, we observed feeding-induced declines of cardenolide concentrations in A. viridis. Cardenolide concentrations did not respond to aphid feeding in the other three milkweed species. Aphids also caused reductions in biomass accumulation by two of four Asclepias species, A. viridis and A. incarnata. High aphid density led to a decrease in A. viridis foliar nitrogen concentration. However, aphids had no effect on the defensive chemistry, growth, or nutritional quality of either A. syriaca or A. tuberosa. Our results highlight that congeneric plant species may respond differently to the same levels of herbivore damage.

  17. Evolutionary assembly of the milkweed fauna: cytochrome oxidase I and the age of Tetraopes beetles.

    Science.gov (United States)

    Farrell, B D

    2001-03-01

    The insects that feed on the related plant families Apocynaceae and Asclepiadaceae (here collectively termed "milkweeds") comprise a "component community" of highly specialized, distinctive lineages of species that frequently sequester toxic cardiac glycosides from their host plants for defense against predators and are thus often aposematic, advertising their consequent unpalatability. Such sets of specialized lineages provide opportunities for comparative studies of the rate of adaptation, diversification, and habitat-related effects on molecular evolution. The cerambycid genus Tetraopes is the most diverse of the new world milkweed herbivores and the species are generally host specific, being restricted to single, different species of Asclepias, more often so than most other milkweed insects. Previous work revealed correspondence between the phylogeny of these beetles and that of their hosts. The present study provides analyses of near-complete DNA sequences for Tetraopes and relatives that are used to establish a molecular clock and temporal framework for Tetraopes evolution with their milkweed hosts. Copyright 2001 Academic Press.

  18. Horizontal transfer of DNA from the mitochondrial to the plastid genome and its subsequent evolution in milkweeds (Apocynaceae)

    Science.gov (United States)

    Shannon C.K. Straub; Richard C. Cronn; Christopher Edwards; Mark Fishbein; Aaron. Liston

    2013-01-01

    Horizontal gene transfer (HGT) of DNA from the plastid to the nuclear and mitochondrial genomes of higher plants is a common phenomenon; however, plastid genomes (plastomes) are highly conserved and have generally been regarded as impervious to HGT. We sequenced the 158 kb plastome and the 690 kb mitochondrial genome of common milkweed (Asclepias syriaca [Apocynaceae...

  19. Generalised pollination systems for three invasive milkweeds in Australia.

    Science.gov (United States)

    Ward, M; Johnson, S D

    2013-05-01

    Because most plants require pollinator visits for seed production, the ability of an introduced plant species to establish pollinator relationships in a new ecosystem may have a central role in determining its success or failure as an invader. We investigated the pollination ecology of three milkweed species - Asclepias curassavica, Gomphocarpus fruticosus and G. physocarpus - in their invaded range in southeast Queensland, Australia. The complex floral morphology of milkweeds has often been interpreted as a general trend towards specialised pollination requirements. Based on this interpretation, invasion by milkweeds contradicts the expectation than plant species with specialised pollination systems are less likely to become invasive that those with more generalised pollination requirements. However, observations of flower visitors in natural populations of the three study species revealed that their pollination systems are essentially specialised at the taxonomic level of the order, but generalised at the species level. Specifically, pollinators of the two Gomphocarpus species included various species of Hymenoptera (particularly vespid wasps), while pollinators of A. curassavica were primarily Lepidoptera (particularly nymphalid butterflies). Pollinators of all three species are rewarded with copious amounts of highly concentrated nectar. It is likely that successful invasion by these three milkweed species is attributable, at least in part, to their generalised pollinator requirements. The results of this study are discussed in terms of how data from the native range may be useful in predicting pollination success of species in a new environment. © 2012 German Botanical Society and The Royal Botanical Society of the Netherlands.

  20. Evolution of specialization: a phylogenetic study of host range in the red milkweed beetle (Tetraopes tetraophthalmus).

    Science.gov (United States)

    Rasmann, Sergio; Agrawal, Anurag A

    2011-06-01

    Specialization is common in most lineages of insect herbivores, one of the most diverse groups of organisms on earth. To address how and why specialization is maintained over evolutionary time, we hypothesized that plant defense and other ecological attributes of potential host plants would predict the performance of a specialist root-feeding herbivore (the red milkweed beetle, Tetraopes tetraophthalmus). Using a comparative phylogenetic and functional trait approach, we assessed the determinants of insect host range across 18 species of Asclepias. Larval survivorship decreased with increasing phylogenetic distance from the true host, Asclepias syriaca, suggesting that adaptation to plant traits drives specialization. Among several root traits measured, only cardenolides (toxic defense chemicals) correlated with larval survival, and cardenolides also explained the phylogenetic distance effect in phylogenetically controlled multiple regression analyses. Additionally, milkweed species having a known association with other Tetraopes beetles were better hosts than species lacking Tetraopes herbivores, and milkweeds with specific leaf area values (a trait related to leaf function and habitat affiliation) similar to those of A. syriaca were better hosts than species having divergent values. We thus conclude that phylogenetic distance is an integrated measure of phenotypic and ecological attributes of Asclepias species, especially defensive cardenolides, which can be used to explain specialization and constraints on host shifts over evolutionary time.

  1. Investigation of some characteristics of polyhydroxy milkweed triglycerides and their acylated derivatives in relation to lubricity.

    Science.gov (United States)

    Harry-O'kuru, Rogers E; Biresaw, Girma; Cermak, Steven C; Gordon, Sherald H; Vermillion, Karl

    2011-05-11

    Most industrial lubricants are derived from nonrenewable petroleum-based sources. As useful as these lubricants are, their unintended consequences are the pollution of the Earth's environment as a result of the slow degradation of the spent materials. Native seed oils, on the other hand, are renewable and are also biodegradable in the environment, but these oils often suffer a drawback in having lower thermal stability and a shorter shelf life because of the intrinsic -C═C- unsaturation in their structures. This drawback can be overcome, yet the inherent biodegradative property retained, by appropriate derivatization of the oil. Pursuant to this, this study investigated derivatized polyhydroxy milkweed oil to assess its suitability as lubricant. The milkweed plant is a member of the Asclepiadaceae, a family with many genera including the common milkweeds, Asclepias syriaca L., Asclepias speciosa L., Asclepias tuberosa L., etc. The seeds of these species contain mainly C-18 triglycerides that are highly unsaturated, 92%. The olefinic character of this oil has been chemically modified by generating polyhydroxy triglycerides (HMWO) that show high viscosity and excellent moisturizing characteristics. In this work, HMWO have been chemically modified by esterifying their hydroxyl groups with acyl groups of various chain lengths (C2-C5). The results of investigation into the effect of the acyl derivatives' chemical structure on kinematic and dynamic viscosity, oxidation stability, cold-flow (pour point, cloud point) properties, coefficient of friction, wear, and elastohydrodynamic film thickness are discussed.

  2. Climate Change May Alter Breeding Ground Distributions of Eastern Migratory Monarchs (Danaus plexippus) via Range Expansion of Asclepias Host Plants

    Science.gov (United States)

    Lemoine, Nathan P.

    2015-01-01

    Climate change can profoundly alter species’ distributions due to changes in temperature, precipitation, or seasonality. Migratory monarch butterflies (Danaus plexippus) may be particularly susceptible to climate-driven changes in host plant abundance or reduced overwintering habitat. For example, climate change may significantly reduce the availability of overwintering habitat by restricting the amount of area with suitable microclimate conditions. However, potential effects of climate change on monarch northward migrations remain largely unknown, particularly with respect to their milkweed (Asclepias spp.) host plants. Given that monarchs largely depend on the genus Asclepias as larval host plants, the effects of climate change on monarch northward migrations will most likely be mediated by climate change effects on Asclepias. Here, I used MaxEnt species distribution modeling to assess potential changes in Asclepias and monarch distributions under moderate and severe climate change scenarios. First, Asclepias distributions were projected to extend northward throughout much of Canada despite considerable variability in the environmental drivers of each individual species. Second, Asclepias distributions were an important predictor of current monarch distributions, indicating that monarchs may be constrained as much by the availability of Asclepias host plants as environmental variables per se. Accordingly, modeling future distributions of monarchs, and indeed any tightly coupled plant-insect system, should incorporate the effects of climate change on host plant distributions. Finally, MaxEnt predictions of Asclepias and monarch distributions were remarkably consistent among general circulation models. Nearly all models predicted that the current monarch summer breeding range will become slightly less suitable for Asclepias and monarchs in the future. Asclepias, and consequently monarchs, should therefore undergo expanded northern range limits in summer months

  3. Climate change may alter breeding ground distributions of eastern migratory monarchs (Danaus plexippus via range expansion of Asclepias host plants.

    Directory of Open Access Journals (Sweden)

    Nathan P Lemoine

    Full Text Available Climate change can profoundly alter species' distributions due to changes in temperature, precipitation, or seasonality. Migratory monarch butterflies (Danaus plexippus may be particularly susceptible to climate-driven changes in host plant abundance or reduced overwintering habitat. For example, climate change may significantly reduce the availability of overwintering habitat by restricting the amount of area with suitable microclimate conditions. However, potential effects of climate change on monarch northward migrations remain largely unknown, particularly with respect to their milkweed (Asclepias spp. host plants. Given that monarchs largely depend on the genus Asclepias as larval host plants, the effects of climate change on monarch northward migrations will most likely be mediated by climate change effects on Asclepias. Here, I used MaxEnt species distribution modeling to assess potential changes in Asclepias and monarch distributions under moderate and severe climate change scenarios. First, Asclepias distributions were projected to extend northward throughout much of Canada despite considerable variability in the environmental drivers of each individual species. Second, Asclepias distributions were an important predictor of current monarch distributions, indicating that monarchs may be constrained as much by the availability of Asclepias host plants as environmental variables per se. Accordingly, modeling future distributions of monarchs, and indeed any tightly coupled plant-insect system, should incorporate the effects of climate change on host plant distributions. Finally, MaxEnt predictions of Asclepias and monarch distributions were remarkably consistent among general circulation models. Nearly all models predicted that the current monarch summer breeding range will become slightly less suitable for Asclepias and monarchs in the future. Asclepias, and consequently monarchs, should therefore undergo expanded northern range limits in

  4. Climate change may alter breeding ground distributions of eastern migratory monarchs (Danaus plexippus) via range expansion of Asclepias host plants.

    Science.gov (United States)

    Lemoine, Nathan P

    2015-01-01

    Climate change can profoundly alter species' distributions due to changes in temperature, precipitation, or seasonality. Migratory monarch butterflies (Danaus plexippus) may be particularly susceptible to climate-driven changes in host plant abundance or reduced overwintering habitat. For example, climate change may significantly reduce the availability of overwintering habitat by restricting the amount of area with suitable microclimate conditions. However, potential effects of climate change on monarch northward migrations remain largely unknown, particularly with respect to their milkweed (Asclepias spp.) host plants. Given that monarchs largely depend on the genus Asclepias as larval host plants, the effects of climate change on monarch northward migrations will most likely be mediated by climate change effects on Asclepias. Here, I used MaxEnt species distribution modeling to assess potential changes in Asclepias and monarch distributions under moderate and severe climate change scenarios. First, Asclepias distributions were projected to extend northward throughout much of Canada despite considerable variability in the environmental drivers of each individual species. Second, Asclepias distributions were an important predictor of current monarch distributions, indicating that monarchs may be constrained as much by the availability of Asclepias host plants as environmental variables per se. Accordingly, modeling future distributions of monarchs, and indeed any tightly coupled plant-insect system, should incorporate the effects of climate change on host plant distributions. Finally, MaxEnt predictions of Asclepias and monarch distributions were remarkably consistent among general circulation models. Nearly all models predicted that the current monarch summer breeding range will become slightly less suitable for Asclepias and monarchs in the future. Asclepias, and consequently monarchs, should therefore undergo expanded northern range limits in summer months

  5. 4-Hydroxy-3-methoxycinnamate esters of milkweed oil: synthesis and characterization.

    Science.gov (United States)

    Harry-O'kuru, Rogers E

    2005-11-01

    The common milkweed (Asclepias syriaca L.) is a new industrial crop. Its seed oil (TAG) is highly polyunsaturated. In the search for novel applications for milkweed seed oil, the olefinic groups in the TAG were oxidized to polyhydroxy TAG via epoxidation and subsequent epoxy ring-opening reactions. These polyhydroxy TAG exhibit unique industrially desirable emulsoid properties in water. Esterification of the secondary polyhydroxy functionalities of the TAG derivatives of the oil with trans-4-hydroxy-3-methoxycinnamic acid (ferulic acid) has resulted in the development of novel cinnamate esters of milkweed oil. These cinnamates are also obtainable via direct ring-opening of the epoxy TAG intermediate with ferulic acid. Among the interesting characteristics of the ester derivatives is their UV radiation-absorbing property.

  6. Monarchs (Danaus plexippus) and milkweeds (Asclepias species): The current situation and methods for propagating milkweeds

    Science.gov (United States)

    Tara Luna; R. Kasten Dumroese

    2013-01-01

    An international effort is under way to conserve populations of the monarch butterfly (Danaus plexippus L. [Lepidoptera: Nymphalidae]). Monarchs complete an impressive migration each year, flying from winter roosts on the California coast and the central mountains of Mexico to breeding areas throughout North America. Monarchs depend on habitats along their migratory...

  7. The Isolation of Rubber from Milkweed Leaves. An Introductory Organic Chemistry Lab

    Science.gov (United States)

    Volaric, Lisa; Hagen, John P.

    2002-01-01

    We present an introductory organic chemistry lab in which students isolate rubber from the leaves of milkweed plants (Asclepias syriaca). Students isolated rubber with a recovery of 2.4 ± 1.8% and 1.8 ± 0.7% for the microscale and macroscale procedures, respectively. Infrared spectra of their products were compared with the spectrum of synthetic rubber, cis-polyisoprene. Students tested for elasticity of their product by twisting it on a spatula and pulling; all students found some degree of elasticity.

  8. Induced responses to herbivory and jasmonate in three milkweed species.

    Science.gov (United States)

    Rasmann, Sergio; Johnson, M Daisy; Agrawal, Anurag A

    2009-11-01

    We studied constitutive and induced defensive traits (latex exudation, cardenolides, proteases, and C/N ratio) and resistance to monarch caterpillars (Danaus plexippus) in three closely related milkweed species (Asclepias angustifolia, A. barjoniifolia and A. fascicularis). All traits showed significant induction in at least one of the species. Jasmonate application only partially mimicked the effect of monarch feeding. We found some correspondence between latex and cardenolide content and reduced larval growth. Larvae fed cut leaves of A. angustifolia grew better than larvae fed intact plants. Addition of the cardenolide digitoxin to cut leaves reduced larval growth but ouabain (at the same concentration) had no effect. We, thus, confirm that latex and cardenolides are major defenses in milkweeds, effective against a specialist herbivore. Other traits such as proteases and C/N ratio additionally may be integrated in the defense scheme of those plants. Induction seems to play an important role in plants that have an intermediate level of defense, and we advocate incorporating induction as an additional axis of the plant defense syndrome hypothesis.

  9. Intragenomic polymorphisms among high-copy loci: a genus-wide study of nuclear ribosomal DNA in Asclepias (Apocynaceae).

    Science.gov (United States)

    Weitemier, Kevin; Straub, Shannon C K; Fishbein, Mark; Liston, Aaron

    2015-01-01

    Despite knowledge that concerted evolution of high-copy loci is often imperfect, studies that investigate the extent of intragenomic polymorphisms and comparisons across a large number of species are rarely made. We present a bioinformatic pipeline for characterizing polymorphisms within an individual among copies of a high-copy locus. Results are presented for nuclear ribosomal DNA (nrDNA) across the milkweed genus, Asclepias. The 18S-26S portion of the nrDNA cistron of Asclepias syriaca served as a reference for assembly of the region from 124 samples representing 90 species of Asclepias. Reads were mapped back to each individual's consensus and at each position reads differing from the consensus were tallied using a custom perl script. Low frequency polymorphisms existed in all individuals (mean = 5.8%). Most nrDNA positions (91%) were polymorphic in at least one individual, with polymorphic sites being less frequent in subunit regions and loops. Highly polymorphic sites existed in each individual, with highest abundance in the "noncoding" ITS regions. Phylogenetic signal was present in the distribution of intragenomic polymorphisms across the genus. Intragenomic polymorphisms in nrDNA are common in Asclepias, being found at higher frequency than any other study to date. The high and variable frequency of polymorphisms across species highlights concerns that phylogenetic applications of nrDNA may be error-prone. The new analytical approach provided here is applicable to other taxa and other high-copy regions characterized by low coverage genome sequencing (genome skimming).

  10. Seed dormancy and germination vary within and among species of milkweeds

    Science.gov (United States)

    Kaye, Thomas N; Sandlin, Isaac J; Bahm, Matt A

    2018-01-01

    Abstract Pollinators in general and monarch butterflies in particular are in decline due to habitat loss. Efforts to restore habitats for insects that rely on specific plant groups as larvae or adults depend on the ability of practitioners to grow and produce these plants. Monarch larvae feed exclusively on milkweed species, primarily in the genus Asclepias, making propagation and restoration of these plants crucial for habitat restoration. Seed germination protocols for milkweeds are not well established, in part due to the large number of milkweed species and conflicting reports of seed dormancy in the genus. We tested for seed dormancy and the optimum period of cold stratification in 15 populations of A. speciosa and 1–2 populations of five additional species, including A. asperula, A. fascicularis, A. subulata, A. subverticillata and A. syriaca. We exposed seeds to cold (5 °C) moist conditions for 0, 2, 4, 6 and 8 weeks and then moved them to 15 °C/25 °C alternating temperatures. In A. speciosa, dormancy was detected in eight populations, and this dormancy was broken by 2–4 weeks of cold stratification. The remaining seven populations showed no dormancy. Seed dormancy was also detected in two populations of A. fascicularis (broken by 4–6 weeks of cold stratification) and a single population of A. syriaca (broken by 2 weeks of cold stratification). No dormancy was detected in A. asperula, A. subulata or A. subverticillata. Seed dormancy appears to be widespread in the genus (confirmed in 15 species) but can vary between populations even within the same species. Variation in seed dormancy and cold stratification requirements within and among Asclepias species suggests local adaptation and maternal environments may drive seedling ecology, and that growers should watch for low germination and use cold stratification as needed to maximize seed germination and retain genetic variability in restored populations. PMID:29593856

  11. Characterization of a structurally and functionally diverged acyl-acyl carrier protein desaturase from milkweed seed.

    Science.gov (United States)

    Cahoon, E B; Coughlan, S J; Shanklin, J

    1997-04-01

    A cDNA for a structurally variant acyl-acyl carrier protein (ACP) desaturase was isolated from milkweed (Asclepias syriaca) seed, a tissue enriched in palmitoleic (16:1delta9)* and cis-vaccenic (18:1delta11) acids. Extracts of Escherichia coli that express the milkweed cDNA catalyzed delta9 desaturation of acyl-ACP substrates, and the recombinant enzyme exhibited seven- to ten-fold greater specificity for palmitoyl (16:0)-ACP and 30-fold greater specificity for myristoyl (14:0)-ACP than did known delta9-stearoyl (18:0)-ACP desaturases. Like other variant acyl-ACP desaturases reported to date, the milkweed enzyme contains fewer amino acids near its N-terminus compared to previously characterized delta9-18:0-ACP desaturases. Based on the activity of an N-terminal deletion mutant of a delta9-18:0-ACP desaturase, this structural feature likely does not account for differences in substrate specificities.

  12. Milkweed (Gentianales: Apocynaceae): a farmscape resource for increasing parasitism of stink bugs (Hemiptera: Pentatomidae) and providing nectar to insect pollinators and monarch butterflies.

    Science.gov (United States)

    Tillman, P G; Carpenter, J E

    2014-04-01

    In peanut-cotton farmscapes in Georgia, the stink bugs Nezara viridula (L.) and Chinavia hilaris (Say) (Hemiptera: Pentatomidae) and the leaffooted bug, Leptoglossus phyllopus (L.) (Hemiptera: Coreidae), disperse at crop-to-crop interfaces to feed on bolls in cotton. The main objective of this study was to determine whether insecticide-free tropical milkweed (Asclepias curassavica L.), a nectar-producing plant, can increase parasitism of these bugs by Trichopoda pennipes (F.) (Diptera: Tachinidae) and provide nectar to monarch butterflies and insect pollinators in these farmscapes. Peanut-cotton plots with and without flowering milkweed plants were established in 2009 and 2010. Adult T. pennipes, monarch butterflies, honey bees, and native insect pollinators readily fed on floral nectar of milkweed. Monarch larvae feeding on milkweed vegetation successfully developed into pupae. In 2009, N. viridula was the primary host of T. pennipes in cotton, and parasitism of this pest by the parasitoid was significantly higher in milkweed cotton (61.6%) than in control cotton (13.3%). In 2010, parasitism of N. viridula, C. hilaris, and L. phyllopus by T. pennipes was significantly higher in milkweed cotton (24.0%) than in control cotton (1.1%). For both years of the study, these treatment differences were not owing to a response by the parasitoid to differences in host density, because density of hosts was not significantly different between treatments. In conclusion, incorporation of milkweed in peanut-cotton plots increased stink bug parasitism in cotton and provided nectar to insect pollinators and monarch butterflies.

  13. Cytotoxicity of cardenolides and cardenolide glycosides from Asclepias curassavica.

    Science.gov (United States)

    Li, Jun-Zhu; Qing, Chen; Chen, Chang-Xiang; Hao, Xiao-Jiang; Liu, Hai-Yang

    2009-04-01

    A new cardenolide, 12beta,14beta-dihydroxy-3beta,19-epoxy-3alpha-methoxy-5alpha-card-20(22)-enolide (6), and a new doubly linked cardenolide glycoside, 12beta-hydroxycalotropin (13), together with eleven known compounds, coroglaucigenin (1), 12beta-hydroxycoroglaucigenin (2), calotropagenin (3), desglucouzarin (4), 6'-O-feruloyl-desglucouzarin (5), calotropin (7), uscharidin (8), asclepin (9), 16alpha-hydroxyasclepin (10), 16alpha-acetoxycalotropin (11), and 16alpha-acetoxyasclepin (12), were isolated from the aerial part of ornamental milkweed, Asclepias curassavica and chemically elucidated through spectral analyses. All the isolates were evaluated for their cytotoxic activity against HepG2 and Raji cell lines. The results showed that asclepin (9) had the strongest cytotoxic activity with an IC(50) value of 0.02 microM against the two cancer cell lines and the new compound 13 had significant cytotoxic activity with IC(50) values of 0.69 and 1.46 microM, respectively.

  14. Corneal Toxicity Following Exposure to Asclepias Tuberosa.

    Science.gov (United States)

    Mikkelsen, Lauge Hjorth; Hamoudi, Hassan; Gül, Cigdem Altuntas; Heegaard, Steffen

    2017-01-01

    To present a case of corneal toxicity following exposure to milky plant latex from Asclepias tuberosa. A 70-year-old female presented with blurred vision and pain in her left eye after handling an Ascepias tuberosa . Clinical examination revealed a corneal stromal oedema with small epithelial defects. The corneal endothelium was intact and folds in Descemets membrane were observed. The oedema was treated with chloramphenicol, dexamethasone and scopolamine. The corneal oedema had appeared after corneal exposure to the plant, Asclepias tuberosa , whose latex contains cardenolides that inhibit the Na + / K + -ATPase in the corneal endothelium. The oedema resolved after 96 hours. After nine months the best corrected visual acuity was 20/20. Corneal toxicity has previously been reported for plants of the Asclepias family. This is a rare case describing severe corneal toxicity caused by exposure to latex from Asclepias tuberosa . Handling of plants of the Asclepias family should be kept as a differential diagnosis in cases of acute corneal toxicity.

  15. Characterization of papain-like isoenzymes from latex of Asclepias curassavica by molecular biology validated by proteomic approach.

    Science.gov (United States)

    Obregón, Walter D; Liggieri, Constanza S; Trejo, Sebastian A; Avilés, Francesc X; Vairo-Cavalli, Sandra E; Priolo, Nora S

    2009-01-01

    Latices from Asclepias spp are used in wound healing and the treatment of some digestive disorders. These pharmacological actions have been attributed to the presence of cysteine proteases in these milky latices. Asclepias curassavica (Asclepiadaceae), "scarlet milkweed" is a perennial subshrub native to South America. In the current paper we report a new approach directed at the selective biochemical and molecular characterization of asclepain cI (acI) and asclepain cII (acII), the enzymes responsible for the proteolytic activity of the scarlet milkweed latex. SDS-PAGE spots of both purified peptidases were digested with trypsin and Peptide Mass Fingerprints (PMFs) obtained showed no equivalent peptides. No identification was possible by MASCOT search due to the paucity of information concerning Asclepiadaceae latex cysteine proteinases available in databases. From total RNA extracted from latex samples, cDNA of both peptidases was obtained by RT-PCR using degenerate primers encoding Asclepiadaceae cysteine peptidase conserved domains. Theoretical PMFs of partial polypeptide sequences obtained by cloning (186 and 185 amino acids) were compared with empirical PMFs, confirming that the sequences of 186 and 185 amino acids correspond to acI and acII, respectively. N-terminal sequences of acI and acII, characterized by Edman sequencing, were overlapped with those coming from the cDNA to obtain the full-length sequence of both mature peptidases (212 and 211 residues respectively). Alignment and phylogenetic analysis confirmed that acI and acII belong to the subfamily C1A forming a new group of papain-like cysteine peptidases together with asclepain f from Asclepias fruticosa. We conclude that PMF could be adopted as an excellent tool to differentiate, in a fast and unequivocal way, peptidases with very similar physicochemical and functional properties, with advantages over other conventional methods (for instance enzyme kinetics) that are time consuming and afford less

  16. Analysis and optimization of a synthetic milkweed floral attractant for mosquitoes.

    Science.gov (United States)

    Otienoburu, Philip E; Ebrahimi, Babak; Phelan, P Larry; Foster, Woodbridge A

    2012-07-01

    A pentane extract of flowers of common milkweed, Asclepias syriaca (Asclepiadaceae), elicited significant orientation from both male and female Culex pipiens in a dual-port flight olfactometer. Analysis of the extract by gas chromatography-mass spectrometry revealed six major constituents in order of relative abundance: benzaldehyde, (E)-β-ocimene, phenylacetaldehyde, benzyl alcohol, nonanal, and (E)-2-nonenal. Although not all were collected from the headspace profile of live flowers, a synthetic blend of these six compounds, when presented to mosquitoes in the same levels and proportions that occur in the extract, elicited a response comparable to the extract. Subtractive behavioral bioassays demonstrated that a three-component blend consisting of benzaldehyde, phenylacetaldehyde, and (E)-2-nonenal was as attractive as the full blend. These findings suggest the potential use of synthetic floral-odor blends for monitoring or control of both male and female disease-vectoring mosquitoes.

  17. Molecular characterization, ecology, and epidemiology of a novel Tymovirus in Asclepias viridis from Oklahoma.

    Science.gov (United States)

    Min, Byoung-Eun; Feldman, Tracy S; Ali, Akhtar; Wiley, Graham; Muthukumar, Vijay; Roe, Bruce A; Roossinck, Marilyn; Melcher, Ulrich; Palmer, Michael W; Nelson, Richard S

    2012-02-01

    Native virus-plant interactions require more understanding and their study will provide a basis from which to identify potential sources of emerging destructive viruses in crops. A novel tymovirus sequence was detected in Asclepias viridis (green milkweed), a perennial growing in a natural setting in the Tallgrass Prairie Preserve (TGPP) of Oklahoma. It was abundant within and frequent among A. viridis plants and, to varying extents, within other dicotyledonous and one grass (Panicum virgatum) species obtained from the TGPP. Extracts from A. viridis containing the sequence were infectious to a limited number of species. The virus genome was cloned and determined to be closely related to Kennedya yellow mosaic virus. The persistence of the virus within the Oklahoma A. viridis population was monitored for five successive years. Virus was present in a high percentage of plants within representative areas of the TGPP in all years and was spreading to additional plants. Virus was present in regions adjacent to the TGPP but not in plants sampled from central and south-central Oklahoma. Virus was present in the underground caudex of the plant during the winter, suggesting overwintering in this tissue. The RNA sequence encoding the virus coat protein varied considerably between individual plants (≈3%), likely due to drift rather than selection. An infectious clone was constructed and the virus was named Asclepias asymptomatic virus (AsAV) due to the absence of obvious symptoms on A. viridis.

  18. Oil sorption and retention capacities of thermally-bonded hybrid nonwovens prepared from cotton, kapok, milkweed and polypropylene fibers.

    Science.gov (United States)

    Thilagavathi, G; Praba Karan, C; Das, Dipayan

    2018-08-01

    This work reports on a series of thermally-bonded, hybrid and oil-sorbent nonwovens developed from binary and tertiary mixing of cotton, kapok, and three varieties of milkweed fibers (Asclepias Syriaca, Calotropis Procera and Calotropis Gigantea) and polypropylene fibers. The physical and chemical properties of the fibers were investigated to examine their oleophilic character. It was observed that all the fiber surfaces were covered with natural wax. Further, kapok and milkweed fibers were found to have less cell wall thickness and high void ratio. Oil sorption and retention characteristics of these fibers were studied in loose fibrous form as well as in structured assembly form (thermally-bonded nonwovens) using high density oil and diesel oil. The effects of fiber diameter, fiber cross-sectional shape, fiber surface area and porosity on the oil sorption behavior were discussed. An excellent and a selective oil sorption behavior of milkweed fibers (Calotropis Procera and Calotropis Gigantea) blended with cotton and polypropylene fibers were observed. The maximum oil sorption capacity of the developed thermal bonded nonwoven was 40.16 g/g for high density (HD) oil and 23.00 g/g for diesel oil. Further, a high porosity combined with high surface area played a major role in deciding the oil sorption and retention characteristics. Copyright © 2018 Elsevier Ltd. All rights reserved.

  19. Arbuscular mycorrhizal fungi alter above- and below-ground chemical defense expression differentially among Asclepias species

    Science.gov (United States)

    Vannette, Rachel L.; Hunter, Mark D.; Rasmann, Sergio

    2013-01-01

    Below-ground (BG) symbionts of plants can have substantial influence on plant growth and nutrition. Recent work demonstrates that mycorrhizal fungi can affect plant resistance to herbivory and the performance of above- (AG) and BG herbivores. Although these examples emerge from diverse systems, it is unclear if plant species that express similar defensive traits respond similarly to fungal colonization, but comparative work may inform this question. To examine the effects of arbuscular mycorrhizal fungi (AMF) on the expression of chemical resistance, we inoculated 8 species of Asclepias (milkweed)—which all produce toxic cardenolides—with a community of AMF. We quantified plant biomass, foliar and root cardenolide concentration and composition, and assessed evidence for a growth-defense tradeoff in the presence and absence of AMF. As expected, total foliar and root cardenolide concentration varied among milkweed species. Importantly, the effect of mycorrhizal fungi on total foliar cardenolide concentration also varied among milkweed species, with foliar cardenolides increasing or decreasing, depending on the plant species. We detected a phylogenetic signal to this variation; AMF fungi reduced foliar cardenolide concentrations to a greater extent in the clade including A. curassavica than in the clade including A. syriaca. Moreover, AMF inoculation shifted the composition of cardenolides in AG and BG plant tissues in a species-specific fashion. Mycorrhizal inoculation changed the relative distribution of cardenolides between root and shoot tissue in a species-specific fashion, but did not affect cardenolide diversity or polarity. Finally, a tradeoff between plant growth and defense in non-mycorrhizal plants was mitigated completely by AMF inoculation. Overall, we conclude that the effects of AMF inoculation on the expression of chemical resistance can vary among congeneric plant species, and ameliorate tradeoffs between growth and defense. PMID:24065971

  20. Arbuscular mycorrhizal fungi alter above- and below-ground chemical defense expression differentially among Asclepias species.

    Science.gov (United States)

    Vannette, Rachel L; Hunter, Mark D; Rasmann, Sergio

    2013-01-01

    Below-ground (BG) symbionts of plants can have substantial influence on plant growth and nutrition. Recent work demonstrates that mycorrhizal fungi can affect plant resistance to herbivory and the performance of above- (AG) and BG herbivores. Although these examples emerge from diverse systems, it is unclear if plant species that express similar defensive traits respond similarly to fungal colonization, but comparative work may inform this question. To examine the effects of arbuscular mycorrhizal fungi (AMF) on the expression of chemical resistance, we inoculated 8 species of Asclepias (milkweed)-which all produce toxic cardenolides-with a community of AMF. We quantified plant biomass, foliar and root cardenolide concentration and composition, and assessed evidence for a growth-defense tradeoff in the presence and absence of AMF. As expected, total foliar and root cardenolide concentration varied among milkweed species. Importantly, the effect of mycorrhizal fungi on total foliar cardenolide concentration also varied among milkweed species, with foliar cardenolides increasing or decreasing, depending on the plant species. We detected a phylogenetic signal to this variation; AMF fungi reduced foliar cardenolide concentrations to a greater extent in the clade including A. curassavica than in the clade including A. syriaca. Moreover, AMF inoculation shifted the composition of cardenolides in AG and BG plant tissues in a species-specific fashion. Mycorrhizal inoculation changed the relative distribution of cardenolides between root and shoot tissue in a species-specific fashion, but did not affect cardenolide diversity or polarity. Finally, a tradeoff between plant growth and defense in non-mycorrhizal plants was mitigated completely by AMF inoculation. Overall, we conclude that the effects of AMF inoculation on the expression of chemical resistance can vary among congeneric plant species, and ameliorate tradeoffs between growth and defense.

  1. Arbuscular mycorrhizal fungi alter above- and below-ground chemical defense expression differentially among Asclepias species

    Directory of Open Access Journals (Sweden)

    Rachel L Vannette

    2013-09-01

    Full Text Available Belowground symbionts of plants can have substantial influence on plant growth and nutrition. Recent work demonstrates that mycorrhizal fungi can affect plant resistance to herbivory and the performance of above and belowground herbivores. Although these examples emerge from diverse systems, it is unclear if plant species that express similar defensive traits respond similarly to fungal colonization, but comparative work may inform this question. To examine the effects of arbuscular mycorrhizal fungi (AMF on the expression of chemical resistance, we inoculated 8 species of Asclepias (milkweed--which all produce toxic cardenolides--with a community of AMF. We quantified plant biomass, foliar and root cardenolide concentration and composition, and assessed evidence for a growth-defense tradeoff in the presence and absence of AMF. As expected, total foliar and root cardenolide concentration varied among milkweed species. Importantly, the effect of mycorrhizal fungi on total foliar cardenolide concentration also varied among milkweed species, with foliar cardenolides increasing or decreasing, depending on the plant species. We detected a phylogenetic signal to this variation; AMF fungi reduced foliar cardenolide concentrations to a greater extent in the clade including A. curassavica than in the clade including A. syriaca. Moreover, AMF inoculation shifted the composition of cardenolides in above- and below-ground plant tissues in a species-specific fashion. Mycorrhizal inoculation changed the relative distribution of cardenolides between root and shoot tissue in a species-specific fashion, but did not affect cardenolide diversity or polarity. Finally, a tradeoff between plant growth and defense in non-mycorrhizal plants was mitigated completely by AMF inoculation. Overall, we conclude that the effects of AMF inoculation on the expression of chemical resistance can vary among congeneric plant species, and ameliorate tradeoffs between growth and

  2. Milkweed butterfly resistance to plant toxins is linked to sequestration, not coping with a toxic diet.

    Science.gov (United States)

    Petschenka, Georg; Agrawal, Anurag A

    2015-11-07

    Insect resistance to plant toxins is widely assumed to have evolved in response to using defended plants as a dietary resource. We tested this hypothesis in the milkweed butterflies (Danaini) which have progressively evolved higher levels of resistance to cardenolide toxins based on amino acid substitutions of their cellular sodium-potassium pump (Na(+)/K(+)-ATPase). Using chemical, physiological and caterpillar growth assays on diverse milkweeds (Asclepias spp.) and isolated cardenolides, we show that resistant Na(+)/K(+)-ATPases are not necessary to cope with dietary cardenolides. By contrast, sequestration of cardenolides in the body (as a defence against predators) is associated with the three levels of Na(+)/K(+)-ATPase resistance. To estimate the potential physiological burden of cardenolide sequestration without Na(+)/K(+)-ATPase adaptations, we applied haemolymph of sequestering species on isolated Na(+)/K(+)-ATPase of sequestering and non-sequestering species. Haemolymph cardenolides dramatically impair non-adapted Na(+)/K(+)-ATPase, but had systematically reduced effects on Na(+)/K(+)-ATPase of sequestering species. Our data indicate that major adaptations to plant toxins may be evolutionarily linked to sequestration, and may not necessarily be a means to eat toxic plants. Na(+)/K(+)-ATPase adaptations thus were a potential mechanism through which predators spurred the coevolutionary arms race between plants and insects. © 2015 The Author(s).

  3. Intragenomic polymorphisms among high-copy loci: a genus-wide study of nuclear ribosomal DNA in Asclepias (Apocynaceae

    Directory of Open Access Journals (Sweden)

    Kevin Weitemier

    2015-01-01

    Full Text Available Despite knowledge that concerted evolution of high-copy loci is often imperfect, studies that investigate the extent of intragenomic polymorphisms and comparisons across a large number of species are rarely made. We present a bioinformatic pipeline for characterizing polymorphisms within an individual among copies of a high-copy locus. Results are presented for nuclear ribosomal DNA (nrDNA across the milkweed genus, Asclepias. The 18S-26S portion of the nrDNA cistron of Asclepias syriaca served as a reference for assembly of the region from 124 samples representing 90 species of Asclepias. Reads were mapped back to each individual’s consensus and at each position reads differing from the consensus were tallied using a custom perl script. Low frequency polymorphisms existed in all individuals (mean = 5.8%. Most nrDNA positions (91% were polymorphic in at least one individual, with polymorphic sites being less frequent in subunit regions and loops. Highly polymorphic sites existed in each individual, with highest abundance in the “noncoding” ITS regions. Phylogenetic signal was present in the distribution of intragenomic polymorphisms across the genus. Intragenomic polymorphisms in nrDNA are common in Asclepias, being found at higher frequency than any other study to date. The high and variable frequency of polymorphisms across species highlights concerns that phylogenetic applications of nrDNA may be error-prone. The new analytical approach provided here is applicable to other taxa and other high-copy regions characterized by low coverage genome sequencing (genome skimming.

  4. Milkweed control by food imprinted rabbits.

    Science.gov (United States)

    Ducs, Anita; Kazi, Andrea; Bilkó, Ágnes; Altbäcker, Vilmos

    2016-09-01

    Many species of invasive plants are spreading out rapidly in Europe. The common milkweed occupies increasingly more area. Being poisonous, most animals will not graze on it however rabbits would be an effective organism for the biological control of milkweed. Rabbit kittens can learn the maternal diet in various ways. They prefer aromatic foods which their mother had eaten during pregnancy or lactation period, -even if it is poisonous- but they can also learn the maternal diet from the fecal pellets deposited by the mother into the nest during the nursing events. The present study was aimed to investigate if rabbit kittens can learn that the common milkweed is a potential food also. In the first 10days of their lives kits got fecal pellets originating from individuals having fed on common milkweed previously. When weaned on day 28 postpartum, these pups preferred the milkweed in the 3-way food choice test, opposite to the control group. Most surprisingly in a second experiment it was also shown that the common milkweed was also preferred by the kittens if their mother ate it not during, but one month before pregnancy. Copyright © 2016 Elsevier B.V. All rights reserved.

  5. Corneal Toxicity Following Exposure to Asclepias Tuberosa

    DEFF Research Database (Denmark)

    Mikkelsen, Lauge Hjorth; Hamoudi, Hassan; Gül, Cigdem Altuntas

    2017-01-01

    PURPOSE: To present a case of corneal toxicity following exposure to milky plant latex from Asclepias tuberosa. METHODS: A 70-year-old female presented with blurred vision and pain in her left eye after handling an Ascepias tuberosa. Clinical examination revealed a corneal stromal oedema with small...... epithelial defects. The corneal endothelium was intact and folds in Descemets membrane were observed. The oedema was treated with chloramphenicol, dexamethasone and scopolamine. RESULTS: The corneal oedema had appeared after corneal exposure to the plant, Asclepias tuberosa, whose latex contains cardenolides...... that inhibit the Na+/ K+-ATPase in the corneal endothelium. The oedema resolved after 96 hours. After nine months the best corrected visual acuity was 20/20. CONCLUSION: Corneal toxicity has previously been reported for plants of the Asclepias family. This is a rare case describing severe corneal toxicity...

  6. Bioavailability and Uptake of Lead by Coffeeweed (Sesbania exaltata Raf.

    Directory of Open Access Journals (Sweden)

    Gloria Miller

    2008-12-01

    and increased the propensity for uptake by plants into roots and shoots. Further, these results indicate that Sesbania exaltata can be grown under elevated Pb conditions and may be suitable as a potential crop rotation species for phytoextraction.

  7. Horizontal Transfer of DNA from the Mitochondrial to the Plastid Genome and Its Subsequent Evolution in Milkweeds (Apocynaceae)

    Science.gov (United States)

    Straub, Shannon C.K.; Cronn, Richard C.; Edwards, Christopher; Fishbein, Mark; Liston, Aaron

    2013-01-01

    Horizontal gene transfer (HGT) of DNA from the plastid to the nuclear and mitochondrial genomes of higher plants is a common phenomenon; however, plastid genomes (plastomes) are highly conserved and have generally been regarded as impervious to HGT. We sequenced the 158 kb plastome and the 690 kb mitochondrial genome of common milkweed (Asclepias syriaca [Apocynaceae]) and found evidence of intracellular HGT for a 2.4-kb segment of mitochondrial DNA to the rps2–rpoC2 intergenic spacer of the plastome. The transferred region contains an rpl2 pseudogene and is flanked by plastid sequence in the mitochondrial genome, including an rpoC2 pseudogene, which likely provided the mechanism for HGT back to the plastome through double-strand break repair involving homologous recombination. The plastome insertion is restricted to tribe Asclepiadeae of subfamily Asclepiadoideae, whereas the mitochondrial rpoC2 pseudogene is present throughout the subfamily, which confirms that the plastid to mitochondrial HGT event preceded the HGT to the plastome. Although the plastome insertion has been maintained in all lineages of Asclepiadoideae, it shows minimal evidence of transcription in A. syriaca and is likely nonfunctional. Furthermore, we found recent gene conversion of the mitochondrial rpoC2 pseudogene in Asclepias by the plastid gene, which reflects continued interaction of these genomes. PMID:24029811

  8. Honey bees are the dominant diurnal pollinator of native milkweed in a large urban park.

    Science.gov (United States)

    MacIvor, James Scott; Roberto, Adriano N; Sodhi, Darwin S; Onuferko, Thomas M; Cadotte, Marc W

    2017-10-01

    In eastern North America, the field milkweed, Asclepias syriaca L. (Asclepiadaceae), is used in planting schemes to promote biodiversity conservation for numerous insects including the endangered monarch butterfly, Danaus plexippus (Linnaeus) (Nymphalidae). Less is known about its pollinators, and especially in urban habitats where it is planted often despite being under increasing pressure from invasive plant species, such as the related milkweed, the dog-strangling vine (DSV), Vincetoxicum rossicum (Kleopow) Barbar. (Asclepiadaceae). During the A. syriaca flowering period in July 2016, we surveyed bees in open habitats along a DSV invasion gradient and inspected 433 individuals of 25 bee species in 12 genera for pollinia: these were affixed to bees that visited A. syriaca for nectar and contain pollen packets that are vectored (e.g., transferred) between flowers. Of all bees sampled, pollinia were found only on the nonindigenous honeybee, Apis mellifera (43% of all bees identified), as well as one individual bumblebee, Bombus impatiens Cresson. Pollinia were recorded from 45.2% of all honeybees collected. We found no relationship between biomass of DSV and biomass of A. syriaca per site. There was a significant positive correlation between A. syriaca biomass and the number of pollinia, and the proportion vectored. No relationship with DSV biomass was detected for the number of pollinia collected by bees but the proportion of vectored pollinia declined with increasing DSV biomass. Although we find no evidence of DSV flowers attracting potential pollinators away from A. syriaca and other flowering plants, the impacts on native plant-pollinator mutualisms relate to its ability to outcompete native plants. As wild bees do not appear to visit DSV flowers, it could be altering the landscape to one which honeybees are more tolerant than native wild bees.

  9. Density-dependent reduction and induction of milkweed cardenolides by a sucking insect herbivore.

    Science.gov (United States)

    Martel, John W; Malcolm, Stephen B

    2004-03-01

    The effect of aphid population size on host-plant chemical defense expression and the effect of plant defense on aphid population dynamics were investigated in a milkweed-specialist herbivore system. Density effects of the aposematic oleander aphid, Aphis nerii, on cardenolide expression were measured in two milkweed species, Asclepias curassavica and A. incarnata. These plants vary in constitutive chemical investment with high mean cardenolide concentration in A. curassavica and low to zero in A. incarnata. The second objective was to determine whether cardenolide expression in these two host plants impacts mean A. nerii colony biomass (mg) and density. Cardenolide concentration (microgram/g) of A. curassavica in both aphid-treated leaves and opposite, herbivore-free leaves decreased initially in comparison with aphid-free controls, and then increased significantly with A. nerii density. Thus, A. curassavica responds to aphid herbivory initially with density-dependent phytochemical reduction, followed by induction of cardenolides to concentrations above aphid-free controls. In addition, mean cardenolide concentration of aphid-treated leaves was significantly higher than that of opposite, herbivore-free leaves. Therefore, A. curassavica induction is strongest in herbivore-damage tissue. Conversely, A. incarnata exhibited no such chemical response to aphid herbivory. Furthermore, neither host plant responded chemically to herbivore feeding duration time (days) or to the interaction between herbivore initial density and feeding duration time. There were also no significant differences in mean colony biomass or population density of A. nerii reared on high cardenolide (A. curassavica) and low cardenolide (A. incarnata) hosts.

  10. Corneal Toxicity Following Exposure to Asclepias Tuberosa

    OpenAIRE

    Mikkelsen, Lauge Hjorth; Hamoudi, Hassan; G?l, Cigdem Altuntas; Heegaard, Steffen

    2017-01-01

    PURPOSE: To present a case of corneal toxicity following exposure to milky plant latex from Asclepias tuberosa.METHODS: A 70-year-old female presented with blurred vision and pain in her left eye after handling an Ascepias tuberosa. Clinical examination revealed a corneal stromal oedema with small epithelial defects. The corneal endothelium was intact and folds in Descemets membrane were observed. The oedema was treated with chloramphenicol, dexamethasone and scopolamine.RESULTS: The corneal ...

  11. Induced defences alter the strength and direction of natural selection on reproductive traits in common milkweed.

    Science.gov (United States)

    Thompson, K A; Cory, K A; Johnson, M T J

    2017-06-01

    Evolutionary biologists have long sought to understand the ecological processes that generate plant reproductive diversity. Recent evidence indicates that constitutive antiherbivore defences can alter natural selection on reproductive traits, but it is unclear whether induced defences will have the same effect and whether reduced foliar damage in defended plants is the cause of this pattern. In a factorial field experiment using common milkweed, Asclepias syriaca L., we induced plant defences using jasmonic acid (JA) and imposed foliar damage using scissors. We found that JA-induced plants experienced selection for more inflorescences that were smaller in size (fewer flowers), whereas control plants only experienced a trend towards selection for larger inflorescences (more flowers); all effects were independent of foliar damage. Our results demonstrate that induced defences can alter both the strength and direction of selection on reproductive traits, and suggest that antiherbivore defences may promote the evolution of plant reproductive diversity. © 2017 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2017 European Society For Evolutionary Biology.

  12. Long-term trends in midwestern milkweed abundances and their relevance to monarch butterfly declines

    Science.gov (United States)

    Zaya, David N.; Pearse, Ian; Spyreas, Gregory

    2017-01-01

    Declines in monarch butterfly populations have prompted investigation into the sensitivity of their milkweed host plants to land-use change. Documented declines in milkweed abundance in croplands have spurred efforts to promote milkweeds in other habitats. Nevertheless, our current understanding of milkweed populations is poor. We used a long-term plant survey from Illinois to evaluate whether trends in milkweed abundance have caused monarch decline and to highlight the habitat-management practices that promote milkweeds. Milkweed abundance in natural areas has not declined precipitously, although when croplands are considered, changes in agricultural weed management have led to a 68% loss of milkweed available for monarchs across the region. Midsuccessional plant communities with few invasive species provide optimal milkweed habitat. The augmentation of natural areas and the management of existing grasslands, such as less frequent mowing and woody- and exotic-species control, may replace some of the milkweed that has been lost from croplands.

  13. Thermogravimetric analysis and fast pyrolysis of Milkweed.

    Science.gov (United States)

    Kim, Seung-Soo; Agblevor, Foster A

    2014-10-01

    Pyrolysis of Milkweed was carried out in a thermogravimetric analyzer and a bubbling fluidized bed reactor. Total liquid yield of Milkweed pyrolysis was between 40.74% and 44.19 wt% between 425 °C and 550 °C. The gas yield increased from 27.90 wt% to 33.33 wt% with increasing reaction temperature. The higher heating values (HHV) of the Milkweed bio-oil were relatively high (30.33-32.87 MJ/kg) and varied with reaction temperature, feeding rate and fluidization velocity. The selectivity for CO2 was highest within non-condensable gases, and the molar ratio of CO2/CO was about 3 at the different reaction conditions. The (13)C NMR analysis, of the bio-oil showed that the relative concentration carboxylic group and its derivatives was higher at 425 °C than 475 °C, which resulted in slightly higher oxygen content in bio-oil. The pH of aqueous phase obtained at 475 °C was 7.37 which is the highest reported for any lignocellulosic biomass pyrolysis oils. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. Structures, chemotaxonomic significance, cytotoxic and Na(+),K(+)-ATPase inhibitory activities of new cardenolides from Asclepias curassavica.

    Science.gov (United States)

    Zhang, Rong-Rong; Tian, Hai-Yan; Tan, Ya-Fang; Chung, Tse-Yu; Sun, Xiao-Hui; Xia, Xue; Ye, Wen-Cai; Middleton, David A; Fedosova, Natalya; Esmann, Mikael; Tzen, Jason T C; Jiang, Ren-Wang

    2014-11-28

    Five new cardenolide lactates (1–5) and one new dioxane double linked cardenolide glycoside (17) along with 15 known compounds (6–16 and 18–21) were isolated from the ornamental milkweed Asclepias curassavica. Their structures were elucidated by extensive spectroscopic methods (IR, UV, MS, 1D- and 2D-NMR). The molecular structures and absolute configurations of 1–3 and 17 were further confirmed by single-crystal X-ray diffraction analysis. Simultaneous isolation of dioxane double linked cardenolide glycosides (17–21) and cardenolide lactates (1–5) provided unique chemotaxonomic markers for this genus. Compounds 1–21 were evaluated for the inhibitory activities against DU145 prostate cancer cells. The dioxane double linked cardenolide glycosides showed the most potent cytotoxic effect followed by normal cardenolides and cardenolide lactates, while the C21 steroids were non-cytotoxic. Enzymatic assay established a correlation between the cytotoxic effects in DU145 cancer cells and the Ki for the inhibition of Na(+),K(+)-ATPase. Molecular docking analysis revealed relatively strong H-bond interactions between the bottom of the binding cavity and compounds 18 or 20, and explained why the dioxane double linked cardenolide glycosides possessed higher inhibitory potency on Na(+),K(+)-ATPase than the cardenolide lactate.

  15. Acylated-oxypregnane glycosides from the roots of Asclepias syriaca.

    Science.gov (United States)

    Warashina, Tsutomu; Noro, Tadataka

    2009-02-01

    Twenty new pregnane glycosides were obtained from the roots of Asclepias syriaca L. (Asclepiadaceae). These glycosides were confirmed to contain ikemagenin, 12-O-nicotinoyllineolon, 5alpha,6-dihydroikemagenin, and 12-O-tigloylisolineolon, as their aglycones, using both spectroscopic and chemical methods.

  16. Steroidal glycosides from the roots of Asclepias curassavica.

    Science.gov (United States)

    Warashina, Tsutomu; Noro, Tadataka

    2008-03-01

    Twenty-six new acylated-oxypregnane glycosides were obtained along with three known cardenolide glycosides from the roots of Asclepias curassavica (Asclepiadaceae). The new compounds were confirmed to contain 12-O-benzoylsarcostin, 12-O-benzoyldeacylmetaplexigenin, kidjolanin, and 12-O-benzoyltayloron, and one new acylated-oxypregnane, 12-O-(E)-cinnamoyltayloron, as their aglycones, using both spectroscopic and chemical methods.

  17. Patterns of adaptive trait evolution across the North American Asclepias

    OpenAIRE

    Rosa, Raffica La

    2016-01-01

    We conducted analyses using an Asclepias phylogeny constructed by Fishbein et al. (2011), floral traits measured from pickled specimens, and bioclimatic data for 117 species. Bioclimatic data was extracted by combining WorldClim data and occurrence data of individual specimens collected by iDigBio, GBIF, and SEINet.

  18. First chemical constituents from Cordia exaltata Lam and antimicrobial activity of two neolignans.

    Science.gov (United States)

    de Sá de Sousa Nogueira, Tiago Bezerra; de Sá de Sousa Nogueira, Raquel Bezerra; E Silva, Davi Antas; Tavares, Josean Fechine; de Oliveira Lima, Edeltrudes; de Oliveira Pereira, Fillipe; da Silva Maciel, Jéssica Karina; de Souza Fernandes, Milen Maria Magalhães; de Medeiros, Fernando Antônio; do Socorro Ferreira Rodrigues Sarquis, Rosangela; Filho, Raimundo Braz; de Fátima Vanderlei de Souza, Maria

    2013-09-10

    The phytochemical study of Cordia exaltata Lam. (Boraginaceae) led to the isolation, through chromatographic techniques, of nineteen secondary metabolites: 8,8'dimethyl-3,4,3',4'-dimethylenedioxy-7-oxo-2,7'cyclolignan (1), 8,8'-dimethyl-4,5-dimethoxy-3',4'-methylenodioxy-7-oxo-2,7'cyclolignan (2), sitosterol (3a), stigmasterol (3b), sitosterol-3-O-β-D-glucopyranoside (4a), stigmasterol-3-O-β-D-glucopyranoside (4b), phaeophytin A (5), 13²-hydroxyphaeophytin A (6), 17³-ethoxypheophorbide A (7), 13²-hydroxy-17³-ethoxypheophorbide A (8), m-methoxy-p-hydroxybenzaldehyde (9), (E)-7-(3,4-dihydroxyphenyl)-7-propenoic acid (10), 1-benzopyran-2-one (11), 7-hydroxy-1-benzopyran-2-one (12), 2,5-bis-(3',4'-methylenedioxiphenyl)-3,4-dimethyltetrahydrofuran (13), 3,4,5,3',5'-pentamethoxy-1'-allyl-8.O.4'-neolignan (14), 3,5,7,3',4'-pentahydroxyflavonol (15), 5,7-dihydroxy-4'-methoxyflavone (16), 5,8-dihydroxy-7,4'-dimethoxyflavone (17), kaempherol 3-O-β-D-glucosyl-6''-α-L-ramnopyranoside (18) and kaempherol 3,7-di-O-α-L-ramnopyranoside (19). Their structures were identified by ¹H and ¹³C-NMR using one and two-dimensional techniques. In addition, the antimicrobial activity of compounds 1, 2, 13 and 14 against bacteria and fungi are reported here for the first time.

  19. Milkweed Seed Dispersal: A Means for Integrating Biology and Physics.

    Science.gov (United States)

    Bisbee, Gregory D.; Kaiser, Cheryl A.

    1997-01-01

    Describes an activity that integrates biology and physics concepts by experimenting with the seed dispersal of common milkweed or similar wind-dispersed seeds. Student teams collect seeds and measure several parameters, review principles of trajectory motion, perform experiments, and graph data. Students examine the ideas of…

  20. Flavonoids in the leaves of Asclepias incarnata L.

    Science.gov (United States)

    Sikorska, Maria

    2003-01-01

    Seven flavonoid compounds: quercelin 3-O-beta-galactopyranoside, 3-O-beta-glucopyranoside, 3-O-arabinoside, 3-O-beta-glucopyranosyl (1-->2)-beta-galactopyranoside, 3-O-beta-xylopyranosyl (1-->2)-beta-galactopyranoside, 3-O-alpha-rhamnopyranosyl (1-->2)-beta-galactopyranoside and kaempferol 3-beta-glucopyranoside were isolated and identified from the leaves of Asclepias incarnata, L. (Asclepiadaceae).

  1. Ocular toxicity secondary to asclepias physocarpa: the balloon plant

    OpenAIRE

    Pina, S; Pedrosa, C; Santos, C; Feijóo, B; Pego, P; Vendrell, C; Santos, MJ; Prieto, I

    2014-01-01

    We report a case of a 65-year-old woman with symptoms of blurred vision and ocular irritation a few hours after accidental contact of the right eye with Asclepias physocarpa milky latex. Observation showed a diffuse conjunctival hyperemia and stromal corneal edema with Descemet's membrane folds. Recovery was fast and apparently complete in less than one month. However, specular microscopy at 6-months follow-up showed an abnormal endothelial morphology as sequelae, suggesting this condition is...

  2. Poor sequestration of toxic host plant cardenolides and their rapid loss in the milkweed butterfly Danaus chrysippus (Lepidoptera: Nymphalidae: Danainae: Danaini).

    Science.gov (United States)

    Mebs, Dietrich; Wunder, Cora; Toennes, Stefan W

    2017-06-01

    Butterflies of the genus Danaus are known to sequester toxic cardenolides from milkweed host plants (Apocynaceae). In particular, Danaus plexippus efficiently sequesters and stores these compounds, whereas D. chrysippus, is considered to poorly sequester cardenolides. To estimate its sequestration capability compared with that of D. plexippus, larvae of both species were jointly reared on Asclepias curassavica and the major cardenolides of the host plant, calotropin and calactin, were analyzed in adults sampled at different time intervals after eclosion. Both cardenolides were detected in body and wings of D. plexippus. Whereas the calotropin-concentration remained constant over a period of 24 days, that of calactin steadily decreased. In the body, but not in the wings of D. chrysippus, calactin only was detected in low amounts, which was then almost completely lost during the following 8 days after eclosion, suggesting that in contrast to D. plexippus, cardenolides seem to be less important for that butterfly's defence against predators. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Evaluation of Indian milkweed (Calotropis gigantea) seed oil as alternative feedstock for biodiesel

    Science.gov (United States)

    Calotropis gigantea (Indian milkweed) is a common plant in Asia that grows as a weed on open waste ground. Flowering and fruiting take place throughout the year. In this study, Indian milkweed oil was evaluated as a potential feedstock for biodiesel production. The oil was extracted from Indian milk...

  4. Milkweed: A resource for increasing stink bug parasitism and aiding insect pollinator and monarch butterfly conservation

    Science.gov (United States)

    The flowers of milkweed species can produce a rich supply of nectar, and therefore, planting an insecticide-free milkweed habitat in agricultural farmscapes could possibly conserve monarch butterflies, bees and other insect pollinators, as well as enhance parasitism of insect pests. In peanut-cotton...

  5. Monarch butterfly oviposition preference supports a diversity of milkweed species on the landscape

    Science.gov (United States)

    Over the past two decades, the population of monarch butterflies east of the Rocky Mountains has experienced a significant decline in overwintering numbers. Habitat restoration that includes planting milkweeds is essential to boost monarch numbers within the breeding range. Milkweeds are the only ho...

  6. Cytotoxic cardiac glycosides and other compounds from Asclepias syriaca.

    Science.gov (United States)

    Araya, Juan J; Kindscher, Kelly; Timmermann, Barbara N

    2012-03-23

    Phytochemical investigation of the dried biomass of Asclepias syriaca afforded five new compounds (1-5), along with 19 known structures. Overall, the secondary metabolites isolated and identified from this plant showed a wide structural diversity including pentacyclic triterpenes, cardiac glycosides, flavonoid glycosides, lignans, a phenylethanoid, and a glycosylated megastigmane. In addition, the isolates were tested against the cancer breast cell line Hs578T, and those showing IC(50) values lower than 50 μM (1 and 6-9) were further investigated in three additional breast cancer cell lines (MCF-7, T47D, and Sk-Br-3) and the normal breast cell line Hs578Bst.

  7. Ocular Toxicity Secondary to Asclepias physocarpa: The Balloon Plant

    Directory of Open Access Journals (Sweden)

    Susana Pina

    2014-01-01

    Full Text Available We report a case of a 65-year-old woman with symptoms of blurred vision and ocular irritation a few hours after accidental contact of the right eye with Asclepias physocarpa milky latex. Observation showed a diffuse conjunctival hyperemia and stromal corneal edema with Descemet’s membrane folds. Recovery was fast and apparently complete in less than one month. However, specular microscopy at 6-months follow-up showed an abnormal endothelial morphology as sequelae, suggesting this condition is not as innocuous as it has been suggested.

  8. Ocular Toxicity Secondary to Asclepias physocarpa: The Balloon Plant.

    Science.gov (United States)

    Pina, Susana; Pedrosa, Catarina; Santos, Cristina; Feijóo, Bernardo; Pego, Peter; Vendrell, Cristina; Santos, Maria João; Prieto, Isabel

    2014-01-01

    We report a case of a 65-year-old woman with symptoms of blurred vision and ocular irritation a few hours after accidental contact of the right eye with Asclepias physocarpa milky latex. Observation showed a diffuse conjunctival hyperemia and stromal corneal edema with Descemet's membrane folds. Recovery was fast and apparently complete in less than one month. However, specular microscopy at 6-months follow-up showed an abnormal endothelial morphology as sequelae, suggesting this condition is not as innocuous as it has been suggested.

  9. Climate niches of milkweeds with plesiomorphic traits (Secamonoideae; Apocynaceae) and the milkweed sister group link ancient African climates and floral evolution.

    Science.gov (United States)

    Livshultz, Tatyana; Mead, Jerry V; Goyder, David J; Brannin, Michelle

    2011-12-01

    Climate change that increases mortality of plants and pollinators can create mate-finding Allee effects and thus act as a strong selective force on floral morphology. Milkweeds (Secamonoideae and Asclepiadoideae; Apocynaceae) are typically small plants of seasonally dry habitats, with pollinia and high pollen-transfer efficiency. Their sister group (tribe Baisseeae and Dewevrella) is mostly comprised of giant lianas of African rainforests, with pollen in monads. Comparison of the two groups motivated a new hypothesis: milkweeds evolved in the context of African aridification and the shifting of rainforest to dry forest. Pollinia and high pollen-transfer efficiency may have been adaptations that alleviated mate-finding Allee effects generated by high mortality during droughts. We formally tested whether milkweeds have a drier climate niche by comparing milkweeds with plesiomorphic traits (Secamonoideae) and the milkweed sister group in continental Africa. We georeferenced specimens of the milkweed sister group and Secamonoideae in continental Africa, extracted 19 climatic variables from the Worldclim model, conducted factor analysis to identify correlated suites of variables, and compared the frequency distributions of the two lineages relative to each factor. The distributions of Secamonoideae and the milkweed sister group differed significantly relative to four factors, each correlated with a distinct suite of climate parameters: (1) air temperature (Secamonoideae: cooler), (2) total and (3) summer precipitation (Secamonoideae: drier), and (4) temperature seasonality and isothermality (Secamonoideae: more seasonal and less isothermal). Secamonoideae in continental Africa inhabit drier, cooler sites than do the milkweed sister group, consistent with a shift from rainforests to dry forests in a cooling climate.

  10. Assessment of the Efficacy of Chelate-Assisted Phytoextraction of Lead by Coffeeweed (Sesbania exaltata Raf.

    Directory of Open Access Journals (Sweden)

    Gloria Miller

    2008-12-01

    Full Text Available Lead (Pb, depending upon the reactant surface, pH, redox potential and other factors can bind tightly to the soil with a retention time of many centuries. Soil-metal interactions by sorption, precipitation and complexation processes, and differences between plant species in metal uptake efficiency, transport, and susceptibility make a general prediction of soil metal bioavailability and risks of plant metal toxicity difficult. Moreover, the tight binding characteristic of Pb to soils and plant materials make a significant portion of Pb unavailable for uptake by plants. This experiment was conducted to determine whether the addition of ethylenediaminetetraacetic acid (EDTA, ethylene glycol tetraacetic acid (EGTA, or acetic acid (HAc can enhance the phytoextraction of Pb by making the Pb soluble and more bioavailable for uptake by coffeeweed (Sesbania exaltata Raf.. Also we wanted to assess the efficacy of chelates in facilitating translocation of the metal into the above-ground biomass of this plant. To test the effect of chelates on Pb solubility, 2 g of Pb-spiked soil (1000 mg Pb/kg dry soil were added to each 15 mL centrifuge tube. Chelates (EDTA, EGTA, HAc in a 1:1 ratio with the metal, or distilled deionized water were then added. Samples were shaken on a platform shaker then centrifuged at the end of several time periods. Supernatants were filtered with a 0.45 μm filter and quantified by inductively coupled plasma-optical emission spectrometry (ICP-OES to determine soluble Pb concentrations. Results revealed that EDTA was the most effective in bringing Pb into solution, and that maximum solubility was reached 6 days after chelate amendment. Additionally, a greenhouse experiment was conducted by planting Sesbania seeds in plastic tubes containing top soil and peat (2:1, v:v spiked with various levels (0, 1000, 2000 mg Pb/kg dry soil of lead nitrate. At six weeks after emergence, aqueous solutions of EDTA and/or HAc (in a 1:1 ratio

  11. Field responses of Prunus serotina and Asclepias syriaca to ozone around southern Lake Michigan

    Energy Technology Data Exchange (ETDEWEB)

    Bennett, J.P. [U.S. Geological Survey and Institute for Environmental Studies, University of Wisconsin, Madison, WI 53706 (United States)]. E-mail: jpbennet@wisc.edu; Jepsen, E.A. [Bureau of Air Management, Wisconsin Department of Natural Resources, Madison, WI 53707 (United States); Roth, J.A. [Bureau of Air Management, Wisconsin Department of Natural Resources, Madison, WI 53707 (United States)

    2006-07-15

    Higher ozone concentrations east of southern Lake Michigan compared to west of the lake were used to test hypotheses about injury and growth effects on two plant species. We measured approximately 1000 black cherry trees and over 3000 milkweed stems from 1999 to 2001 for this purpose. Black cherry branch elongation and milkweed growth and pod formation were significantly higher west of Lake Michigan while ozone injury was greater east of Lake Michigan. Using classification and regression tree (CART) analyses we determined that departures from normal precipitation, soil nitrogen and ozone exposure/peak hourly concentrations were the most important variables affecting cherry branch elongation, and milkweed stem height and pod formation. The effects of ozone were not consistently comparable with the effects of soil nutrients, weather, insect or disease injury, and depended on species. Ozone SUM06 exposures greater than 13 ppm-h decreased cherry branch elongation 18%; peak 1-h exposures greater than 93 ppb reduced milkweed stem height 13%; and peak 1-h concentrations greater than 98 ppb reduced pod formation 11% in milkweed. - Decreased cherry branch elongation, milkweed stem height and pod production, and foliar injury on both species occurred at sites around southern Lake Michigan at ozone exposures of 13 SUM06 ppm-h and 93-98 ppb peak hourly.

  12. Field responses of Prunus serotina and Asclepias syriaca to ozone around southern Lake Michigan

    International Nuclear Information System (INIS)

    Bennett, J.P.; Jepsen, E.A.; Roth, J.A.

    2006-01-01

    Higher ozone concentrations east of southern Lake Michigan compared to west of the lake were used to test hypotheses about injury and growth effects on two plant species. We measured approximately 1000 black cherry trees and over 3000 milkweed stems from 1999 to 2001 for this purpose. Black cherry branch elongation and milkweed growth and pod formation were significantly higher west of Lake Michigan while ozone injury was greater east of Lake Michigan. Using classification and regression tree (CART) analyses we determined that departures from normal precipitation, soil nitrogen and ozone exposure/peak hourly concentrations were the most important variables affecting cherry branch elongation, and milkweed stem height and pod formation. The effects of ozone were not consistently comparable with the effects of soil nutrients, weather, insect or disease injury, and depended on species. Ozone SUM06 exposures greater than 13 ppm-h decreased cherry branch elongation 18%; peak 1-h exposures greater than 93 ppb reduced milkweed stem height 13%; and peak 1-h concentrations greater than 98 ppb reduced pod formation 11% in milkweed. - Decreased cherry branch elongation, milkweed stem height and pod production, and foliar injury on both species occurred at sites around southern Lake Michigan at ozone exposures of 13 SUM06 ppm-h and 93-98 ppb peak hourly

  13. Palp-faction: an African milkweed dismembers its wasp pollinators.

    Science.gov (United States)

    Shuttleworth, Adam; Johnson, Steven D

    2009-06-01

    Interactions between pollinators and nectar-producing flowers are usually assumed to be mutualistic, but the exploitative basis of these relationships can lead to antagonistic interactions. Flowers of the African milkweed, Pachycarpus appendiculatus E. Mey, produce concentrated nectar that is consumed primarily by the large spider-hunting wasp Hemipepsis dedjas Guerin (Hymenoptera: Pompilidae). Pollinaria of this milkweed become attached to the palps of these wasps during nectar feeding. Broken wasp palps were found between guide rails, attached to corpuscula that were trapped behind the guide rails, and attached to pollinia that were inserted into the stigmatic chambers of the flowers. Approximately 85% of wasps captured on flowers of P. appendiculatus were missing one or more palps, whereas only 9% of wasps captured on flowers of another asclepiad species were missing any palps. It thus seems that wasps face a high risk of losing their palps when foraging on these flowers. The interaction may thus be antagonistic for the wasps if the cost of losing their sensory palps (not yet established) is greater than the benefits of the nectar reward. The plants, however, gain clear benefit from the interaction, as verified by the removal and insertion of pollinia in flowers exposed solely to visits by pompilid wasps.

  14. Evolution at the tips: Asclepias phylogenomics and new perspectives on leaf surfaces.

    Science.gov (United States)

    Fishbein, Mark; Straub, Shannon C K; Boutte, Julien; Hansen, Kimberly; Cronn, Richard C; Liston, Aaron

    2018-03-01

    Leaf surface traits, such as trichome density and wax production, mediate important ecological processes such as anti-herbivory defense and water-use efficiency. We present a phylogenetic analysis of Asclepias plastomes as a framework for analyzing the evolution of trichome density and presence of epicuticular waxes. We produced a maximum-likelihood phylogeny using plastomes of 103 species of Asclepias. We reconstructed ancestral states and used model comparisons in a likelihood framework to analyze character evolution across Asclepias. We resolved the backbone of Asclepias, placing the Sonoran Desert clade and Incarnatae clade as successive sisters to the remaining species. We present novel findings about leaf surface evolution of Asclepias-the ancestor is reconstructed as waxless and sparsely hairy, a macroevolutionary optimal trichome density is supported, and the rate of evolution of trichome density has accelerated. Increased sampling and selection of best-fitting models of evolution provide more resolved and robust estimates of phylogeny and character evolution than obtained in previous studies. Evolutionary inferences are more sensitive to character coding than model selection. © 2018 The Authors. American Journal of Botany is published by Wiley Periodicals, Inc. on behalf of the Botanical Society of America.

  15. Field responses of Prunus serotina and Asclepias syriaca to ozone around southern Lake Michigan.

    Science.gov (United States)

    Bennett, J P; Jepsen, E A; Roth, J A

    2006-07-01

    Higher ozone concentrations east of southern Lake Michigan compared to west of the lake were used to test hypotheses about injury and growth effects on two plant species. We measured approximately 1000 black cherry trees and over 3000 milkweed stems from 1999 to 2001 for this purpose. Black cherry branch elongation and milkweed growth and pod formation were significantly higher west of Lake Michigan while ozone injury was greater east of Lake Michigan. Using classification and regression tree (CART) analyses we determined that departures from normal precipitation, soil nitrogen and ozone exposure/peak hourly concentrations were the most important variables affecting cherry branch elongation, and milkweed stem height and pod formation. The effects of ozone were not consistently comparable with the effects of soil nutrients, weather, insect or disease injury, and depended on species. Ozone SUM06 exposures greater than 13 ppm-h decreased cherry branch elongation 18%; peak 1-h exposures greater than 93 ppb reduced milkweed stem height 13%; and peak 1-h concentrations greater than 98 ppb reduced pod formation 11% in milkweed.

  16. Six new C21 steroidal glycosides from Asclepias curassavica L.

    Science.gov (United States)

    Li, Jun-Zhu; Liu, Hai-Yang; Lin, Yi-Ju; Hao, Xiao-Jiang; Ni, Wei; Chen, Chang-Xiang

    2008-07-01

    Six new C(21) steroidal glycosides, named curassavosides A-F (3-8), were obtained from the aerial parts of Asclepias curassavica (Asclepiadaceae), along with two known oxypregnanes, 12-O-benzoyldeacylmetaplexigenin (1) and 12-O-benzoylsarcostin (2). By spectroscopic methods, the structures of the six new compounds were determined as 12-O-benzoyldeacylmetaplexigenin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (3), 12-O-benzoylsarcostin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (4), sarcostin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (5), sarcostin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-D-digitoxopyranoside (6), 12-O-benzoyldeacylmetaplexigenin 3-O-beta-D-glucopyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-d-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (7), and 12-O-benzoylsarcostin 3-O-beta-D-glucopyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-d-canaropyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (8), respectively. All compounds (1-8) were tested for in vitro cytotoxicity; only compound 3 showed weak inhibitory activity against Raji and AGZY cell lines.

  17. Chemical composition and biological evaluation of the volatile constituents from the aerial parts of Nephrolepis exaltata (L.) and Nephrolepis cordifolia (L.) C. Presl grown in Egypt.

    Science.gov (United States)

    El-Tantawy, Mona E; Shams, Manal M; Afifi, Manal S

    2016-01-01

    The essential oil from the aerial parts of Nephrolepis exaltata and Nephrolepis cordifolia obtained by hydro-distillation were analyzed by gas chromatography/ mass spectrometry. The essential oils exhibited potential antibacterial and antifungal activities against a majority of the selected microorganisms. NEA oil showed promising cytotoxicity in breast, colon and lung carcinoma cells. The results presented indicate that NEA oil could be useful alternative for the treatment of dermatophytosis. Comparative investigation of hydro-distilled volatile constituents from aerial parts (A) of Nephrolepis exaltata (NE) and Nephrolepis cordifolia (NC) (Family Nephrolepidaceae) was carried out. Gas chromatography/mass spectrometry revealed that oils differ in composition and percentages of components. Oxygenated compounds were dominant in NEA and NCA. 2,4-Hexadien-1-ol (16.1%), nonanal (14.4%), β-Ionone (6.7%) and thymol (2.7%) were predominant in NEA. β-Ionone (8.0%), eugenol (7.2%) and anethol (4.6%) were the main constituents in NCA. Volatile samples were screened for their antibacterial and antifungal activities using agar diffusion method and minimum inhibitory concentrations. The cytotoxic activity was evaluated using viability assay in breast (MCF-7), colon (HCT-116) and lung carcinoma (A-549) cells by the MTT assay. The results revealed that NEA oil exhibited potential antimicrobial activity against most of the tested organisms and showed promising cytotoxicity.

  18. New cardenolide and acylated lignan glycosides from the aerial parts of Asclepias curassavica.

    Science.gov (United States)

    Warashina, Tsutomu; Shikata, Kimiko; Miyase, Toshio; Fujii, Satoshi; Noro, Tadataka

    2008-08-01

    Three new cardenolide glycosides and six new acylated lignan glycosides were obtained along with nineteen known compounds from the aerial parts of Asclepias curassavica L. (Asclepiadaceae). The structure of each compound was determined based on interpretations of NMR and MS measurements and chemical evidence.

  19. Antiproliferative and apoptotic activities of extracts of Asclepias subulata.

    Science.gov (United States)

    Rascón Valenzuela, Luisa Alondra; Jiménez Estrada, Manuel; Velázquez Contreras, Carlos Arturo; Garibay Escobar, Adriana; Medina Juárez, Luis Angel; Gámez Meza, Nohemi; Robles Zepeda, Ramón Enrique

    2015-01-01

    Asclepias subulata Decne. (Apocynaceae) is a shrub used in the Mexican traditional medicine for the treatment of cancer. The objective of this study was to evaluate the antiproliferative activity of methanol extract of aerial parts of A. subulata and its fractions against different cancer cell lines. Additionally, we analyzed the mechanism of action of the active fractions. Methanol extract fractions were prepared by serial extraction with n-hexane, ethyl acetate, and ethanol. The antiproliferative activity of methanol extract and its fractions was evaluated, against several murine (M12.C3.F6, RAW 264.7, and L929) and human (HeLa, A549, PC-3, LS 180, and ARPE-19) cell lines by the MTT assay, using concentrations of 0.4-400 µg/mL for 48 h. Ethanol and residual fractions were separated using silica gel column. Apoptosis induction of cancer cells was evaluated by Annexin and JC-1 staining using flow cytometry. Methanol extract and its fractions showed antiproliferative activity against all human cancer cell lines tested. Methanol extract had the highest antiproliferative activity on A549 and HeLa cells (IC50 values < 0.4 and 8.7 µg/mL, respectively). Ethanol and residual fractions exerted significant antiproliferative effect on A549 (IC50 < 0.4 µg/mL) and PC3 cells (IC50 1.4 and 5.1 µg/mL). Apoptotic assays showed that CEF7, CEF9, CRF6, and CRF5 fractions induced mitochondrial depolarization in A549 cells, 70, 73, 77, and 80%, respectively. Those fractions triggered the apoptosis mitochondrial pathway. Our data show that A. subulata extracts have potent antiproliferative properties on human cancer cell lines. This plant should be considered an important source of potent anticancer compounds.

  20. Seasonal profiles of leaf ascorbic acid content and redox state in ozone-sensitive wildflowers

    International Nuclear Information System (INIS)

    Burkey, Kent O.; Neufeld, Howard S.; Souza, Lara; Chappelka, Arthur H.; Davison, Alan W.

    2006-01-01

    Cutleaf coneflower (Rudbeckia laciniata L.), crown-beard (Verbesina occidentalis Walt.), and tall milkweed (Asclepias exaltata L.) are wildflower species native to Great Smoky Mountains National Park (U.S.A.). Natural populations of each species were analyzed for leaf ascorbic acid (AA) and dehydroascorbic acid (DHA) to assess the role of ascorbate in protecting the plants from ozone stress. Tall milkweed contained greater quantities of AA (7-10 μmol g -1 fresh weight) than crown-beard (2-4 μmol g -1 fresh weight) or cutleaf coneflower (0.5-2 μmol g -1 fresh weight). DHA was elevated in crown-beard and cutleaf coneflower relative to tall milkweed suggesting a diminished capacity for converting DHA into AA. Tall milkweed accumulated AA in the leaf apoplast (30-100 nmol g -1 fresh weight) with individuals expressing ozone foliar injury symptoms late in the season having less apoplast AA. In contrast, AA was not present in the leaf apoplast of either crown-beard or cutleaf coneflower. Unidentified antioxidant compounds were present in the leaf apoplast of all three species. Overall, distinct differences in antioxidant metabolism were found in the wildflower species that corresponded with differences in ozone sensitivity. - Wildflower species exhibit differences in ascorbic acid content and redox status that affect ozone sensitivity

  1. Seasonal profiles of leaf ascorbic acid content and redox state in ozone-sensitive wildflowers

    Energy Technology Data Exchange (ETDEWEB)

    Burkey, Kent O. [Plant Science Research Unit, USDA-ARS and North Carolina State University, 3127 Ligon Street, Raleigh, NC 27607 (United States)]. E-mail: koburkey@unity.ncsu.edu; Neufeld, Howard S. [Appalachian State University, Boone, NC (United States); Souza, Lara [Department of Ecology and Evolutionary Biology, University of Tennessee, Knoxville, TN (United States); Chappelka, Arthur H. [Auburn University, Auburn, AL (United States); Davison, Alan W. [University of Newcastle, Newcastle, England (United Kingdom)

    2006-10-15

    Cutleaf coneflower (Rudbeckia laciniata L.), crown-beard (Verbesina occidentalis Walt.), and tall milkweed (Asclepias exaltata L.) are wildflower species native to Great Smoky Mountains National Park (U.S.A.). Natural populations of each species were analyzed for leaf ascorbic acid (AA) and dehydroascorbic acid (DHA) to assess the role of ascorbate in protecting the plants from ozone stress. Tall milkweed contained greater quantities of AA (7-10 {mu}mol g{sup -1} fresh weight) than crown-beard (2-4 {mu}mol g{sup -1} fresh weight) or cutleaf coneflower (0.5-2 {mu}mol g{sup -1} fresh weight). DHA was elevated in crown-beard and cutleaf coneflower relative to tall milkweed suggesting a diminished capacity for converting DHA into AA. Tall milkweed accumulated AA in the leaf apoplast (30-100 nmol g{sup -1} fresh weight) with individuals expressing ozone foliar injury symptoms late in the season having less apoplast AA. In contrast, AA was not present in the leaf apoplast of either crown-beard or cutleaf coneflower. Unidentified antioxidant compounds were present in the leaf apoplast of all three species. Overall, distinct differences in antioxidant metabolism were found in the wildflower species that corresponded with differences in ozone sensitivity. - Wildflower species exhibit differences in ascorbic acid content and redox status that affect ozone sensitivity.

  2. Antiproliferative activity of cardenolide glycosides from Asclepias subulata.

    Science.gov (United States)

    Rascón-Valenzuela, L; Velázquez, C; Garibay-Escobar, A; Medina-Juárez, L A; Vilegas, W; Robles-Zepeda, R E

    2015-08-02

    Asclepias subulata Decne. is a shrub occurring in Sonora-Arizona desert (Mexico-USA). The ethnic groups, Seris and Pimas, use this plant for the treatment of sore eyes, gastrointestinal disorders and cancer. To isolate the compounds responsible for antiproliferative activity of the methanol extract of A. subulata. A bioguided fractionation of methanol extract of A. subulata was performed using MTT assay to measure the antiproliferative activity of different compounds on three human cancer cell lines (A549, LS 180 and PC-3), one murine cancer cell line (RAW 264.7) and one human normal cell line (ARPE-19). The methanol extract was partitioned with hexane, ethyl acetate and ethanol. The active fractions, ethanol and residual, were fractioned by silica-column chromatography and active sub-fractions were separated using HPLC. The chemical structures of isolated compounds were elucidated with different chemical and spectroscopic methods. A new cardenolide glycoside, 12, 16-dihydroxycalotropin, and three known, calotropin, corotoxigenin 3-O-glucopyranoside and desglucouzarin, were isolated of active sub-fractions. All isolated compounds showed a strong antiproliferative activity in human cancer cells. Calotropin was the more active with IC50 values of 0.0013, 0.06 and 0.41 µM on A549, LS 180 and PC-3 cell lines, respectively; while 12, 16-dihydroxycalotropin reached values of 2.48, 5.62 and 11.70 µM, on the same cells; corotoxigenin 3-O-glucopyranoside had IC50 of 2.64, 3.15 and 6.62 µM and desglucouzarin showed values of 0.90, 6.57 and 6.62, µM. Doxorubicin, positive control, showed IC50 values of 1.78, 6.99 and 3.18 µM, respectively. The isolated compounds had a weak effect on murine cancer cells and human normal cells, exhibiting selectivity to human cancer cells. In this study, we found that 12, 16-dihydroxicalotropin, calotropin, corotoxigenin 3-O-glucopyranoside and desglucouzarin are responsible of antiproliferative properties of A. subulata, and that these

  3. Apoptotic activities of cardenolide glycosides from Asclepias subulata.

    Science.gov (United States)

    Rascón-Valenzuela, L A; Velázquez, C; Garibay-Escobar, A; Vilegas, W; Medina-Juárez, L A; Gámez-Meza, N; Robles-Zepeda, R E

    2016-12-04

    Asclepias subulata Decne. (Apocynaceae) is a shrub occurring in Sonora-Arizona desert. The ethnic groups of Sonora, Mexico, Seris and Pimas, use this plant for the treatment of sore eyes, gastrointestinal disorders and cancer. To determine the cell death pathways that the cardenolide glycosides with antiproliferative activity found in the methanol extract of A. subulata are able to activate. The effect of cardenolide glycosides isolated of A. subulata on induction of apoptosis in cancer cells was evaluated through the measuring of several key events of apoptosis. A549 cells were treated for 12h with doses of 3.0, 0.2, 3.0 and 1.0µM of 12, 16-dihydroxicalotropin, calotropin, corotoxigenin 3-O-glucopyranoside and desglucouzarin, respectively. Apoptotic and necrotic cell levels were measured by double staining with annexin V-FITC/PI. Mitochondrial membrane depolarization was examined through JC-1 staining. Apoptosis cell death and the apoptosis pathways activated by cardenolide glycosides isolated of A. subulata were further characterized by the measurement of caspase-3, caspase-8 and caspase-9 activity. Apoptotic assays showed that the four cardenolide glycosides isolated of A. subulata induced apoptosis in A549 cells, which was evidencing by phosphatidylserine externalization in 18.2%, 17.0%, 23.9% and 22.0% for 12, 16-dihydroxicalotropin, calotropin, corotoxigenin 3-O-glucopyranoside and desglucouzarin, respectively, compared with 4.6% of control cells. Cell death was also associated with a decrease in mitochondrial membrane potential, which was more than 75% in the treated cultures respect to control. The activation of caspase-3 was observed in all cardenolide glycosides-treated cancer cells indicating the caspase-dependent apoptosis of A549 cells. Extrinsic and intrinsic apoptosis pathways were activated by cardenolide glycosides treatment at the doses tested. In this study was found that cardenolide glycosides, 12, 16-dihydroxicalotropin, calotropin

  4. Synthesis of formyl esters of vegetable oils: Milkweed, Pennycress and Soy

    Science.gov (United States)

    In a previous study of the characteristics of acyl derivatives of polyhydroxy milkweed oil (PHMWO), it was observed that the densities and viscosities of the respective derivatives decreased with increased chain length of the substituent acyl group. Thus, from the polyhydroxyl starting material, att...

  5. Secondary Defense Chemicals in Milkweed Reduce Parasite Infection in Monarch Butterflies, Danaus plexippus.

    Science.gov (United States)

    Gowler, Camden D; Leon, Kristoffer E; Hunter, Mark D; de Roode, Jacobus C

    2015-06-01

    In tri-trophic systems, herbivores may benefit from their host plants in fighting parasitic infections. Plants can provide parasite resistance in two contrasting ways: either directly, by interfering with the parasite, or indirectly, by increasing herbivore immunity or health. In monarch butterflies, the larval diet of milkweed strongly influences the fitness of a common protozoan parasite. Toxic secondary plant chemicals known as cardenolides correlate strongly with parasite resistance of the host, with greater cardenolide concentrations in the larval diet leading to lower parasite growth. However, milkweed cardenolides may covary with other indices of plant quality including nutrients, and a direct experimental link between cardenolides and parasite performance has not been established. To determine if the anti-parasitic activity of milkweeds is indeed due to secondary chemicals, as opposed to nutrition, we supplemented the diet of infected and uninfected monarch larvae with milkweed latex, which contains cardenolides but no nutrients. Across three experiments, increased dietary cardenolide concentrations reduced parasite growth in infected monarchs, which consequently had longer lifespans. However, uninfected monarchs showed no differences in lifespan across treatments, confirming that cardenolide-containing latex does not increase general health. Our results suggest that cardenolides are a driving force behind plant-derived resistance in this system.

  6. Study of oil sorption behavior of filled and structured fiber assemblies made from polypropylene, kapok and milkweed fibers.

    Science.gov (United States)

    Rengasamy, R S; Das, Dipayan; Karan, C Praba

    2011-02-15

    This article reports on oil sorption behavior of fiber assemblies made up of single natural and synthetic fibers as well as blend of natural and synthetic fibers when tested with high density oil and diesel oil. A series of filled fiber assemblies were prepared from 100% polypropylene, kapok, and milkweed fibers and another series of bonded structured fiber assemblies were prepared from a 70/30 blend of kapok and polypropylene fibers and a 70/30 blend of milkweed and polypropylene fibers. It was observed that the porosity of the fiber assemblies played a very important role in determining its oil sorption capacity. The polypropylene fiber assembly exhibited the highest sorption capacity (g/g) followed by the kapok and milkweed fiber assemblies at porosity milkweed fibers have intra fiber porosities of 0.81 and 0.83, respectively. All the fiber assemblies showed higher oil sorption capacity with the high density oil as compared to the diesel oil. As the kapok and milkweed fiber have low cellulose content, hence their slow degradation is an advantage in fresh and marine water applications. The good sorption capacity of kapok and milkweed fiber assemblies along with their bio-degradable nature offer great scope for structuring them into fiber assemblies with large porosity and uniform pores to have efficient oil sorbents. Copyright © 2010 Elsevier B.V. All rights reserved.

  7. Diagnose of the ingestion of Asclepias mellodora St. Hil. by sheep through microhistological analysis of their digestive contents

    Directory of Open Access Journals (Sweden)

    María Silvia Cid

    2011-02-01

    Full Text Available Asclepias mellodora St. Hil. is a native acute toxic species frequent in the grasslands of the Buenos Aires province, Argentina, whose toxicity had not been assessed until now. This study evaluates the minimal lethal dose of this species for sheep, and the possibility of microscopically recognizing its fragments in gastrointestinal contents as a complementary diagnostic tool in necropsies. Three Frisona sheep (average LW=55±4.5 kg were dosed via an esophageal tube with each one of the following doses of asclepias: 8.0, 5.0, 2.0 and 0.8 g DM.kg LW-1. Sheep poisoned with the three higher doses died between 10 and 85 h after intoxication, but those receiving the lower dose did not. During necropsies we: 1 determined the dry weight of the contents of rumen+reticulum, omasum+abomasum, and large intestine, 2 estimated the percentages of asclepias fragments by microanalysis correcting for digestion effects on fragment recognition, and 3 calculated the total mass of asclepias in the digestive tract of each animal. For the three higher doses, the mass of asclepias identified in the total ingesta was 12.3±3.4% of the amount supplied, possibly because of the strong diarrhea its ingestion produced. The percentages of asclepias in rumen+reticulum did not differ from the average quantified for the entire tract. The results of this study indicate that the minimal lethal doses of asclepias for sheep is between 2.0 and 0.8g DM·kg LW-1, and that the microhistological analysis of the rumen+reticulum, the easiest region to sample, can be used to confirm the ingestion of this toxic species, although the estimated percentage will be not a good estimator of the ingested percentage.

  8. Thrombin like activity of Asclepias curassavica L. latex: action of cysteine proteases.

    Science.gov (United States)

    Shivaprasad, H V; Rajesh, R; Nanda, B L; Dharmappa, K K; Vishwanath, B S

    2009-05-04

    To validate the scientific basis of plant latex to stop bleeding on fresh cuts. Cysteine protease(s) from Asclepias curassavica (Asclepiadaceae) plant latex was assessed for pro-coagulant and thrombin like activities. A waxy material from the latex of Asclepias curassavica latex was removed by freezing and thawing. The resulted latex enzyme fraction was assayed for proteolytic activity using denatured casein as substrate. Its coagulant activity and thrombin like activity were determined using citrated plasma and pure fibrinogen, respectively. Inhibition studies were performed using specific protease inhibitors to know the type of protease. The latex enzyme fraction exhibited strong proteolytic activity when compared to trypsin and exerted pro-coagulant action by reducing plasma clotting time from 195 to 58 s whereas trypsin reduced clotting time marginally from 195 to 155 s. The pro-coagulant activity of this enzyme fraction was exerted by selectively hydrolyzing A alpha and B beta subunits of fibrinogen to form fibrin clot when pure fibrinogen was used as substrate as assessed by fibrinogen-agarose plate method and fibrinogen polymerization assay. Trypsin failed to induce any fibrin clot under similar conditions. The electrophoretic pattern of latex enzyme fraction-induced fibrin clot was very much similar to that of thrombin-induced fibrin clot and mimic thrombin like action. The proteolytic activity including thrombin like activity of Asclepias curassavica latex enzyme fraction was completely inhibited by iodoaceticacid (IAA). Cysteine proteases from Asclepias curassavica latex exhibited strong pro-coagulant action and were found to be specific in its action (Thrombin like). This could be the basis for the use of plant latex in pharmacological applications that justify their use as folk medicine.

  9. 8,14-Secopregnane glycosides from the aerial parts of Asclepias tuberosa.

    Science.gov (United States)

    Warashina, Tsutomu; Noro, Tadataka

    2009-07-01

    Twenty pregnane glycosides, tuberoside A(1)-L(5), were isolated from the diethyl ether-soluble fraction of the MeOH extract from the aerial parts of Asclepias tuberosa (Asclepiadaceae). The pregnane glycosides were composed of 8,12;8,20-diepoxy-8,14-secopregnane as aglycon, and D-cymarose, D-oleandrose, D-digitoxose and/or D-glucose as the component sugars. Their structures were established using NMR spectroscopic analysis and chemical methodologies.

  10. Kaempferol and its glycosides in the seeds hair of Asclepias syriaca L.

    Science.gov (United States)

    Sikorska, M; Matławska, I; Frański, R

    2001-01-01

    The following flavonoid compounds have been isolated and identified from the seeds hair of Asclepias syriaca L.: kaempferol, kaempferol 3-O-beta-galactopyranoside, kaempferol 3-O-beta-xylopyranosyl (1 --> 2)-beta-galactopyranoside, kaempferol 3-O-beta-glucopyranosyl (1 --> 2)-beta-galactopyranoside, kaempferol 3-O-alpha-rhamnopyranosyl (1 --> 2)-beta-galactopyranoside. Their structures were established by acid hydrolysis, H2O2 oxidation and spectral analysis (UV, 1H, 3C NMR, MS).

  11. Monitoring of BHT-quinone and BHT-CHO in the gas of capsules of Asclepias physocarpa.

    Science.gov (United States)

    Ma, Bing-Ji; Peng, Hua; Liu, Ji-Kai

    2006-01-01

    Three volatile components, namely benzoic acid ethyl ester (1), 2,6-di-tert-butyl-p-benzoquinone (BHT-quinone) (2), and 3,5-di-tert-butyl-4-hydroxybenzaldehyde (BHT-CHO) (3), were detected from the gas in the capsules of Asclepias physocarpa by means of GC/MS analysis. BHT-quinone and BHT-CHO as organic pollutants are the degradation products of the antioxidant 2,6-di-tert-butyl-4-methylphenol (BHT). Ground water, lake water and/or rain water are a source of BHT metabolites in the plant Asclepias physocarpa.

  12. Verticillosides A-M: Polyoxygenated pregnane glycosides from Asclepias verticillata L.

    Science.gov (United States)

    Araya, Juan J; Binns, Franklin; Kindscher, Kelly; Timmermann, Barbara N

    2012-06-01

    As part of our ongoing effort to explore the chemical diversity of plants of the United States Midwest region, the isolation and identification of 13 pregnane glycosides named verticillosides A-M from Asclepias verticillata L. are reported. The structures of these compounds were elucidated by various spectroscopic techniques, including 1D and 2D NMR, IR, UV, and HRMS. The cytotoxicity of the isolates was evaluated against paired breast cell lines Hs578T (cancer) and Hs578Bst (normal), however, no significant growth inhibition was observed. Copyright © 2012 Elsevier Ltd. All rights reserved.

  13. Kaempferol, isorhamnetin and their glycosides in the flowers of Asclepias syriaca L.

    Science.gov (United States)

    Sikorska, M; Matławska, I

    2001-01-01

    The following flavonoid compounds have been isolated and identified from the flowers of Asclepias svriaca L.: kaempferol, kaempferol 7-O-beta-glucoside, kaempferol 3-O-beta-galactopyranoside, kaempferol 3-O-beta-xylopyranosyl (1-->2)-beta-galactopyranoside, kaempferol 3-O-beta-glucopyranosyl (1-->2)-beta-galactopyranoside, isorhamnetin, isorhamnetin 7-O-beta-glucoside, isorhamnetin 3-O-beta-galactoside and isorhamnetin 3-O-beta-xylopyranosyl (1-->2)-beta-galactopyranoside. Their structures were established by conventional (acid, enzymatic hydrolysis and H2O2 oxidation) and spectral analysis (UV, 1H NMR, 13C NMR).

  14. Assessment of atmospheric pollution level using Asclepias procera leaves as biomonitor

    Energy Technology Data Exchange (ETDEWEB)

    Daud, M.; Khalid, N.; Ahmad, S. [Pakistan Inst. of Nuclear Science and Technology, Islamabad (Pakistan). Nuclear Chemistry Div.; Iqbal, J. [University of the Punjab, Lahore (Pakistan). Inst. of Chemistry

    2007-07-01

    The potential of Asclepias procera plant leaves as biomonitor for air pollution monitoring has been explored by analyzing 36 elements in the leaf samples employing Instrumental Neutron Activation Analysis (INAA) and Atomic Absorption Spectrometric (AAS) techniques. The leaf samples were collected in summer and winter seasons from urban areas of Islamabad with different anthropogenic activities as well as from a rural area as a reference site. The soil samples of the respective sites were also analyzed. The reliability of the methods used was established by analyzing the certified reference materials under identical experimental conditions and comparing the results obtained with the certified values, which are in quite good agreement with each other. Pollution Load Index (PLI) of the determined elements was computed and is discussed accordingly. The uptake of metals from soil to roots, stem and leaves has also been investigated by analyzing these parts of the same plant. The results suggest that the leaves of Asclepias procera plant have a good potential to indicate the air pollution levels both in the vicinity of industrial as well as near roadside areas. (orig.)

  15. Assessment of atmospheric pollution level using Asclepias procera leaves as biomonitor

    International Nuclear Information System (INIS)

    Daud, M.; Khalid, N.; Ahmad, S.; Iqbal, J.

    2007-01-01

    The potential of Asclepias procera plant leaves as biomonitor for air pollution monitoring has been explored by analyzing 36 elements in the leaf samples employing Instrumental Neutron Activation Analysis (INAA) and Atomic Absorption Spectrometric (AAS) techniques. The leaf samples were collected in summer and winter seasons from urban areas of Islamabad with different anthropogenic activities as well as from a rural area as a reference site. The soil samples of the respective sites were also analyzed. The reliability of the methods used was established by analyzing the certified reference materials under identical experimental conditions and comparing the results obtained with the certified values, which are in quite good agreement with each other. Pollution Load Index (PLI) of the determined elements was computed and is discussed accordingly. The uptake of metals from soil to roots, stem and leaves has also been investigated by analyzing these parts of the same plant. The results suggest that the leaves of Asclepias procera plant have a good potential to indicate the air pollution levels both in the vicinity of industrial as well as near roadside areas. (orig.)

  16. Thermal Properties of Extruded Injection-Molded Poly (lactic acid) and Milkweed Composites: Degradation Kinectics and Enthalpic Relaxation

    Science.gov (United States)

    In order to determine the degree of compatibility between Poly (lactic Acid) (PLA) and different biomaterials, PLA was compounded with milkweed fiber, a new crop oil seed. After oil extraction, the remaining cake retained approximately 10% residual oil and 47% protein. The pressed seed cake (10% mo...

  17. Which native milkweeds are acceptable host plants for larval monarch butterflies (Danaus plexippus) within the Midwestern U.S.

    Science.gov (United States)

    Over the past two decades, the population of monarch butterflies east of the Rocky Mountains has experienced a significant decline. Habitat restoration within the summer breeding range is crucial to boost population numbers. Monarch butterfly larvae use milkweeds as their only host plant. However, l...

  18. Climate change and an invasive, tropical milkweed: an ecological trap for monarch butterflies.

    Science.gov (United States)

    Faldyn, Matthew J; Hunter, Mark D; Elderd, Bret D

    2018-05-01

    While it is well established that climate change affects species distributions and abundances, the impacts of climate change on species interactions has not been extensively studied. This is particularly important for specialists whose interactions are tightly linked, such as between the monarch butterfly (Danaus plexippus) and the plant genus Asclepias, on which it depends. We used open-top chambers (OTCs) to increase temperatures in experimental plots and placed either nonnative Asclepias curassavica or native A. incarnata in each plot along with monarch larvae. We found, under current climatic conditions, adult monarchs had higher survival and mass when feeding on A. curassavica. However, under future conditions, monarchs fared much worse on A. curassavica. The decrease in adult survival and mass was associated with increasing cardenolide concentrations under warmer temperatures. Increased temperatures alone reduced monarch forewing length. Cardenolide concentrations in A. curassavica may have transitioned from beneficial to detrimental as temperature increased. Thus, the increasing cardenolide concentrations may have pushed the larvae over a tipping point into an ecological trap; whereby past environmental cues associated with increased fitness give misleading information. Given the ubiquity of specialist plant-herbivore interactions, the potential for such ecological traps to emerge as temperatures increase may have far-reaching consequences. © 2018 by the Ecological Society of America.

  19. 8,12;8,20-Diepoxy-8,14-secopregnane glycosides from the aerial parts of Asclepias tuberosa.

    Science.gov (United States)

    Warashina, Tsutomu; Noro, Tadataka

    2010-02-01

    Further study of constituents from the aerial parts of Asclepias tuberosa afforded twenty-two new steroidal glycosides along with tuberoside B(5) and G(5). These glycosides were confirmed to contain 8,12;8,20-diepoxy-8,14-secopregnanes, tuberogenin and its congeners, as their aglycones. The structure of each of these compounds was elucidated based on the interpretation of NMR and MS measurements and from chemical evidence.

  20. Structural polarity and dynamics of male germline stem cells in an insect (milkweed bug Oncopeltus fasciatus).

    Science.gov (United States)

    Dorn, David C; Dorn, August

    2008-01-01

    Knowing the structure opens a door for a better understanding of function because there is no function without structure. Male germline stem cells (GSCs) of the milkweed bug (Oncopeltus fasciatus) exhibit a very extraordinary structure and a very special relationship with their niche, the apical cells. This structural relationship is strikingly different from that known in the fruit fly (Drosophila melanogaster) -- the most successful model system, which allowed deep insights into the signaling interactions between GSCs and niche. The complex structural polarity of male GSCs in the milkweed bug combined with their astonishing dynamics suggest that cell morphology and dynamics are causally related with the most important regulatory processes that take place between GSCs and niche and ensure maintenance, proliferation, and differentiation of GSCs in accordance with the temporal need of mature sperm. The intricate structure of the GSCs of the milkweed bug (and probably of some other insects, i.e., moths) is only accessible by electron microscopy. But, studying singular sections through the apical complex (i.e., GSCs and apical cells) is not sufficient to obtain a full picture of the GSCs; especially, the segregation of projection terminals is not tangible. Only serial sections and their overlay can establish whether membrane ingrowths merely constrict projections or whether a projection terminal is completely cut off. To sequence the GSC dynamics, it is necessary to include juvenile stages, when the processes start and the GSCs occur in small numbers. The fine structural analysis of segregating projection terminals suggests that these terminals undergo autophagocytosis. Autophagosomes can be labeled by markers. We demonstrated acid phosphatase and thiamine pyrophosphatase (TPPase). Both together are thought to identify autophagosomes. Using the appropriate substrate of the enzymes and cerium chloride, the precipitation of electron-dense cerium phosphate granules

  1. Pheromones of milkweed bugs (Heteroptera: Lygaeidae) attract wayward plant bugs: Phytocoris mirid sex pheromone.

    Science.gov (United States)

    Zhang, Qing-He; Aldrich, Jeffrey R

    2003-08-01

    The synthetic aggregation pheromone of the large milkweed bug, Oncopeltus fasciatus (Dallas) (Lygaeinae), also attracted males of the plant bug, Phytocoris difficilis Knight (Miridae). Field testing partial blends against the six-component blend comprising the Oncopeltus pheromone showed that cross-attraction of P. difficilis males was due to synergism between (E)-2-octenyl acetate and (E,E)-2,4-hexadienyl acetate. Hexyl acetate was abundant in the metathoracic scent gland (MSG) secretion of P. difficilis males, but because female P. difficilis could not initially be found in the field, further combinatorial tests were guided by prior research on the pheromones of two Phytocoris species in the western United States. The combination of hexyl, (E)-2-hexenyl, and (E)-2-octenyl acetates was as attractive to P. difficilis males as the milkweed bug pheromone, yet no milkweed bugs were drawn to this blend. Gas chromatographic (GC)-electroantennographic detection (EAD) and GC-mass spectrometric (MS) analyses of female P. difficilis MSGs determined that their secretion contained predominantly hexyl, (E)-2-hexenyl, and (E)-2-octenyl acetates (all strongly EAD-active)-the latter two compounds found only in trace amounts from males-plus five minor female-specific compounds, three of which were EAD-active. (E,E)-2,4-Hexadienyl acetate was not detected from P. difficilis females or males. The blend of the three major components, hexyl, (E)-2-hexenyl, and (E)-2-octenyl acetates (2:1.5:1 by volume), was as attractive as the blend of all six EAD-active compounds identified from females, indicating that this ternary blend constitutes the sex pheromone of P. difficilis. Hexyl acetate with (E)-2-octenyl acetate also attracted males of another species, P. breviusculus Reuter, but addition of (E)-2-hexenyl acetate and/or (E,E)-2,4-hexadienyl acetate inhibited attraction of P. breviusculus males. Attraction of P. difficilis males occurred mainly during the first half of scotophase. The

  2. Sterility and mating competitiveness of irradiated males of the large milkweed bug, Oncopeltus fasciatus

    International Nuclear Information System (INIS)

    Moursy, L.E.; Eesa, N.M.; Cutkomp, L.K.

    1991-01-01

    Low level gamma radiation adversely affected the reproductive capacity of the large milkweed bug, oncopeltus fasciatus dallas, as expressed by fecundity and fertility. Treatment was applied to late 5th instar male nymphs. Both fecundity and fertility decreased linearly with the treatment dose and complete sterility occurred when males were exposed to 6 kilorads and mated with normal females. The mating competitiveness of O. fasciatus males irradiated at late 5th instar nymphs decreased linearly with the treatment dose. A strong negative relationship existed between dose and mating competitiveness ( r = -0.93). A 3:2 ratio of irradiated males at 4 kilorads ( as late 5th instar as many progeny as normal in F 1 .2 tab.,1 fig

  3. Hox gene function and interaction in the milkweed bug Oncopeltus fasciatus (Hemiptera).

    Science.gov (United States)

    Angelini, David R; Liu, Paul Z; Hughes, Cynthia L; Kaufman, Thomas C

    2005-11-15

    Studies in genetic model organisms such as Drosophila have demonstrated that the homeotic complex (Hox) genes impart segmental identity during embryogenesis. Comparative studies in a wide range of other insect taxa have shown that the Hox genes are expressed in largely conserved domains along the anterior-posterior body axis, but whether they are performing the same functions in different insects is an open question. Most of the Hox genes have been studied functionally in only a few holometabolous insects that undergo metamorphosis. Thus, it is unclear how the Hox genes are functioning in the majority of direct-developing insects and other arthropods. To address this question, we used a combination of RNAi and in situ hybridization to reveal the expression, functions, and regulatory interactions of the Hox genes in the milkweed bug Oncopeltus fasciatus. Our results reveal many similarities and some interesting differences compared to Drosophila. We find that the gene Antennapedia is required for the identity of all three thoracic segments, while Ultrabithorax, abdominal-A and Abdominal-B cooperate to pattern the abdomen. The three abdominal genes exhibit posterior prevalence like in Drosophila, but apparently via some post-transcriptional mechanism. The functions of the head genes proboscipedia, Deformed, and Sex combs reduced were shown previously, and here we find that the complex temporal expression of pb in the labium is like that of other insects, but its regulatory relationship with Scr is unique. Overall, our data reveal that the evolution of insect Hox genes has included many small changes within general conservation of expression and function, and that the milkweed bug provides a useful model for understanding the roles of Hox genes in a direct-developing insect.

  4. Synthesis of Polyformate Esters of Vegetable Oils: Milkweed, Pennycress, and Soy

    Directory of Open Access Journals (Sweden)

    Rogers E. Harry-O’kuru

    2016-01-01

    Full Text Available In a previous study of the characteristics of acyl derivatives of polyhydroxy milkweed oil (PHMWO, it was observed that the densities and viscosities of the respective derivatives decreased with increased chain length of the substituent acyl group. Thus from the polyhydroxy starting material, attenuation in viscosity of the derivatives relative to PHMWO was found in the order: PHMWO ≫ PAcMWE ≫ PBuMWE ≫ PPMWE (2332 : 1733 : 926.2 : 489.4 cSt, resp., at 40°C, where PAcMWE, PBuMWE, and PPMWE were the polyacetyl, polybutyroyl, and polypentanoyl ester derivatives, respectively. In an analogous manner, the densities also decreased as the chain length increased although not as precipitously compared to the viscosity drop. By inference, derivatives of vegetable oils with short chain length substituents on the triglyceride would be attractive in lubricant applications in view of their higher densities and possibly higher viscosity indices. Pursuant to this, we have explored the syntheses of formyl esters of three vegetable oils in order to examine the optimal density, viscosity, and related physical characteristics in relation to their suitability as lubricant candidates. In the absence of ready availability of formic anhydride, we opted to employ the epoxidized vegetable oils as substrates for formyl ester generation using glacial formic acid. The epoxy ring-opening process was smooth but was apparently followed by a simultaneous condensation reaction of the putative α-hydroxy formyl intermediate to yield vicinal diformyl esters from the oxirane. All three polyformyl esters milkweed, soy, and pennycress derivatives exhibited low coefficient of friction and a correspondingly much lower wear scar in the 4-ball antiwear test compared to the longer chain acyl analogues earlier studied.

  5. Synthesis of Polyformate Esters of Vegetable Oils: Milkweed, Pennycress, and Soy.

    Science.gov (United States)

    Harry-O'kuru, Rogers E; Biresaw, Girma; Tisserat, Brent; Evangelista, Roque

    2016-01-01

    In a previous study of the characteristics of acyl derivatives of polyhydroxy milkweed oil (PHMWO), it was observed that the densities and viscosities of the respective derivatives decreased with increased chain length of the substituent acyl group. Thus from the polyhydroxy starting material, attenuation in viscosity of the derivatives relative to PHMWO was found in the order: PHMWO ≫ PAcMWE ≫ PBuMWE ≫ PPMWE (2332 : 1733 : 926.2 : 489.4 cSt, resp., at 40°C), where PAcMWE, PBuMWE, and PPMWE were the polyacetyl, polybutyroyl, and polypentanoyl ester derivatives, respectively. In an analogous manner, the densities also decreased as the chain length increased although not as precipitously compared to the viscosity drop. By inference, derivatives of vegetable oils with short chain length substituents on the triglyceride would be attractive in lubricant applications in view of their higher densities and possibly higher viscosity indices. Pursuant to this, we have explored the syntheses of formyl esters of three vegetable oils in order to examine the optimal density, viscosity, and related physical characteristics in relation to their suitability as lubricant candidates. In the absence of ready availability of formic anhydride, we opted to employ the epoxidized vegetable oils as substrates for formyl ester generation using glacial formic acid. The epoxy ring-opening process was smooth but was apparently followed by a simultaneous condensation reaction of the putative α-hydroxy formyl intermediate to yield vicinal diformyl esters from the oxirane. All three polyformyl esters milkweed, soy, and pennycress derivatives exhibited low coefficient of friction and a correspondingly much lower wear scar in the 4-ball antiwear test compared to the longer chain acyl analogues earlier studied.

  6. Transcriptional profile and differential fitness in a specialist milkweed insect across host plants varying in toxicity.

    Science.gov (United States)

    Birnbaum, Stephanie S L; Rinker, David C; Gerardo, Nicole M; Abbot, Patrick

    2017-12-01

    Interactions between plants and herbivorous insects have been models for theories of specialization and co-evolution for over a century. Phytochemicals govern many aspects of these interactions and have fostered the evolution of adaptations by insects to tolerate or even specialize on plant defensive chemistry. While genomic approaches are providing new insights into the genes and mechanisms insect specialists employ to tolerate plant secondary metabolites, open questions remain about the evolution and conservation of insect counterdefences, how insects respond to the diversity defences mounted by their host plants, and the costs and benefits of resistance and tolerance to plant defences in natural ecological communities. Using a milkweed-specialist aphid (Aphis nerii) model, we test the effects of host plant species with increased toxicity, likely driven primarily by increased secondary metabolites, on aphid life history traits and whole-body gene expression. We show that more toxic plant species have a negative effect on aphid development and lifetime fecundity. When feeding on more toxic host plants with higher levels of secondary metabolites, aphids regulate a narrow, targeted set of genes, including those involved in canonical detoxification processes (e.g., cytochrome P450s, hydrolases, UDP-glucuronosyltransferases and ABC transporters). These results indicate that A. nerii marshal a variety of metabolic detoxification mechanisms to circumvent milkweed toxicity and facilitate host plant specialization, yet, despite these detoxification mechanisms, aphids experience reduced fitness when feeding on more toxic host plants. Disentangling how specialist insects respond to challenging host plants is a pivotal step in understanding the evolution of specialized diet breadths. © 2017 John Wiley & Sons Ltd.

  7. Indirect organogenesis in milkweed ( Calotropis procera from mature zygotic embryo explants

    Directory of Open Access Journals (Sweden)

    Hojatollah Abbasi

    2018-01-01

    Full Text Available Milkweed ( Calotropis procera is a valuable medicinal plant which grows in many regions of Iran. Its significant medicinal properties have made it an important crop which is cultivated commercially. This plant is propagated from seeds as well as root and shoot cuttings. Due to problems in the usage of these reproduction methods, new propagation methods such as tissue culturing should be developed. This study was aimed at obtaining appropriate concentrations of plant hormones for indirect organogenesis of milkweed. The experiment was arranged in a completely randomized design (CRD with 3 replications. The effects of various concentrations of (2,4-dichlorophenoxyacetic acid 2,4-D (0.1, 0.5, 1, 2 and 3 mg/l were studied in terms of callus induction and shoot regeneration on an MS based medium supplemented with BA (benzyl amino purine and NAA (naphthalene acetic acid at the same concentration. Mature embryos were used as explants and morphological traits such as embryo size, callus size, number and size of shoots and roots were recorded. The results showed that 2,4-D significantly increased the size of cultured embryos (P < 0.05. The largest embryo volume was observed in cultures treated with 3 mg/l 2,4-D. The highest callusing was recorded in 2 mg/l 2,4-D. The effects of BA and NAA concentrations on shoot regeneration were significant and the highest values were observed for a combination of 1 mg/l BA and 2 mg/l NAA. 1 mg/l IBA (Indole 3-butyric acid was able to induce the highest number of better quality roots and shoots.

  8. Study of Antibacterial Activity and Bacteriology of Latex from Asclepias syriaca L

    Science.gov (United States)

    McCay, Steven; Mahlberg, Paul

    1973-01-01

    Whole and fractionated latex of Asclepias syriaca was tested for antimicrobial or growth-promoting activity with 16 genera and species of bacteria. Latex and extracted fractions (distilled water, acetic acid, sodium bicarbonate, sulfuric acid, and ethyl ether) possessed no detectable antimicrobial activity. Comparison of growth curves of selected bacteria incubated with serum and rubber fractions, as well as controls, revealed no detectable inhibition of growth, except for a slight inhibitory response to autoclaved serum. Most bacteria were capable of utilizing latex for a substrate as indicated by the increased growth rate in the exponential phase. The stationary phase was entered simultaneously by both the treated cultures and the controls. Various bacteria cultured in a litmus latex mixture yielded populations which ranged from <104 organisms/ml for Lactobacillus casei, Staphylococcus aureus and Micrococcus lysodeikticus to 1.1 × 1010 organisms/ml for Clostridium acetobutylicum. Whole latex, as well as the serum and rubber fractions, support the growth of various bacteria, but under field conditions there is no evidence for systemic infection of this type of cell by bacteria. PMID:4790590

  9. Detection and plant monitoring programs: lessons from an intensive survey of Asclepias meadii with five observers.

    Directory of Open Access Journals (Sweden)

    Helen M Alexander

    Full Text Available Monitoring programs, where numbers of individuals are followed through time, are central to conservation. Although incomplete detection is expected with wildlife surveys, this topic is rarely considered with plants. However, if plants are missed in surveys, raw count data can lead to biased estimates of population abundance and vital rates. To illustrate, we had five independent observers survey patches of the rare plant Asclepias meadii at two prairie sites. We analyzed data with two mark-recapture approaches. Using the program CAPTURE, the estimated number of patches equaled the detected number for a burned site, but exceeded detected numbers by 28% for an unburned site. Analyses of detected patches using Huggins models revealed important effects of observer, patch state (flowering/nonflowering, and patch size (number of stems on probabilities of detection. Although some results were expected (i.e. greater detection of flowering than nonflowering patches, the importance of our approach is the ability to quantify the magnitude of detection problems. We also evaluated the degree to which increased observer numbers improved detection: smaller groups (3-4 observers generally found 90 - 99% of the patches found by all five people, but pairs of observers or single observers had high error and detection depended on which individuals were involved. We conclude that an intensive study at the start of a long-term monitoring study provides essential information about probabilities of detection and what factors cause plants to be missed. This information can guide development of monitoring programs.

  10. Structure of Asclepias syriaca L. population against phytocenotic and habitat conditions in Widuchowa (West Pomerania

    Directory of Open Access Journals (Sweden)

    Bacieczko Wanda

    2015-12-01

    Full Text Available Asclepias syriaca L. is on the invasive species list in Poland. Its sites are scattered, with the exception of cultivation sites; they are also not well identified in the country and that is why they have not been presented in the ATPOL (Distribution Atlas of Vascular Plants in Poland yet. In this study, spatial structure of A. syriaca population against phytocenotic and soil conditions in Widuchowa (West Pomeraniawere examined. Number of specimens, their density per 1 m2, and mean crowding were determined. In addition, the population spatial structure type was identified through observations and by calculation of the dispersion coefficient. On the basis of the conducted research, it was found that the investigated population comprised 1 500 specimens and occupied the area of 38 m2. It exhibited regular spatial distribution type (dispersion coefficient<1 and was characterized by high value of mean shoot density, which amounted to 29 spec./1 m2 (max. 35 spec./1 m2. On the basis of the conducted chemical analysis of the soil from the A. syriaca habitat, the substrate was classified as alkaline soil (pH=7.3-7.6, of low total nitrogen (0.07-0.15%, as well as low total carbon content (0.8-1.45%.

  11. Properties of Single K+ and Cl− Channels in Asclepias tuberosa Protoplasts 1

    Science.gov (United States)

    Schauf, Charles L.; Wilson, Kathryn J.

    1987-01-01

    Potassium and chloride channels were characterized in Asclepias tuberosa suspension cell derived protoplasts by patch voltage-clamp. Whole-cell currents and single channels in excised patches had linear instantaneous current-voltage relations, reversing at the Nernst potentials for K+ and Cl−, respectively. Whole cell K+ currents activated exponentially during step depolarizations, while voltage-dependent Cl− channels were activated by hyperpolarizations. Single K+ channel conductance was 40 ± 5 pS with a mean open time of 4.5 milliseconds at 100 millivolts. Potassium channels were blocked by Cs+ and tetraethylammonium, but were insensitive to 4-aminopyridine. Chloride channels had a single-channel conductance of 100 ± 17 picosiemens, mean open time of 8.8 milliseconds, and were blocked by Zn2+ and ethacrynic acid. Whole-cell Cl− currents were inhibited by abscisic acid, and were unaffected by indole-3-acetic acid and 2,4-dichlorophenoxyacetic acid. Since internal and external composition can be controlled, patch-clamped protoplasts are ideal systems for studying the role of ion channels in plant physiology and development. Images Fig. 5 PMID:16665712

  12. Purification and biochemical characterization of asclepain c I from the latex of Asclepias curassavica L.

    Science.gov (United States)

    Liggieri, Constanza; Arribére, M Cecilia; Trejo, Sebastián A; Canals, Francesc; Avilés, Francesc X; Priolo, Nora S

    2004-08-01

    In this work we report the isolation, purification and characterization of a new protease from latex of Asclepias curassavica L. Crude extract (CE) was obtained by gathering latex on 0.1 M citric-phosphate buffer with EDTA and cysteine with subsequent ultracentrifugation. Proteolytic assays were made on casein or azocasein as substrates. Caseinolytic activity was completely inhibited by E-64. Stability at different temperatures, optimum pH and ionic strength were evaluated by measuring the residual caseinolytic activity at different times after the incubation. CE showed the highest caseinolytic activity at pH 8.5 in the presence of 12 mM cysteine. CE was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by SDS-PAGE, were isolated. The major purified protease (asclepain cI) showed a molecular mass of 23.2 kDa by mass spectrometry and a pI higher than 9.3. The N-terminal sequence showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-aminoacid-p-nitrophenyl esters, the enzyme showed higher preference for the glutamine derivative. Determinations of kinetic parameter (km and Kcat) were performed with PFLNA.

  13. Detection and plant monitoring programs: lessons from an intensive survey of Asclepias meadii with five observers.

    Science.gov (United States)

    Alexander, Helen M; Reed, Aaron W; Kettle, W Dean; Slade, Norman A; Bodbyl Roels, Sarah A; Collins, Cathy D; Salisbury, Vaughn

    2012-01-01

    Monitoring programs, where numbers of individuals are followed through time, are central to conservation. Although incomplete detection is expected with wildlife surveys, this topic is rarely considered with plants. However, if plants are missed in surveys, raw count data can lead to biased estimates of population abundance and vital rates. To illustrate, we had five independent observers survey patches of the rare plant Asclepias meadii at two prairie sites. We analyzed data with two mark-recapture approaches. Using the program CAPTURE, the estimated number of patches equaled the detected number for a burned site, but exceeded detected numbers by 28% for an unburned site. Analyses of detected patches using Huggins models revealed important effects of observer, patch state (flowering/nonflowering), and patch size (number of stems) on probabilities of detection. Although some results were expected (i.e. greater detection of flowering than nonflowering patches), the importance of our approach is the ability to quantify the magnitude of detection problems. We also evaluated the degree to which increased observer numbers improved detection: smaller groups (3-4 observers) generally found 90 - 99% of the patches found by all five people, but pairs of observers or single observers had high error and detection depended on which individuals were involved. We conclude that an intensive study at the start of a long-term monitoring study provides essential information about probabilities of detection and what factors cause plants to be missed. This information can guide development of monitoring programs.

  14. UGT74AN1, a Permissive Glycosyltransferase from Asclepias curassavica for the Regiospecific Steroid 3-O-Glycosylation.

    Science.gov (United States)

    Wen, Chao; Huang, Wei; Zhu, Xue-Lin; Li, Xiao-San; Zhang, Fan; Jiang, Ren-Wang

    2018-02-02

    A permissive steroid glycosyltransferase (UGT74AN1) from Asclepias curassavica exhibited robust capabilities for the regiospecific C3 glycosylation of cardiotonic steroids and C 21 steroid precursors, and unprecedented promiscuity toward 53 structurally diverse natural and unnatural compounds to form O-, N-, and S-glycosides, along with the catalytic reversibility for a one-pot transglycosylation reaction. These findings highlight UGT74AN1 as the first regiospecific catalyst for cardiotonic steroid C3 glycosylation and exhibit significant potential for glycosylation of diverse bioactive molecules in drug discovery.

  15. Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.

    Science.gov (United States)

    Liggieri, Constanza; Obregon, Walter; Trejo, Sebastian; Priolo, Nora

    2009-02-01

    Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain c-II) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain c-II was the minor proteolytic component in the latex, but showed higher specific activity than asclepain c-I, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain c-II displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain c-II is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The Nterminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-alpha-CBZ-L-Gln-p-nitrophenyl ester as substrate: K(m)=0.1634 mM, k(cat)=121.48 s(-1), and k(cat)/K(m)=7.4 x 10(5) s(-1)/mM.

  16. Dynamics of growth zone patterning in the milkweed bug Oncopeltus fasciatus.

    Science.gov (United States)

    Auman, Tzach; Vreede, Barbara M I; Weiss, Aryeh; Hester, Susan D; Williams, Terri A; Nagy, Lisa M; Chipman, Ariel D

    2017-05-15

    We describe the dynamic process of abdominal segment generation in the milkweed bug Oncopeltus fasciatus We present detailed morphological measurements of the growing germband throughout segmentation. Our data are complemented by cell division profiles and expression patterns of key genes, including invected and even-skipped as markers for different stages of segment formation. We describe morphological and mechanistic changes in the growth zone and in nascent segments during the generation of individual segments and throughout segmentation, and examine the relative contribution of newly formed versus existing tissue to segment formation. Although abdominal segment addition is primarily generated through the rearrangement of a pool of undifferentiated cells, there is nonetheless proliferation in the posterior. By correlating proliferation with gene expression in the growth zone, we propose a model for growth zone dynamics during segmentation in which the growth zone is functionally subdivided into two distinct regions: a posterior region devoted to a slow rate of growth among undifferentiated cells, and an anterior region in which segmental differentiation is initiated and proliferation inhibited. © 2017. Published by The Company of Biologists Ltd.

  17. Evaluation of synthetic hydrocarbons for mark-recapture studies on the red milkweed beetle.

    Science.gov (United States)

    Ginzel, Matthew D; Hanks, Lawrence M

    2002-05-01

    This study evaluates the potential for using blends of synthetic hydrocarbons in mark-recapture studies of insects. To test the durability of hydrocarbons, we applied a blend of five straight-chain hydrocarbons (C24, C21, C26. C28, C30) to detached elytra of the red milkweed beetle, Tetraopes tetrophthalmus (Forster) (Coleoptera: Cerambycidae), mounted the elytra on pins, and placed them in an exposed location outdoors. The amount of hydrocarbons on the elytra did not change over time, even after two months of exposure to sun and rain. Synthetic hydrocarbons applied to the elytra of living beetles did not significantly influence their longevity or mating success in a laboratory study. and the amounts of hydrocarbons did not change with age. The invariability of hydrocarbon ratios over time suggests that blends could provide a nearly infinite variety of ratios to mark individual insects uniquely and indelibly with a hydrocarbon "fingerprint." This technique offers a convenient, safe, and durable means of individually marking insects and may find application in field studies of larger bodied insects that are long-lived and sedentary.

  18. Evidence against a germ plasm in the milkweed bug Oncopeltus fasciatus, a hemimetabolous insect

    Directory of Open Access Journals (Sweden)

    Ben Ewen-Campen

    2013-04-01

    Primordial germ cell (PGC formation in holometabolous insects like Drosophila melanogaster relies on maternally synthesised germ cell determinants that are asymmetrically localised to the oocyte posterior cortex. Embryonic nuclei that inherit this “germ plasm” acquire PGC fate. In contrast, historical studies of basally branching insects (Hemimetabola suggest that a maternal requirement for germ line genes in PGC specification may be a derived character confined principally to Holometabola. However, there have been remarkably few investigations of germ line gene expression and function in hemimetabolous insects. Here we characterise PGC formation in the milkweed bug Oncopeltus fasciatus, a member of the sister group to Holometabola, thus providing an important evolutionary comparison to members of this clade. We examine the transcript distribution of orthologues of 19 Drosophila germ cell and/or germ plasm marker genes, and show that none of them localise asymmetrically within Oncopeltus oocytes or early embryos. Using multiple molecular and cytological criteria, we provide evidence that PGCs form after cellularisation at the site of gastrulation. Functional studies of vasa and tudor reveal that these genes are not required for germ cell formation, but that vasa is required in adult males for spermatogenesis. Taken together, our results provide evidence that Oncopeltus germ cells may form in the absence of germ plasm, consistent with the hypothesis that germ plasm is a derived strategy of germ cell specification in insects.

  19. The buck in the milkweed: evidence of male-male interference among pollinaria on pollinators.

    Science.gov (United States)

    Cocucci, Andrea A; Marino, Salvador; Baranzelli, Matías; Wiemer, Ana P; Sérsic, Alicia

    2014-07-01

    Direct physical confrontation among conspecifics for access to mates is a form of sexual selection well known among animals, but not thought to take place in plants. Consequently, no structures are known that can be considered as weapons that evolved under such confrontation. Pollinaria of milkweeds may physically compete for access to attachment points on the pollinators' body, and occasionally pollinaria may link onto pre-existing pollinaria on a pollinator resulting in concatenation. We hypothesized that concatenation may result in interference between proximal and distal pollinaria, and that features of nonconcatenating pollinaria might be attributed to prevention of concatenation. We tested this by analyzing pollen donation efficiency, experimental manipulation of the phenotype and the phylogenetic patterns of co-occurrence of traits. It is shown that concatenation was able to diminish the reproductive performance of proximal pollinaria, that horns on pollinaria prevented concatenation, and that horn acquisition was correlated with a loss of concatenation. The experimental removal of horns in species that did not concatenate caused reversion to concatenation. The present work could be the first evidence of male physical struggles and of the acquisition of weapons related to these struggles, that are analogous to those known in animals. © 2014 The Authors. New Phytologist © 2014 New Phytologist Trust.

  20. Structural polarity and dynamics of male germline stem cells in the milkweed bug (Oncopeltus fasciatus).

    Science.gov (United States)

    Schmidt, Esther D; Dorn, August

    2004-11-01

    The male germline stem cells (GSCs) of the milkweed bug present an extraordinary structural polarity that is, to our knowledge, unequalled by any other type of stem cells. They consist of a perikaryon and numerous projections arising from the cell pole directed toward the apical cells, the proposed niche of the GSCs. The projections can traverse a considerable distance until their terminals touch the apical cells. From hatching until death, the GSC projections undergo conspicuous changes, the sequence of which has been deduced from observations of all developmental stages. Projection formation starts from lobular cell protrusions showing trabecular ingrowths of the cell membrane. Finger-like projections result from a process of growth and "carving out". The newly formed projections contain mostly only free ribosomes other than a few mitochondria. A stereotyped degradation process commences in the projection terminals: profiles of circular, often concentric, cisternae of rough endoplasmic reticulum appear and turn into myelin bodies, whereas mitochondria become more numerous. The cytoplasm vesiculates, lysosomal bodies appear, and mitochondria become swollen. At the same time, the projection terminals are segregated by transverse ingrowths of the cell membrane. Finally, autophagic vacuoles and myelin bodies fill the segregated terminals, which then rupture. Simultaneously, new projections seem to sprout from the perikaryon of the GSCs. These dynamics, which are not synchronized among the GSCs, indicate that a novel type of signal exchange and transduction between the stem cells and their niche is involved in the regulation of asymmetric versus symmetric division of GSCs.

  1. Late extraembryonic morphogenesis and its zen(RNAi)-induced failure in the milkweed bug Oncopeltus fasciatus.

    Science.gov (United States)

    Panfilio, Kristen A

    2009-09-15

    Many insects undergo katatrepsis, essential reorganization by the extraembryonic membranes that repositions the embryo. Knockdown of the zen gene by RNA interference (RNAi) prevents katatrepsis in the milkweed bug Oncopeltus fasciatus. However, the precise morphogenetic defect has been uncertain, and katatrepsis itself has not been characterized in detail. The dynamics of wild type and zen(RNAi) eggs were analyzed from time-lapse movies, supplemented by analysis of fixed specimens. These investigations identify three zen(RNAi) defects. First, a reduced degree of tissue contraction implies a role for zen in baseline compression prior to katatrepsis. Subsequently, a characteristic 'bouncing' activity commences, leading to the initiation of katatrepsis in wild type eggs. The second zen(RNAi) defect is a delay in this activity, suggesting that a temporal window of opportunity is missed after zen knockdown. Ultimately, the extraembryonic membranes fail to rupture in zen(RNAi) eggs: the third defect. Nevertheless, the outer serosal membrane manages to contract, albeit in an aberrant fashion with additional phenotypic consequences for the embryo. These data identify a novel epithelial morphogenetic event - rupture of the 'serosal window' structure - as the ultimate site of defect. Overall, Oncopeltus zen seems to have a role in coordinating a number of pre-katatreptic events during mid embryogenesis.

  2. Evidence against a germ plasm in the milkweed bug Oncopeltus fasciatus, a hemimetabolous insect.

    Science.gov (United States)

    Ewen-Campen, Ben; Jones, Tamsin E M; Extavour, Cassandra G

    2013-06-15

    Primordial germ cell (PGC) formation in holometabolous insects like Drosophila melanogaster relies on maternally synthesised germ cell determinants that are asymmetrically localised to the oocyte posterior cortex. Embryonic nuclei that inherit this "germ plasm" acquire PGC fate. In contrast, historical studies of basally branching insects (Hemimetabola) suggest that a maternal requirement for germ line genes in PGC specification may be a derived character confined principally to Holometabola. However, there have been remarkably few investigations of germ line gene expression and function in hemimetabolous insects. Here we characterise PGC formation in the milkweed bug Oncopeltus fasciatus, a member of the sister group to Holometabola, thus providing an important evolutionary comparison to members of this clade. We examine the transcript distribution of orthologues of 19 Drosophila germ cell and/or germ plasm marker genes, and show that none of them localise asymmetrically within Oncopeltus oocytes or early embryos. Using multiple molecular and cytological criteria, we provide evidence that PGCs form after cellularisation at the site of gastrulation. Functional studies of vasa and tudor reveal that these genes are not required for germ cell formation, but that vasa is required in adult males for spermatogenesis. Taken together, our results provide evidence that Oncopeltus germ cells may form in the absence of germ plasm, consistent with the hypothesis that germ plasm is a derived strategy of germ cell specification in insects.

  3. The maize milkweed pod1 mutant reveals a mechanism to modify organ morphology.

    Science.gov (United States)

    Johnston, Robyn; Candela, Héctor; Hake, Sarah; Foster, Toshi

    2010-07-01

    Plant lateral organs, such as leaves, have three primary axes of growth-proximal-distal, medial--lateral and adaxial-abaxial (dorsal-ventral). Although most leaves are planar, modified leaf forms, such as the bikeeled grass prophyll, can be found in nature. A detailed examination of normal prophyll development indicates that polarity is established differently in the keels than in other parts of the prophyll. Analysis of the maize HD-ZIPIII gene rolled leaf1 (rld1) suggests that altered expression patterns are responsible for keel outgrowth. Recessive mutations in the maize (Zea mays) KANADI (KAN) gene milkweed pod1 (mwp1), which promotes abaxial cell identity, strongly affect development of the prophyll and silks (fused carpels). The prophyll is reduced to two unfused midribs and the silks are narrow and misshapen. Our data indicate that the prophyll and other fused organs are particularly sensitive to disruptions in adaxial-abaxial polarity. In addition, lateral and proximal-distal growth of most lateral organs is reduced in the mwp1-R mutant, supporting a role for the adaxial-abaxial boundary in promoting growth along both axes. We propose that the adaxial-abaxial patterning mechanism has been co-opted during evolution to generate diverse organ morphologies. (c) 2010 Wiley-Liss, Inc.

  4. Stepwise evolution of resistance to toxic cardenolides via genetic substitutions in the Na+/K+ -ATPase of milkweed butterflies (lepidoptera: Danaini).

    Science.gov (United States)

    Petschenka, Georg; Fandrich, Steffi; Sander, Nils; Wagschal, Vera; Boppré, Michael; Dobler, Susanne

    2013-09-01

    Despite the monarch butterfly (Danaus plexippus) being famous for its adaptations to the defensive traits of its milkweed host plants, little is known about the macroevolution of these traits. Unlike most other animal species, monarchs are largely insensitive to cardenolides, because their target site, the sodium pump (Na(+)/K(+) -ATPase), has evolved amino acid substitutions that reduce cardenolide binding (so-called target site insensitivity, TSI). Because many, but not all, species of milkweed butterflies (Danaini) are associated with cardenolide-containing host plants, we analyzed 16 species, representing all phylogenetic lineages of milkweed butterflies, for the occurrence of TSI by sequence analyses of the Na(+)/K(+) -ATPase gene and by enzymatic assays with extracted Na(+)/K(+) -ATPase. Here we report that sensitivity to cardenolides was reduced in a stepwise manner during the macroevolution of milkweed butterflies. Strikingly, not all Danaini typically consuming cardenolides showed TSI, but rather TSI was more strongly associated with sequestration of toxic cardenolides. Thus, the interplay between bottom-up selection by plant compounds and top-down selection by natural enemies can explain the evolutionary sequence of adaptations to these toxins. © 2013 The Author(s). Evolution © 2013 The Society for the Study of Evolution.

  5. Effect of captivity on genetic variance for five traits in the large milkweed bug (Oncopeltus fasciatus).

    Science.gov (United States)

    Rodríguez-Clark, K M

    2004-07-01

    Understanding the changes in genetic variance which may occur as populations move from nature into captivity has been considered important when populations in captivity are used as models of wild ones. However, the inherent significance of these changes has not previously been appreciated in a conservation context: are the methods aimed at founding captive populations with gene diversity representative of natural populations likely also to capture representative quantitative genetic variation? Here, I investigate changes in heritability and a less traditional measure, evolvability, between nature and captivity for the large milkweed bug, Oncopeltus fasciatus, to address this question. Founders were collected from a 100-km transect across the north-eastern US, and five traits (wing colour, pronotum colour, wing length, early fecundity and later fecundity) were recorded for founders and for their offspring during two generations in captivity. Analyses reveal significant heritable variation for some life history and morphological traits in both environments, with comparable absolute levels of evolvability across all traits (0-30%). Randomization tests show that while changes in heritability and total phenotypic variance were highly variable, additive genetic variance and evolvability remained stable across the environmental transition in the three morphological traits (changing 1-2% or less), while they declined significantly in the two life-history traits (5-8%). Although it is unclear whether the declines were due to selection or gene-by-environment interactions (or both), such declines do not appear inevitable: captive populations with small numbers of founders may contain substantial amounts of the evolvability found in nature, at least for some traits.

  6. The maternal and early embryonic transcriptome of the milkweed bug Oncopeltus fasciatus.

    Science.gov (United States)

    Ewen-Campen, Ben; Shaner, Nathan; Panfilio, Kristen A; Suzuki, Yuichiro; Roth, Siegfried; Extavour, Cassandra G

    2011-01-25

    Most evolutionary developmental biology ("evo-devo") studies of emerging model organisms focus on small numbers of candidate genes cloned individually using degenerate PCR. However, newly available sequencing technologies such as 454 pyrosequencing have recently begun to allow for massive gene discovery in animals without sequenced genomes. Within insects, although large volumes of sequence data are available for holometabolous insects, developmental studies of basally branching hemimetabolous insects typically suffer from low rates of gene discovery. We used 454 pyrosequencing to sequence over 500 million bases of cDNA from the ovaries and embryos of the milkweed bug Oncopeltus fasciatus, which lacks a sequenced genome. This indirectly developing insect occupies an important phylogenetic position, branching basal to Diptera (including fruit flies) and Hymenoptera (including honeybees), and is an experimentally tractable model for short-germ development. 2,087,410 reads from both normalized and non-normalized cDNA assembled into 21,097 sequences (isotigs) and 112,531 singletons. The assembled sequences fell into 16,617 unique gene models, and included predictions of splicing isoforms, which we examined experimentally. Discovery of new genes plateaued after assembly of ~1.5 million reads, suggesting that we have sequenced nearly all transcripts present in the cDNA sampled. Many transcripts have been assembled at close to full length, and there is a net gain of sequence data for over half of the pre-existing O. fasciatus accessions for developmental genes in GenBank. We identified 10,775 unique genes, including members of all major conserved metazoan signaling pathways and genes involved in several major categories of early developmental processes. We also specifically address the effects of cDNA normalization on gene discovery in de novo transcriptome analyses. Our sequencing, assembly and annotation framework provide a simple and effective way to achieve high

  7. The maternal and early embryonic transcriptome of the milkweed bug Oncopeltus fasciatus

    Directory of Open Access Journals (Sweden)

    Roth Siegfried

    2011-01-01

    Full Text Available Abstract Background Most evolutionary developmental biology ("evo-devo" studies of emerging model organisms focus on small numbers of candidate genes cloned individually using degenerate PCR. However, newly available sequencing technologies such as 454 pyrosequencing have recently begun to allow for massive gene discovery in animals without sequenced genomes. Within insects, although large volumes of sequence data are available for holometabolous insects, developmental studies of basally branching hemimetabolous insects typically suffer from low rates of gene discovery. Results We used 454 pyrosequencing to sequence over 500 million bases of cDNA from the ovaries and embryos of the milkweed bug Oncopeltus fasciatus, which lacks a sequenced genome. This indirectly developing insect occupies an important phylogenetic position, branching basal to Diptera (including fruit flies and Hymenoptera (including honeybees, and is an experimentally tractable model for short-germ development. 2,087,410 reads from both normalized and non-normalized cDNA assembled into 21,097 sequences (isotigs and 112,531 singletons. The assembled sequences fell into 16,617 unique gene models, and included predictions of splicing isoforms, which we examined experimentally. Discovery of new genes plateaued after assembly of ~1.5 million reads, suggesting that we have sequenced nearly all transcripts present in the cDNA sampled. Many transcripts have been assembled at close to full length, and there is a net gain of sequence data for over half of the pre-existing O. fasciatus accessions for developmental genes in GenBank. We identified 10,775 unique genes, including members of all major conserved metazoan signaling pathways and genes involved in several major categories of early developmental processes. We also specifically address the effects of cDNA normalization on gene discovery in de novo transcriptome analyses. Conclusions Our sequencing, assembly and annotation framework

  8. Calotropin from Asclepias curasavica induces cell cycle arrest and apoptosis in cisplatin-resistant lung cancer cells.

    Science.gov (United States)

    Mo, En-Pan; Zhang, Rong-Rong; Xu, Jun; Zhang, Huan; Wang, Xiao-Xiong; Tan, Qiu-Tong; Liu, Fang-Lan; Jiang, Ren-Wang; Cai, Shao-Hui

    2016-09-16

    Calotropin (M11), an active compound isolated from Asclepias curasavica L., was found to exert strong inhibitory and pro-apoptotic activity specifically against cisplatin-induced resistant non-small cell lung cancer (NSCLC) cells (A549/CDDP). Molecular mechanism study revealed that M11 induced cell cycle arrest at the G2/M phase through down-regulating cyclins, CDK1, CDK2 and up-regulating p53 and p21. Furthermore, M11 accelerated apoptosis through the mitochondrial apoptotic pathway which was accompanied by increase Bax/Bcl-2 ratio, decrease in mitochondrial membrane potential, increase in reactive oxygen species production, activations of caspases 3 and 9 as well as cleavage of poly ADP-ribose polymerase (PARP). The activation and phosphorylation of JNK was also found to be involved in M11-induced apoptosis, and SP610025 (specific JNK inhibitor) partially prevented apoptosis induced by M11. In contrast, all of the effects that M11 induce cell cycle arrest and apoptosis in A549/CDDP cells were not significant in A549 cells. Drugs with higher sensitivity against resistant tumor cells than the parent cells are rather rare. Results of this study supported the potential application of M11 on the non-small lung cancer (NSCLC) with cisplatin resistance. Copyright © 2016 Elsevier Inc. All rights reserved.

  9. Extensive bilateral corneal edema 6 weeks after cataract surgery: Keratopathy due to Asclepias physocarpa: a case report.

    Science.gov (United States)

    Matsuura, Kazuki; Hatta, Shiro; Terasaka, Yuki; Inoue, Yoshitsugu

    2017-01-18

    Surgeons may be unaware of the ability of plant toxins to cause corneal damage. Therefore, corneal damage following intraocular surgery due to plant toxins may be misdiagnosed as postoperative infection. A 74-year-old man presented with hyperemia and reduced visual acuity in both eyes 6 weeks after uneventful cataract surgery. We observed extensive hyperemia and corneal stromal edema with Descemet's folds in both eyes. After obtaining a detailed patient history, we diagnosed plant toxin-induced corneal edema due to Asclepias physocarpa, which can induce corneal edema by inhibiting the Na + /K + ATPase activity of the corneal endothelium. Antimicrobial and steroid eye drops and an oral steroid were prescribed accordingly. Symptons began to improve on day 3 and had almost completely resolved by day 6. At 1 month, the patient had fully recovered without any sequelae. The correct diagnosis was possible in the present case as symptoms were bilateral and the patient was able to report his potential exposure to plant toxins. However, if the symptoms had been unilateral and the patient had been unaware of these toxins, he may have undergone unnecessary surgical interventions to treat non-existent postoperative endophthalmitis.

  10. Sequencing and characterization of asclepain f: the first cysteine peptidase cDNA cloned and expressed from Asclepias fruticosa latex.

    Science.gov (United States)

    Trejo, Sebastián A; López, Laura M I; Caffini, Néstor O; Natalucci, Claudia L; Canals, Francesc; Avilés, Francesc X

    2009-07-01

    Asclepain f is a papain-like protease previously isolated and characterized from latex of Asclepias fruticosa. This enzyme is a member of the C1 family of cysteine proteases that are synthesized as preproenzymes. The enzyme belongs to the alpha + beta class of proteins, with two disulfide bridges (Cys22-Cys63 and Cys56-Cys95) in the alpha domain, and another one (Cys150-Cys201) in the beta domain, as was determined by molecular modeling. A full-length 1,152 bp cDNA was cloned by RT-RACE-PCR from latex mRNA. The sequence was predicted as an open reading frame of 340 amino acid residues, of which 16 residues belong to the signal peptide, 113 to the propeptide and 211 to the mature enzyme. The full-length cDNA was ligated to pPICZalpha vector and expressed in Pichia pastoris. Recombinant asclepain f showed endopeptidase activity on pGlu-Phe-Leu-p-nitroanilide and was identified by PMF-MALDI-TOF MS. Asclepain f is the first peptidase cloned and expressed from mRNA isolated from plant latex, confirming the presence of the preprocysteine peptidase in the latex.

  11. ¿Envenenamiento por consumo de Asclepias curassavica o nematodiasis gastrointestinal en ovinos en pastoreo? Hallazgos de un estudio de caso

    OpenAIRE

    Macedo Barragán, Rafael; Arredondo Ruiz, Victalina; Ramírez Rodríguez, Julia; García Márquez, Luis Jorge

    2009-01-01

    Se realizó un estudio de caso con el objetivo de documentar la posible ocurrencia de envenenamiento por el consumo de Asclepias curassavica o de casos agudos de nematodiasis gastrointestinal en ovinos en pastoreo. Se registró la densidad de población, la ubicación espacial de la maleza y el tipo de vegetación; además, se observaron los hábitos de pastoreo del rebaño y la semiología mostrada por los ovinos afectados. Posteriormente se realizó una necropsia con la finalidad de describir hallazg...

  12. 8,12;8,20-diepoxy-8,14-secopregnane glycosides from roots of Asclepias tuberosa and their effect on proliferation of human skin fibroblasts.

    Science.gov (United States)

    Warashina, Tsutomu; Umehara, Kaoru; Miyase, Toshio; Noro, Tadataka

    2011-10-01

    A pregnane glycoside fraction from the roots of Asclepias tuberosa L. caused normal human skin fibroblasts to proliferate. This fraction contained 21 pregnane glycosides whose structures were established using NMR spectroscopic analysis and chemical evidence. The aglycones of most of these compounds were identified as 8,12;8,20-diepoxy-8,14-secopregnanes, such as tuberogenin or 5,6-didehydrotuberogenin, the same aglycones as constituents of the aerial parts of this plant. Some of these compounds also caused proliferation of skin fibroblasts. Copyright © 2011 Elsevier Ltd. All rights reserved.

  13. Are there evidences of a complex mimicry system among Asclepias curassavica (Apocynaceae), Epidendrum fulgens (Orchidaceae), and Lantana camara (Verbenaceae) in Southern Brazil?

    OpenAIRE

    Fuhro, Daniela; Araújo, Aldo Mellender de; Irgang, Bruno Edgar

    2010-01-01

    The goal of this paper was to test the presence of mimicry in Asclepias curassavica L., Epidendrum fulgens Brong., and Lantana camara L. The study was carried out at the Parque Estadual de Itapeva, RS, southern Brazil, from 2004 to 2006. Flowering period of each of the three species was followed up; focal observations of butterflies visiting flowers, from fixed point and during random walks were carried out. We also estimated the frequency of pollinaria removal in the orchid, as well as its m...

  14. Factors involved in early polarization of the anterior-posterior axis in the milkweed bug Oncopeltus fasciatus.

    Science.gov (United States)

    Ginzburg, Neta; Cohen, Mira; Chipman, Ariel D

    2017-05-01

    The axes of insect embryos are defined early in the blastoderm stage. Genes involved in this polarization are well known in Drosophila, but less so in other insects, such as the milkweed bug Oncopeltus fasciatus. Using quantitative PCR, we looked at differential expression of several candidate genes for early anterior-posterior patterning and found that none of them are expressed asymmetrically in the early blastoderm. We then used an RNA-Seq approach to identify novel candidate genes that might be involved in early polarization in Oncopeltus. We focused on transcription factors (TFs) as these are likely to be central players in developmental processes. Using both homology and domain based identification approaches, we were unable to find any TF encoding transcripts that are expressed asymmetrically along the anterior-posterior axis at early stages. Using a GO-term analysis of all asymmetrically expressed mRNAs, we found an enrichment of genes relating to mitochondrial function in the posterior at the earliest studied time-point. We also found a gradual enrichment of transcription related activities, giving us a putative time frame for the maternal to zygotic transition. Our dataset provides us with a list of new candidate genes in early development, which can be followed up experimentally. © 2017 Wiley Periodicals, Inc.

  15. Distribution and activity of a Dippu DH31-like peptide in the large milkweed bug Oncopeltus fasciatus.

    Science.gov (United States)

    Te Brugge, V A; Orchard, I

    2008-02-01

    The milkweed bug, Oncopeltus fasciatus, is a plant feeding hemipteran. While there has been much research done on the neurohormonal control of the post-feeding diuresis in the blood-feeding hemipteran, Rhodnius prolixus, little is known about the control of the post-feeding diuresis in O. fasciatus. One of the neurohormones that may play a role in this rapid diuresis belongs to the calcitonin-like diuretic hormone (DH31) family of insect peptides. In this study we demonstrate the presence of DH31-like immunoreactivity in the central nervous system (CNS) and gut of O. fasciatus 5th instars. As well, DH31-like material was quantified and partially purified from the CNS of 5th instar O. fasciatus using reversed-phase liquid chromatography (RPLC) and monitored with an enzyme-linked immunosorbent assay (ELISA). When tested on O. fasciatus 5th instar Malpighian tubules, DH31-like peptides significantly increased the rate of secretion over saline controls. The results suggest that there is a DH31-like peptide(s) present in the CNS of O. fasciatus and that this peptide may play a role in the control of Malpighian tubule secretion.

  16. The milkweed pod1 gene encodes a KANADI protein that is required for abaxial/adaxial patterning in maize leaves.

    Science.gov (United States)

    Candela, Héctor; Johnston, Robyn; Gerhold, Abigail; Foster, Toshi; Hake, Sarah

    2008-08-01

    Leaf primordia initiate from the shoot apical meristem with inherent polarity; the adaxial side faces the meristem, while the abaxial side faces away from the meristem. Adaxial/abaxial polarity is thought to be necessary for laminar growth of leaves, as mutants lacking either adaxial or abaxial cell types often develop radially symmetric lateral organs. The milkweed pod1 (mwp1) mutant of maize (Zea mays) has adaxialized sectors in the sheath, the proximal part of the leaf. Ectopic leaf flaps develop where adaxial and abaxial cell types juxtapose. Ectopic expression of the HD-ZIPIII gene rolled leaf1 (rld1) correlates with the adaxialized regions. Cloning of mwp1 showed that it encodes a KANADI transcription factor. Double mutants of mwp1-R with a microRNA-resistant allele of rld1, Rld1-N1990, show a synergistic phenotype with polarity defects in sheath and blade and a failure to differentiate vascular and photosynthetic cell types in the adaxialized sectors. The sectored phenotype and timing of the defect suggest that mwp1 is required late in leaf development to maintain abaxial cell fate. The phenotype of mwp1; Rld1 double mutants shows that both genes are also required early in leaf development to delineate leaf margins as well as to initiate vascular and photosynthetic tissues.

  17. Evading plant defence: Infestation of poisonous milkweed fruits (Asclepiadaceae) by the fruit fly Dacus siliqualactis (Diptera: Tephritidae).

    Science.gov (United States)

    Schneider, Michael; Wunder, Cora; Reuss, Esther; Toennes, Stefan W; Mebs, Dietrich

    2017-12-01

    To cope with toxic metabolites plants use for defence, herbivorous insects employ various adaptive strategies. For oviposition, the fruit fly Dacus siliqualactis (Tephritidae) uses milkweed plants of the genus Gomphocarpus (Asclepiadaceae) by circumventing the plant's physical (gluey latex) and chemical (toxic cadenolides) defence. With its long, telescope-like ovipositor, the fly penetrates the exo- and endocarp of the fruit and places the eggs on the unripe seeds located in the centre of the fruit. Whereas most plant parts contain high concentrations of cardenolides such as gomphoside, calotropin/calacatin and gomphogenin, only the seeds exhibit low cardenolide levels. By surmounting physical barriers (fruit membranes, latex), the fly secures a safe environment and a latex-free food source of low toxicity for the developing larvae. One amino acid substitution (Q111V) at the cardenolide binding site of the fly's Na + , K + -ATPase was detected, but the significance of that substitution: reducing cardenolide sensitivity or not, is unclear. However, poisoning of the larvae by low levels of cardenolides is assumed to be prevented by non-resorption and excretion of the polar cardenolides, which cannot passively permeate the midgut membrane. This example of an insect-plant interaction demonstrates that by morphological and behavioural adaptation, a fruit fly manages to overcome even highly effective defence mechanisms of its host plant. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. RNAi analysis of Deformed, proboscipedia and Sex combs reduced in the milkweed bug Oncopeltus fasciatus: novel roles for Hox genes in the hemipteran head.

    Science.gov (United States)

    Hughes, C L; Kaufman, T C

    2000-09-01

    Insects have evolved a large variety of specialized feeding strategies, with a corresponding variability in mouthpart morphology. We have, however, little understanding of the developmental mechanisms that underlie this diversity. Until recently it was difficult to perform any analysis of gene function outside of the genetic model insects Drosophila melanogaster and Tribolium castaneum. In this paper, we report the use of dsRNA-mediated interference (RNAi) to dissect gene function in the development of the milkweed bug Oncopeltus fasciatus, which has specialized suctorial mouthparts. The Hox genes Deformed (Dfd), proboscipedia (pb) and Sex combs reduced (Scr) have previously been shown to be expressed in the gnathal appendages of this species. Strikingly, the milkweed bug was found to have an unusual expression pattern of pb. Here, by analyzing single and combination RNAi depletions, we find that Dfd, pb and Scr are used in the milkweed bug to specify the identity of the mouthparts. The exact roles of the genes, however, are different from what is known in the two genetic model insects. The maxillary appendages in the bug are determined by the activities of the genes Dfd and Scr, rather than Dfd and pb as in the fly and beetle. The mandibular appendages are specified by Dfd, but their unique morphology in Oncopeltus suggests that Dfd's target genes are different. As in flies and beetles, the labium is specified by the combined activities of pb and Scr, but again, the function of pb appears to be different. Additionally, the regulatory control of pb by the other two genes seems to be different in the bug than in either of the other species. These novelties in Hox function, expression pattern and regulatory relationships may have been important for the evolution of the unique Hemipteran head.

  19. Absence of ribosomal DNA amplification in the meroistic (telotrophic) ovary of the large milkweed bug Oncopeltus fasciatus (Dallas) (Hemiptera: Lygaeidae)

    Science.gov (United States)

    1975-01-01

    In the typical meroistic insect ovary, the oocyte nucleus synthesizes little if any RNA. Nurse cells or trophocytes actively synthesize ribosomes which are transported to and accumulated by the oocyte. In the telotrophic ovary a morphological separation exists, the nurse cells being localized at the apical end of each ovariole and communicating with the ooocytes via nutritive cords. In order to determine whether the genes coding for ribosomal RNA (rRNA) are amplified in the telotrophic ovary of the milkweed bug Oncopeltus fasciatus, the percentages of the genome coding for ribosomal RNA in somatic cells, spermatogenic cells, ovarian follicles, and nurse cells were compared. The oocytes and most of the nurse cells of O. fasciatus are uninucleolate. DNA hybridizing with ribosomal RNA is localized in a satellite DNA, the density of which is 1.712 g/cm(-3). The density of main-band DNA is 1.694 g/cm(-3). The ribosomal DNA satellite accounts for approximately 0.2% of the DNA in somatic and gametogenic tissues of both males and females. RNA-DNA hybridization analysis demonstrates that approximately 0.03% of the DNA in somatic tissues, testis, ovarian follicles, and isolated nurse cells hybridizes with ribosomal RNA. The fact that the percentage of DNA hybridizing with rRNA is the same in somatic and in male and female gametogenic tissues indicates that amplification of ribosomal DNA does not occur in nurse cells and that if it occurs in oocytes, it represents less than a 50- fold increase in ribosomal DNA. An increase in total genome DNA accounted by polyploidization appears to provide for increasing the amount of ribosomal DNA in the nurse cells. PMID:1158969

  20. New 8,12;8,20-diepoxy-8,14-secopregnane hexa- and hepta-glycosides from the roots of Asclepias tuberosa.

    Science.gov (United States)

    Warashina, Tsutomu; Miyase, Toshio

    2018-01-01

    Previously, phytochemical investigation of the roots of Asclepias tuberosa (Asclepiadaceae) led to the isolation of some 8,12;8,20-diepoxy-8,14-secopregnane tri-, tetra-, and penta-glycosides. An additional eight new minor 8,12;8,20-diepoxy-8,14-secopregnane glycosides were afforded in the recent investigation of this plant. These glycosides consisted of six or seven 2,6-dideoxy-hexopyranoses together with the aglycone, tuberogenin. The structures of each of these compounds were established using NMR, mass spectroscopic analysis and chemical evidence. As 8,12;8,20-diepoxy-8,14-secopregnane-type glycosides were observed only in A. tuberosa, these compounds were considered to be characteristic phytochemicals of this plant.

  1. Insecticidal effect of Canavalia ensiformis major urease on nymphs of the milkweed bug Oncopeltus fasciatus and characterization of digestive peptidases.

    Science.gov (United States)

    Defferrari, Marina S; Demartini, Diogo R; Marcelino, Thiago B; Pinto, Paulo M; Carlini, Celia R

    2011-06-01

    Jackbean (Canavalia ensiformis) ureases are entomotoxic upon the release of internal peptides by insect's digestive enzymes. Here we studied the digestive peptidases of Oncopeltus fasciatus (milkweed bug) and its susceptibility to jackbean urease (JBU). O. fasciatus nymphs fed urease showed a mortality rate higher than 80% after two weeks. Homogenates of midguts dissected from fourth instars were used to perform proteolytic activity assays. The homogenates hydrolyzed JBU in vitro, yielding a fragment similar in size to known entomotoxic peptides. The major proteolytic activity at pH 4.0 upon protein substrates was blocked by specific inhibitors of aspartic and cysteine peptidases, but not significantly affected by inhibitors of metallopeptidases or serine peptidases. The optimal activity upon N-Cbz-Phe-Arg-MCA was at pH 5.0, with complete blockage by E-64 in all pH tested. Optimal activity upon Abz-AIAFFSRQ-EDDnp (a substrate for aspartic peptidases) was detected at pH 5.0, with partial inhibition by Pepstatin A in the pH range 2-8. Fluorogenic substrates corresponding to the N- and C-terminal regions flanking a known entomotoxic peptide within urease sequence were also tested. While the midgut homogenate did not hydrolyze the N-terminal peptide, it cleaved the C-terminal peptide maximally at pH 4.0-5.0, and this activity was inhibited by E-64 (10 μM). The midgut homogenate was submitted to ion-exchange chromatography followed by gel filtration. A 22 kDa active fraction was obtained, resolved in SDS-PAGE (12%), the corresponding band was in-gel digested by trypsin, the peptides were analyzed by mass spectrometry, retrieving a cathepsin L protein. The purified cathepsin L was shown to have at least two possible cleavage sites within the urease sequence, and might be able to release a known insecticidal peptide in a single or cascade event. The results suggest that susceptibility of O. fasciatus nymphs to jackbean urease is, like in other insect models, due mostly

  2. Migratory monarchs wintering in California experience low infection risk compared to monarchs breeding year-round on non-native milkweed.

    Science.gov (United States)

    Satterfield, Dara A; Villablanca, Francis X; Maerz, John C; Altizer, Sonia

    2016-08-01

    Long-distance migration can lower infection risk for animal populations by removing infected individuals during strenuous journeys, spatially separating susceptible age classes, or allowing migrants to periodically escape from contaminated habitats. Many seasonal migrations are changing due to human activities including climate change and habitat alteration. Moreover, for some migratory populations, sedentary behaviors are becoming more common as migrants abandon or shorten their journeys in response to supplemental feeding or warming temperatures. Exploring the consequences of reduced movement for host-parasite interactions is needed to predict future responses of animal pathogens to anthropogenic change. Monarch butterflies (Danaus plexippus) and their specialist protozoan parasite Ophryocystis elektroscirrha (OE) provide a model system for examining how long-distance migration affects infectious disease processes in a rapidly changing world. Annual monarch migration from eastern North America to Mexico is known to reduce protozoan infection prevalence, and more recent work suggests that monarchs that forego migration to breed year-round on non-native milkweeds in the southeastern and south central Unites States face extremely high risk of infection. Here, we examined the prevalence of OE infection from 2013 to 2016 in western North America, and compared monarchs exhibiting migratory behavior (overwintering annually along the California coast) with those that exhibit year-round breeding. Data from field collections and a joint citizen science program of Monarch Health and Monarch Alert showed that infection frequency was over nine times higher for monarchs sampled in gardens with year-round milkweed as compared to migratory monarchs sampled at overwintering sites. Results here underscore the importance of animal migrations for lowering infection risk and motivate future studies of pathogen transmission in migratory species affected by environmental change. © The

  3. Trait differences in responses to arbuscular mycorrhizal fungi are stronger and more consistent than fixed differences among populations of Asclepias speciosa.

    Science.gov (United States)

    Waller, Lauren P; Hahn, Philip G; Maron, John L; Lekberg, Ylva

    2018-02-01

    Arbuscular mycorrhizal (AM) fungi can promote plant growth and reproduction, but other plant physiological traits or traits that provide defense against herbivores can also be affected by AM fungi. However, whether responses of different traits to AM fungi are correlated and whether these relationships vary among plants from different populations are unresolved. In a common garden experiment, we grew Asclepias speciosa plants from seed collected from populations found along an environmental gradient with and without AM fungi to assess whether the responses of six growth and defense traits to AM fungi are correlated. Although there was strong genetic differentiation in mean trait values among populations, AM fungi consistently increased expression of most growth and defense traits across all populations. Responses of biomass and root to shoot ratio to AM fungi were positively correlated, suggesting that plants that are more responsive to AM fungi allocated more biomass belowground. Responses of biomass and trichome density to AM fungi were negatively correlated, indicating a trade-off in responsiveness between a growth and defensive trait. Our results suggest that while there is substantial population differentiation in many traits of A. speciosa, populations respond similarly to AM fungi, and both positive and negative correlations among trait responses occur. © 2018 Botanical Society of America.

  4. Plant genotype shapes ant-aphid interactions: implications for community structure and indirect plant defense.

    Science.gov (United States)

    Mooney, Kailen A; Agrawal, Anurag A

    2008-06-01

    Little is known about the mechanisms by which plant genotype shapes arthropod community structure. In a field experiment, we measured the effects of milkweed (Asclepias syriaca) genotype and ants on milkweed arthropods. Populations of the ant-tended aphid Aphis asclepiadis and the untended aphid Myzocallis asclepiadis varied eight- to 18-fold among milkweed genotypes, depending on aphid species and whether ants were present. There was no milkweed effect on predatory arthropods. Ants increased Aphis abundance 59%, decreased Myzocallis abundance 52%, and decreased predator abundance 56%. Milkweed genotype indirectly influenced ants via direct effects on Aphis and Myzocallis abundance. Milkweed genotype also modified ant-aphid interactions, influencing the number of ants attracted per Aphis and Myzocallis. While ant effects on Myzocallis were consistently negative, effects on Aphis ranged from antagonistic to mutualistic among milkweed genotypes. As a consequence of milkweed effects on ant-aphid interactions, ant abundance varied 13-fold among milkweed genotypes, and monarch caterpillar survival was negatively correlated with genetic variation in ant abundance. We speculate that heritable variation in milkweed phloem sap drives these effects on aphids, ants, and caterpillars. In summary, milkweed exerts genetic control over the interactions between aphids and an ant that provides defense against foliage-feeding caterpillars.

  5. The milkweed pod1 Gene Encodes a KANADI Protein That Is Required for Abaxial/Adaxial Patterning in Maize Leaves[W

    Science.gov (United States)

    Candela, Héctor; Johnston, Robyn; Gerhold, Abigail; Foster, Toshi; Hake, Sarah

    2008-01-01

    Leaf primordia initiate from the shoot apical meristem with inherent polarity; the adaxial side faces the meristem, while the abaxial side faces away from the meristem. Adaxial/abaxial polarity is thought to be necessary for laminar growth of leaves, as mutants lacking either adaxial or abaxial cell types often develop radially symmetric lateral organs. The milkweed pod1 (mwp1) mutant of maize (Zea mays) has adaxialized sectors in the sheath, the proximal part of the leaf. Ectopic leaf flaps develop where adaxial and abaxial cell types juxtapose. Ectopic expression of the HD-ZIPIII gene rolled leaf1 (rld1) correlates with the adaxialized regions. Cloning of mwp1 showed that it encodes a KANADI transcription factor. Double mutants of mwp1-R with a microRNA-resistant allele of rld1, Rld1-N1990, show a synergistic phenotype with polarity defects in sheath and blade and a failure to differentiate vascular and photosynthetic cell types in the adaxialized sectors. The sectored phenotype and timing of the defect suggest that mwp1 is required late in leaf development to maintain abaxial cell fate. The phenotype of mwp1; Rld1 double mutants shows that both genes are also required early in leaf development to delineate leaf margins as well as to initiate vascular and photosynthetic tissues. PMID:18757553

  6. The distribution and function of serotonin in the large milkweed bug, Oncopeltus fasciatus. a comparative study with the blood-feeding bug, Rhodnius prolixus.

    Science.gov (United States)

    Miggiani, L; Orchard, I; TeBrugge, V

    1999-11-01

    The blood-feeding hemipteran, Rhodnius prolixus, ingests a large blood meal at the end of each larval stage. To accommodate and process this meal, its cuticle undergoes plasticisation, and its gut and Malpighian tubules respectively absorb and secrete a large volume of water and salts for rapid diuresis. Serotonin has been found to be integral to the feeding process in this animal, along with a diuretic peptide(s). The large milkweed bug, Oncopeltus fasciatus, tends to feed in a more continuous and abstemious manner, and therefore may have different physiological requirements than the blood feeder. Unlike R. prolixus, O. fasciatus is lacking serotonin-like immunoreactive dorsal unpaired median neurons in the mesothoracic ganglionic mass, and lacks serotonin-like immunoreactive neurohaemal areas and processes on the abdominal nerves, integument, salivary glands, and anterior junction of the foregut and crop. The salivary glands and crop do, however, respond to serotonin with increased levels of cAMP, while the integument and Malpighian tubules do not. In addition, O. fasciatus Malpighian tubules respond to both O. fasciatus and R. prolixus partially purified CNS extracts, which are likely to contain any native diuretic peptides. Thus, while serotonin and diuretic peptides may be involved in tubule control in R. prolixus, the latter may be of greater importance in O. fasciatus.

  7. A conserved function of the zinc finger transcription factor Sp8/9 in allometric appendage growth in the milkweed bug Oncopeltus fasciatus.

    Science.gov (United States)

    Schaeper, Nina D; Prpic, Nikola-Michael; Wimmer, Ernst A

    2009-08-01

    The genes encoding the closely related zinc finger transcription factors Buttonhead (Btd) and D-Sp1 are expressed in the developing limb primordia of Drosophila melanogaster and are required for normal growth of the legs. The D-Sp1 homolog of the red flour beetle Tribolium castaneum, Sp8 (appropriately termed Sp8/9), is also required for the proper growth of the leg segments. Here we report on the isolation and functional study of the Sp8/9 gene from the milkweed bug Oncopeltus fasciatus. We show that Sp8/9 is expressed in the developing appendages throughout development and that the downregulation of Sp8/9 via RNAi leads to antennae, rostrum, and legs with shortened and fused segments. This supports a conserved role of Sp8/9 in allometric leg segment growth. However, all leg segments including the claws are present and the expression of the leg genes Distal-less, dachshund, and homothorax are proportionally normal, thus providing no evidence for a role of Sp8/9 in appendage specification.

  8. Functional analyses in the milkweed bug Oncopeltus fasciatus (Hemiptera) support a role for Wnt signaling in body segmentation but not appendage development.

    Science.gov (United States)

    Angelini, David R; Kaufman, Thomas C

    2005-07-15

    Specification of the proximal-distal (PD) axis of insect appendages is best understood in Drosophila melanogaster, where conserved signaling molecules encoded by the genes decapentaplegic (dpp) and wingless (wg) play key roles. However, the development of appendages from imaginal discs as in Drosophila is a derived state, while more basal insects produce appendages from embryonic limb buds. Therefore, the universality of the Drosophila limb PD axis specification mechanism has been debated since dpp expression in more basal insect species differs dramatically from Drosophila. Here, we test the function of Wnt signaling in the development of the milkweed bug Oncopeltus fasciatus, a species with the basal state of appendage development from limb buds. RNA interference of wg and pangolin (pan) produce defects in the germband and eyes, but not in the appendages. Distal-less and dachshund, two genes regulated by Wg signaling in Drosophila and expressed in specific PD domains along the limbs of both species, are expressed normally in the limbs of pan-depleted Oncopeltus embryos. Despite these apparently paradoxical results, Armadillo protein, the transducer of Wnt signaling, does not accumulate properly in the nuclei of cells in the legs of pan-depleted embryos. In contrast, engrailed RNAi in Oncopeltus produces cuticular and appendage defects similar to Drosophila. Therefore, our data suggest that Wg signaling is functionally conserved in the development of the germband, while it is not essential in the specification of the limb PD axis in Oncopeltus and perhaps basal insects.

  9. Microwave-assisted enhancement of milkweed (Calotropis procera L.) leaves as an eco-friendly source of natural colorants for textile.

    Science.gov (United States)

    Hussaan, Muhammad; Iqbal, Naeem; Adeel, Shahid; Azeem, Muhammad; Tariq Javed, M; Raza, Ali

    2017-02-01

    Application of natural colorants to textile fabrics has gained worldwide public acceptance due to the hazardous nature of synthetic dyes. Present study investigated the microwave's mediated extraction of natural colorants from leaves of milkweed (Calotropis procera L.) as well as their application to cotton fabrics assisted with biochemical mordants. Dye extraction from C. procera leaves was carried out in various mediums (alkali and aqueous), and the extracted dye as well as cotton fabrics was irradiated with microwaves for 2, 4, 6, 8, or 10 min. Effect of various temperature regimes and sodium chloride (NaCl) concentrations was also evaluated on the color strength of dyed cotton fabrics. The results revealed that extraction of natural colorants was enhanced when microwave radiations were applied for 4 min by using alkali as an extraction medium as compared to aqueous one. Optimum dyeing of cotton fabrics was achieved by using NaCl at a temperature of 55 °C. Among the chemical mordants, iron was effective for better color strength when used as pre- and post-mordant. Among the studied bio-mordants, extract of Acacia nilotica bark significantly improved the color strength and fastness properties as pre-mordant and Curcuma longa tuber as post-mordant. It was concluded that extract of C. procera leaves was a potential source of natural colorants and a high level of dye was obtained upon irradiation of alkali-solubilized extract for 4 min. Application of NaCl at concentration of 3 g/100 mL and temperature treatment of 55 °C significantly improved the color strength of dyed cotton fabrics.

  10. Hyb-Seq: combining target enrichment and genome skimming for plant phylogenomics

    Science.gov (United States)

    Kevin Weitemier; Shannon C.K. Straub; Richard C. Cronn; Mark Fishbein; Roswitha Schmickl; Angela McDonnell; Aaron. Liston

    2014-01-01

    • Premise of the study: Hyb-Seq, the combination of target enrichment and genome skimming, allows simultaneous data collection for low-copy nuclear genes and high-copy genomic targets for plant systematics and evolution studies. • Methods and Results: Genome and transcriptome assemblies for milkweed ( Asclepias syriaca ) were used to design enrichment probes for 3385...

  11. Anthropogenic Impacts on Mortality and Population Viability of the Monarch Butterfly.

    Science.gov (United States)

    Malcolm, Stephen B

    2018-01-07

    Monarch butterflies (Danaus plexippus) are familiar herbivores of milkweeds of the genus Asclepias, and most monarchs migrate each year to locate these host plants across North American ecosystems now dominated by agriculture. Eastern migrants overwinter in high-elevation forests in Mexico, and western monarchs overwinter in trees on the coast of California. Both populations face three primary threats to their viability: (a) loss of milkweed resources for larvae due to genetically modified crops, pesticides, and fertilizers; (b) loss of nectar resources from flowering plants; and (c) degraded overwintering forest habitats due to commercially motivated deforestation and other economic activities. Secondary threats to population viability include (d) climate change effects on milkweed host plants and the dynamics of breeding, overwintering, and migration; (e) the influence of invasive plants and natural enemies; (f) habitat fragmentation and coalescence that promote homogeneous, species-depleted landscapes; and (g) deliberate culture and release of monarchs and invasive milkweeds.

  12. Genetic variation in plant volatile emission does not result in differential attraction of natural enemies in the field.

    Science.gov (United States)

    Wason, Elizabeth L; Hunter, Mark D

    2014-02-01

    Volatile organic chemical (VOC) emission by plants may serve as an adaptive plant defense by attracting the natural enemies of herbivores. For plant VOC emission to evolve as an adaptive defense, plants must show genetic variability for the trait. To date, such variability has been investigated primarily in agricultural systems, yet relatively little is known about genetic variation in VOCs emitted by natural populations of native plants. Here, we investigate intraspecific variation in constitutive and herbivore-induced plant VOC emission using the native common milkweed plant (Asclepias syriaca) and its monarch caterpillar herbivore (Danaus plexippus) in complementary field and common garden greenhouse experiments. In addition, we used a common garden field experiment to gauge natural enemy attraction to milkweed VOCs induced by monarch damage. We found evidence of genetic variation in the total constitutive and induced concentrations of VOCs and the composition of VOC blends emitted by milkweed plants. However, all milkweed genotypes responded similarly to induction by monarchs in terms of their relative change in VOC concentration and blend. Natural enemies attacked decoy caterpillars more frequently on damaged than on undamaged milkweed, and natural enemy visitation was associated with higher total VOC concentrations and with VOC blend. Thus, we present evidence that induced VOCs emitted by milkweed may function as a defense against herbivores. However, plant genotypes were equally attractive to natural enemies. Although milkweed genotypes diverge phenotypically in their VOC concentrations and blends, they converge into similar phenotypes with regard to magnitude of induction and enemy attraction.

  13. Environmental Impact Statement. Deactivation of the Minuteman II Missile Wing at Whiteman Air Force Base, Missouri

    Science.gov (United States)

    1992-08-01

    holidays would cause the missile removal and transport rate to vary. i Under existing operations, approximately 1 day is required to remove the RV and...flying. A similar reaction would occur if a predator or competitor entered an individual’s habitat area. I Reactions to sudden noise, such as blasting...Cos. outcrops, saline- soil prairies Mead’s milkweed T Barton, Ben- Virgin blue- (Asclepias meadii) ton, Cass, stem Dade, Pettis, prairies Polk, St

  14. Efeito da densidade e da distância de caruru-de-mancha e amendoim-bravo na cultura do feijoeiro Effect of the density and distance of slender amaranth and milkweed on the common bean (Phaseolus vulgari

    Directory of Open Access Journals (Sweden)

    A.A.M. Barroso

    2012-03-01

    Full Text Available O objetivo deste trabalho foi avaliar a interferência causada pelo caruru-demancha (Amaranthus viridis e amendoim-bravo (Euphorbia heterophylla, em função das densidades e distâncias, no feijoeiro (Phaseolus vulgaris cultivar Pérola. Como recipientes, foram utilizadas caixas de cimento-amianto, com capacidade para 50 litros, preenchidas com LatossoloVermelho-Escuro. As mudas foram formadas em bandejas de 128 células preenchidas com substrato hortícola; quando as plântulas atingiram o estádio V2, foram transplantadas para as caixas, sendo as de feijoeiro numa linha central, reproduzindo a semeadura em campo, e as das plantas daninhas nas densidades de 8, 16 e 32 plantas m-2, distanciadas de 0, 12 e 24 cm das plantas de feijão e igualmente entre si. O experimento foi conduzido no delineamento experimental de blocos casualizados, com os tratamentos dispostos em esquema fatorial 3x3+2T, com quatro repetições, constituindo as parcelas experimentais. Foram avaliadas características de crescimento e de produtividade da cultura e das plantas daninhas. Os dados obtidos foram submetidos à análise de variância pelo teste F, e as médias, comparadas pelo teste de Tukey. Observou-se que as plantas daninhas obtiveram maior desenvolvimento quando em maior distância da cultura. O caruru-de-mancha causou reduções no número de vagens e na produtividade estimada do feijoeiro. Para o caruru-de-mancha, o aumento da densidade só causou redução na produtividade da cultura quando as plantas estavam distanciadas em pelo menos 12 cm. A 0 cm, o feijoeiro tornou-se mais competitivo e não sofreu interferência das plantas daninhas, independentemente da densidade destas.The aim of this study was to evaluate the interference caused by Slender amaranth (Amaranthus viridis and Milkweed (Euphorbia heterophylla at different densities and distances in the common bean (Phaseolus vulgaris cv. Pérola. The experiment was carried out using asbestos cement boxes

  15. Milkweed, stink bugs, and Georgia cotton

    Science.gov (United States)

    In peanut-cotton farmscapes in Georgia, stink bugs, i.e., Nezara viridula (L.)(Say) and Chinavia hilaris (Say), develop in peanut and then disperse at the crop-to-crop interface to feed on fruit in cotton. The main objective of this study was to examine the influence of a habitat of tropical milkwe...

  16. Latitudinal patterns in plant defense: evolution of cardenolides, their toxicity and induction following herbivory.

    Science.gov (United States)

    Rasmann, Sergio; Agrawal, Anurag A

    2011-05-01

    Attempts over the past 50 years to explain variation in the abundance, distribution and diversity of plant secondary compounds gave rise to theories of plant defense. Remarkably, few phylogenetically robust tests of these long-standing theories have been conducted. Using >50 species of milkweed (Asclepias spp.), we show that variation among plant species in the induction of toxic cardenolides is explained by latitude, with higher inducibility evolving more frequently at lower latitudes. We also found that: (1) the production of cardenolides showed positive-correlated evolution with the diversity of cardenolides, (2) greater cardenolide investment by a species is accompanied by an increase in an estimate of toxicity (measured as chemical polarity) and (3) instead of trading off, constitutive and induced cardenolides were positively correlated. Analyses of root and shoot cardenolides showed concordant patterns. Thus, milkweed species from lower latitudes are better defended with higher inducibility, greater diversity and added toxicity of cardenolides. © 2011 Blackwell Publishing Ltd/CNRS.

  17. Evolutionary trade-offs in plants mediate the strength of trophic cascades.

    Science.gov (United States)

    Mooney, Kailen A; Halitschke, Rayko; Kessler, Andre; Agrawal, Anurag A

    2010-03-26

    Predators determine herbivore and plant biomass via so-called trophic cascades, and the strength of such effects is influenced by ecosystem productivity. To determine whether evolutionary trade-offs among plant traits influence patterns of trophic control, we manipulated predators and soil fertility and measured impacts of a major herbivore (the aphid Aphis nerii) on 16 milkweed species (Asclepias spp.) in a phylogenetic field experiment. Herbivore density was determined by variation in predation and trade-offs between herbivore resistance and plant growth strategy. Neither herbivore density nor predator effects on herbivores predicted the cascading effects of predators on plant biomass. Instead, cascade strength was strongly and positively associated with milkweed response to soil fertility. Accordingly, contemporary patterns of trophic control are driven by evolutionary convergent trade-offs faced by plants.

  18. Restoring monarch butterfly habitat in the Midwestern US: 'All hands on deck'

    Science.gov (United States)

    Thogmartin, Wayne E.; Lopez-Hoffman, Laura; Rohweder, Jason; Diffendorfer, James E.; Drum, Ryan G.; Semmens, Darius J.; Black, Scott; Caldwell, Iris; Cotter, Donita; Drobney, Pauline; Jackson, Laura L.; Gale, Michael; Helmers, Doug; Hilburger, Steven B.; Howard, Elizabeth; Oberhauser, Karen S.; Pleasants, John M.; Semmens, Brice X.; Taylor, Orley R.; Ward, Patrick; Weltzin, Jake F.; Wiederholt, Ruscena

    2017-01-01

    The eastern migratory population of monarch butterflies (Danaus plexippus plexippus) has declined by >80% within the last two decades. One possible cause of this decline is the loss of ≥1.3 billion stems of milkweed (Asclepias spp.), which monarchs require for reproduction. In an effort to restore monarchs to a population goal established by the US Fish and Wildlife Service and adopted by Mexico, Canada, and the US, we developed scenarios for amending the Midwestern US landscape with milkweed. Scenarios for milkweed restoration were developed for protected area grasslands, Conservation Reserve Program land, powerline, rail and roadside rights of way, urban/suburban lands, and land in agricultural production. Agricultural land was further divided into productive and marginal cropland. We elicited expert opinion as to the biological potential (in stems per acre) for lands in these individual sectors to support milkweed restoration and the likely adoption (probability) of management practices necessary for affecting restoration. Sixteen of 218 scenarios we developed for restoring milkweed to the Midwestern US were at levels (>1.3 billion new stems) necessary to reach the monarch population goal. One of these scenarios would convert all marginal agriculture to conserved status. The other 15 scenarios converted half of marginal agriculture (730 million stems), with remaining stems contributed by other societal sectors. Scenarios without substantive agricultural participation were insufficient for attaining the population goal. Agricultural lands are essential to reaching restoration targets because they occupy 77% of all potential monarch habitat. Barring fundamental changes to policy, innovative application of economic tools such as habitat exchanges may provide sufficient resources to tip the balance of the agro-ecological landscape toward a setting conducive to both robust agricultural production and reduced imperilment of the migratory monarch butterfly.

  19. Restoring monarch butterfly habitat in the Midwestern US: ‘all hands on deck’

    Science.gov (United States)

    Thogmartin, Wayne E.; López-Hoffman, Laura; Rohweder, Jason; Diffendorfer, Jay; Drum, Ryan; Semmens, Darius; Black, Scott; Caldwell, Iris; Cotter, Donita; Drobney, Pauline; Jackson, Laura L.; Gale, Michael; Helmers, Doug; Hilburger, Steve; Howard, Elizabeth; Oberhauser, Karen; Pleasants, John; Semmens, Brice; Taylor, Orley; Ward, Patrick; Weltzin, Jake F.; Wiederholt, Ruscena

    2017-07-01

    The eastern migratory population of monarch butterflies (Danaus plexippus plexippus) has declined by >80% within the last two decades. One possible cause of this decline is the loss of ≥1.3 billion stems of milkweed (Asclepias spp.), which monarchs require for reproduction. In an effort to restore monarchs to a population goal established by the US Fish and Wildlife Service and adopted by Mexico, Canada, and the US, we developed scenarios for amending the Midwestern US landscape with milkweed. Scenarios for milkweed restoration were developed for protected area grasslands, Conservation Reserve Program land, powerline, rail and roadside rights of way, urban/suburban lands, and land in agricultural production. Agricultural land was further divided into productive and marginal cropland. We elicited expert opinion as to the biological potential (in stems per acre) for lands in these individual sectors to support milkweed restoration and the likely adoption (probability) of management practices necessary for affecting restoration. Sixteen of 218 scenarios we developed for restoring milkweed to the Midwestern US were at levels (>1.3 billion new stems) necessary to reach the monarch population goal. One of these scenarios would convert all marginal agriculture to conserved status. The other 15 scenarios converted half of marginal agriculture (730 million stems), with remaining stems contributed by other societal sectors. Scenarios without substantive agricultural participation were insufficient for attaining the population goal. Agricultural lands are essential to reaching restoration targets because they occupy 77% of all potential monarch habitat. Barring fundamental changes to policy, innovative application of economic tools such as habitat exchanges may provide sufficient resources to tip the balance of the agro-ecological landscape toward a setting conducive to both robust agricultural production and reduced imperilment of the migratory monarch butterfly.

  20. Patterns of resource use by milkweed insects in Sinai Abstract ...

    African Journals Online (AJOL)

    Francis

    Host-plant defensive chemistry is known to mediate food choice in many .... in the morning between 0745 and 1030 h (local time), and two times in the afternoon between ... high-pressure liquid chromatography (HPLC) eluted with methanol: ...

  1. Thermal properties of poly (lactic acid)/milkweed composites

    Science.gov (United States)

    Currently, most polymer composites utilize petroleum-based materials that are non-degradable and difficult to recycle or incur substantial cost for disposal. Green composites can be used in nondurable limited applications. In order to determine the degree of compatibility between Poly (lactic Acid...

  2. Studies on the cardenolide sequestration in African milkweed butterflies (Danaidae).

    Science.gov (United States)

    Mebs, Dietrich; Reuss, Esther; Schneider, Michael

    2005-04-01

    Butterflies of the Danaidae family are considered to be toxic or distasteful due to the presence of cardiac glycosides sequestered from their larval food plants. Alcoholic extracts of specimens of Danaus chrysippus aegyptius and Amauris ochlea ochlea from southern Africa (Namibia, S.-Africa, Mozambique) were analyzed by thin-layer chromatography for these cardenolides. But only 4 of 75 specimens of D. chrysippus aegyptius contained trace amounts, all others including 13 specimens of A. ochlea ochlea were negative. Genetic analysis of the ouabain binding site of the Na(+), K(+)-ATPase revealed that both species do not present an amino acid replacement at the position 122, which otherwise makes the enzyme insensitive to cardenolides suggesting that other strategies of toxin tolerance must have been developed.

  3. Beneficial Insects and Insect Pollinators on Milkweed in South Georgia

    Science.gov (United States)

    Insect pollinators are essential for the reproduction of more than two-thirds of the world’s crops, and beneficial insects play an important role in managing pest insects in agricultural farmscapes. These insects depend on nectar for their survival in these farmscapes. The flowers of tropical milkwe...

  4. Patterns of resource use by milkweed insects in Sinai | Elbanna ...

    African Journals Online (AJOL)

    Plant morphology and defensive chemistry are related to the insect community of herbivores on Gomphocarpus sinaicus (Boiss.) (Apocynaceae) in Sinai (Egypt). There appears to be significant variation among individual plants in the components of their chemical defences. The different components of the community ...

  5. Disease ecology across soil boundaries: effects of below-ground fungi on above-ground host-parasite interactions.

    Science.gov (United States)

    Tao, Leiling; Gowler, Camden D; Ahmad, Aamina; Hunter, Mark D; de Roode, Jacobus C

    2015-10-22

    Host-parasite interactions are subject to strong trait-mediated indirect effects from other species. However, it remains unexplored whether such indirect effects may occur across soil boundaries and connect spatially isolated organisms. Here, we demonstrate that, by changing plant (milkweed Asclepias sp.) traits, arbuscular mycorrhizal fungi (AMF) significantly affect interactions between a herbivore (the monarch butterfly Danaus plexippus) and its protozoan parasite (Ophryocystis elektroscirrha), which represents an interaction across four biological kingdoms. In our experiment, AMF affected parasite virulence, host resistance and host tolerance to the parasite. These effects were dependent on both the density of AMF and the identity of milkweed species: AMF indirectly increased disease in monarchs reared on some species, while alleviating disease in monarchs reared on other species. The species-specificity was driven largely by the effects of AMF on both plant primary (phosphorus) and secondary (cardenolides; toxins in milkweeds) traits. Our study demonstrates that trait-mediated indirect effects in disease ecology are extensive, such that below-ground interactions between AMF and plant roots can alter host-parasite interactions above ground. In general, soil biota may play an underappreciated role in the ecology of many terrestrial host-parasite systems. © 2015 The Author(s).

  6. Disease ecology across soil boundaries: effects of below-ground fungi on above-ground host–parasite interactions

    Science.gov (United States)

    Tao, Leiling; Gowler, Camden D.; Ahmad, Aamina; Hunter, Mark D.; de Roode, Jacobus C.

    2015-01-01

    Host–parasite interactions are subject to strong trait-mediated indirect effects from other species. However, it remains unexplored whether such indirect effects may occur across soil boundaries and connect spatially isolated organisms. Here, we demonstrate that, by changing plant (milkweed Asclepias sp.) traits, arbuscular mycorrhizal fungi (AMF) significantly affect interactions between a herbivore (the monarch butterfly Danaus plexippus) and its protozoan parasite (Ophryocystis elektroscirrha), which represents an interaction across four biological kingdoms. In our experiment, AMF affected parasite virulence, host resistance and host tolerance to the parasite. These effects were dependent on both the density of AMF and the identity of milkweed species: AMF indirectly increased disease in monarchs reared on some species, while alleviating disease in monarchs reared on other species. The species-specificity was driven largely by the effects of AMF on both plant primary (phosphorus) and secondary (cardenolides; toxins in milkweeds) traits. Our study demonstrates that trait-mediated indirect effects in disease ecology are extensive, such that below-ground interactions between AMF and plant roots can alter host–parasite interactions above ground. In general, soil biota may play an underappreciated role in the ecology of many terrestrial host–parasite systems. PMID:26468247

  7. Host Diet Affects the Morphology of Monarch Butterfly Parasites.

    Science.gov (United States)

    Hoang, Kevin; Tao, Leiling; Hunter, Mark D; de Roode, Jacobus C

    2017-06-01

    Understanding host-parasite interactions is essential for ecological research, wildlife conservation, and health management. While most studies focus on numerical traits of parasite groups, such as changes in parasite load, less focus is placed on the traits of individual parasites such as parasite size and shape (parasite morphology). Parasite morphology has significant effects on parasite fitness such as initial colonization of hosts, avoidance of host immune defenses, and the availability of resources for parasite replication. As such, understanding factors that affect parasite morphology is important in predicting the consequences of host-parasite interactions. Here, we studied how host diet affected the spore morphology of a protozoan parasite ( Ophryocystis elektroscirrha ), a specialist parasite of the monarch butterfly ( Danaus plexippus ). We found that different host plant species (milkweeds; Asclepias spp.) significantly affected parasite spore size. Previous studies have found that cardenolides, secondary chemicals in host plants of monarchs, can reduce parasite loads and increase the lifespan of infected butterflies. Adding to this benefit of high cardenolide milkweeds, we found that infected monarchs reared on milkweeds of higher cardenolide concentrations yielded smaller parasites, a potentially hidden characteristic of cardenolides that may have important implications for monarch-parasite interactions.

  8. Density estimates of monarch butterflies overwintering in central Mexico

    Directory of Open Access Journals (Sweden)

    Wayne E. Thogmartin

    2017-04-01

    Full Text Available Given the rapid population decline and recent petition for listing of the monarch butterfly (Danaus plexippus L. under the Endangered Species Act, an accurate estimate of the Eastern, migratory population size is needed. Because of difficulty in counting individual monarchs, the number of hectares occupied by monarchs in the overwintering area is commonly used as a proxy for population size, which is then multiplied by the density of individuals per hectare to estimate population size. There is, however, considerable variation in published estimates of overwintering density, ranging from 6.9–60.9 million ha−1. We develop a probability distribution for overwinter density of monarch butterflies from six published density estimates. The mean density among the mixture of the six published estimates was ∼27.9 million butterflies ha−1 (95% CI [2.4–80.7] million ha−1; the mixture distribution is approximately log-normal, and as such is better represented by the median (21.1 million butterflies ha−1. Based upon assumptions regarding the number of milkweed needed to support monarchs, the amount of milkweed (Asclepias spp. lost (0.86 billion stems in the northern US plus the amount of milkweed remaining (1.34 billion stems, we estimate >1.8 billion stems is needed to return monarchs to an average population size of 6 ha. Considerable uncertainty exists in this required amount of milkweed because of the considerable uncertainty occurring in overwinter density estimates. Nevertheless, the estimate is on the same order as other published estimates. The studies included in our synthesis differ substantially by year, location, method, and measures of precision. A better understanding of the factors influencing overwintering density across space and time would be valuable for increasing the precision of conservation recommendations.

  9. Density estimates of monarch butterflies overwintering in central Mexico

    Science.gov (United States)

    Thogmartin, Wayne E.; Diffendorfer, James E.; Lopez-Hoffman, Laura; Oberhauser, Karen; Pleasants, John M.; Semmens, Brice X.; Semmens, Darius J.; Taylor, Orley R.; Wiederholt, Ruscena

    2017-01-01

    Given the rapid population decline and recent petition for listing of the monarch butterfly (Danaus plexippus L.) under the Endangered Species Act, an accurate estimate of the Eastern, migratory population size is needed. Because of difficulty in counting individual monarchs, the number of hectares occupied by monarchs in the overwintering area is commonly used as a proxy for population size, which is then multiplied by the density of individuals per hectare to estimate population size. There is, however, considerable variation in published estimates of overwintering density, ranging from 6.9–60.9 million ha−1. We develop a probability distribution for overwinter density of monarch butterflies from six published density estimates. The mean density among the mixture of the six published estimates was ∼27.9 million butterflies ha−1 (95% CI [2.4–80.7] million ha−1); the mixture distribution is approximately log-normal, and as such is better represented by the median (21.1 million butterflies ha−1). Based upon assumptions regarding the number of milkweed needed to support monarchs, the amount of milkweed (Asclepias spp.) lost (0.86 billion stems) in the northern US plus the amount of milkweed remaining (1.34 billion stems), we estimate >1.8 billion stems is needed to return monarchs to an average population size of 6 ha. Considerable uncertainty exists in this required amount of milkweed because of the considerable uncertainty occurring in overwinter density estimates. Nevertheless, the estimate is on the same order as other published estimates. The studies included in our synthesis differ substantially by year, location, method, and measures of precision. A better understanding of the factors influencing overwintering density across space and time would be valuable for increasing the precision of conservation recommendations.

  10. Mycorrhizae Alter Toxin Sequestration and Performance of Two Specialist Herbivores

    Directory of Open Access Journals (Sweden)

    Amanda R. Meier

    2018-04-01

    Full Text Available Multitrophic species interactions are shaped by both top-down and bottom-up factors. Belowground symbionts of plants, such as arbuscular mycorrhizal fungi (AMF, can alter the strength of these forces by altering plant phenotype. For example, AMF-mediated changes in foliar toxin and nutrient concentrations may influence herbivore growth and fecundity. In addition, many specialist herbivores sequester toxins from their host plants to resist natural enemies, and the extent of sequestration varies with host plant secondary chemistry. Therefore, by altering plant phenotype, AMF may affect both herbivore performance and their resistance to natural enemies. We examined how inoculation of plants with AMF influences toxin sequestration and performance of two specialist herbivores feeding upon four milkweed species (Asclepias incarnata, A. curassavica, A. latifolia, A. syriaca. We raised aphids (Aphis nerii and caterpillars (Danaus plexippus on plants for 6 days in a fully factorial manipulation of milkweed species and level of AMF inoculation (zero, medium, and high. We then assessed aphid and caterpillar sequestration of toxins (cardenolides and performance, and measured defensive and nutritive traits of control plants. Aphids and caterpillars sequestered higher concentrations of cardenolides from plants inoculated with AMF across all milkweed species. Aphid per capita growth rates and aphid body mass varied non-linearly with increasing AMF inoculum availability; across all milkweed species, aphids had the lowest performance under medium levels of AMF availability and highest performance under high AMF availability. In contrast, caterpillar survival varied strongly with AMF availability in a plant species-specific manner, and caterpillar growth was unaffected by AMF. Inoculation with AMF increased foliar cardenolide concentrations consistently among milkweed species, but altered aboveground biomasses and foliar phosphorous concentrations in a plant

  11. Hyb-Seq: Combining Target Enrichment and Genome Skimming for Plant Phylogenomics

    Directory of Open Access Journals (Sweden)

    Kevin Weitemier

    2014-08-01

    Full Text Available Premise of the study: Hyb-Seq, the combination of target enrichment and genome skimming, allows simultaneous data collection for low-copy nuclear genes and high-copy genomic targets for plant systematics and evolution studies. Methods and Results: Genome and transcriptome assemblies for milkweed (Asclepias syriaca were used to design enrichment probes for 3385 exons from 768 genes (>1.6 Mbp followed by Illumina sequencing of enriched libraries. Hyb-Seq of 12 individuals (10 Asclepias species and two related genera resulted in at least partial assembly of 92.6% of exons and 99.7% of genes and an average assembly length >2 Mbp. Importantly, complete plastomes and nuclear ribosomal DNA cistrons were assembled using off-target reads. Phylogenomic analyses demonstrated signal conflict between genomes. Conclusions: The Hyb-Seq approach enables targeted sequencing of thousands of low-copy nuclear exons and flanking regions, as well as genome skimming of high-copy repeats and organellar genomes, to efficiently produce genome-scale data sets for phylogenomics.

  12. Hyb-Seq: Combining target enrichment and genome skimming for plant phylogenomics1

    Science.gov (United States)

    Weitemier, Kevin; Straub, Shannon C. K.; Cronn, Richard C.; Fishbein, Mark; Schmickl, Roswitha; McDonnell, Angela; Liston, Aaron

    2014-01-01

    • Premise of the study: Hyb-Seq, the combination of target enrichment and genome skimming, allows simultaneous data collection for low-copy nuclear genes and high-copy genomic targets for plant systematics and evolution studies. • Methods and Results: Genome and transcriptome assemblies for milkweed (Asclepias syriaca) were used to design enrichment probes for 3385 exons from 768 genes (>1.6 Mbp) followed by Illumina sequencing of enriched libraries. Hyb-Seq of 12 individuals (10 Asclepias species and two related genera) resulted in at least partial assembly of 92.6% of exons and 99.7% of genes and an average assembly length >2 Mbp. Importantly, complete plastomes and nuclear ribosomal DNA cistrons were assembled using off-target reads. Phylogenomic analyses demonstrated signal conflict between genomes. • Conclusions: The Hyb-Seq approach enables targeted sequencing of thousands of low-copy nuclear exons and flanking regions, as well as genome skimming of high-copy repeats and organellar genomes, to efficiently produce genome-scale data sets for phylogenomics. PMID:25225629

  13. Plant-derived differences in the composition of aphid honeydew and their effects on colonies of aphid-tending ants

    Science.gov (United States)

    Pringle, Elizabeth G; Novo, Alexandria; Ableson, Ian; Barbehenn, Raymond V; Vannette, Rachel L

    2014-01-01

    In plant–ant–hemipteran interactions, ants visit plants to consume the honeydew produced by phloem-feeding hemipterans. If genetically based differences in plant phloem chemistry change the chemical composition of hemipteran honeydew, then the plant's genetic constitution could have indirect effects on ants via the hemipterans. If such effects change ant behavior, they could feed back to affect the plant itself. We compared the chemical composition of honeydews produced by Aphis nerii aphid clones on two milkweed congeners, Asclepias curassavica and Asclepias incarnata, and we measured the responses of experimental Linepithema humile ant colonies to these honeydews. The compositions of secondary metabolites, sugars, and amino acids differed significantly in the honeydews from the two plant species. Ant colonies feeding on honeydew derived from A. incarnata recruited in higher numbers to artificial diet, maintained higher queen and worker dry weight, and sustained marginally more workers than ants feeding on honeydew derived from A. curassavica. Ants feeding on honeydew from A. incarnata were also more exploratory in behavioral assays than ants feeding from A. curassavica. Despite performing better when feeding on the A. incarnata honeydew, ant workers marginally preferred honeydew from A. curassavica to honeydew from A. incarnata when given a choice. Our results demonstrate that plant congeners can exert strong indirect effects on ant colonies by means of plant-species-specific differences in aphid honeydew chemistry. Moreover, these effects changed ant behavior and thus could feed back to affect plant performance in the field. PMID:25505534

  14. Use of bioindicators and passive sampling devices to evaluate ambient ozone concentrations in north central Pennsylvania

    Energy Technology Data Exchange (ETDEWEB)

    Yuska, D.E.; Skelly, J.M.; Ferdinand, J.A.; Stevenson, R.E.; Savage, J.E.; Mulik, J.D.; Hines, A

    2003-09-01

    Passive samplers and bioindicator plants detect ozone air pollution in north central Pennsylvania. - Ambient concentrations of tropospheric ozone and ozone-induced injury to black cherry (Prunus serotina) and common milkweed (Asclepias syriaca) were determined in north central Pennsylvania from 29 May to 5 September 2000 and from 28 May to 18 September 2001. Ogawa passive ozone samplers were utilized within openings at 15 forested sites of which six were co-located with TECO model 49 continuous ozone monitors. A significant positive correlation was observed between the Ogawa passive samplers and the TECO model 49 continuous ozone monitors for the 2000 (r=0.959) and 2001 (r=0.979) seasons. In addition, a significant positive correlation existed in 2000 and 2001 between ozone concentration and elevation (r=0.720) and (r=0.802), respectively. Classic ozone-induced symptoms were observed on black cherry and common milkweed. In 2000, initial injury was observed in early June, whereas for the 2001 season, initial injury was initially observed in late June. During both seasons, injury was noted at most sites by mid- to late-July. Soil moisture potential was measured for the 2001 season and a significant positive relationship (P<0.001) showed that injury to black cherry was a function of cumulative ozone concentrations and available soil moisture.

  15. Phylogenetic incongruence and the evolutionary origins of cardenolide-resistant forms of Na+,K+-ATPase in Danaus butterflies

    Science.gov (United States)

    Aardema, Matthew L.; Andolfatto, Peter

    2016-01-01

    Many distantly-related insect species are specialized feeders of cardenolide-containing host plants such as milkweed (Asclepias spp.). Studies have revealed frequent, parallel substitution of a functionally important amino acid substitution (N122H) in the alpha subunit of Na+,K+-ATPase (N122H) in many of these species. This substitution facilitates the ability of these insects to feed on their toxic hosts. Among milkweed butterflies of the genus Danaus, the previously established phylogeny for this group suggests that N122H arose independently and fixed in two distinct lineages. We re-evaluate this conclusion by examining Danaus phylogenetic relationships using >400 orthologous gene sequences assembled from transcriptome data. Our results indicate that the three Danaus species known to harbor the N122H substitution are more closely related than previously thought, consistent with a single, common origin for N122H. However, we also find evidence of both incomplete lineage sorting and post-speciation genetic exchange among these butterfly species, raising the possibility of collateral evolution of cardenolide-insensitivity in this species group. PMID:27405795

  16. Use of bioindicators and passive sampling devices to evaluate ambient ozone concentrations in north central Pennsylvania

    International Nuclear Information System (INIS)

    Yuska, D.E.; Skelly, J.M.; Ferdinand, J.A.; Stevenson, R.E.; Savage, J.E.; Mulik, J.D.; Hines, A.

    2003-01-01

    Passive samplers and bioindicator plants detect ozone air pollution in north central Pennsylvania. - Ambient concentrations of tropospheric ozone and ozone-induced injury to black cherry (Prunus serotina) and common milkweed (Asclepias syriaca) were determined in north central Pennsylvania from 29 May to 5 September 2000 and from 28 May to 18 September 2001. Ogawa passive ozone samplers were utilized within openings at 15 forested sites of which six were co-located with TECO model 49 continuous ozone monitors. A significant positive correlation was observed between the Ogawa passive samplers and the TECO model 49 continuous ozone monitors for the 2000 (r=0.959) and 2001 (r=0.979) seasons. In addition, a significant positive correlation existed in 2000 and 2001 between ozone concentration and elevation (r=0.720) and (r=0.802), respectively. Classic ozone-induced symptoms were observed on black cherry and common milkweed. In 2000, initial injury was observed in early June, whereas for the 2001 season, initial injury was initially observed in late June. During both seasons, injury was noted at most sites by mid- to late-July. Soil moisture potential was measured for the 2001 season and a significant positive relationship (P<0.001) showed that injury to black cherry was a function of cumulative ozone concentrations and available soil moisture

  17. Effects of pregnane glycosides on food intake depend on stimulation of the melanocortin pathway and BDNF in an animal model.

    Science.gov (United States)

    Komarnytsky, Slavko; Esposito, Debora; Rathinasabapathy, Thirumurugan; Poulev, Alexander; Raskin, Ilya

    2013-02-27

    Pregnane glycosides appear to modulate food intake by possibly affecting the hypothalamic feeding circuits; however, the mechanisms of the appetite-regulating effect of pregnane glycosides remain obscure. Here, we show that pregnane glycoside-enriched extracts from swamp milkweed Asclepias incarnata at 25-100 mg/kg daily attenuated food intake (up to 47.1 ± 8.5% less than controls) and body weight gain in rats (10% for males and 9% for females, respectively) by activating melanocortin signaling and inhibiting gastric emptying. The major milkweed pregnane glycoside, ikemagenin, exerted its appetite-regulating effect by decreasing levels of agouti-related protein (0.6-fold) but not NPY satiety peptides. Ikemagenin treatment also increased secretion of brain-derived neurotropic factor (BDNF) downstream of melanocortin receptors in the hypothalamus (1.4-fold) and in the C6 rat glioma cell culture in vitro (up to 6-fold). These results support the multimodal effects of pregnane glycosides on feeding regulation, which depends on the activity of the melanocortin signaling pathway and BDNF.

  18. An Evaluation of Butterfly Gardens for Restoring Habitat for the Monarch Butterfly (Lepidoptera: Danaidae).

    Science.gov (United States)

    Cutting, Brian T; Tallamy, Douglas W

    2015-10-01

    The eastern migratory monarch butterfly (Danaus plexippus L.) population in North America hit record low numbers during the 2013-2014 overwintering season, prompting pleas by scientists and conservation groups to plant the butterfly's milkweed host plants (Asclepias spp.) in residential areas. While planting butterfly gardens with host plants seems like an intuitive action, no previous study has directly compared larval survival in gardens and natural areas to demonstrate that gardens are suitable habitats for Lepidoptera. In this study, milkweed was planted in residential gardens and natural areas. In 2009 and 2010, plants were monitored for oviposition by monarch butterflies and survival of monarch eggs and caterpillars. Monarchs oviposited significantly more frequently in gardens than in natural sites, with 2.0 and 6.2 times more eggs per plant per observation in 2009 and 2010, respectively. There were no significant differences in overall subadult survival between gardens and natural areas. Significant differences in survival were measured for egg and larval cohorts when analyzed separately, but these were not consistent between years. These results suggest that planting gardens with suitable larval host plants can be an effective tool for restoring habitat for monarch butterflies. If planted over a large area, garden plantings may be useful as a partial mitigation for dramatic loss of monarch habitat in agricultural settings. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  19. Stochastic prey arrivals and crab spider giving-up times: simulations of spider performance using two simple "rules of thumb".

    Science.gov (United States)

    Kareiva, Peter; Morse, Douglass H; Eccleston, Jill

    1989-03-01

    We compared the patch-choice performances of an ambush predator, the crab spider Misumena vatia (Thomisidae) hunting on common milkweed Asclepias syriaca (Asclepiadaceae) umbles, with two stochastic rule-of-thumb simulation models: one that employed a threshold giving-up time and one that assumed a fixed probability of moving. Adult female Misumena were placed on milkweed plants with three umbels, each with markedly different numbers of flower-seeking prey. Using a variety of visitation regimes derived from observed visitation patterns of insect prey, we found that decreases in among-umbel variance in visitation rates or increases in overall mean visitation rates reduced the "clarity of the optimum" (the difference in the yield obtained as foraging behavior changes), both locally and globally. Yield profiles from both models were extremely flat or jagged over a wide range of prey visitation regimes; thus, differences between optimal and "next-best" strategies differed only modestly over large parts of the "foraging landscape". Although optimal yields from fixed probability simulations were one-third to one-half those obtained from threshold simulations, spiders appear to depart umbels in accordance with the fixed probability rule.

  20. Phylogenetic incongruence and the evolutionary origins of cardenolide-resistant forms of Na(+) ,K(+) -ATPase in Danaus butterflies.

    Science.gov (United States)

    Aardema, Matthew L; Andolfatto, Peter

    2016-08-01

    Many distantly related insect species are specialized feeders of cardenolide-containing host plants such as milkweed (Asclepias spp.). Previous studies have revealed frequent, parallel substitution of a functionally important amino acid substitution (N122H) in the alpha subunit of Na(+) ,K(+) -ATPase in a number of these species. This substitution facilitates the ability of these insects to feed on their toxic hosts and sequester cardenolides for their own use in defense. Among milkweed butterflies of the genus Danaus, the previously established phylogeny for this group suggests that N122H arose independently and fixed in two distinct lineages. We reevaluate this conclusion by examining Danaus phylogenetic relationships using >400 orthologous gene sequences assembled from transcriptome data. Our results indicate that the three Danaus species known to harbor the N122H substitution are more closely related than previously thought, consistent with a single, common origin for N122H. However, we also find evidence of both incomplete lineage sorting and post-speciation genetic exchange among these butterfly species, raising the possibility of collateral evolution of cardenolide-insensitivity in this species group. © 2016 The Author(s). Evolution © 2016 The Society for the Study of Evolution.

  1. Evidence for adaptive radiation from a phylogenetic study of plant defenses

    Science.gov (United States)

    Agrawal, Anurag A.; Fishbein, Mark; Halitschke, Rayko; Hastings, Amy P.; Rabosky, Daniel L.; Rasmann, Sergio

    2009-01-01

    One signature of adaptive radiation is a high level of trait change early during the diversification process and a plateau toward the end of the radiation. Although the study of the tempo of evolution has historically been the domain of paleontologists, recently developed phylogenetic tools allow for the rigorous examination of trait evolution in a tremendous diversity of organisms. Enemy-driven adaptive radiation was a key prediction of Ehrlich and Raven's coevolutionary hypothesis [Ehrlich PR, Raven PH (1964) Evolution 18:586–608], yet has remained largely untested. Here we examine patterns of trait evolution in 51 North American milkweed species (Asclepias), using maximum likelihood methods. We study 7 traits of the milkweeds, ranging from seed size and foliar physiological traits to defense traits (cardenolides, latex, and trichomes) previously shown to impact herbivores, including the monarch butterfly. We compare the fit of simple random-walk models of trait evolution to models that incorporate stabilizing selection (Ornstein-Ulenbeck process), as well as time-varying rates of trait evolution. Early bursts of trait evolution were implicated for 2 traits, while stabilizing selection was implicated for several others. We further modeled the relationship between trait change and species diversification while allowing rates of trait evolution to vary during the radiation. Species-rich lineages underwent a proportionately greater decline in latex and cardenolides relative to species-poor lineages, and the rate of trait change was most rapid early in the radiation. An interpretation of this result is that reduced investment in defensive traits accelerated diversification, and disproportionately so, early in the adaptive radiation of milkweeds. PMID:19805160

  2. Intoxicação experimental por Asclepias curassavica (Asclepiadaceae em bovinos. Dados complementares

    Directory of Open Access Journals (Sweden)

    Tokarnia Carlos Hubinger

    2001-01-01

    Full Text Available Em experimentos com bovinos, que receberam diariamente doses subletais repetidas (2,5 e 5,0 g/kg/dia durante 12 dias até alcançar a dose letal e/ou ultrapassá-la, A. curassavica recém-coletada não demonstrou efeito acumulativo. Em um animal houve desenvolvimento de tolerância contra a dose que anteriormente causou sintomas de intoxicação (5,0 g/kg, mas não contra uma dose maior (10 g/kg. A planta dessecada continuou tóxica até 2 meses após a coleta, mas após 6 meses tinha perdido a sua toxidez. A mistura da planta fresca picada com capim fresco picado não foi ingerida pelos animais em quantidades que pudessem causar sintomas de intoxicação, em nenhuma das proporções que variaram de 1:2 a 1:6, planta : capim. A planta recentemente dessecada picada em mistura com capim fenado picado, na proporção de 1:3, só foi consumida por um de quatro bovinos em quantidades que poderiam provocar sintomas de intoxicação; mas mesmo esse bovino não chegou a adoecer.

  3. Host use evolution in Chrysochus milkweed beetles: evidence from behaviour, population genetics and phylogeny.

    Science.gov (United States)

    Dobler, S; Farrell, B D

    1999-08-01

    In two sister species of leaf beetles with overlapping host associations, Chrysochus auratus and C. cobaltinus, we established diet breadth and food preference of local populations for evaluation together with genetic differentiation between populations. While C. auratus turned out to be monophagous on the same plant wherever we collected the beetles, the studied populations of C. cobaltinus fed on three different plant species in the field. Plant preference and ranking of the potential host plants significantly differed between these populations. The amount of genetic differentiation between populations was measured by a polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) assay of a 1300 bp mitochondrial DNA (mtDNA) sequence. In addition, the dominant genotypes of all populations were sequenced. No genetic differentiation between the populations of C. auratus could be detected in the RFLP assay and sequence divergence was low (= 0.3%). In C. cobaltinus, on the other hand, genetic differentiation between populations was high, revealing a lack of gene flow over a much smaller scale and a maximum of 1.3% sequence divergence. C. cobaltinus thereby has the prerequisites for host race formation on different plants from the original host spectrum. Our sequence-based phylogeny estimate allows us to reconstruct historical diet evolution in Chrysochus. Starting from an original association with Asclepiadaceae, the common ancestor of C. auratus and C. cobaltinus included Apocynaceae in its diet. The strict specialization on Apocynum and the loss of acceptance of Asclepiadaceae observed in C. auratus could have resulted from a process similar to that displayed by C. cobaltinus populations.

  4. Evolution of the insect terminal patterning system--insights from the milkweed bug, Oncopeltus fasciatus.

    Science.gov (United States)

    Weisbrod, Anat; Cohen, Mira; Chipman, Ariel D

    2013-08-01

    The anterior and posterior ends of the insect embryo are patterned through the terminal patterning system, which is best known from the fruitfly Drosophila melanogaster. In Drosophila, the RTK receptor Torso and its presumed co-activator Torso-like initiate a signaling cascade, which activates two terminal gap genes, tailless and huckebein. These in turn interact with various patterning genes to define terminal structures. Work on other insect species has shown that this system is poorly conserved, and not all of its components have been found in all cases studied. We place the variability of the system within a broader phylogenetic framework. We describe the expression and knock-down phenotypes of the homologues of terminal patterning genes in the hemimetabolous Oncopeltus fasciatus. We have examined the interactions among these genes and between them and other patterning genes. We demonstrate that all of these genes have different roles in Oncopeltus relative to Drosophila; torso-like is expressed in follicle cells during oogenesis and is involved in the invagination of the blastoderm to form the germ band, and possibly also in defining the growth zone; tailless is regulated by orthodenticle and has a role only in anterior determination; huckebein is expressed only in the middle of the blastoderm; finally, torso was not found in Oncopeltus and its role in terminal patterning seems novel within holometabolous insects. We then use our data, together with published data on other insects, to reconstruct the evolution of the terminal patterning gene network in insects. We suggest that the Drosophila terminal patterning network evolved recently in the lineage leading to the Diptera, and represents an example of evolutionary "tinkering", where pre-existing pathways are co-opted for a new function. Copyright © 2013 Elsevier Inc. All rights reserved.

  5. Cercosporoid leaf pathogens from whorled milkweed and spineless safflower in California

    NARCIS (Netherlands)

    Koike, S.T.; Baameur, A.; Groenewald, J.Z.; Crous, P.W.

    2011-01-01

    Annulatascus nilensis sp. nov., from freshwater habitats in Egypt, is described, illustrated and compared to other species in the genus. Phylogenetic analyses of its LSU rDNA sequence with similar fungi placed the new species in the genus Annulatascus (Annulatascaceae, Sordariomycetidae incertae

  6. Early patterning and blastodermal fate map of the head in the milkweed bug Oncopeltus fasciatus.

    Science.gov (United States)

    Birkan, Michael; Schaeper, Nina D; Chipman, Ariel D

    2011-01-01

    The process of head development in insects utilizes a set of widely conserved genes, but this process and its evolution are not well understood. Recent data from Tribolium castaneum have provided a baseline for an understanding of insect head development. However, work on a wider range of insect species, including members of the hemimetabolous orders, is needed in order to draw general conclusions about the evolution of head differentiation and regionalization. We have cloned and studied the expression and function of a number of candidate genes for head development in the hemipteran Oncopeltus fasciatus. These include orthodenticle, empty spiracles, collier, cap 'n' collar, and crocodile. The expression patterns of these genes show a broad conservation relative to Tribolium, as well as differences from Drosophila indicating that Tribolium + Oncopeltus represent a more ancestral pattern. In addition, our data provide a blastodermal fate map for different head regions in later developmental stages and supply us with a "roadmap" for future studies on head development in this species. © 2011 Wiley Periodicals, Inc.

  7. Attraction of milkweed stem weevils, Rhyssomatus spp. (Coleoptera: Curculiondae), to grandlure

    Science.gov (United States)

    A trapping study was initiated in the spring of 2010 to compare the attraction of boll weevils to standard grandlure (synthesized boll weevil pheromone) and a new experimental formulation of grandlure. Both formulations contained the same four pheromone components, but differed in the proportion of...

  8. Transovum transmission of trypanosomatid cysts in the Milkweed bug, Oncopeltus fasciatus.

    Directory of Open Access Journals (Sweden)

    Felipe de Almeida Dias

    Full Text Available Leptomonas wallacei is a trypanosomatid that develops promastigotes and cystic forms in the gut of the hemipteran insect Oncopeltus fasciatus. Insect trypanosomatids are thought to be solely transmitted from one host to another through the ingestion of parasite-contaminated feces. However, here we show that L. wallacei cysts present on the eggshells of eggs laid by O. fasciatus can also act as infective forms that are transmitted to the insect offspring. Newly hatched O. faciatus nymphs are parasite-free, but some of them become contaminated with L. wallacei after feeding on eggshell remnants. The present study is the first report of transovum transmission of a trypanosomatid, a process that may have a relevant role in parasite's within-host population dynamics.

  9. Transovum transmission of trypanosomatid cysts in the Milkweed bug, Oncopeltus fasciatus.

    Science.gov (United States)

    Dias, Felipe de Almeida; Vasconcellos, Luiz Ricardo da Costa; Romeiro, Alexandre; Attias, Marcia; Souto-Padrón, Thais Cristina; Lopes, Angela Hampshire

    2014-01-01

    Leptomonas wallacei is a trypanosomatid that develops promastigotes and cystic forms in the gut of the hemipteran insect Oncopeltus fasciatus. Insect trypanosomatids are thought to be solely transmitted from one host to another through the ingestion of parasite-contaminated feces. However, here we show that L. wallacei cysts present on the eggshells of eggs laid by O. fasciatus can also act as infective forms that are transmitted to the insect offspring. Newly hatched O. faciatus nymphs are parasite-free, but some of them become contaminated with L. wallacei after feeding on eggshell remnants. The present study is the first report of transovum transmission of a trypanosomatid, a process that may have a relevant role in parasite's within-host population dynamics.

  10. Investigation of some characteristics of polyhydroxy milkweed triglycerides and their acylated derivatives in relation to lubricity

    Science.gov (United States)

    Most industrial lubricants are derived from non-renewable petroleum-based sources. As useful as these lubricants are, their unintended consequences are the pollution of our environment as a result of the very slow degradation of the spent materials. Native seed oils, on the other hand, are renewa...

  11. Characteristics of polyhydroxy milkweed triglycerides and their acylated derivatives in relation to lubricity

    Science.gov (United States)

    Industrial lubricants are derived from non-renewable petroleum-based resources that can cause pollution due to poor degradation. Seed oils, however, are both renewable and readily biodegradable, but have lower thermal stability and shorter shelf-life. This drawback can be overcome and yet retain the...

  12. Occurrence and host specificity of a neogregarine protozoan in four milkweed butterfly hosts (Danaus spp.).

    Science.gov (United States)

    Barriga, Paola A; Sternberg, Eleanore D; Lefèvre, Thierry; de Roode, Jacobus C; Altizer, Sonia

    2016-10-01

    Throughout their global range, wild monarch butterflies (Danaus plexippus) are infected with the protozoan Ophryocystis elektroscirrha (OE). In monarchs, OE infection reduces pupal eclosion, adult lifespan, adult body size and flight ability. Infection of other butterfly hosts with OE is rare or unknown, and the only previously published records of OE infection were on monarch and queen butterflies (D. gilippus). Here we explored the occurrence and specificity of OE and OE-like parasites in four Danaus butterfly species. We surveyed wild D. eresimus (soldier), D. gilippus (queen), D. petilia (lesser wanderer), and D. plexippus (monarch) from five countries to determine the presence of infection. We conducted five cross-infection experiments, on monarchs and queen butterflies and their OE and OE-like parasites, to determine infection probability and the impact of infection on their hosts. Our field survey showed that OE-like parasites were present in D. gilippus, D. petilia, and D. plexippus, but were absent in D. eresimus. Infection probability varied geographically such that D. gilippus and D. plexippus populations in Puerto Rico and Trinidad were not infected or had low prevalence of infection, whereas D. plexippus from S. Florida and Australia had high prevalence. Cross-infection experiments showed evidence for host specificity, in that OE strains from monarchs were more effective at infecting monarchs than queens, and monarchs were less likely to be infected by OE-like strains from queens and lesser wanderers relative to their own natal strains. Our study showed that queens are less susceptible to OE and OE-like infection than monarchs, and that the reduction in adult lifespan following infection is more severe in monarchs than in queens. Copyright © 2016 Elsevier Inc. All rights reserved.

  13. Feeding on toxic prey. The praying mantis (Mantodea) as predator of poisonous butterfly and moth (Lepidoptera) caterpillars.

    Science.gov (United States)

    Mebs, Dietrich; Wunder, Cora; Pogoda, Werner; Toennes, Stefan W

    2017-06-01

    Caterpillars of the monarch butterfly, Danaus plexippus, feed on milkweed plants, Asclepias spp. (Apocynaceae), and sequester their toxic cardenolides aimed at deterring predators. Nevertheless, Chinese praying mantids, Tenodera sinensis, consume these caterpillars after removing the midgut ("gutting") including its plant content. In the present study, monarch caterpillars raised on A. curassavica, and those of the death's-head hawkmoth, Acherontia atropos, raised on Atropa belladonna containing atropine, were fed to mantids, Hierodula membranacea, which removed the gut of both species discarding about 59% of cardenolides and more than 90% of atropine, respectively. The ingestion of these compounds produced no apparent ill effects in the mantids and both were excreted with faeces. On the other hand, when mantids were fed with larvae of two moth species, Amata mogadorensis and Brahmaea certia, raised on non-poisonous host plants, the mantids showed the same gutting behaviour, thereby discarding indigestible plant material. As polar compounds, e.g. cardenolides and atropine, are not absorbed from the mantids midgut and do not pass the gut membrane, this enables the mantids to feed on toxic prey. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Pollination success following loss of a frequent pollinator: the role of compensatory visitation by other effective pollinators

    Science.gov (United States)

    Hallett, Allysa C.; Mitchell, Randall J.; Chamberlain, Evan R.

    2017-01-01

    Abstract Pollinator abundance is declining worldwide and may lower the quantity and quality of pollination services to flowering plant populations. Loss of an important pollinator is often assumed to reduce the amount of pollen received by stigmas of a focal species (pollination success), yet this assumption has rarely been tested experimentally. The magnitude of the effect, if any, may depend on the relative efficiency of the remaining pollinators, and on whether the loss of one pollinator leads to changes in visitation patterns by other pollinators. To explore how a change in pollinator composition influences pollination of Asclepias verticillata, we excluded bumble bees from plots in large and small populations of this milkweed species. We then quantified pollinator visitation rates, pollen export and pollen receipt for control plots and for plots where bumble bees were experimentally excluded. We found that exclusion of bumble bees did not reduce pollen receipt by A. verticillata flowers. Visitation by Polistes wasps increased markedly following bumble bee exclusion, both in small populations (186 % increase) and in large populations (400 % increase). Because Polistes wasps were as efficient as bumble bees at pollen transfer, increased wasp visitation offset lost bumble bee pollination services. Thus, loss of a frequent pollinator will not necessarily lead to a decline in pollination success. When pollinator loss is followed by a shift in the composition and abundance of remaining pollinators, pollination success will depend on the net change in the quantity and quality of pollination services. PMID:28798863

  15. Evolution of plant growth and defense in a continental introduction.

    Science.gov (United States)

    Agrawal, Anurag A; Hastings, Amy P; Bradburd, Gideon S; Woods, Ellen C; Züst, Tobias; Harvey, Jeffrey A; Bukovinszky, Tibor

    2015-07-01

    Substantial research has addressed adaptation of nonnative biota to novel environments, yet surprisingly little work has integrated population genetic structure and the mechanisms underlying phenotypic differentiation in ecologically important traits. We report on studies of the common milkweed Asclepias syriaca, which was introduced from North America to Europe over the past 400 years and which lacks most of its specialized herbivores in the introduced range. Using 10 populations from each continent grown in a common environment, we identified several growth and defense traits that have diverged, despite low neutral genetic differentiation between continents. We next developed a Bayesian modeling approach to account for relationships between molecular and phenotypic differences, confirming that continental trait differentiation was greater than expected from neutral genetic differentiation. We found evidence that growth-related traits adaptively diverged within and between continents. Inducible defenses triggered by monarch butterfly herbivory were substantially reduced in European populations, and this reduction in inducibility was concordant with altered phytohormonal dynamics, reduced plant growth, and a trade-off with constitutive investment. Freedom from the community of native and specialized herbivores may have favored constitutive over induced defense. Our replicated analysis of plant growth and defense, including phenotypically plastic traits, suggests adaptive evolution following a continental introduction.

  16. Incidence of ozone symptoms on vegetation within a National Wildlife Refuge in New Jersey, USA

    International Nuclear Information System (INIS)

    Davis, Donald D.; Orendovici, Teodora

    2006-01-01

    During 1993-1996 and 2001-2003, we evaluated the percentage of plants (incidence) exhibiting ozone-induced foliar symptoms on vegetation within a National Wildlife Refuge located along the Atlantic Ocean coast of New Jersey, USA. Incidence varied among plant species and years. Bioindicator plants most sensitive to ozone, across all years, included native common milkweed (Asclepias syriaca) and wild grape (Vitis spp.), as well as introduced tree-of-heaven (Ailanthus altissima). Less sensitive bioindicators included Virginia creeper (Parthenocissus quinquefolia) and winged sumac (Rhus coppolina). Black cherry (Prunus serotina) and sassafras (Sassafras albidum) were least sensitive. The greatest incidence of ozone symptoms, across all plant species, occurred in 1996, followed by 2001 > 1995 > 1994 > 1993 > 2003 > 2002. A model was developed that showed a statistically significant relationship between incidence of ozone symptoms and the following parameters: plant species, Palmer Drought Severity Index, and the interaction of W126 x N100 measures of ambient ozone. - Vegetation in a National Wildlife Refuge containing a Class I wilderness area exhibits foliar symptoms from ambient ozone

  17. Incidence of ozone symptoms on vegetation within a National Wildlife Refuge in New Jersey, USA

    Energy Technology Data Exchange (ETDEWEB)

    Davis, Donald D. [Department of Plant Pathology, Ecology Program, Penn State Institutes of the Environment, Pennsylvania State University, University Park, PA 16803 (United States)]. E-mail: ddd2@psu.edu; Orendovici, Teodora [Department of Plant Pathology, Ecology Program, Penn State Institutes of the Environment, Pennsylvania State University, University Park, PA 16803 (United States)

    2006-10-15

    During 1993-1996 and 2001-2003, we evaluated the percentage of plants (incidence) exhibiting ozone-induced foliar symptoms on vegetation within a National Wildlife Refuge located along the Atlantic Ocean coast of New Jersey, USA. Incidence varied among plant species and years. Bioindicator plants most sensitive to ozone, across all years, included native common milkweed (Asclepias syriaca) and wild grape (Vitis spp.), as well as introduced tree-of-heaven (Ailanthus altissima). Less sensitive bioindicators included Virginia creeper (Parthenocissus quinquefolia) and winged sumac (Rhus coppolina). Black cherry (Prunus serotina) and sassafras (Sassafras albidum) were least sensitive. The greatest incidence of ozone symptoms, across all plant species, occurred in 1996, followed by 2001 > 1995 > 1994 > 1993 > 2003 > 2002. A model was developed that showed a statistically significant relationship between incidence of ozone symptoms and the following parameters: plant species, Palmer Drought Severity Index, and the interaction of W126 x N100 measures of ambient ozone. - Vegetation in a National Wildlife Refuge containing a Class I wilderness area exhibits foliar symptoms from ambient ozone.

  18. Thermal properties of extruded injection-molded poly (lactic acid) and milkweed composites: degradation kinetics and enthalpic relaxation

    Science.gov (United States)

    Currently, most polymer composites utilize petroleum-based materials that are non-degradable and difficult to recycle or incur substantial cost for disposal. Green composites can be used in nondurable limited applications. In order to determine the degree of compatibility between Poly (lactic Acid...

  19. Modeling Stomatal Conductance to Estimate Seasonal Uptake in the Ozone-Sensitive Bioindicator Plant Common Milkweed (A. syriaca L.)

    Science.gov (United States)

    Bergweiler, C.

    2008-12-01

    The US EPA National Ambient Air Quality Standard (NAAQS) was not conceived to nor does it provide an accurate definition of the absorbed ozone dose or baseline exposure level to protect vegetation. This research presents a multiplicative modeling approach based not only on atmospheric, but on equally important physiological, phenological, and environmental parameters. Physiological constraints on ozone uptake demonstrate that actual absorption is substantially lower than that assumed by a simple interpretation of hourly atmospheric ozone concentrations. Coupled with development of foliar injury expression this provides evidence that tropospheric ozone is more toxic to vegetation than is currently understood.

  20. Differential infectivity of two Pseudomonas species and the immune response in the milkweed bug, Oncopeltus fasciatus (Insecta: Hemiptera).

    Science.gov (United States)

    Schneider, M; Dorn, A

    2001-10-01

    Pseudomonas aeruginosa and Pseudomonas putida show a profound differential infectivity after inoculation in Oncopeltus fasciatus. Whereas P. putida has no significant impact on nymphs, P. aeruginosa kills all experimental animals within 48 h. Both Pseudomonas species, however, induce the same four hemolymph peptides in O. fasciatus. Also injection of saline solution and injury induced these peptides. In general peptide induction was stronger in nymphs than in adult males. A significantly higher number of nymphs survived a challenge with P. aeruginosa when an immunization with P. putida preceded. The antibacterial properties of the hemolymph were demonstrated in inhibition experiments with P. putida. Two of the four inducible peptides (peptides 1 and 4) could be partially sequenced after Edman degradation and were compared with known antibacterial peptides. Peptide 1, of 15 kDa, showed 47.1% identity with the glycine-rich hemiptericin of Pyrrhocoris apterus. Peptide 4, of 2 kDa, had a 77.8% identity with the proline-rich pyrrhocoricin of P. apterus and a 76.9% identity with metalnikowin 1 of Palomena prasina. Peptides 2 and 3 are also small, with molecular weights of 8 and 5 kDa.

  1. Enhanced stress responses and metabolic adjustments linked to diapause and onset of migration in the large milkweed bug Oncopeltus fasciatus

    Czech Academy of Sciences Publication Activity Database

    Dean, C. A. E.; Teets, N. M.; Košťál, Vladimír; Šimek, Petr; Denlinger, D. L.

    2016-01-01

    Roč. 41, č. 2 (2016), s. 152-161 ISSN 0307-6962 R&D Projects: GA ČR GA13-18509S Institutional support: RVO:60077344 Keywords : diapause * heat shock proteins * metabolome Subject RIV: ED - Physiology Impact factor: 1.364, year: 2016 http://onlinelibrary.wiley.com/doi/10.1111/phen.12140/abstract

  2. Effects of gamma radiation on nymphal development and reproductive capacity of the large milkweed bug, Oncopeltus fasciatus (Dallas) (Hemiptera - Lygaeidae)

    International Nuclear Information System (INIS)

    Moursy, L.E.

    1985-01-01

    Gamma radiation adversely affected important fitness components of Oncopeltus fasciatus, particularly as expressed by nymphal development, subsequent reproductive capacity, mating competitiveness and longevity. Early treated 5th instar nymphs are about 2X more sensitive to gamma radiation than late treated 5th instar nymphs based upon LD50 values. The extremes in sensitivity were 5.01 kilorads (krad) for early treated males and 13.09 krad for females treated late in the 5th instar. Wing deformities resulted from doses in the same range as those for mortality. Fifty percent of early treated males had wing deformities at a dose of 10.81 krad while a dose of 12.5 and 12.89 krad was necessary for 50% wing deformities in males and females, respectively, when treated late in the 5th instar. Fecundity and fertility were affected at lower dosages of radiation than for mortality. The treatment of both sexes produced the greatest effect. Fecundity was reduced by 50% at 1.22 krad, while 50% reduction in fertility occurred at about half that dose, or 0.66 krad. Somewhat greater doses were required when females alone were treated and mated with untreated males. In this case a 50% reduction occurred with 1.87 and 1.07 krad for fecundity and fertility, respectively. When males alone were treated, ED50 values were 2.24 and 1.58 krad for fecundity and fertility, respectively

  3. Assessing Installation Ethnobotanical Resources Using Land Condition Trend Analysis (LCTA) Data: A Fort Riley, Kansas, Case Study

    Science.gov (United States)

    1998-07-01

    incarnata S F Carya illinoensis G L Asclepias stenophylla S B Ceanothus herbaceus S B Asclepias syriaca S B Ceanothus oliganthus S L Asclepias tuberosa S...cannabinum S B Carex retroflexa G F Argemone polyanthemos S F Carex vulpinoidea S F Artemisia ludoviciana S B Carya cordiformis S B Asclepias...longipilum G B Descurainia pinnata S F Hordeum pusillum G F Descurainia sophia S F Hymenopappus scabiosaeus G B Desmanthus illinoensis S B Hypericum

  4. Who's hot, who's not? Effects of concentrating solar power heliostats on soil temperature at Ivanpah Solar Electric Generating System, Mojave Desert, USA

    Science.gov (United States)

    Grodsky, S.; Hernandez, R. R.

    2017-12-01

    Solar energy development may function as a contemporary, anthropogenic driver of disturbance when sited in natural ecosystems. Orientation and density of solar modules, including heliostats at concentrating solar power (CSP) facilities, may affect soils via shading and altered surface-water flow. Meanwhile, soil attributes like temperature and moisture may affect nutrient cycling, plant germination and growth, and soil biota. We tested effects of CSP heliostats on soil temperature at Ivanpah Solar Electric Generating System (ISEGS) in the Mojave Desert, USA. We implemented experimental treatments based on preconstruction rare plant [e.g., Mojave milkweed (Asclepias nyctaginifolia)] protection areas (hereafter "halos"), site preparation activities, and heliostat density throughout three, replicated CSP blocks (i.e., tower and associated heliostats), including: (1) No Halos (Bladed) - high site preparation intensity, high heliostat density immediately surrounding towers; (2) No Halos (Mowed) - moderate site preparation intensity, moderate to low heliostat density as distance increases from towers; and (3) Halos - no site preparation, no heliostats. We also established control sites within 1,600 km of ISEGS in undisturbed desert. We observed significant differences in soil temperature across treatments. We recorded significantly lower soil temperatures in the No Halos (Bladed) treatments (26.7°C) and No Halos (Mowed) treatments (29.9°C) than in the Halos treatments (32.9°C) and controls (32.1°C). We also determined that soil temperatures in the Halos treatments and controls did not significantly differ. Our results indicated that shading from high-density heliostat configuration significantly reduced soil temperature relative to low-density heliostat configuration and areas without CSP. Shading from heliostats and consequential fluctuation in soil temperatures may affect local-scale distribution of flora and fauna, leading to altered "bottom-up" ecological

  5. Evidence for an Invasive Aphid “Superclone”: Extremely Low Genetic Diversity in Oleander Aphid (Aphis nerii) Populations in the Southern United States

    Science.gov (United States)

    Harrison, John Scott; Mondor, Edward B.

    2011-01-01

    Background The importance of genetic diversity in successful biological invasions is unclear. In animals, but not necessarily plants, increased genetic diversity is generally associated with successful colonization and establishment of novel habitats. The Oleander aphid, Aphis nerii, though native to the Mediterranean region, is an invasive pest species throughout much of the world. Feeding primarily on Oleander (Nerium oleander) and Milkweed (Asclepias spp.) under natural conditions, these plants are unlikely to support aphid populations year round in the southern US. The objective of this study was to describe the genetic variation within and among US populations of A. nerii, during extinction/recolonization events, to better understand the population ecology of this invasive species. Methodology/Principal Findings We used five microsatellite markers to assess genetic diversity over a two year period within and among three aphid populations separated by small (100 km) and large (3,700 km) geographic distances on two host plant species. Here we provide evidence for A. nerii “superclones”. Genotypic variation was absent in all populations (i.e., each population consisted of a single multilocus genotype (MLG) or “clone”) and the genetic composition of only one population completely changed across years. There was no evidence of sexual reproduction or host races on different plant species. Conclusions/Significance Aphis nerii is a well established invasive species despite having extremely low genetic diversity. As this aphid appears to be obligatorily asexual, it may share more similarities with clonally reproducing invasive plants, than with other animals. Patterns of temporal and geographic genetic variation, viewed in the context of its population dynamics, have important implications for the management of invasive pests and the evolutionary biology of asexual species. PMID:21408073

  6. An adaptive decision framework for the conservation of a threatened plant

    Science.gov (United States)

    Moore, Clinton T.; Fonnesbeck, Christopher J.; Shea, Katriona; Lah, Kristopher J.; McKenzie, Paul M.; Ball, Lianne C.; Runge, Michael C.; Alexander, Helen M.

    2011-01-01

    Mead's milkweed Asclepias meadii, a long-lived perennial herb of tallgrass prairie and glade communities of the central United States, is a species designated as threatened under the U.S. Endangered Species Act. Challenges to its successful management include the facts that much about its life history is unknown, its age at reproductive maturity is very advanced, certain life stages are practically unobservable, its productivity is responsive to unpredictable environmental events, and most of the known populations occur on private lands unprotected by any legal conservation instrument. One critical source of biological uncertainty is the degree to which fire promotes growth and reproductive response in the plant. To aid in its management, we developed a prototype population-level state-dependent decision-making framework that explicitly accounts for this uncertainty and for uncertainties related to stochastic environmental effects and vital rates. To parameterize the decision model, we used estimates found in the literature, and we analyzed data from a long-term monitoring program where fates of individual plants were observed through time. We demonstrate that different optimal courses of action are followed according to how one believes that fire influences reproductive response, and we show that the action taken for certain population states is informative for resolving uncertainty about competing beliefs regarding the effect of fire. We advocate the use of a model-predictive approach for the management of rare populations, particularly when management uncertainty is profound. Over time, an adaptive management approach should reduce uncertainty and improve management performance as predictions of management outcome generated under competing models are continually informed and updated by monitoring data.

  7. A genetically-based latitudinal cline in the emission of herbivore-induced plant volatile organic compounds.

    Science.gov (United States)

    Wason, Elizabeth L; Agrawal, Anurag A; Hunter, Mark D

    2013-08-01

    The existence of predictable latitudinal variation in plant defense against herbivores remains controversial. A prevailing view holds that higher levels of plant defense evolve at low latitudes compared to high latitudes as an adaptive plant response to higher herbivore pressure on low-latitude plants. To date, this prediction has not been examined with respect to volatile organic compounds (VOCs) that many plants emit, often thus attracting the natural enemies of herbivores. Here, we compared genetically-based constitutive and herbivore-induced aboveground vegetative VOC emissions from plants originating across a gradient of more than 10° of latitude (>1,500 km). We collected headspace VOCs from Asclepias syriaca (common milkweed) originating from 20 populations across its natural range and grown in a common garden near the range center. Feeding by specialist Danaus plexippus (monarch) larvae induced VOCs, and field environmental conditions (temperature, light, and humidity) also influenced emissions. Monarch damage increased plant VOC concentrations and altered VOC blends. We found that genetically-based induced VOC emissions varied with the latitude of plant population origin, although the pattern followed the reverse of that predicted-induced VOC concentration increased with increasing latitude. This pattern appeared to be driven by a greater induction of sesquiterpenoids at higher latitudes. In contrast, constitutive VOC emission did not vary systematically with latitude, and the induction of green leafy volatiles declined with latitude. Our results do not support the prevailing view that plant defense is greater at lower than at higher latitudes. That the pattern holds only for herbivore-induced VOC emission, and not constitutive emission, suggests that latitudinal variation in VOCs is not a simple adaptive response to climatic factors.

  8. Evidence for an invasive aphid "superclone": extremely low genetic diversity in Oleander aphid (Aphis nerii populations in the southern United States.

    Directory of Open Access Journals (Sweden)

    John Scott Harrison

    2011-03-01

    Full Text Available The importance of genetic diversity in successful biological invasions is unclear. In animals, but not necessarily plants, increased genetic diversity is generally associated with successful colonization and establishment of novel habitats. The Oleander aphid, Aphis nerii, though native to the Mediterranean region, is an invasive pest species throughout much of the world. Feeding primarily on Oleander (Nerium oleander and Milkweed (Asclepias spp. under natural conditions, these plants are unlikely to support aphid populations year round in the southern US. The objective of this study was to describe the genetic variation within and among US populations of A. nerii, during extinction/recolonization events, to better understand the population ecology of this invasive species.We used five microsatellite markers to assess genetic diversity over a two year period within and among three aphid populations separated by small (100 km and large (3,700 km geographic distances on two host plant species. Here we provide evidence for A. nerii "superclones". Genotypic variation was absent in all populations (i.e., each population consisted of a single multilocus genotype (MLG or "clone" and the genetic composition of only one population completely changed across years. There was no evidence of sexual reproduction or host races on different plant species.Aphis nerii is a well established invasive species despite having extremely low genetic diversity. As this aphid appears to be obligatorily asexual, it may share more similarities with clonally reproducing invasive plants, than with other animals. Patterns of temporal and geographic genetic variation, viewed in the context of its population dynamics, have important implications for the management of invasive pests and the evolutionary biology of asexual species.

  9. Establishing native warm season grasses on Eastern Kentucky strip mines

    Energy Technology Data Exchange (ETDEWEB)

    Barnes, T.G.; Larkin, J.L.; Arnett, M.B. [Univ. of Kentucky, Lexington, KY (United States). Dept. of Forestry

    1998-12-31

    The authors evaluated various methods of establishing native warm season grasses on two reclaimed Eastern Kentucky mines from 1994--1997. Most current reclamation practices incorporate the use of tall fescue (Festuca arundinacea) and other cool-season grasses/legumes that provide little wildlife habitats. The use of native warm season grasses will likely improve wildlife habitat on reclaimed strip mines. Objectives of this study were to compare the feasibility of establishing these grasses during fall, winter, or spring using a native rangeland seeder or hydroseeding; a fertilizer application at planting; or cold-moist stratification prior to hydroseeding. Vegetative cover, bare ground, species richness, and biomass samples were collected at the end of each growing season. Native warm season grass plantings had higher plant species richness compared to cool-season reclamation mixtures. There was no difference in establishment of native warm season grasses as a result of fertilization or seeding technique. Winter native warm season grass plantings were failures and cold-moist stratification did not increase plant establishment during any season. As a result of a drought during 1997, both cool-season and warm season plantings were failures. Cool-season reclamation mixtures had significantly more vegetative cover and biomass compared to native warm season grass mixtures and the native warm season grass plantings did not meet vegetative cover requirements for bond release. Forbs and legumes that established well included pale purple coneflower (Echinacea pallida), lance-leaf coreopsis (Coreopsis lanceolata), round-headed lespedeza (Lespedeza capitata), partridge pea (Cassia fasiculata), black-eyed susan (Rudbeckia hirta), butterfly milkweed (Asclepias tuberosa), and bergamot (Monarda fistulosa). Results from two demonstration plots next to research plots indicate it is possible to establish native warm season grasses on Eastern Kentucky strip mines for wildlife habitat.

  10. Establishing native warm season grasses on Eastern Kentucky strip mines

    International Nuclear Information System (INIS)

    Barnes, T.G.; Larkin, J.L.; Arnett, M.B.

    1998-01-01

    The authors evaluated various methods of establishing native warm season grasses on two reclaimed Eastern Kentucky mines from 1994--1997. Most current reclamation practices incorporate the use of tall fescue (Festuca arundinacea) and other cool-season grasses/legumes that provide little wildlife habitats. The use of native warm season grasses will likely improve wildlife habitat on reclaimed strip mines. Objectives of this study were to compare the feasibility of establishing these grasses during fall, winter, or spring using a native rangeland seeder or hydroseeding; a fertilizer application at planting; or cold-moist stratification prior to hydroseeding. Vegetative cover, bare ground, species richness, and biomass samples were collected at the end of each growing season. Native warm season grass plantings had higher plant species richness compared to cool-season reclamation mixtures. There was no difference in establishment of native warm season grasses as a result of fertilization or seeding technique. Winter native warm season grass plantings were failures and cold-moist stratification did not increase plant establishment during any season. As a result of a drought during 1997, both cool-season and warm season plantings were failures. Cool-season reclamation mixtures had significantly more vegetative cover and biomass compared to native warm season grass mixtures and the native warm season grass plantings did not meet vegetative cover requirements for bond release. Forbs and legumes that established well included pale purple coneflower (Echinacea pallida), lance-leaf coreopsis (Coreopsis lanceolata), round-headed lespedeza (Lespedeza capitata), partridge pea (Cassia fasiculata), black-eyed susan (Rudbeckia hirta), butterfly milkweed (Asclepias tuberosa), and bergamot (Monarda fistulosa). Results from two demonstration plots next to research plots indicate it is possible to establish native warm season grasses on Eastern Kentucky strip mines for wildlife habitat

  11. Rare earth elements (REEs): effects on germination and growth of selected crop and native plant species.

    Science.gov (United States)

    Thomas, Philippe J; Carpenter, David; Boutin, Céline; Allison, Jane E

    2014-02-01

    The phytotoxicity of rare earth elements (REEs) is still poorly understood. The exposure-response relationships of three native Canadian plant species (common milkweed, Asclepias syriaca L., showy ticktrefoil, Desmodium canadense (L.) DC. and switchgrass, Panicum virgatum L.) and two commonly used crop species (radish, Raphanus sativus L., and tomato, Solanum lycopersicum L.) to the REEs lanthanum (La), yttrium (Y) and cerium (Ce) were tested. In separate experiments, seven to eight doses of each element were added to the soil prior to sowing seeds. Effects of REE dose on germination were established through measures of total percent germination and speed of germination; effects on growth were established through determination of above ground biomass. Ce was also tested at two pH levels and plant tissue analysis was conducted on pooled samples. Effects on germination were mostly observed with Ce at low pH. However, effects on growth were more pronounced, with detectable inhibition concentrations causing 10% and 25% reductions in biomass for the two native forb species (A. syriaca and D. canadense) with all REEs and on all species tested with Ce in both soil pH treatments. Concentration of Ce in aboveground biomass was lower than root Ce content, and followed the dose-response trend. From values measured in natural soils around the world, our results continue to support the notion that REEs are of limited toxicity and not considered extremely hazardous to the environment. However, in areas where REE contamination is likely, the slow accumulation of these elements in the environment could become problematic. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.

  12. Asclepiasterol, a novel C21 steroidal glycoside derived from Asclepias curassavica, reverses tumor multidrug resistance by down-regulating P-glycoprotein expression.

    Science.gov (United States)

    Yuan, Wei-Qi; Zhang, Rong-Rong; Wang, Jun; Ma, Yan; Li, Wen-Xue; Jiang, Ren-Wang; Cai, Shao-Hui

    2016-05-24

    Multidrug resistance (MDR) mediated by P-glycoprotein (P-gp) is a major cause of cancer therapy failure. In this study, we identified a novel C21 steroidal glycoside, asclepiasterol, capable of reversing P-gp-mediated MDR. Asclepiasterol (2.5 and 5.0μM) enhanced the cytotoxity of P-gp substrate anticancer drugs in MCF-7/ADR and HepG-2/ADM cells. MDR cells were more responsive to paclitaxel in the presence of asclepiasterol, and colony formation of MDR cells was only reduced upon treatment with a combination of asclepiasterol and doxorubicin. Consistent with these findings, asclepiasterol treatment increased the intracellular accumulation of doxorubicin and rhodamine 123 (Rh123) in MDR cells. Asclepiasterol decreased expression of P-gp protein without stimulating or suppressing MDR1 mRNA levels. Asclepiasterol-mediated P-gp suppression caused inhibition of ERK1/2 phosphorylation in two MDR cell types, and EGF, an activator of the MAPK/ERK pathway, reversed the P-gp down-regulation, implicating the MAPK/ERK pathway in asclepiasterol-mediated P-gp down-regulation. These results suggest that asclepiasterol could be developed as a modulator for reversing P-gp-mediated MDR in P-gp-overexpressing cancer variants.

  13. Na+/K+-ATPase resistance and cardenolide sequestration: basal adaptations to host plant toxins in the milkweed bugs (Hemiptera: Lygaeidae: Lygaeinae).

    Science.gov (United States)

    Bramer, Christiane; Dobler, Susanne; Deckert, Jürgen; Stemmer, Michael; Petschenka, Georg

    2015-04-22

    Despite sequestration of toxins being a common coevolutionary response to plant defence in phytophagous insects, the macroevolution of the traits involved is largely unaddressed. Using a phylogenetic approach comprising species from four continents, we analysed the ability to sequester toxic cardenolides in the hemipteran subfamily Lygaeinae, which is widely associated with cardenolide-producing Apocynaceae. In addition, we analysed cardenolide resistance of their Na(+)/K(+)-ATPases, the molecular target of cardenolides. Our data indicate that cardenolide sequestration and cardenolide-resistant Na(+)/K(+)-ATPase are basal adaptations in the Lygaeinae. In two species that shifted to non-apocynaceous hosts, the ability to sequester was secondarily reduced, yet Na(+)/K(+)-ATPase resistance was maintained. We suggest that both traits evolved together and represent major coevolutionary adaptations responsible for the evolutionary success of lygaeine bugs. Moreover, specialization on cardenolides was not an evolutionary dead end, but enabled this insect lineage to host shift to cardenolide-producing plants from distantly related families. © 2015 The Author(s) Published by the Royal Society. All rights reserved.

  14. The nuclear receptor E75A has a novel pair-rule-like function in patterning the milkweed bug, Oncopeltus fasciatus.

    Science.gov (United States)

    Erezyilmaz, Deniz F; Kelstrup, Hans C; Riddiford, Lynn M

    2009-10-01

    Genetic studies of the fruit fly Drosophila have revealed a hierarchy of segmentation genes (maternal, gap, pair-rule and HOX) that subdivide the syncytial blastoderm into sequentially finer-scale coordinates. Within this hierarchy, the pair-rule genes translate gradients of information into periodic stripes of expression. How pair-rule genes function during the progressive mode of segmentation seen in short and intermediate-germ insects is an ongoing question. Here we report that the nuclear receptor Of'E75A is expressed with double segment periodicity in the head and thorax. In the abdomen, Of'E75A is expressed in a unique pattern during posterior elongation, and briefly resembles a sequence that is typical of pair-rule genes. Depletion of Of'E75A mRNA caused loss of a subset of odd-numbered parasegments, as well as parasegment 6. Because these parasegments straddle segment boundaries, we observe fusions between adjacent segments. Finally, expression of Of'E75A in the blastoderm requires even-skipped, which is a gap gene in Oncopeltus. These data show that the function of Of'E75A during embryogenesis shares many properties with canonical pair-rule genes in other insects. They further suggest that parasegment specification may occur through irregular and episodic pair-rule-like activity.

  15. Milkweed (Gentianales: Apocynaceae): A farmscape resource for increasing parasitism of stink bugs (Hemiptera: Pentatomidae) and providing nectar to insect pollinators and monarch butterflies

    Science.gov (United States)

    In peanut-cotton farmscapes in Georgia, stink bugs, i.e., Nezara viridula (L.), Euschistus servus (Say), and Chinavia hilaris (Say), develop in peanut and then disperse at the crop-to-crop interface to feed on fruit in cotton. The main objective of this study was to examine the influence of a habit...

  16. Assessment and prediction of the invasiveness of some alien plants in conditions of climate change in the steppe Dnieper region

    Directory of Open Access Journals (Sweden)

    Y. V. Lykholat

    2017-02-01

    Full Text Available The flora of the steppe Dnieper region is characterized by an abundance of naturalized alien species, some of which colonised over the last decade. Climate change, associated primarily with increasing temperature, became clearly manifested in this period. We tested the hypothesis that there is an association between climate change and the initiation of invasiveness of some alien plant species in the steppe Dnieper region. For this purpose, comparative studies of the distribution boundaries of naturalized alien trees, shrubs and herbaceous plants were conducted. Along the research route numerous 5–10-year-old broadleaf linden trees (Tilia platyphyllos Scop. were found in the man-made plantation communities of Dnipro city in areas with moist soil; seeded undergrowth was located at a significant distance from the adult linden plants. Numerous groups of young 7–10-year-old plants of the smoke trees (Cotinus coggygria Scop., which had a seed origin, were found in the shelterbelt and urban recreational plantations. Young 10–12-year-old virginal and generative plants of the black cherry (Padus serotina Ehrh. were found in large numbers in both the semi-natural and artificial plant communities at great distances from the adult trees. The alien plant species common hackberry (Celtis occidentalis L. showed the ability to form fairly sparse seminal seedlings, which was presented by the plants at the age of 4–7 years in both the natural and urban plant communities. The perennial herbaceous plant common milkweed (Asclepias syriaca L. was found in the course of the research in ruderal habitats, urban plant communities, and also in the agrocoenoses. The common milkweed reached its greatest abundance in fields of winter crops, where the spread of this species was accompanied by a sharp decrease in the number of other species of segetal plants. Our study results confirm that the extension of the distribution boundaries of alien species over the last

  17. Factors contributing to the recalcitrance of herbaceous dicotyledons (forbs) to enzymatic deconstruction.

    Science.gov (United States)

    Jabbour, Dina; Angelos, Evan R; Mukhopadhyay, Achira; Womboldt, Alec; Borrusch, Melissa S; Walton, Jonathan D

    2014-04-05

    Many different feedstocks are under consideration for the practical production of biofuels from lignocellulosic materials. The best choice under any particular combination of economic, agronomic, and environmental conditions depends on multiple factors. The use of old fields, restored prairie, or marginal lands to grow biofuel feedstocks offers several potential benefits including minimal agronomic inputs, reduced competition with food production, and high biodiversity. However, a major component of such landscapes is often herbaceous dicotyledonous plants, also known as forbs. The potential and obstacles of using forbs as biofuel feedstocks compared to the more frequently considered grasses and woody plants are poorly understood. The factors that contribute to the yield of fermentable sugars from four representative forbs were studied in comparison with corn stover. The forbs chosen for the study were lamb's quarters (Chenopodium album), goldenrod (Solidago canadensis), milkweed (Asclepias syriaca), and Queen Anne's lace (Daucus carota). These plants are taxonomically diverse, widely distributed in northern temperate regions including the continental United States, and are weedy but not invasive. All of the forbs had lower total glucose (Glc) content from all sources (cell walls, sucrose, starch, glucosides, and free Glc) compared to corn stover (range 16.2 to 23.0% on a dry weight basis compared to 39.2% for corn stover). When digested with commercial enzyme mixtures after alkaline pretreatment, yields of Glc as a percentage of total Glc were lower for the forbs compared to corn stover. Enzyme inhibition by water-extractable compounds was not a significant contributor to the lower yields. Based on experiments with optimized cocktails of pure glycosyl hydrolases, enzyme imbalance probably accounted for much of the lower yields. Addition of xyloglucanase and α-xylosidase, two enzymes targeting Glc-containing polysaccharides that are more abundant in dicotyledonous

  18. Investigation of radioisotopes in different organisms around Paks NPP

    International Nuclear Information System (INIS)

    Janovics, R.; Bihari, A.; Major, Z.; Palcsu, L.; Papp, L.; Veres, M.

    2010-01-01

    Complete text of publication follows. The Paks Nuclear Power Plant is a pressurised water reactor, therefore, it requires a large amount of cooling water. Cooling water is pumped from the Danube, and used water is also discharged back to the river through the warm-water channel. In the study Danube water and various aquatic organisms (a snail, Viviparus Acerosus, a mussel Unio Tumidus, a predatory fish Stizostedion lucioperca and a non-predatory fish Leuciscus idus) were collected upstream and downstream of the inlet of the channel. After freeze-drying both from the interstitial water and the dry matter of the aquatic organisms collected, tritium measurements were performed by the T- 3 He method to gain information about the ratio of the tritium concentration of the organically bound and the not-bound hydrogen, as well. The activity of the organically bound tritium reflects the mean activity of the environment of the organism, while the tritium activity of the interstitial water shows the actual activity of the aquatic environment. The activity of gamma emitters in the dry matter was also measured by gamma spectrometry. In case of the mussel and snail samples gamma spectrometry measurements were performed separately from the calciferous skeleton and the tissues. Besides the aquatic organisms, soil and plant samples (Scots Pine Pinus sylvestris, Common Milkweed Asclepias syriaca L., giant goldenrod Solidago gigantea) were collected in the vicinity of the nuclear power plant and in a background site, as well. These samples were analysed by gamma spectrometry and for tritium concentration, and the results were compared with a background site. On the basis of the gamma spectrometry results significant amount of artificial gamma emitter isotopes do not get to the Danube through the warm-water channel. Only 60 Co occurred in certain mussel, snail and sludge in a measurable activity concentration, however, it is not of power plant origin, as it was present even in the

  19. Dicty_cDB: Contig-U04816-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available one) Oryza sativa genomic DNA, chromos... 89 9e-17 FM877967_1( FM877967 |pid:none) Asclepias curassavic.... 86 1e-15 FM877966_1( FM877966 |pid:none) Asclepias curassavica partial mRNA...

  20. O Sistema Asclepias curassavica L., Epidendrum fulgens Brongn. e Lantana camara L. constitui um complexo mimético, com borboletas como operadores? um estudo no Parque Estadual de Itapeva, Torres, RS

    OpenAIRE

    Daniela Fuhro

    2006-01-01

    O mimetismo é uma adaptação onde duas ou mais espécies, que podem pertencer a grupos taxonômicos distintos, assemelham-se no padrão geral de cor e/ou forma e que devido a isso são confundidas por um outro organismo. Os tipos clássicos de mimetismo, Batesiano e Mülleriano, nem sempre se ajustam a estudos com flores; esta limitação, todavia, não afeta o chamado Sistema Tripartido. O Sistema Tripartido foi proposto originalmente por Wolfgang Wickler (1968) e aperfeiçoado por Richard I. Vane Righ...

  1. Archaeological Investigations in the Upper Tombigbee Valley, Mississippi: Phase I. Volume 4.

    Science.gov (United States)

    1983-01-01

    marshelder (sumpweed) (7va) maygrass (Phalaris carol iniana) maypop (Passi flora Incarnata) milkweed (Asclepiodora viridis ) neftles (Urt ica) Ohio...plum (Prunus) wild potato vine (Tpomoea pandurata) wild rice (Zizania aquatica) wild strawberries ( Fragaria ) DATE, FILMED 15, 8 3 DTIC

  2. Evolution of Plant Growth and Defense in a Continental Introduction

    NARCIS (Netherlands)

    Agrawal, A.A.; Hastings, A.P.; Bradburd, G.S.; Woods, E.C.; Züst, T.; Harvey, J.A.; Bukovinszky, T.

    2015-01-01

    Substantial research has addressed adaptation of nonnative biota to novel environments, yet surprisingly little work has integrated population genetic structure and the mechanisms underlying phenotypic differentiation in ecologically important traits. We report on studies of the common milkweed

  3. Evolution of plant growth and defense in a continental introduction

    NARCIS (Netherlands)

    Agrawal, A.A.; Hastings, A.P.; Bradburd, G.S.; Woods, E.C.; Züst, T.; Harvey, J.A.; Bukovinszki, T.

    2015-01-01

    Substantial research has addressed adaptation of nonnative biota to novel environments, yet surprisingly little work has integrated population genetic structure and the mechanisms underlying phenotypic differentiation in ecologically important traits. We report on studies of the common milkweed

  4. 75 FR 54629 - Notice of Receipt of Several Pesticide Petitions Filed for Residues of Pesticide Chemicals in or...

    Science.gov (United States)

    2010-09-08

    ..., milkweed, mustard seed, oil radish, poppy seed, rapeseed, sesame, sweet rocket, calendula, castor oil plant..., stokes aster, sunflower, tallowwood, tea oil plant, and vernonia at 0.01 ppm; grain, cereal, group 15 at...

  5. Assessment of plant-derived hydrocarbons. Final report

    Energy Technology Data Exchange (ETDEWEB)

    McFadden, K.; Nelson, S.H.

    1981-09-30

    A number of hydrocarbon producing plants are evaluated as possible sources of rubber, liquid fuels, and industrial lubricants. The plants considered are Euphorbia lathyris or gopher plant, milkweeds, guayule, rabbit brush, jojoba, and meadow foam. (ACR)

  6. Food plant derived disease tolerance and resistance in a natural butterfly-plant-parasite interactions.

    Science.gov (United States)

    Sternberg, Eleanore D; Lefèvre, Thierry; Li, James; de Castillejo, Carlos Lopez Fernandez; Li, Hui; Hunter, Mark D; de Roode, Jacobus C

    2012-11-01

    Organisms can protect themselves against parasite-induced fitness costs through resistance or tolerance. Resistance includes mechanisms that prevent infection or limit parasite growth while tolerance alleviates the fitness costs from parasitism without limiting infection. Although tolerance and resistance affect host-parasite coevolution in fundamentally different ways, tolerance has often been ignored in animal-parasite systems. Where it has been studied, tolerance has been assumed to be a genetic mechanism, unaffected by the host environment. Here we studied the effects of host ecology on tolerance and resistance to infection by rearing monarch butterflies on 12 different species of milkweed food plants and infecting them with a naturally occurring protozoan parasite. Our results show that monarch butterflies experience different levels of tolerance to parasitism depending on the species of milkweed that they feed on, with some species providing over twofold greater tolerance than other milkweed species. Resistance was also affected by milkweed species, but there was no relationship between milkweed-conferred resistance and tolerance. Chemical analysis suggests that infected monarchs obtain highest fitness when reared on milkweeds with an intermediate concentration, diversity, and polarity of toxic secondary plant chemicals known as cardenolides. Our results demonstrate that environmental factors-such as interacting species in ecological food webs-are important drivers of disease tolerance. © 2012 The Author(s). Evolution© 2012 The Society for the Study of Evolution.

  7. Non-target effects of clothianidin on monarch butterflies

    Science.gov (United States)

    Pecenka, Jacob R.; Lundgren, Jonathan G.

    2015-04-01

    Monarch butterflies ( Danaus plexippus) frequently consume milkweed in and near agroecosystems and consequently may be exposed to pesticides like neonicotinoids. We conducted a dose response study to determine lethal and sublethal doses of clothianidin using a 36-h exposure scenario. We then quantified clothianidin levels found in milkweed leaves adjacent to maize fields. Toxicity assays revealed LC10, LC50, and LC90 values of 7.72, 15.63, and 30.70 ppb, respectively. Sublethal effects (larval size) were observed at 1 ppb. Contaminated milkweed plants had an average of 1.14 ± 0.10 ppb clothianidin, with a maximum of 4 ppb in a single plant. This research suggests that clothianidin could function as a stressor to monarch populations.

  8. Highly porous carbon from a natural cellulose fiber as high efficiency sorbent for lead in waste water.

    Science.gov (United States)

    Ilangovan, Manikandan; Guna, Vijaykumar; Olivera, Sharon; Ravi, Ashwini; Muralidhara, H B; Santosh, M S; Reddy, Narendra

    2017-12-01

    The persistence of hollow centre in the carbon obtained from milkweed floss provides exceptional sorption characteristics, not seen in common biomasses or their derivatives. A considerably high sorption of 320mg of lead per gram of milkweed carbon was achieved without any chemical modification to the biomass. In this research, we have carbonized milkweed floss and used the carbon as a sorbent for lead in waste water. A high surface area of 170m 2 g -1 and pore volume of 1.07cm 3 g -1 was seen in the carbon. Almost complete removal (>99% efficiency) of lead could be achieved within 5min when the concentration of lead in the solution was 100ppm, close to that prevailing in industrial waste water. SEM images showed that the carbon was hollow and confocal images confirmed that the sorbate could penetrate inside the hollow tube. Copyright © 2017 Elsevier Ltd. All rights reserved.

  9. Interpreting surveys to estimate the size of the monarch butterfly population: Pitfalls and prospects.

    Directory of Open Access Journals (Sweden)

    John M Pleasants

    Full Text Available To assess the change in the size of the eastern North American monarch butterfly summer population, studies have used long-term data sets of counts of adult butterflies or eggs per milkweed stem. Despite the observed decline in the monarch population as measured at overwintering sites in Mexico, these studies found no decline in summer counts in the Midwest, the core of the summer breeding range, leading to a suggestion that the cause of the monarch population decline is not the loss of Midwest agricultural milkweeds but increased mortality during the fall migration. Using these counts to estimate population size, however, does not account for the shift of monarch activity from agricultural fields to non-agricultural sites over the past 20 years, as a result of the loss of agricultural milkweeds due to the near-ubiquitous use of glyphosate herbicides. We present the counter-hypotheses that the proportion of the monarch population present in non-agricultural habitats, where counts are made, has increased and that counts reflect both population size and the proportion of the population observed. We use data on the historical change in the proportion of milkweeds, and thus monarch activity, in agricultural fields and non-agricultural habitats to show why using counts can produce misleading conclusions about population size. We then separate out the shifting proportion effect from the counts to estimate the population size and show that these corrected summer monarch counts show a decline over time and are correlated with the size of the overwintering population. In addition, we present evidence against the hypothesis of increased mortality during migration. The milkweed limitation hypothesis for monarch decline remains supported and conservation efforts focusing on adding milkweeds to the landscape in the summer breeding region have a sound scientific basis.

  10. EL TURISMO ALTERNATIVO COMO ESTRATEGIA DE CONSERVACIÓN DE LA RESERVA DE LA BIOSFERA DE LA MARIPOSA MONARCA (2008-2010)

    OpenAIRE

    Isidro Rogel Fajardo

    2011-01-01

    El planteamiento del problema se sitúa en el contexto internacional durante la ruta migratoria (Canadá, Estados Unidos, México) de la mariposa monarca que se alimenta principalmente de Asclepia syriaca. Un estudio realizado en el año 2000 sobre el aprovechamiento de hábitats agrícolas por la mariposa monarca sugirió que hasta el 70% de los individuos de esta especie que volaron a México se alimentaron de asclepias. Considerando el cambio en las prácticas de cultivos ocurridas a partir de ento...

  11. Crescimento e nutrição mineral de capim-camalote Growth and mineral nutrition of "camalote grass"

    Directory of Open Access Journals (Sweden)

    S. Bianco

    2004-09-01

    Full Text Available Rottboelia exaltata é considerada uma das 12 piores espécies daninhas que infestam a cultura da cana-de-açúcar, pois geralmente não permite o fechamento das entrelinhas da cana quando se encontra em densidades maiores que 10 plantas por m². Com o objetivo de estudar a produção de massa seca, a distribuição e o acúmulo de macronutrientes em plantas de capim-camalote, foi conduzido o presente trabalho em condições de casa de vegetação. As plantas foram cultivadas em vasos preenchidos com areia de rio lavada e peneirada, sendo irrigadas diariamente com solução nutritiva completa de Hoagland & Arnon a 50% da concentração original. A primeira avaliação foi realizada aos 21 dias após a emergência (DAE, e as seguintes, em intervalos de 14 dias. Foi determinada a biomassa seca das diferentes partes da planta. O material foi moído e analisado quanto aos teores de macronutrientes. Os resultados indicaram que a planta apresentou crescimento durante toda a fase experimental. O maior acúmulo ocorreu aos 133 DAE, quando a planta acumulou 87,18 gramas de massa seca. Aos 133 DAE, cerca de 34,60% da biomassa seca estava alocada nas raízes, 40,29% nos colmos + bainhas, 15,13% nas folhas e 8,35% nas inflorescências. O acúmulo total dos macronutrientes foi crescente ao longo do ciclo de desenvolvimento da planta. Até 77 DAE, uma planta de capim-camalote acumula 7,14 gramas de massa seca; 132,2 mg de K; 81,5 mg de N; 32,3 mg de Ca; 18,8 mg de P; 18,6 mg de Mg; e 10,1 mg de S.Rottboelia exaltata is considered one of the twelve worst weeds infesting sugarcane, because, in general, it does not allow suitable crop growth between sugarcane rows at weed density above 10/m². Dry matter production, distribution and macro-nutrient accumulation in R. exaltata were studied under greenhouse conditions. The plants were grown in pots filled with washed and sieved river sand, irrigated daily with Hoagland & Arnon complete nutrient solution at 50% of

  12. Capacities of Candidate Herbaceous Plants for Phytoremediation of Soil-based TNT and RDX on Ranges

    Science.gov (United States)

    2008-09-01

    installations and distribution of Sida spinosa...Lehi, UT • Forb seeds from three vendors as follows: redroot pigweed (Amaran- thus retroflexus), morning glory (Ipomoea lacunosa), and prickly sida ... Sida spinosa) from Azlin Seed Service, Leland, MS; common milk- weed (Asclepias syriaca) from Prairiemoon Nursery, Winona, WI; common purslane

  13. Monitoring update on four listed plants on the Arizona Strip

    Science.gov (United States)

    Lee E. Hughes

    2001-01-01

    Four listed plants on the Arizona Strip are being monitored for various population characteristics. Pediocactus sileri Engelm. L. Benson and P. bradyi L. Benson have been monitored since 1985-86, Asclepias welshii N & P Holmgren since 1989, and Cycladenia humilis Benth. var. jonesii Welsh & Atwood since 1993. The two pediocactus species were monitored in plots...

  14. Arabidopsis CDS blastp result: AK241294 [KOME

    Lifescience Database Archive (English)

    Full Text Available , putative / stearoyl-ACP desaturase, putative similar to Acyl-[acyl-carrier protein] desaturase from Lupinus luteus GI:4704824, Ascl...epias syriaca GI:1762436, Ricinus communis SP|P22337; contains Pfam profile PF03405 Fatty acid desaturase 1e-97 ...

  15. Untitled

    Indian Academy of Sciences (India)

    Syriaca and Crété (1950) Linum variation of Solanad type of embryo develop- ment in Asclepias curassavica. Rao and Rao (1954) published an account of male and female gametophytes, endosperm and embryo development in. Cryptostegia grandiflora and Caralluma attenuata. Biswas (1957) studied the embryology of ...

  16. First report of Idiopterus nephrelepidis Davis, 1909 (Hemiptera: Aphididae from Bulgaria

    Directory of Open Access Journals (Sweden)

    Elena Tasheva-Terzieva

    2011-11-01

    Full Text Available Idiopterus nephrelepidis (Hemiptera: Aphididae is reported for the first time in Bulgaria on ornamental ferns in four greenhouses in Sofia and Varna. Dense colonies of apterous viviparous females and larvae were observed. The established host plants are Nephrolepis exaltata, Asplenium nidus and Pteris cretica. Infested ferns exhibit leaf deformation. The aphids were reared in laboratory conditions for four months. A morphometric study of apterae was carried out. Taking into account the presence of host plants of I. nephrelepidis in Bulgaria which are native to the local flora and the reports of the aphid from the Balkan area, it may spread in the country outdoors.

  17. Abilities of some higher plants to hydrolyze the acetates of phenols and aromatic-aliphatic alcohols

    Directory of Open Access Journals (Sweden)

    Agnieszka Mironowicz

    2014-01-01

    Full Text Available In the biotransformations carried out under the same conditions, the whole intact plants of Spirodela punctata, Nephrolepis exaltata, Cyrtomium falcatum, Nephrolepis cordifolia and the suspension cultures of Helianthus tuberosus, Daucus carota and Petunia hybrida hydrolyze (partially or totally the ester bonds of the acetates of phenols and aromatic-aliphatic alcohols and also the menthyl acetate. Nevertheless, the methyl esters of aromatic acids, structurally similar to the former substrates, do not undergo hydrolysis. At the same time, the viability of first four plants was observed for different levels of acetate concentration. The method of continuous preparative hydrolysis of the same acetates was worked out in Cyrtomium falcatum culture.

  18. Insects in the Classroom: A Study of Animal Behavior

    Science.gov (United States)

    Miller, Jon S.

    2004-01-01

    These activities allow students to investigate behavioral responses of the large Milkweed bug, "Oncopeltus fasciatus," and the mealworm, "Tenebrio molitor" or "Tenebrio obscurus," to external stimuli of light, color, and temperature. During the activities, students formulate hypotheses to research questions presented. They also observe insects for…

  19. Author Details

    African Journals Online (AJOL)

    Elbanna, SM. Vol 11 (2009) - Articles Patterns of resource use by milkweed insects in Sinai Abstract PDF. ISSN: 1110-6859. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for Librarians · for Authors · FAQ's · More about AJOL · AJOL's Partners · Terms and Conditions of Use · Contact AJOL · News.

  20. Author Details

    African Journals Online (AJOL)

    ... Spilostethus pandurus in the wadis of the St Katherine Protectorate, South Sinai Abstract · Vol 10 (2008) - Articles Ecological studies of some insects associated with Bedouin settlements in St Katherine Protectorate, South Sinai, Egypt. Abstract · Vol 11 (2009) - Articles Patterns of resource use by milkweed insects in Sinai

  1. Author Details

    African Journals Online (AJOL)

    Histomorphometric and histopathological studies on the effect of Calotropis procera(Giant milkweed)on the male reproductive organs of wistar rats. Abstract PDF · Vol 5, No 3 (2002) - Articles Haematological changes accompanying prolonged ocula chloramphenicol administration in laboratory rabbits. Abstract PDF.

  2. African Journal of Biomedical Research - Vol 5, No 1-2 (2002)

    African Journals Online (AJOL)

    Histomorphometric and histopathological studies on the effect of Calotropis procera(Giant milkweed)on the male reproductive organs of wistar rats · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. AK Akinloye, MO Abatan, OO Alaka, BO Oke ...

  3. Demo biomassagewassen binnen project Energieboerderij

    NARCIS (Netherlands)

    Mheen, van der H.J.C.J.

    2011-01-01

    Door de Stuurgroep Energieboerderij werd op 16 maart 2011 de in een velddemo te beproeven gewassen vastgesteld. Gekozen werd voor de navolgende acht gewassen: Landschapsmais, Mariadistel, Tagetes minuta, Tagetes patula, Milkweed, Switchgrass, Reed Canary Grass (RCG) en Witte Krodde. Met uitzondering

  4. Download this PDF file

    African Journals Online (AJOL)

    DR. AMINU

    2013-12-02

    Dec 2, 2013 ... fruit, desert wick plant milkweed Swallow- worth,“Tumfafiya” and Apple of Sodom (Ahmad and. Beg, 1993; Trulat, 1997). It is a shrub or small tree reaching 2.5-6m in height, stems usually simple rarely branch woody at base and covered with a tissue corky bark. All part of the plant produces white latex when.

  5. Representing "The Great Devouring:" Romani Characters in Young Adult Holocaust Literature

    Science.gov (United States)

    Dean-Ruzicka, Rachel

    2014-01-01

    This article discusses the representation of Roma-Sinti ("gypsy") characters in young adult literature about the Holocaust. It analyzes three primary texts: Jerry Spinelli's "Milkweed" (2003), Erich Hackl's "Farewell Sidonia" (1991), and Alexander Ramati's "And the Violins Stopped Playing"…

  6. Realistic Bomber Training Initiative. Environmental Impact Statement. Volume 1

    Science.gov (United States)

    2000-01-01

    arizonica Bitterweed Hymenoxys odorata Black grama Bouteloua eriopoda Broadleaf milkweed Ascelpias latifolia Broomweed Amphiachyris spp. and...Larrea tridentata Douglas fir Pseudotsuga menziesii Fragrant ash Fraxinus cuspidata Galleta grass Hilaria jamesii Gambel (=shin) oak Quercus gambelii...Guajillo Acacia berlandieri Juniper Juniperus spp. Little bluestem Schizachyrium scoparium Live oak Quercus turbinella Mesquite Prosopis spp. Mexican

  7. 76 FR 9991 - Endangered and Threatened Wildlife and Plants; 12-Month Finding on a Petition To List Thorne's...

    Science.gov (United States)

    2011-02-23

    ... Thorne's hairstreak butterflies are known to feed on the nectar of Eriogonum fasciculatum (California... (narrowleaf milkweed) is also used as an adult nectar source throughout the subspecies' range (Lucas 2009... plant species as nectar sources, and frequency of use is primarily dependent on availability. Thorne's...

  8. Fuel characteristics and pyrolysis studies of solvent extractables and residues from the evergreen shrub Calotropis procera

    Energy Technology Data Exchange (ETDEWEB)

    Erdman, M.D.; Gregorski, K.S.; Pavlath, A.E.

    1984-01-01

    Solvent extractables and residues from milkweed were evaluated as sources of liquid and solid fuels. Selected chemical, physical and pyrolytic determinations of the extractables and residues indicated that hexane extract is a potentially valuable, high density fuel resource. Methanol extract was shown to be a lower energy, highly toxic extract. Extracted residues were demonstrated to be valuable as solid fuel energy resources. 31 references.

  9. 76 FR 16413 - Pesticide Products; Registration Applications

    Science.gov (United States)

    2011-03-23

    ..., lunaria, meadowfoam, milkweed, mustard seed, oil radish, poppy seed, rapeseed (canola), sesame, and sweet... treatment on alfalfa, potato, and rice; seed treatment on alfalfa, barley, dry bean and peas (crop subgroup 6C), potato, rice, soybeans, triticale, and wheat; and nursery seed and seedlings of conifers and...

  10. 77 FR 66832 - Notice of Receipt of Pesticide Products; Registration Applications To Register New Uses

    Science.gov (United States)

    2012-11-07

    ... subgroup 4B; peppermint and spearmint (tops and oil); berry subgroups 13-07 A, B, and G; taro (corm and...: Herbicide. Proposed Uses: Oilseed crop, group 20 (borage, calendula, camelina, Chinese tallowtree, cuphea..., milkweed, mustard seed, Niger seed, oil radish, poppy seed, rose hip, sesame, Stokes aster, sweet rocket...

  11. Trans-generational parasite protection associated with paternal diet.

    Science.gov (United States)

    Sternberg, Eleanore D; de Roode, Jacobus C; Hunter, Mark D

    2015-01-01

    Multiple generations of hosts are often exposed to the same pathogens, favouring the evolution of trans-generational defences. Because females have more opportunities to transfer protective molecules to offspring, many studies have focused on maternally derived protection. However, males of many species can transfer compounds along with sperm, including chemicals that could provide protection. Here, we assess maternally and paternally derived protection in a monarch butterfly-protozoan parasite system where parasite resistance is heavily influenced by secondary plant chemicals, known as cardenolides, present in the larval diet of milkweed plants. We reared monarch butterflies on medicinal and non-medicinal milkweed species and then measured resistance of their offspring to infection. We also measured cardenolide content in adult monarchs reared on the two species, and in the eggs that they produced. We found that offspring were more resistant to infection when their fathers were reared on medicinal milkweed, while maternal diet had less of an effect. We also found that eggs contained the highest levels of cardenolides when both parents were reared on the medicinal species. Moreover, females reared on non-medicinal milkweed produced eggs with significantly higher levels of cardenolides if they mated with males reared on the medicinal milkweed species. However, we found an equivocal relationship between the cardenolides present in eggs and parasite resistance in the offspring. Our results demonstrate that males reared on medicinal plants can transfer protection to their offspring, but the exact mechanism remains unresolved. This suggests that paternal protection from parasitism might be important, particularly when there are environmental sources of parasite resistance and when males transfer spermatophores during mating. © 2014 The Authors. Journal of Animal Ecology © 2014 British Ecological Society.

  12. Comparative epidermal anatomical studies in six taxa of genus Nephrolepis Swart in Nigeria

    Directory of Open Access Journals (Sweden)

    A. A. Fajuke

    2018-04-01

    Full Text Available Anatomical studies in six taxa of genus Nephrolepis; N. biserrata, N. cordifolia, N. exaltata (i & (ii, N. biserrata var. furcans and N. undulata were carried out with a view to identify anatomic characters of taxonomic values. Both qualitative and quantitative anatomical studies were carried out. Quantitative data were subjected to descriptive statistical analysis. Anatomical characters studied include venation patterns, trichome types, presence and absence of stomata and values of the stomatal index which are valuable in delimiting the species. The overall results showed overlaps in the quantitative anatomical attributes of the Nephrolepis taxa studied suggesting that they belong to the same genus. Qualitative anatomical attributes that separated the genus into distinct taxa are the presence of simple multicellular glandular trichomes in N. biserrata and simple multicellular non-glandular trichomes in N. exaltata (i and N. exalta (ii while N. biserrata var. furcans and N. undulata have simple unicellular non-glandular trichomes and absence of trichome in N. cordifolia. Presence of anisocytic, diacytic or anomocytic stomata were of diagnostic important in the six taxa.

  13. Biological and molecular characterization of a putative new sobemovirus infecting Imperata cylindrica and maize in Africa.

    Science.gov (United States)

    Sérémé, Drissa; Lacombe, Séverine; Konaté, Moumouni; Pinel-Galzi, Agnès; Traoré, Valentin Stanislas Edgar; Hébrard, Eugénie; Traoré, Oumar; Brugidou, Christophe; Fargette, Denis; Konaté, Gnissa

    2008-01-01

    A new virus was isolated from both the grass Imperata cylindrica and maize plants that had yellow mottle symptoms in Burkina Faso, West Africa. The virus has isometric particles ca. 32 nm in diameter. The experimental host range was restricted to Rottboellia exaltata. Virions were isolated from leaves of systemically infected maize plants. Koch's postulates were completed by mechanically inoculating uninfected Imperata or maize with either purified virus or sap from infected Imperata plants. Virion preparations were used to produce a specific polyclonal antiserum, and an enzyme-linked immunosorbent assay test was set up. The full genome of the virus was sequenced, and it comprised 4,547 nucleotides. Phylogenetic studies indicated that the virus is closely related to rice yellow mottle virus, a sobemovirus that infects monocotyledons in Africa, and is more distantly related to cocksfoot mottle virus, another sobemovirus that infects monocotyledons. Although the virus can infect R. exaltata experimentally, it differs from Rottboellia yellow mottle virus, a member of a tentative species of the genus Sobemovirus that also infects monocotyledons in Africa. Particle morphology, serological properties, genomic organization, and phylogenetic analysis are all consistent with assignment of the new virus to the genus Sobemovirus. The name Imperata yellow mottle virus is proposed.

  14. Fire creates host plant patches for monarch butterflies

    Science.gov (United States)

    Baum, Kristen A.; Sharber, Wyatt V.

    2012-01-01

    Monarch butterflies (Danaus plexippus) depend on the presence of host plants (Asclepias spp.) within their breeding range for reproduction. In the southern Great Plains, Asclepias viridis is a perennial that flowers in May and June, and starts to senesce by August. It is locally abundant and readily used by monarchs as a host plant. We evaluated the effects of summer prescribed fire on A. viridis and the use of A. viridis by monarch butterflies. Summer prescribed fire generated a newly emergent population of A. viridis that was absent in other areas. Pre-migrant monarch butterflies laid eggs on A. viridis in summer burned plots in late August and September, allowing adequate time for a new generation of adult monarchs to emerge and migrate south to their overwintering grounds. Thus, summer prescribed fire may provide host plant patches and/or corridors for pre-migrant monarchs during a time when host plant availability may be limited in other areas. PMID:22859559

  15. Aspidonepsis (Asclepiadaceae, a new southern African genus

    Directory of Open Access Journals (Sweden)

    A. Nicholas

    1992-10-01

    Full Text Available Aspidonepsis, an endemic southern African genus, is described and compared to the closely allied genus Aspidoglossum. This newly described genus is composed of two subgenera, Aspidonepsis and Unguilobium. consisting of three and two species respectively.  Asclepias diploglossa, A. flava, A. cognata and A. reneensis are transferred to Aspidonepsis. and A. shebae is newly described. All species are discussed, illustrated and a key is given to aid in their identification.

  16. The chemistry of antipredator defense by secondary compounds in neotropical lepidoptera: facts, perspectives and caveats

    OpenAIRE

    Trigo, José R.

    2000-01-01

    Chemical defense against predation in butterflies and moths has been studied since nineteenth century. A classical example is that of the larvae of the monarch butterfly Danaus plexippus, which feed on leaves of Asclepias curassavica (Asclepiadaceae), sequestering cardenolides. The adults are protected against predation by birds. Several other substances may be involved in chemical defense, such as iridoid glycosides, cyanogenic glycosides, glucosinolates, pyrrolizidine and tropane alkaloids,...

  17. Determination of calorific values of some renewable biofuels

    Energy Technology Data Exchange (ETDEWEB)

    Kumar, Jothi V.; Pratt, Benjamin C. [Department of Chemistry, North Carolina A and T State University, Greensboro, North Carolina (United States)

    1996-06-01

    Thermal methods such as differential scanning calorimetry (DSC), and elemental analysis (EA) were employed to determine the calorific values of some renewable biofuels either directly or indirectly. The biofuels tested were the common milkweed, dogbane, kudzu, and eucalyptus tree. The purpose of this work was to optimize the experimental conditions for DSC analysis of biofuels, improve the calorific values by adding metal oxides as catalysts, and compare the heat values between DSC and EA analyses

  18. An insight into the sialotranscriptome of the seed-feeding bug, Oncopeltus fasciatus

    OpenAIRE

    Francischetti, Ivo M.B.; Lopes, Angela H.; Dias, Felipe A.; Pham, Van M.; Ribeiro, José M.C.

    2007-01-01

    The salivary transcriptome of the seed-feeding hemipteran, Oncopeltus fasciatus (milkweed bug), is described following assembly of 1,025 ESTs into 305 clusters of related sequences. Inspection of these sequences reveals abundance of low complexity, putative secreted products rich in the amino acids (aa) glycine, serine or threonine, which might function as silk or mucins and assist food canal lubrication and sealing of the feeding site around the mouthparts. Several protease inhibitors were f...

  19. Phyto-toxicity and Phyto-remediation Potential of Mercury in Indian Mustard and Two Ferns with Mercury Contaminated Water and Oak Ridge Soil

    International Nuclear Information System (INIS)

    Su, Y.; Han, F.X.; Chen, J.; Shiyab, S.; Monts, D.L.; Monts, D.L.

    2009-01-01

    Phyto-remediation is an emerging technology that uses various plants to degrade, extract, contain, or immobilize contaminants from soil and water. Certain fern and Indian mustard species have been suggested as candidates for phyto-remediation of heavy metal-contaminated soil and water because of their high efficiency of accumulating metals in shoots and their high biomass production. Currently, no known hyper-accumulator plants for mercury have been found. Here we report the Hg uptake and phyto-toxicity by two varieties of fern and Indian mustard. Their potential for Hg phyto-remediation application was also investigated. Anatomical, histochemical and biochemical approaches were used to study mercury phyto-toxicity as well as anti-oxidative responses in ferns [Chinese brake fern (P. vittata) and Boston fern (N. exaltata)] and Indian mustard (Florida broadleaf and longstanding) (Brassica juncea L.) grown in a hydroponic system. Phyto-remediation potentials of these plant species were estimated based on their Hg uptake performance with contaminated soils from Oak Ridge (TN, USA). Our results show that mercury exposure led to severe phyto-toxicity accompanied by lipid peroxidation and rapid accumulation of hydrogen peroxide (H 2 O 2 ) in P. vittata, but not in N. exaltata. The two cultivars of fern responded differently to mercury exposure in terms of anti-oxidative enzymes (superoxide dismutase, SOD; catalase, CAT; peroxidase, POD; glutathione reductase, GR). Mercury exposure resulted in the accumulation of ascorbic acid (ASA) and glutathione (GSH) in the shoots of both cultivars of fern. On the other hand, Indian mustard effectively generated an enzymatic antioxidant defense system (especially CAT) to scavenge H 2 O 2 , resulting in lower H 2 O 2 in shoots with higher mercury concentrations. These two cultivars of Indian mustard demonstrated an efficient metabolic defense and adaptation system to mercury-induced oxidative stress. In both varieties of fern and Indian

  20. Temperature-Dependent Species Interactions Shape Priority Effects and the Persistence of Unequal Competitors.

    Science.gov (United States)

    Grainger, Tess Nahanni; Rego, Adam Ivan; Gilbert, Benjamin

    2018-02-01

    The order of species arrival at a site can determine the outcome of competitive interactions when early arrivers alter the environment or deplete shared resources. These priority effects are predicted to be stronger at high temperatures, as higher vital rates caused by warming allow early arrivers to more rapidly impact a shared environment. We tested this prediction using a pair of congeneric aphid species that specialize on milkweed plants. We manipulated temperature and arrival order of the two aphid species and measured aphid population dynamics and milkweed survival and defensive traits. We found that warming increased the impact of aphids on the quantity and quality of milkweed, which amplified the importance of priority effects by increasing the competitive exclusion of the inferior competitor when it arrived late. Warming also enhanced interspecific differences in dispersal, which could alter relative arrival times at a regional scale. Our experiment provides a first link between temperature-dependent trophic interactions, priority effects, and dispersal. This study suggests that the indirect and cascading effects of temperature observed here may be important determinants of diversity in the temporally and spatially complex landscapes that characterize ecological communities.

  1. An insect countermeasure impacts plant physiology: midrib vein cutting, defoliation and leaf photosynthesis.

    Science.gov (United States)

    Delaney, Kevin J; Higley, Leon G

    2006-07-01

    One type of specialised herbivory receiving little study even though its importance has frequently been mentioned is vein cutting. We examined how injury to a leaf's midrib vein impairs gas exchange, whether impairment occurs downstream or upstream from injury, duration of impairment, compared the severity of midrib injury with non-midrib defoliation, and modelled how these two leaf injuries affect whole-leaf photosynthesis. Leaf gas exchange response to midrib injury was measured in five Asclepiadaceae (milkweed), one Apocynaceae (dogbane), one Polygonaceae and one Fabaceae species, which have been observed or reported to have midrib vein cutting injury in their habitats. Midrib vein injury impaired several leaf gas exchange parameters, but only downstream (distal) from the injury location. The degree of gas exchange impairment from midrib injury was usually more severe than from manually imposed and actual insect defoliation (non-midrib), where partial recovery occurred after 28 d in one milkweed species. Non-midrib tissue defoliation reduced whole-leaf photosynthetic activity mostly by removing photosynthetically active tissue, while midrib injury was most severe as the injury location came closer to the petiole. Midrib vein cutting has been suggested to have evolved as a countermeasure to deactivate induced leaf latex or cardenolide defences of milkweeds and dogbanes, yet vein cutting effects on leaf physiology seem more severe than the non-midrib defoliation the defences evolved to deter.

  2. Ecosystem-Based Incorporation of Nectar-Producing Plants for Stink Bug Parasitoids

    Directory of Open Access Journals (Sweden)

    Glynn Tillman

    2017-06-01

    Full Text Available Adult parasitoids of pest insects rely on floral resources for survival and reproduction, but can be food-deprived in intensively managed agricultural systems lacking these resources. Stink bugs are serious pests for crops in southwest Georgia. Provisioning nectar-producing plants for parasitoids of stink bugs potentially can enhance biocontrol of these pests. Knowledge of spatial and temporal availability and distribution of stink bugs in host plants is necessary for appropriate timing and placement of flowering plants in agroecosystems. Stink bugs move between closely associated host plants throughout the growing season in response to deteriorating suitability of their host plants. In peanut-cotton farmscapes, stink bugs develop in peanut, and subsequently the adults disperse into adjacent cotton. Parasitism of Nezara viridula (L. adults by Trichopoda pennipes (F. at the peanut-cotton interface was significantly higher in cotton with a strip of milkweed or buckwheat between the two crops than in cotton alone. Milkweed and buckwheat also provided nectar to a wide range of insect pollinators. Monarch butterflies fed on milkweed. When placed between peanut and cotton, a strip of soybean was an effective trap crop for cotton, reducing economic damage. Incorporation of buckwheat near soybean enhanced parasitism of Euschistus servus (Say eggs by Telenomus podisi Ashmead in cotton. In conclusion, nectar provision enhances biocontrol of stink bugs, acts together with other management tactics for stink bug control, and aids in conservation of natural enemies, insect pollinators, and the monarch butterfly.

  3. АГРОЭКОЛОГИЧЕСКАЯ ОЦЕНКА ЭФФЕКТИВНОСТИ СИСТЕМ ОБРАБОТКИ ПОЧВЫ КАК МЕТОДА КОНТРОЛЯ ВАТОЧНИКА СИРИЙСКОГО (ASCLEPIAS SYRIACA L.

    Directory of Open Access Journals (Sweden)

    O. S. Papka

    2015-12-01

    Full Text Available В работе на основе экспериментальных данных с помощью иерархических процедур статистического анализа установлены оптимальные режимы механического возделывания почвы как агротехнического приема контроля численности сообщества сорняков в целом и ваточника сирийского. Одноразовое механическое уничтожение сорняков путем вспашки или дискования приводит к увеличению общей засоренности необрабатываемых земель на 22,30 % (пахота и 26,65 % (дискование. Культивация, которая проводилась после пахоты, приводила к снижению на 37,42 % общей численности сорняков, а культивация после дискования – к снижению численности сорняков на 44,58 %. Проведение второй культивации после пахоты обеспечивало гибель 70,1 % сорняков в сравнении с контролем и 52,2 % в сравнении с первой культивацией. Проведение вспашки после дискования и культивации приводит к снижению общего количества сорняков на 73,69 % в сравнении с контролем и на 52,52 % по сравнению с последовательным дискованием и культивацией. Одноразовое возделывание существенно не влияет на количество ваточника сирийского в сообществе сорняков. Культивация после пахоты снижает долю ваточника сирийского на 19,20 %, а после дискования – на 13,03 %. Третье возделывание почвы не оказывает воздействия на селективное уничтожение ваточника сирийского.

  4. Alelopatía en Saccharum spp. (caña de azúcar

    Directory of Open Access Journals (Sweden)

    R. A. Arévalo

    2011-01-01

    6 Aminoácidos no proteicos, 7 Lactonas no saturadas, 8 ácidos orgánicos, alcoholes alifáticos, aldehídos y cetonas, 9 ácidos grasos, naftoquinonas, antraquinonas, y complejos de quinonas, 10 Coumarina. Los mecanismos de acción en la mayoría de los aleloquímicos son aún desconocidos. Las plantas arvenses, como Cypro-Cyperus rotundus L.; Rooex-Rottboellia exaltata L. f. causan alelopatía en caña de azúcar. Las plantas de Cucsa- Cucumis sativus L. son afectadas por efectos alelopáticos de plantas de Rooex. Las coberturas utilizadas en la agricultura sostenible tienen propiedades alelopáticas. Las respuestas de las plantas cultivadas a los aleloquímicos pueden ser susceptibles, tolerantes o resistentes. La alelopatía tiene gran potencial para el manejo de plagas en la agricultura.

  5. Spectroscopic Analysis of Arsenic Uptake in Pteris Ferns

    Directory of Open Access Journals (Sweden)

    Terrence Slonecker

    2009-09-01

    Full Text Available Two arsenic-accumulating Pteris ferns (Pteris cretica mayii and Pteris multifida, along with a non-accumulating control fern (Nephrolepis exaltata were grown in greenhouse conditions in clean sand spiked with 0, 20, 50, 100 and 200 ppm sodium arsenate. Spectral data were collected for each of five replicates prior to harvest at 4-week intervals. Fern samples were analyzed for total metals content and Partial Least Squares and Stepwise Linear Regression techniques were used to develop models from the spectral data. Results showed that Pteris cretica mayii and Pteris multifida are confirmed hyperaccumulators of inorganic arsenic and that reasonably accurate predictive models of arsenic concentration can be developed from the first derivative of spectral reflectance of the hyperaccumulating Pteris ferns. Both the arsenic uptake and spectral results indicate that there is some species-specific variability but the results compare favorably with previously published data and additional research is recommended.

  6. In Vitro Conservation of Some Threatened and Economically Important Ferns Belonging to the Indian Subcontinent

    Directory of Open Access Journals (Sweden)

    Shastri P. Shukla

    2014-01-01

    Full Text Available This study was undertaken to identify methods of mass multiplication for five ornamental, economically important ferns (Nephrolepis biserrata (Sw. Schott., N. cordifolia cv. ‘‘duffii’’ (L. Presl., N. exaltata cv. bostoniensis (L. Schott., Pteris vittata L., and Cyclosorus dentatus Link., and three threatened ferns, namely, Cyathea spinulosa Wall. ex. Hook, Pityrogramma calomelanos (L. Link., and Microsorum punctatum (L. Schott., through in vitro techniques. Collections were made from different biodiversity zones of India including Northeast Himalayas, Kumaon Himalayas, and Western Ghat and successfully introduced and grown in a fern-house. Aseptic cultures were raised at the morphogenic level of callus, axillary shoot, multiple shoot, and rooted plants. An optimized medium is described for each fern species. Plantlets were also produced from spore culture of Cyathea spinulosa and successfully hardened under fern house conditions.

  7. Phylogenetic signal detection from an ancient rapid radiation: Effects of noise reduction, long-branch attraction, and model selection in crown clade Apocynaceae.

    Science.gov (United States)

    Straub, Shannon C K; Moore, Michael J; Soltis, Pamela S; Soltis, Douglas E; Liston, Aaron; Livshultz, Tatyana

    2014-11-01

    Crown clade Apocynaceae comprise seven primary lineages of lianas, shrubs, and herbs with a diversity of pollen aggregation morphologies including monads, tetrads, and pollinia, making them an ideal group for investigating the evolution and function of pollen packaging. Traditional molecular systematic approaches utilizing small amounts of sequence data have failed to resolve relationships along the spine of the crown clade, a likely ancient rapid radiation. The previous best estimate of the phylogeny was a five-way polytomy, leaving ambiguous the homology of aggregated pollen in two major lineages, the Periplocoideae, which possess pollen tetrads, and the milkweeds (Secamonoideae plus Asclepiadoideae), which possess pollinia. To assess whether greatly increased character sampling would resolve these relationships, a plastome sequence data matrix was assembled for 13 taxa of Apocynaceae, including nine newly generated complete plastomes, one partial new plastome, and three previously reported plastomes, collectively representing all primary crown clade lineages and outgroups. The effects of phylogenetic noise, long-branch attraction, and model selection (linked versus unlinked branch lengths among data partitions) were evaluated in a hypothesis-testing framework based on Shimodaira-Hasegawa tests. Discrimination among alternative crown clade resolutions was affected by all three factors. Exclusion of the noisiest alignment positions and topologies influenced by long-branch attraction resulted in a trichotomy along the spine of the crown clade consisting of Rhabdadenia+the Asian clade, Baisseeae+milkweeds, and Periplocoideae+the New World clade. Parsimony reconstruction on all optimal topologies after noise exclusion unambiguously supports parallel evolution of aggregated pollen in Periplocoideae (tetrads) and milkweeds (pollinia). Our phylogenomic approach has greatly advanced the resolution of one of the most perplexing radiations in Apocynaceae, providing the

  8. “Semillas Ambientales” en el Instituto Pedagógico Arturo Ramírez Montúfar (IPARM de la Universidad Nacional de Colombia – Sede Bogotá.

    Directory of Open Access Journals (Sweden)

    Nubia Torres Guerra

    2009-09-01

    Full Text Available Se promueven actitudes en los aspectos cognitivos, afectivos y comportamentales hacia la conservación de los hábitats en los cuales se desarrollan los insectos, a partir del estudio de la Mariposa Monarca (Danaus plexippus y su planta nutricia la Asclepia curassavica, los estudiantes adoptan la especie, la localizan en su nicho, registran su ciclo de vida y dan cuenta de las particularidades de este grupo de organismos así como las dinámicas de estos al interior de un ecosistema.

  9. 40 CFR 180.412 - Sethoxydim; tolerances for residues.

    Science.gov (United States)

    2010-07-01

    ... mustard, seed 35.0 Hog, fat 0.2 Hog, meat 0.2 Hog, meat byproducts 1.0 Horse, fat 0.2 Horse, meat 0.2... Meadowfoam, seed 35.0 Milk 0.5 Milkweed, seed 35.0 Mustard, seed 35.0 Nectarine 0.2 Nut, tree, group 14 0.2..., sugar, molasses 10 Beet, sugar, tops 3.0 Blueberry 4.0 Borage, meal 10 Borage, seed 6.0 Buckwheat, flour...

  10. The site of 2,4-D accumulation in Euphorbia helioscopia L

    International Nuclear Information System (INIS)

    Sakri, F.A.

    1990-01-01

    The distribution and accumulation of the herbicide 2,4-D have been studied by 14 C labelling and by tracing due to the autoradiographic method in young plants of Euphorbia helioscopia L. (milkweed). Milkweed plants were grown in a greenhouse at 30deg C under 16 hrs. photoperiod for about two weeks. The two lower opposite leaves, the cotyledons, were used as sites for 14 C-labelled 2,4-D application. The autoradiograph of the whole plants revealed that labelled 2,4-D movement was predominantly basipetal into the root as well as acropetal into the shoot apex. The 2,4-D movement has by-passed all the matured leaves in its movement from active sources to active sinks. The microautoradiography indicated that 2,4-D can accumulate to a considerable amount both in the parenchyma of the pith and in the cortical cells. It is concluded that 2,4-D is transported through phloem cells when applied to the healthy long leaves. (author)

  11. Spatial and temporal distribution of weeds in no-tillage system

    Directory of Open Access Journals (Sweden)

    Eduardo L. Bottega

    Full Text Available ABSTRACT Brazil is one of the largest grain producers in the world, due to its extensive arable land and favorable climate for the cultivation of any species. The production could be higher, but problems such as competition between crops and weeds reduces crop yields. This study aimed to analyze the spatial distribution of weeds, especially milkweed (Sonchus oleraceus, horse weed (Conyza spp. and ‘maria-mole’ (Senecio brasiliensis in an area under no-tillage system for two harvests. The work was carried out during the 2013/14 and 2014/15 crop years in an area of 22.5 ha, where soybean is grown in the summer and oat in the winter. The weeds were mapped using a sampling grid of 85 points. The number of plants present in 0.25 m2 was recorded at each sampling point. The data collected in the field composed the information bank and were used for geostatistical analysis and production of maps. Using geostatistical analysis, it was possible to map the horseweed infestation in the studied area for the 2013/14 season. The species ‘maria-mole’ and milkweed did not show spatial dependence. During the 2014/2015 season, because of the management carried out in the off season, none of the studied species showed spatial dependence.

  12. Experimental evidence shows no fractionation of strontium isotopes ((87)Sr/(86)Sr) among soil, plants, and herbivores: implications for tracking wildlife and forensic science.

    Science.gov (United States)

    Flockhart, D T Tyler; Kyser, T Kurt; Chipley, Don; Miller, Nathan G; Norris, D Ryan

    2015-01-01

    Strontium isotopes ((87)Sr/(86)Sr) can be useful biological markers for a wide range of forensic science applications, including wildlife tracking. However, one of the main advantages of using (87)Sr/(86)Sr values, that there is no fractionation from geological bedrock sources through the food web, also happens to be a critical assumption that has never been tested experimentally. We test this assumption by measuring (87)Sr/(86)Sr values across three trophic levels in a controlled greenhouse experiment. Adult monarch butterflies were raised on obligate larval host milkweed plants that were, in turn, grown on seven different soil types collected across Canada. We found no significant differences between (87)Sr/(86)Sr values in leachable Sr from soil minerals, organic soil, milkweed leaves, and monarch butterfly wings. Our results suggest that strontium isoscapes developed from (87)Sr/(86)Sr values in bedrock or soil may serve as a reliable biological marker in forensic science for a range of taxa and across large geographic areas.

  13. Stearoyl-acyl carrier protein desaturases are associated with floral isolation in sexually deceptive orchids

    Energy Technology Data Exchange (ETDEWEB)

    Schluter, P.M.; Shanklin, J.; Xu, S.; Gagliardini, V.; Whittle, E.; Grossniklaus, U.; Schiestl, F. P.

    2011-04-05

    The orchids Ophrys sphegodes and O. exaltata are reproductively isolated from each other by the attraction of two different, highly specific pollinator species. For pollinator attraction, flowers chemically mimic the pollinators sex pheromones, the key components of which are alkenes with different double-bond positions. This study identifies genes likely involved in alkene biosynthesis, encoding stearoyl-acyl carrier protein (ACP) desaturase (SAD) homologs. The expression of two isoforms, SAD1 and SAD2, is flower-specific and broadly parallels alkene production during flower development. SAD2 shows a significant association with alkene production, and in vitro assays show that O. sphegodes SAD2 has activity both as an 18:0-ACP {Delta}{sup 9} and a 16:0-ACP {Delta}{sup 4} desaturase. Downstream metabolism of the SAD2 reaction products would give rise to alkenes with double-bonds at position 9 or position 12, matching double-bond positions observed in alkenes in the odor bouquet of O. sphegodes. SAD1 and SAD2 show evidence of purifying selection before, and positive or relaxed purifying selection after gene duplication. By contributing to the production of species-specific alkene bouquets, SAD2 is suggested to contribute to differential pollinator attraction and reproductive isolation among these species. Taken together, these data are consistent with the hypothesis that SAD2 is a florally expressed barrier gene of large phenotypic effect and, possibly, a genic target of pollinator-mediated selection.

  14. Response of itchgrass and johnson grass to asulam/dalapon combinations

    International Nuclear Information System (INIS)

    Hook, B.J.

    1986-01-01

    Activities of asumlam [methyl[(4-aminophenyl)sulfonyl]carbamate], dalapon (2,2-dichloropropionic acid) and asulam/dalapon combinations on itchgrass (Rottboellia exaltata L.f.) and johnson grass [Sorghum halepense (L.) Pers.] were examined. When metabolism of 14 C-asulam was monitored, seven days after application, 97-100% of recovered 14 C co-chromatographed with 14 C-asulam. Itchgrass exhibited rapid uptake of 14 C-asulam within 8 hr after application. Asumlam concentrations remained constant in the plant between 8 and 72 hr. Johnson grass plants showed a differential response to asulam and asulam/dalapon treatments. Asulam-treated johnson grass absorbed 26-34% 14 C within 2 hr with no future significant increase in absorption in absorption through 72 hr. Treatment of johnson grass with asulam/dalapon enhanced 14 C absorption with time. At 24 and 72 hr 14 C levels were double that absorbed from treatment of asulam alone. Movement of 14 C-asulam in the apoplast and symplast of both itchgrass and johnson grass was noted. The highest radiolabel accumulated in the lower leaves of itchgrass and remained in the treated leaf of johnson grass

  15. The effectiveness of tipi in the treatment of hip and knee osteoarthritis: a preliminary report

    Directory of Open Access Journals (Sweden)

    Marcos Bosi Ferraz

    1991-01-01

    Full Text Available Osteoarthritis (OA is a common painful inflammatory condition occurring mainly in the later half of life. Hipe and knee are the joints mostly affected. Petiveria alliacea (tipi popularly known as an anti-rheumatic medicine, has been used by OA patients to relief pain. This one-week cross-over double-blind trial has preliminary evaluated the analgesic effect of tipi tea in 14 patients with hip and knee OA. Imperata exaltata (sape was used as the Placebo tea. The pain assessments that were made at baseline and before the start of the second treatment period by treatment groups were comparable. While taking tipi or placebo tea patients experienced a statistically significant improvement in pain on motion and pain at night. The comparison between the improvements reported while on tipi and placebo tea, however, did not disclose any statistically significant difference. At the conclusion of the study 7 patients preferred tipi tea and 6 preferred placebo tea (NS. Two patients reported insomnia, one durign placebo treatment and the other during tipi treatment. In this preliminary report both teas succeeded in the aim of relieving pain.

  16. Peatland Fire Danger Rating According to Weeds Characteristic Under Jelutung (Dyera Polyphylla Plantation

    Directory of Open Access Journals (Sweden)

    Acep Akbar

    2016-04-01

    Full Text Available Besides to be a competitor plant, weeds could act as the potential fuel under plantation forest in peatland. Characteristic of weeds in relation to peat swamp forest fire danger was studied under jelutung  plantation in Central Kalimantan. The research was aimed at exploring the potency of weed to become one of the fire danger rating indicators. By using vegetation analyses method in sampling unit of weeds population, results showed that three plantation area have different dominance weed species. The weeds species that could be the indicator of height fire risk according to water content and percentage of weed mortality during the drought, height potency of greenhouse gas emmision, culm height, and chemical material content that easy burned in this study were Imperata cylindrica, Stenochlaena polustris, Cyclosorus aridus, and Nephrolepis exaltata. While, the presence of Glichenia linearis, Melastoma malabatracum, Ficus grossulariodes, Saurophus androginus, Spatoglathis plicata,Himenocalis littoralis, Leptaspis urcheolata, Cyperus rotundus, and Amaranthus spinosa were not indicated high fire risk.

  17. The effectiveness of tipi in the treatment of hip and knee osteoarthritis--a preliminary report.

    Science.gov (United States)

    Ferraz, M B; Pereira, R B; Coelho Andrade, L E; Atra, E

    1991-01-01

    Osteoarthritis (OA) is a common painful inflammatory condition occurring mainly in the later half of life. Hip and knee are the joints mostly affected. Petiveria alliacea (tipi) popularly known as an anti-rheumatic medicine, has been used by OA patients to relief pain. This one-week cross-over double-blind trial has preliminary evaluated the analgesic effect of tipi tea in 14 patients with hip and knee OA. Imperata exaltata (sape) was used as the Placebo tea. The pain assessments that were made at baseline and before the start of the second treatment period by treatment groups were comparable. While taking tipi or placebo tea patients experienced a statistically significant improvement in pain on motion and pain at night. The comparison between the improvements reported while on tipi and placebo tea, however, did not disclose any statistically significant difference. At the conclusion of the study 7 patients preferred tipi tea and 6 preferred placebo tea (NS). Two patients reported insomnia, one during placebo treatment and the other during tipi treatment.

  18. STRUCTURAL CHANGES EVIDENCED BY FTIR SPECTROSCOPY IN CELLULOSE MATERIALS AFTER PRE-TREATMENT WITH IONIC LIQUID AND ENZYMATIC HYDROLYSIS

    Directory of Open Access Journals (Sweden)

    Iuliana Spiridon

    2011-02-01

    Full Text Available Attempts were made to enhance the hydrolysis of Asclepias syriaca (As seed floss and poplar seed floss (PSF by cellulase after pre-treatment with ionic liquids. Two ionic liquids, namely 1-butyl-3-methylimidazolium chloride [BMIM]Cl and 1-ethyl-3-methylimidazolium tetrachloroaluminate [EMIM]Cl-AlCl3, were used. In comparison with conventional cellulose pretreatment processes, the ionic liquids were used under a milder condition corresponding to the optimum activity of cellulase. Hydrolysis kinetics of the IL-treated cellulose materials was significantly enhanced. The initial hydrolysis rates for IL-treated cellulose materials were greater than those of non-treated ones. The structural modifications of hydrolyzed cellulose materials were analyzed using FTIR spectroscopy.

  19. Plantas tóxicas para ruminantes do Sudoeste de Goiás

    Directory of Open Access Journals (Sweden)

    Fabiano José Ferreira de Sant'Ana

    2014-05-01

    Full Text Available Com o objetivo de verificar quais são as plantas incriminadas como tóxicas para ruminantes do Sudoeste de Goiás, foram realizadas 108 entrevistas com produtores rurais, médicos veterinários, zootecnistas e agrônomos de 18 municípios da região. Foram apontadas como tóxicas para ruminantes: Brachiaria spp., Enterolobium contortisiliquum, Dimorphandra mollis, Palicourea marcgravii, Pteridium aquilinum e Sorghum vulgare. Adicionalmente, foram informadas intoxicações menos frequentes por Senna occidentalis, Stryphnodendrum obovatum e Manihot esculenta. Casos isolados de intoxicação em bovinos por Asclepias curassavica e Pterodon emarginatus foram descritos por alguns entrevistados. Este trabalho demonstra que intoxicações por plantas tóxicas são frequentes na região avaliada e representam importante causa de prejuízos econômicos aos pecuaristas locais.

  20. The small molecule calactin induces DNA damage and apoptosis in human leukemia cells.

    Science.gov (United States)

    Lee, Chien-Chih; Lin, Yi-Hsiung; Chang, Wen-Hsin; Wu, Yang-Chang; Chang, Jan-Gowth

    2012-09-01

    We purified calactin from the roots of the Chinese herb Asclepias curassavica L. and analyzed its biologic effects in human leukemia cells. Our results showed that calactin treatment caused DNA damage and resulted in apoptosis. Increased phosphorylation levels of Chk2 and H2AX were observed and were reversed by the DNA damage inhibitor caffeine in calactin-treated cells. In addition, calactin treatment showed that a decrease in the expression of cell cycle regulatory proteins Cyclin B1, Cdk1, and Cdc25C was consistent with a G2/M phase arrest. Furthermore, calactin induced extracellular signal-regulated kinase (ERK) phosphorylation, activation of caspase-3, caspase-8, and caspase-9, and PARP cleavage. Pretreatment with the ERK inhibitor PD98059 significantly blocked the loss of viability in calactin-treated cells. It is indicated that calactin-induced apoptosis may occur through an ERK signaling pathway. Our data suggest that calactin is a potential anticancer compound.

  1. Materials and energy from the sun

    Energy Technology Data Exchange (ETDEWEB)

    Calvin, M.

    1977-08-01

    The use of the green plant as a solar energy collector device is noted. A Brazilian project to produce ethanol from sugar cane is discussed along with the hydrocarbon storage capacities of such rubber-producing plants as Hevea brasiliensis and guayule. Latex-producing plants (including Euphorbia tirucalli, Asclepias, and E. trigona) are described in terms of their possible cultivation under arid or semi-arid conditions. Methods for latex hydrocarbon analysis are presented along with the preliminary results of an experimental planting project. Practical approaches to the use of these hydrocarbons as crude oil are identified, including refining processes and the utilization of the plants as both collectors of sunlight and producers of compounds.

  2. Stem cell autotomy and niche interaction in different systems.

    Science.gov (United States)

    Dorn, David C; Dorn, August

    2015-07-26

    The best known cases of cell autotomy are the formation of erythrocytes and thrombocytes (platelets) from progenitor cells that reside in special niches. Recently, autotomy of stem cells and its enigmatic interaction with the niche has been reported from male germline stem cells (GSCs) in several insect species. First described in lepidopterans, the silkmoth, followed by the gipsy moth and consecutively in hemipterans, foremost the milkweed bug. In both, moths and the milkweed bug, GSCs form finger-like projections toward the niche, the apical cells (homologs of the hub cells in Drosophila). Whereas in the milkweed bug the projection terminals remain at the surface of the niche cells, in the gipsy moth they protrude deeply into the singular niche cell. In both cases, the projections undergo serial retrograde fragmentation with progressing signs of autophagy. In the gipsy moth, the autotomized vesicles are phagocytized and digested by the niche cell. In the milkweed bug the autotomized vesicles accumulate at the niche surface and disintegrate. Autotomy and sprouting of new projections appears to occur continuously. The significance of the GSC-niche interactions, however, remains enigmatic. Our concept on the signaling relationship between stem cell-niche in general and GSC and niche (hub cells and cyst stem cells) in particular has been greatly shaped by Drosophila melanogaster. In comparing the interactions of GSCs with their niche in Drosophila with those in species exhibiting GSC autotomy it is obvious that additional or alternative modes of stem cell-niche communication exist. Thus, essential signaling pathways, including niche-stem cell adhesion (E-cadherin) and the direction of asymmetrical GSC division - as they were found in Drosophila - can hardly be translated into the systems where GSC autotomy was reported. It is shown here that the serial autotomy of GSC projections shows remarkable similarities with Wallerian axonal destruction, developmental axon

  3. Sensory basis of lepidopteran migration: Focus on the monarch butterfly

    Science.gov (United States)

    Guerra, Patrick A.; Reppert, Steven M.

    2015-01-01

    In response to seasonal habitats, migratory lepidopterans, exemplified by the monarch butterfly, have evolved migration to deal with dynamic conditions. During migration, monarchs use orientation mechanisms, exploiting a time-compensated sun compasses and a light-sensitive inclination magnetic compass to facilitate fall migration south. The sun compass is bidirectional with overwintering coldness triggering the change in orientation direction for remigration northward in the spring. The timing of the remigration and milkweed emergence in the southern US have co-evolved for propagation of the migration. Current research is uncovering the anatomical and molecular substrates that underlie migratory-relevant sensory mechanisms with the antennae being critical components. Orientation mechanisms may be detrimentally affected by environmental factors such as climate change and sensory interference from human-generated sources. PMID:25625216

  4. Availability of crop cellulosics for ethanol production

    Energy Technology Data Exchange (ETDEWEB)

    Hayes, R.D.

    1982-10-01

    Past estimates of cellulosic resources available from Canadian agriculture totalled over 23 million tonnes of cereal grain straw and corn stover residues surplus to soil and animal requirements. A new much reduced estimate, based on four detailed regional studies that also include previously unassessed resources such as chaff, oilseed hulls, and food processing wastes, is suggested. Eleven million tonnes are currently available from all residue sources for energy conversion by different processes. Only five million tonnes are identified as potentially usable in ethanol production plants were they to be constructed. Additional resource opportunities may become available in future from currently underutilized land, especially saline soils, novel processing techniques of conventional grains and forages, innovative cropping systems that may increase the yield of agricultural biomass, and new food/feed/fuel (i.e. multi-purpose) crops such as kochia, milkweed, and Jerusalem artichoke. 27 refs., 1 fig., 1 tab.

  5. Ants defend aphids against lethal disease

    Science.gov (United States)

    Nielsen, Charlotte; Agrawal, Anurag A.; Hajek, Ann E.

    2010-01-01

    Social insects defend their own colonies and some species also protect their mutualist partners. In mutualisms with aphids, ants typically feed on honeydew produced by aphids and, in turn guard and shelter aphid colonies from insect natural enemies. Here we report that Formica podzolica ants tending milkweed aphids, Aphis asclepiadis, protect aphid colonies from lethal fungal infections caused by an obligate aphid pathogen, Pandora neoaphidis. In field experiments, bodies of fungal-killed aphids were quickly removed from ant-tended aphid colonies. Ant workers were also able to detect infective conidia on the cuticle of living aphids and responded by either removing or grooming these aphids. Our results extend the long-standing view of ants as mutualists and protectors of aphids by demonstrating focused sanitizing and quarantining behaviour that may lead to reduced disease transmission in aphid colonies. PMID:19923138

  6. Decline of Monarch Butterflies Overwintering in Mexico- Is the Migratory Phenomenon at Risk?

    Science.gov (United States)

    Brower, Lincoln; Taylor, Orley R.; Williams, Ernest H.; Slayback, Daniel; Zubieta, Raul R.; Ramirez, M. Isabel

    2012-01-01

    1.During the 2009-2010 overwintering season and following a 15-year downward trend, the total area in Mexico occupied by the eastern North American population of overwintering monarch butterflies reached an all-time low. Despite an increase, it remained low in 2010-2011. 2. Although the data set is small, the decline in abundance is statistically significant using both linear and exponential regression models. 3. Three factors appear to have contributed to reduce monarch abundance: degradation of the forest in the overwintering areas; the loss of breeding habitat in the United States due to the expansion ofGM herbicide-resistant crops, with consequent loss of milkweed host plants, as well as continued land development; and severe weather. 4. This decline calls into question the long-term survival of the monarchs' migratory phenomenon

  7. Stem cell autotomy and niche interaction in different systems

    Science.gov (United States)

    Dorn, David C; Dorn, August

    2015-01-01

    The best known cases of cell autotomy are the formation of erythrocytes and thrombocytes (platelets) from progenitor cells that reside in special niches. Recently, autotomy of stem cells and its enigmatic interaction with the niche has been reported from male germline stem cells (GSCs) in several insect species. First described in lepidopterans, the silkmoth, followed by the gipsy moth and consecutively in hemipterans, foremost the milkweed bug. In both, moths and the milkweed bug, GSCs form finger-like projections toward the niche, the apical cells (homologs of the hub cells in Drosophila). Whereas in the milkweed bug the projection terminals remain at the surface of the niche cells, in the gipsy moth they protrude deeply into the singular niche cell. In both cases, the projections undergo serial retrograde fragmentation with progressing signs of autophagy. In the gipsy moth, the autotomized vesicles are phagocytized and digested by the niche cell. In the milkweed bug the autotomized vesicles accumulate at the niche surface and disintegrate. Autotomy and sprouting of new projections appears to occur continuously. The significance of the GSC-niche interactions, however, remains enigmatic. Our concept on the signaling relationship between stem cell-niche in general and GSC and niche (hub cells and cyst stem cells) in particular has been greatly shaped by Drosophila melanogaster. In comparing the interactions of GSCs with their niche in Drosophila with those in species exhibiting GSC autotomy it is obvious that additional or alternative modes of stem cell-niche communication exist. Thus, essential signaling pathways, including niche-stem cell adhesion (E-cadherin) and the direction of asymmetrical GSC division - as they were found in Drosophila - can hardly be translated into the systems where GSC autotomy was reported. It is shown here that the serial autotomy of GSC projections shows remarkable similarities with Wallerian axonal destruction, developmental axon

  8. An insight into the sialotranscriptome of the seed-feeding bug, Oncopeltus fasciatus.

    Science.gov (United States)

    Francischetti, Ivo M B; Lopes, Angela H; Dias, Felipe A; Pham, Van M; Ribeiro, José M C

    2007-09-01

    The salivary transcriptome of the seed-feeding hemipteran, Oncopeltus fasciatus (milkweed bug), is described following assembly of 1025 expressed sequence tags (ESTs) into 305 clusters of related sequences. Inspection of these sequences reveals abundance of low complexity, putative secreted products rich in the amino acids (aa) glycine, serine or threonine, which might function as silk or mucins and assist food canal lubrication and sealing of the feeding site around the mouthparts. Several protease inhibitors were found, including abundant expression of cystatin transcripts that may inhibit cysteine proteases common in seeds that might injure the insect or induce plant apoptosis. Serine proteases and lipases are described that might assist digestion and liquefaction of seed proteins and oils. Finally, several novel putative proteins are described with no known function that might affect plant physiology or act as antimicrobials.

  9. La familia Apocynaceae sensu lato en México: diversidad y distribución The family Apocynaceae sensu lato in Mexico: diversity and distribution

    Directory of Open Access Journals (Sweden)

    Verónica Juárez-Jaimes

    2007-12-01

    Full Text Available La familia Apocynaceae s.l. se ubica entre las 15 familias más diversas de México, con 385 especies repartidas en 50 géneros y 3 subfamilias, de las cuales Asclepiadoideae es la de mayor diversidad en géneros, especies y endemismos. Los géneros con más especies nativas (y endémicas son Asclepias y Matelea. Los estados más ricos en diversidad de taxones son los ubicados en ambas vertientes; destacan Chiapas, Guerrero, Oaxaca y Veracruz. Por su número de especies, sobresalen el bosque tropical caducifolio y los matorrales xerófilos. Del total de especies, 176 son endémicas de México. Se presenta la lista de especies registradas, señalándose su distribución por estados.Apocynaceae s.l. is among the 15 most diverse families in Mexico, with a total of 385 species, distributed in 50 genera and 3 subfamilies of which Asclepiadoideae is the most diverse in numbers of genera, species and endemics. The genera with the most native species and endemics are Asclepias and Matelea. The richest states in terms of taxon diversity are those at the Pacific and Atlantic slopes, Chiapas, Oaxaca, Guerrero and Veracruz being the most prominent. Tropical deciduous forest and arid tropical scrub are the most important vegetation types by their total number of species, 176 of which are endemic to Mexico. A list of species recorded in México is provided, indicating their state distribution.

  10. Does skipping a meal matter to a butterfly's appearance? Effects of larval food stress on wing morphology and color in monarch butterflies.

    Directory of Open Access Journals (Sweden)

    Haley Johnson

    Full Text Available In animals with complex life cycles, all resources needed to form adult tissues are procured at the larval stage. For butterflies, the proper development of wings involves synthesizing tissue during metamorphosis based on the raw materials obtained by larvae. Similarly, manufacture of pigment for wing scales also requires resources acquired by larvae. We conducted an experiment to test the effects of food deprivation in the larval stage on multiple measures of adult wing morphology and coloration of monarch butterflies (Danaus plexippus, a species in which long-distance migration makes flight efficiency critical. In a captive setting, we restricted food (milkweed from late-stage larvae for either 24 hrs or 48 hrs, then after metamorphosis we used image analysis methods to measure forewing surface area and elongation (length/width, which are both important for migration. We also measured the brightness of orange pigment and the intensity of black on the wing. There were correlations between several wing features, including an unexpected association between wing elongation and melanism, which will require further study to fully understand. The clearest effect of food restriction was a reduction in adult wing size in the high stress group (by approximately 2%. Patterns observed for other wing traits were ambiguous: monarchs in the low stress group (but not the high had less elongated and paler orange pigmentation. There was no effect on wing melanism. Although some patterns obtained in this study were unclear, our results concerning wing size have direct bearing on the monarch migration. We show that if milkweed is limited for monarch larvae, their wings become stunted, which could ultimately result in lower migration success.

  11. Maternal effects and maternal selection arising from variation in allocation of free amino acid to eggs

    Science.gov (United States)

    Newcombe, Devi; Hunt, John; Mitchell, Christopher; Moore, Allen J

    2015-01-01

    Maternal provisioning can have profound effects on offspring phenotypes, or maternal effects, especially early in life. One ubiquitous form of provisioning is in the makeup of egg. However, only a few studies examine the role of specific egg constituents in maternal effects, especially as they relate to maternal selection (a standardized selection gradient reflecting the covariance between maternal traits and offspring fitness). Here, we report on the evolutionary consequences of differences in maternal acquisition and allocation of amino acids to eggs. We manipulated acquisition by varying maternal diet (milkweed or sunflower) in the large milkweed bug, Oncopeltus fasciatus. Variation in allocation was detected by examining two source populations with different evolutionary histories and life-history response to sunflower as food. We measured amino acids composition in eggs in this 2 × 2 design and found significant effects of source population and maternal diet on egg and nymph mass and of source population, maternal diet, and their interaction on amino acid composition of eggs. We measured significant linear and quadratic maternal selection on offspring mass associated with variation in amino acid allocation. Visualizing the performance surface along the major axes of nonlinear selection and plotting the mean amino acid profile of eggs from each treatment onto the surface revealed a saddle-shaped fitness surface. While maternal selection appears to have influenced how females allocate amino acids, this maternal effect did not evolve equally in the two populations. Furthermore, none of the population means coincided with peak performance. Thus, we found that the composition of free amino acids in eggs was due to variation in both acquisition and allocation, which had significant fitness effects and created selection. However, although there can be an evolutionary response to novel food resources, females may be constrained from reaching phenotypic optima with

  12. Multi-scale responses to warming in an experimental insect metacommunity.

    Science.gov (United States)

    Grainger, Tess Nahanni; Gilbert, Benjamin

    2017-12-01

    In metacommunities, diversity is the product of species interactions at the local scale and dispersal between habitat patches at the regional scale. Although warming can alter both species interactions and dispersal, the combined effects of warming on these two processes remains uncertain. To determine the independent and interactive effects of warming-induced changes to local species interactions and dispersal, we constructed experimental metacommunities consisting of enclosed milkweed patches seeded with five herbivorous milkweed specialist insect species. We treated metacommunities with two levels of warming (unwarmed and warmed) and three levels of connectivity (isolated, low connectivity, high connectivity). Based on metabolic theory, we predicted that if plant resources were limited, warming would accelerate resource drawdown, causing local insect declines and increasing both insect dispersal and the importance of connectivity to neighboring patches for insect persistence. Conversely, given abundant resources, warming could have positive local effects on insects, and the risk of traversing a corridor to reach a neighboring patch could outweigh the benefits of additional resources. We found support for the latter scenario. Neither resource drawdown nor the weak insect-insect associations in our system were affected by warming, and most insect species did better locally in warmed conditions and had dispersal responses that were unchanged or indirectly affected by warming. Dispersal across the matrix posed a species-specific risk that led to declines in two species in connected metacommunities. Combined, this scaled up to cause an interactive effect of warming and connectivity on diversity, with unwarmed metacommunities with low connectivity incurring the most rapid declines in diversity. Overall, this study demonstrates the importance of integrating the complex outcomes of species interactions and spatial structure in understanding community response to climate

  13. Polyamine Triglycerides: Synthesis and Study of Their Potential in Lubrication, Neutralization, and Sequestration.

    Science.gov (United States)

    Harry-O'kuru, Rogers E; Biresaw, Girma; Murray, Rex E

    2015-07-22

    Renewable resources have evoked a new awakening in both scientific and industrial circles in the past decade. Vegetable oil is one category of renewables that is amenable as a source of new industrial products. Because the source feedstock, seeds, are environmentally friendly, the derivatized products from these at the end of their lifetime could also be benign when designed appropriately. Bioethanol and biodiesel are examples of biobased industrial products currently in the market place and have become resources for uplifting the rural economy. Biolubricants also are playing a more prominent role because they have become closely competitive with petroleum-based lubricants. These products are renewable because the crops from which the feedstuff for the biofuels and biolubricants are produced are grown annually in contrast to nonrenewable mineral sources. Added to their renewability is the inherent biodegradability of their end-use products after their useful lifetime. In a recent study of the lubricity characteristics of peracylated polyhydroxy milkweed oil, the derivatives were found to exhibit good oxidative stability as well as excellent antiwear properties. To further explore an expansion in the properties of such materials in lubrication and other applications, in this study the polyhydroxy (OH) moieties of derivatized milkweed triglycerides were replaced with -NHR groupings in the oil. In this process novel polyketo triglyceride intermediates leading to polyamine derivatives of the vegetable oil have been synthesized. The polyamine triglyceride markedly improved the stability of the parent oil to oxidative stress. It has also attenuated the extreme viscosity of the starting polyhydroxy oil to a more useful product that could be amenable for use as a lubricating agent, for example, hydraulic fluid. Both the polyketone and polyimine intermediates of the polyamine have chelating properties. The intermediates and the polyamine were characterized spectroscopically

  14. Does Skipping a Meal Matter to a Butterfly's Appearance? Effects of Larval Food Stress on Wing Morphology and Color in Monarch Butterflies

    Science.gov (United States)

    Johnson, Haley; Solensky, Michelle J.; Satterfield, Dara A.; Davis, Andrew K.

    2014-01-01

    In animals with complex life cycles, all resources needed to form adult tissues are procured at the larval stage. For butterflies, the proper development of wings involves synthesizing tissue during metamorphosis based on the raw materials obtained by larvae. Similarly, manufacture of pigment for wing scales also requires resources acquired by larvae. We conducted an experiment to test the effects of food deprivation in the larval stage on multiple measures of adult wing morphology and coloration of monarch butterflies (Danaus plexippus), a species in which long-distance migration makes flight efficiency critical. In a captive setting, we restricted food (milkweed) from late-stage larvae for either 24 hrs or 48 hrs, then after metamorphosis we used image analysis methods to measure forewing surface area and elongation (length/width), which are both important for migration. We also measured the brightness of orange pigment and the intensity of black on the wing. There were correlations between several wing features, including an unexpected association between wing elongation and melanism, which will require further study to fully understand. The clearest effect of food restriction was a reduction in adult wing size in the high stress group (by approximately 2%). Patterns observed for other wing traits were ambiguous: monarchs in the low stress group (but not the high) had less elongated and paler orange pigmentation. There was no effect on wing melanism. Although some patterns obtained in this study were unclear, our results concerning wing size have direct bearing on the monarch migration. We show that if milkweed is limited for monarch larvae, their wings become stunted, which could ultimately result in lower migration success. PMID:24695643

  15. Fitness costs of animal medication: antiparasitic plant chemicals reduce fitness of monarch butterfly hosts.

    Science.gov (United States)

    Tao, Leiling; Hoang, Kevin M; Hunter, Mark D; de Roode, Jacobus C

    2016-09-01

    The emerging field of ecological immunology demonstrates that allocation by hosts to immune defence against parasites is constrained by the costs of those defences. However, the costs of non-immunological defences, which are important alternatives to canonical immune systems, are less well characterized. Estimating such costs is essential for our understanding of the ecology and evolution of alternative host defence strategies. Many animals have evolved medication behaviours, whereby they use antiparasitic compounds from their environment to protect themselves or their kin from parasitism. Documenting the costs of medication behaviours is complicated by natural variation in the medicinal components of diets and their covariance with other dietary components, such as macronutrients. In the current study, we explore the costs of the usage of antiparasitic compounds in monarch butterflies (Danaus plexippus), using natural variation in concentrations of antiparasitic compounds among plants. Upon infection by their specialist protozoan parasite Ophryocystis elektroscirrha, monarch butterflies can selectively oviposit on milkweed with high foliar concentrations of cardenolides, secondary chemicals that reduce parasite growth. Here, we show that these antiparasitic cardenolides can also impose significant costs on both uninfected and infected butterflies. Among eight milkweed species that vary substantially in their foliar cardenolide concentration and composition, we observed the opposing effects of cardenolides on monarch fitness traits. While high foliar cardenolide concentrations increased the tolerance of monarch butterflies to infection, they reduced the survival rate of caterpillars to adulthood. Additionally, although non-polar cardenolide compounds decreased the spore load of infected butterflies, they also reduced the life span of uninfected butterflies, resulting in a hump-shaped curve between cardenolide non-polarity and the life span of infected butterflies

  16. Does skipping a meal matter to a butterfly's appearance? Effects of larval food stress on wing morphology and color in monarch butterflies.

    Science.gov (United States)

    Johnson, Haley; Solensky, Michelle J; Satterfield, Dara A; Davis, Andrew K

    2014-01-01

    In animals with complex life cycles, all resources needed to form adult tissues are procured at the larval stage. For butterflies, the proper development of wings involves synthesizing tissue during metamorphosis based on the raw materials obtained by larvae. Similarly, manufacture of pigment for wing scales also requires resources acquired by larvae. We conducted an experiment to test the effects of food deprivation in the larval stage on multiple measures of adult wing morphology and coloration of monarch butterflies (Danaus plexippus), a species in which long-distance migration makes flight efficiency critical. In a captive setting, we restricted food (milkweed) from late-stage larvae for either 24 hrs or 48 hrs, then after metamorphosis we used image analysis methods to measure forewing surface area and elongation (length/width), which are both important for migration. We also measured the brightness of orange pigment and the intensity of black on the wing. There were correlations between several wing features, including an unexpected association between wing elongation and melanism, which will require further study to fully understand. The clearest effect of food restriction was a reduction in adult wing size in the high stress group (by approximately 2%). Patterns observed for other wing traits were ambiguous: monarchs in the low stress group (but not the high) had less elongated and paler orange pigmentation. There was no effect on wing melanism. Although some patterns obtained in this study were unclear, our results concerning wing size have direct bearing on the monarch migration. We show that if milkweed is limited for monarch larvae, their wings become stunted, which could ultimately result in lower migration success.

  17. MICROSCOPIA E USO DA CÂMERA DO CELULAR NAS AULAS DE BIOLOGIA: UM INSTRUMENTO DE REGISTRO DE ATIVIDADES

    Directory of Open Access Journals (Sweden)

    Amanda Vieira

    2017-01-01

    Full Text Available O presente trabalho teve como objetivo a observação microscópica de estruturas reprodutoras vegetais ao microscópio monocular 116AL Coleman, objetiva 40x  para ilustrar o ciclo de vida de grupos vegetais por alunos do Ensino Médio do Colégios Univap Aquarius,  na Zona Oeste de São José dos Campos. O trabalho foi dividido em duas etapas: (a a primeira etapa constituiu-se no estudo teórico dos grupos vegetais, ciclos reprodutivos e observação de estruturas reprodutoras de pteridófitas e angiospermas em aula de campo realizada na Praça Ulisses Guimarães, localizada no Jardim Aquarius; (b  a segunda etapa realizada  no laboratório de Biologia do colégio, foram visualizadas ao microscópio óptico, soros, esporângios e esporos vegetais presentes em folhas de samambaias (Nephrolepis exaltata;   e   grãos de pólen de anteras coletadas de flores de “pata de vaca” (Bauhinia forticata. Complementando o resultado das atividades realizadas, os alunos utilizaram a câmera do celular (Iphone 5, câmera digital 8MP acoplada a objetiva do microscópio registrando as estruturas observadas que foram compartilhadas nos grupos de estudo existentes nas redes sociais.

  18. Complete plastid genome sequences suggest strong selection for retention of photosynthetic genes in the parasitic plant genus Cuscuta.

    Science.gov (United States)

    McNeal, Joel R; Kuehl, Jennifer V; Boore, Jeffrey L; de Pamphilis, Claude W

    2007-10-24

    Plastid genome content and protein sequence are highly conserved across land plants and their closest algal relatives. Parasitic plants, which obtain some or all of their nutrition through an attachment to a host plant, are often a striking exception. Heterotrophy can lead to relaxed constraint on some plastid genes or even total gene loss. We sequenced plastid genomes of two species in the parasitic genus Cuscuta along with a non-parasitic relative, Ipomoea purpurea, to investigate changes in the plastid genome that may result from transition to the parasitic lifestyle. Aside from loss of all ndh genes, Cuscuta exaltata retains photosynthetic and photorespiratory genes that evolve under strong selective constraint. Cuscuta obtusiflora has incurred substantially more change to its plastid genome, including loss of all genes for the plastid-encoded RNA polymerase. Despite extensive change in gene content and greatly increased rate of overall nucleotide substitution, C. obtusiflora also retains all photosynthetic and photorespiratory genes with only one minor exception. Although Epifagus virginiana, the only other parasitic plant with its plastid genome sequenced to date, has lost a largely overlapping set of transfer-RNA and ribosomal genes as Cuscuta, it has lost all genes related to photosynthesis and maintains a set of genes which are among the most divergent in Cuscuta. Analyses demonstrate photosynthetic genes are under the highest constraint of any genes within the plastid genomes of Cuscuta, indicating a function involving RuBisCo and electron transport through photosystems is still the primary reason for retention of the plastid genome in these species.

  19. Complete plastid genome sequences suggest strong selection for retention of photosynthetic genes in the parasitic plant genus Cuscuta

    Directory of Open Access Journals (Sweden)

    Kuehl Jennifer V

    2007-10-01

    Full Text Available Abstract Background Plastid genome content and protein sequence are highly conserved across land plants and their closest algal relatives. Parasitic plants, which obtain some or all of their nutrition through an attachment to a host plant, are often a striking exception. Heterotrophy can lead to relaxed constraint on some plastid genes or even total gene loss. We sequenced plastid genomes of two species in the parasitic genus Cuscuta along with a non-parasitic relative, Ipomoea purpurea, to investigate changes in the plastid genome that may result from transition to the parasitic lifestyle. Results Aside from loss of all ndh genes, Cuscuta exaltata retains photosynthetic and photorespiratory genes that evolve under strong selective constraint. Cuscuta obtusiflora has incurred substantially more change to its plastid genome, including loss of all genes for the plastid-encoded RNA polymerase. Despite extensive change in gene content and greatly increased rate of overall nucleotide substitution, C. obtusiflora also retains all photosynthetic and photorespiratory genes with only one minor exception. Conclusion Although Epifagus virginiana, the only other parasitic plant with its plastid genome sequenced to date, has lost a largely overlapping set of transfer-RNA and ribosomal genes as Cuscuta, it has lost all genes related to photosynthesis and maintains a set of genes which are among the most divergent in Cuscuta. Analyses demonstrate photosynthetic genes are under the highest constraint of any genes within the plastid genomes of Cuscuta, indicating a function involving RuBisCo and electron transport through photosystems is still the primary reason for retention of the plastid genome in these species.

  20. Design and Implement a System of Wastewater Treatment Based on Wetlands

    Directory of Open Access Journals (Sweden)

    Martha L. Dominínguez-Patiño

    2012-04-01

    Full Text Available The wetlands are considered as a natural passive cleaning of waste water. Is a process characterizes by its simplicity of operation, low or zero-energy consumption and low waste production. These consist of shallow ponds planted with plants. The processes of decontamination are performed simultaneously by its physical, chemical and biological properties. The objectives of this work are design and implement a system of artificial wetlands as an alternative method for treating waste water produced from the Faculty of Chemistry Science and Engineering that allow to reduce the costs of operation, knowing the degree of water pollution to determine how efficient the wetland and, finally improve the health and environmental conditions of the irrigation water. So the first step was to know the degree of water pollution and quantity to determine the wetland process variables. The second step was to determine the kind of plants that allow reducing the water contaminants. The Manning formula was applied to evaluate the free flow and Darcy’s equation for the surface flow by wetlands. A micro-scale prototype was design and built based on buckets. The absorption capacity of several plants (Bacopa monnieri, Nephrolepis exaltata,Tradescantia zebrine was determined. Also we use a natural filter consisting of Tezontle (first layer, sand (second layer, gravel (third layer, sand (fourth layer, Tezontle (fifth layer, gravel (sixth layer, sand (seventh layer and, organic substrate (eighth layer. A wetland decreases more than 60% the cost compared to a water purification plant as everything is based biodegradable materials and not using any energy or sophisticated equipment to water filtration. Wetlands not only help to purify the water, but also help the conservation of flora and fauna that is dependent on wet conditions, as only biodegradable materials are used there is no pollution to the ground, helping the conservation of the environment. Today we are

  1. In vivo hypotensive effect and in vitro inhibitory activity of some Cyperaceae species

    Directory of Open Access Journals (Sweden)

    Monica Lacerda Lopes Martins

    2013-12-01

    Full Text Available In 1820, French naturalist August Saint Hillaire, during a visit in Espírito Santo (ES, a state in southeastern Brazil, reported a popular use of Cyperaceae species as antidote to snake bites. The plant may even have a hypotensive effect, though it was never properly researched. The in vitro inhibitory of the angiotensin converting enzyme (ACE activity of eigth ethanolic extracts of Cyperaceae was evaluated by colorimetric assay. Total phenolic and flavonoids were determined using colorimetric assay. The hypotensive effect of the active specie (Rhychonospora exaltata, ERE and the in vivo ACE assay was measured in vivo using male Wistar Kyoto (ERE, 0.01-100mg/kg, with acetylcholine (ACh as positive control (5 µg/kg, i.v.. The evaluation of ACE in vivo inhibitory effect was performed comparing the mean arterial pressure before and after ERE (10 mg/kg in animals which received injection of angiotensin I (ANG I; 0,03, 03 and 300 µg/kg, i.v.. Captopril (30 mg/kg was used as positive control. Bulbostylis capillaris (86.89 ± 15.20% and ERE (74.89 ± 11.95%, ERE were considered active in the in vitro ACE inhibition assay, at 100 µg/mL concentration. ACh lead to a hypotensive effect before and after ERE's curve (-40±5% and -41±3%. ERE showed a dose-dependent hypotensive effect and a in vivo ACE inhibitory effect. Cyperaceae species showed an inhibitory activity of ACE, in vitro, as well as high content of total phenolic and flavonoids. ERE exhibited an inhibitory effect on both in vitro and in vivo ACE. The selection of species used in popular medicine as antidotes, along with the in vitro assay of ACE inhibition, might be a biomonitoring method for the screening of new medicinal plants with hypotensive properties.

  2. Transcriptome and proteome data reveal candidate genes for pollinator attraction in sexually deceptive orchids.

    Science.gov (United States)

    Sedeek, Khalid E M; Qi, Weihong; Schauer, Monica A; Gupta, Alok K; Poveda, Lucy; Xu, Shuqing; Liu, Zhong-Jian; Grossniklaus, Ueli; Schiestl, Florian P; Schlüter, Philipp M

    2013-01-01

    Sexually deceptive orchids of the genus Ophrys mimic the mating signals of their pollinator females to attract males as pollinators. This mode of pollination is highly specific and leads to strong reproductive isolation between species. This study aims to identify candidate genes responsible for pollinator attraction and reproductive isolation between three closely related species, O. exaltata, O. sphegodes and O. garganica. Floral traits such as odour, colour and morphology are necessary for successful pollinator attraction. In particular, different odour hydrocarbon profiles have been linked to differences in specific pollinator attraction among these species. Therefore, the identification of genes involved in these traits is important for understanding the molecular basis of pollinator attraction by sexually deceptive orchids. We have created floral reference transcriptomes and proteomes for these three Ophrys species using a combination of next-generation sequencing (454 and Solexa), Sanger sequencing, and shotgun proteomics (tandem mass spectrometry). In total, 121 917 unique transcripts and 3531 proteins were identified. This represents the first orchid proteome and transcriptome from the orchid subfamily Orchidoideae. Proteome data revealed proteins corresponding to 2644 transcripts and 887 proteins not observed in the transcriptome. Candidate genes for hydrocarbon and anthocyanin biosynthesis were represented by 156 and 61 unique transcripts in 20 and 7 genes classes, respectively. Moreover, transcription factors putatively involved in the regulation of flower odour, colour and morphology were annotated, including Myb, MADS and TCP factors. Our comprehensive data set generated by combining transcriptome and proteome technologies allowed identification of candidate genes for pollinator attraction and reproductive isolation among sexually deceptive orchids. This includes genes for hydrocarbon and anthocyanin biosynthesis and regulation, and the development of

  3. Plant Extract Control of the Fungi Associated with Different Egyptian Wheat Cultivars Grains

    Directory of Open Access Journals (Sweden)

    Mohamed Baka Zakaria Awad

    2014-07-01

    Full Text Available Grain samples of 14 Egyptian wheat cultivars were tested for seed-borne fungi. The deep freezing method was used. Five seed-borne fungi viz., Aspergillus flavus, A. niger, Curvularia lunata, Fusarium moniliforme and Penicillium chrysogenum were isolated from the wheat cultivars viz., Bani Suef 4, Bani Suef 5, Gemmiza 7, Gemmiza 9, Gemmiza 10, Giza 168, Misr 1, Misr 2, Sakha 93, Sakha 94, Shandaweel 1, Sids 1, Sids 2 and Sids 3. A. flavus, A. niger and F. moniliforme were the most prevalent fungal species. Their incidence ranged from 21.0-53.5%, 16.0-37.5%, and 12.0-31.0%, respectively. The antifungal potential of water extracts from aerial parts of five wild medicinal plants (Asclepias sinaica, Farsetia aegyptia, Hypericum sinaicum, Phagnalon sinaicum, and Salvia aegyptiaca were collected from the Sinai Peninsula, Egypt. The antifungal potential of water extracts from the aerial parts of these five plants were tested in the laboratory against the dominant fungi isolated from the wheat cultivars. All the aqueous plant extracts significantly (p ≤ 0.05 reduced the incidence of the tested seed-borne fungi. But the extract of Asclepias sinaica exhibited the most antifungal activity on tested fungi at all concentrations used when compared with other plant extracts. Maximum infested grain germination was observed in Giza 168 and minimum in Bani Suef 5. Treating grains with plant extract of A. sinaica (10% enhanced the percentage of grain germination of all cultivars in both laboratory and pot experiments. Maximum root and shoot length of seedlings was recorded in Bani Suef 4 during fungal infestation or treatment by plant extract. For one hour before sowing or storage, the aqueous extract of A. sinaica can be used to treat wheat grains, to reduce the fungal incidence. Aqueous extracts of the aerial parts of selected medicinal plants, particularly A. sinaica, are promising for protecting Egyptian wheat grain cultivars against major seed-borne fungi

  4. COPPER ACCUMULATION IN SOILS AND VEGETATION OF POLLUTED AREA COPŞA MICĂ

    Directory of Open Access Journals (Sweden)

    Nicoleta Vrînceanu

    2010-01-01

    Full Text Available The study carried out in order to estimate the distribution and accumulation of copper in soils and vegetation fromCopşa Mică area used a radial network centered in the source of pollution – S.C. SOMETRA S.A. Copşa Mică. Soil andplant samples taken from the radial nodes of the network were analyzed to determine the content of copper. Values ofcopper content in plant ranged between 4.2 mg/kg and 97 mg/kg. Based on these results has been obtained a regressionequation that estimates the copper content in plants as function of the total copper content in soil. The spontaneousvegetation developed in the investigated area includes plants belonging to the following species: Amaranthusretroflexus, Artemisia vulgaris, Asclepias syriaca, Calamagrostis epigeios, Calamagrostis pseudophragmites, Cynodondactylon, Daucus carota, Equisetum arvense, Phragmites australis, Picris hieracioides, Setaria glauca, Sinapisarvensis, Verbascum phlomoides and Xanthium strumarium. The copper pollution doesn’t represent a major problem inCopşa Mică area.

  5. POTENCY OF THE INDONESIAN MEDICINAL PLANTS AS ANTIMALARIAL DRUGS

    Directory of Open Access Journals (Sweden)

    Subeki Subeki

    2012-12-01

    Full Text Available The Indonesian traditional herbal medicine has been practiced for many centuries in Indonesia to treat malaria diseases. Although modern medicine is becoming increasingly important, herbal medicine is still very popular. In order to select raw material for preparation of safety herbal medicines, forty five medicinal plants have been tested for acute toxicity in mouse at a dose 715 mg/kg body weight. The extracts of Asclepias curassavica leave, Alstonia scholaris leave, Decospermum fruticosum leave, Elaocarpus petiolatus bark, Elaocarpus parvifolius bark, Eurycoma longifolia root, Garcinia rigida bark, Nephelium lappaceum bark, Pentaspodan motleyi leave, Picrasma javanica leave, Phyllanthus niruri whole, Quassia indica leave, Syzygium pycnanthum bark, Tetrasera scandens leave, Cratoxylum glaucum bark, Sandoricum emarginatum bark, Mallotus paniculatus leave, Microcos ovatolanceolata bark, Poikilospermum suaveolens leave, Fibraurea chloroleuea leave, Tetrasera scandens root, and Timonius billitonensis bark showed toxicity with mortality level of 20-100%. The remaining 32 plant extracts were not toxic at dose tested. The toxic plant species should be considered in the preparation of herbal medicines. Of the safety extracts were tested for their antimalarial activity against Plasmodium berghei in vivo at a dose 715 mg/kg body weight. Extract of Carica papaya leave was most active than other plant extracts with parasitemia 1.13%, while control showed 17.21%. More research is needed to scientifically prove efficacy and to identity antimalarial constituents in the plant extracts. Key words: Indonesian medicinal plant, jamu, toxicity, antimalarial activity, Plasmodium berghei.

  6. Pollinator effectiveness varies with experimental shifts in flowering time.

    Science.gov (United States)

    Rafferty, Nicole E; Ives, Anthony R

    2012-04-01

    The earlier flowering times exhibited by many plant species are a conspicuous sign of climate change. Altered phenologies have caused concern that species could suffer population declines if they flower at times when effective pollinators are unavailable. For two perennial wildflowers, Tradescantia ohiensis and Asclepias incarnata, we used an experimental approach to explore how changing phenology affects the taxonomic composition of the pollinator assemblage and the effectiveness of individual pollinator taxa. After finding in the previous year that fruit set varied with flowering time, we manipulated flowering onset in greenhouses, placed plants in the field over the span of five weeks, and measured pollinator effectiveness as the number of seeds produced after a single visit to a flower. The average effectiveness of pollinators and the expected rates of pollination success were lower for plants of both species flowering earlier than for plants flowering at historical times, suggesting there could be reproductive costs to earlier flowering. Whereas for A. incarnata, differences in average seed set among weeks were due primarily to changes in the composition of the pollinator assemblage, the differences for T. ohiensis were driven by the combined effects of compositional changes and increases over time in the effectiveness of some pollinator taxa. Both species face the possibility of temporal mismatch between the availability of the most effective pollinators and the onset of flowering, and changes in the effectiveness of individual pollinator taxa through time may add an unexpected element to the reproductive consequences of such mismatches.

  7. The melliferous potential of apiflora of southwestern Vojvodina (Serbia

    Directory of Open Access Journals (Sweden)

    Mačukanović-Jocić Marina P.

    2016-01-01

    Full Text Available The individual and community-level melliferous potential of apiflora was evaluated in southwestern Vojvodina in order to assess its significance and contribution to the bee pasture. Seven plant communities belonging to ruderal, segetal and floodplain type of vegetation, with a total of 279 plant species were registered. Apifloristic and phytocoenological investigations included the determination and analysis of honey plants using the following parameters: total number, percentage, abundance and frequency of these species in the communities, as well as their intensity of pollen and nectar production. The coenotic coefficient of melliferousness (CCm indicating the melliferous potential of each community, was calculated based on the above parameters. Although the greatest number of melliferous species was found in the ass. Chenopodio-Ambrosietum artemisiifoliae (132, the highest percentage (80% of them was registered in the ass. Consolido-Polygonetum avicularis. Considering the coefficients of nectar and pollen production, the most valuable honey plants commonly present in the majority of communities were: Cirsium arvense, Rubus caesius, Lythrum salicaria, Daucus carota, Trifolium pratense, Dipsacus laciniatus, Medicago sativa, Asclepias syriaca, Cichorium intybus and Taraxacum officinale. The low abundance and frequency of melliferous species within the Consolido-Polygonetum avicularis, Polygonetum convolvulo-avicularis and Populetum nigrae-albae communities indicated their poor contribution to the bee pasture. Within ruderal vegetation, the highest CCm was registered in Amorpho-Typhaetum, providing, theoretically, the richest food resource for the honeybees in the investigated area. [Projekat Ministarstva nauke Republike Srbije, br. 46009 i br. 173018

  8. The chemistry of antipredator defense by secondary compounds in neotropical lepidoptera: facts, perspectives and caveats

    Directory of Open Access Journals (Sweden)

    Trigo José R.

    2000-01-01

    Full Text Available Chemical defense against predation in butterflies and moths has been studied since nineteenth century. A classical example is that of the larvae of the monarch butterfly Danaus plexippus, which feed on leaves of Asclepias curassavica (Asclepiadaceae, sequestering cardenolides. The adults are protected against predation by birds. Several other substances may be involved in chemical defense, such as iridoid glycosides, cyanogenic glycosides, glucosinolates, pyrrolizidine and tropane alkaloids, aristolochic acids, glycosidase inhibitors and pyrazines. The acquisition of these substances by lepidopterans can be due to sequestration from larval or adult host plants or de novo biosynthesis. Many Lepidoptera are known to be unpalatable, including the butterflies Troidini (Papilionidae, Pierinae (Pieridae, Eurytelinae, Melitaeinae, Danainae, Ithomiinae, Heliconiinae and Acraeinae (Nymphalidae, and Arctiidae moths, but knowledge of the chemical substances responsible for property is often scarce. This review discusses mainly three topics: field and laboratory observations on rejection of butterflies and moths by predators, correlation between unpalatability and chemicals found in these insects, and bioassays that test the activity of these chemicals against predators. Perspectives and future directions are suggested for this subject.

  9. Effects of in situ climate warming on monarch caterpillar (Danaus plexippus development

    Directory of Open Access Journals (Sweden)

    Nathan P. Lemoine

    2015-10-01

    Full Text Available Climate warming will fundamentally alter basic life history strategies of many ectothermic insects. In the lab, rising temperatures increase growth rates of lepidopteran larvae but also reduce final pupal mass and increase mortality. Using in situ field warming experiments on their natural host plants, we assessed the impact of climate warming on development of monarch (Danaus plexippus larvae. Monarchs were reared on Asclepias tuberosa grown under ‘Ambient’ and ‘Warmed’ conditions. We quantified time to pupation, final pupal mass, and survivorship. Warming significantly decreased time to pupation, such that an increase of 1 °C corresponded to a 0.5 day decrease in pupation time. In contrast, survivorship and pupal mass were not affected by warming. Our results indicate that climate warming will speed the developmental rate of monarchs, influencing their ecological and evolutionary dynamics. However, the effects of climate warming on larval development in other monarch populations and at different times of year should be investigated.

  10. The ecology and evolution of animal medication: genetically fixed response versus phenotypic plasticity.

    Science.gov (United States)

    Choisy, Marc; de Roode, Jacobus C

    2014-08-01

    Animal medication against parasites can occur either as a genetically fixed (constitutive) or phenotypically plastic (induced) behavior. Taking the tritrophic interaction between the monarch butterfly Danaus plexippus, its protozoan parasite Ophryocystis elektroscirrha, and its food plant Asclepias spp. as a test case, we develop a game-theory model to identify the epidemiological (parasite prevalence and virulence) and environmental (plant toxicity and abundance) conditions that predict the evolution of genetically fixed versus phenotypically plastic forms of medication. Our model shows that the relative benefits (the antiparasitic properties of medicinal food) and costs (side effects of medicine, the costs of searching for medicine, and the costs of plasticity itself) crucially determine whether medication is genetically fixed or phenotypically plastic. Our model suggests that animals evolve phenotypic plasticity when parasite risk (a combination of virulence and prevalence and thus a measure of the strength of parasite-mediated selection) is relatively low to moderately high and genetically fixed medication when parasite risk becomes very high. The latter occurs because at high parasite risk, the costs of plasticity are outweighed by the benefits of medication. Our model provides a simple and general framework to study the conditions that drive the evolution of alternative forms of animal medication.

  11. Dominance of the multicoloured Asian lady beetle Harmonia axyridis in an undisturbed wild meadow ecosystem

    Directory of Open Access Journals (Sweden)

    Élise Bélanger

    2011-12-01

    Full Text Available Fifteen years after its arrival in Quebec (Canada, the multicoloured Asian lady beetle Harmonia axyridis (Pallas 1773 (Coleoptera: Coccinellidae has become one of the dominant coccinellid species in agricultural, forested and urban areas. Several studies conducted in North American agricultural ecosystems show that the arrival of H. axyridis and other exotic coccinellid species was followed by decreases in the populations of native coccinellid species. In this study, the abundances of H. axyridis and other native and exotic species were determined in an undisturbed wild meadow located in a protected area. In 2009 and 2010, mainly Solidago canadensis L. (Asteraceae and Asclepias syriaca L. (Asclepiadaceae infested with aphids were surveyed. A total of 1522 individuals, belonging to seven different species, were recorded. In 2009, on all the plants monitored, H. axyridis was clearly the dominant species (69% of the coccinellid assemblage. In addition, this exotic species constituted 84% of the coccinellid assemblage, including Propylea quatuordecimpunctata (L. and Coccinella septempunctata (L. It is likely the dominance of the eurytopic Asian lady beetle in agricultural, forested, urban and undisturbed open ecosystems, poses a threat to native lady beetles. These results also provide evidence that undisturbed wild meadow ecosystems will not constitute a natural refuge from Harmonia axyridis for native species of lady beetles.

  12. Spectroscopic sensitivity of real-time, rapidly induced phytochemical change in response to damage.

    Science.gov (United States)

    Couture, John J; Serbin, Shawn P; Townsend, Philip A

    2013-04-01

    An ecological consequence of plant-herbivore interactions is the phytochemical induction of defenses in response to insect damage. Here, we used reflectance spectroscopy to characterize the foliar induction profile of cardenolides in Asclepias syriaca in response to damage, tracked in vivo changes and examined the influence of multiple plant traits on cardenolide concentrations. Foliar cardenolide concentrations were measured at specific time points following damage to capture their induction profile. Partial least-squares regression (PLSR) modeling was employed to calibrate cardenolide concentrations to reflectance spectroscopy. In addition, subsets of plants were either repeatedly sampled to track in vivo changes or modified to reduce latex flow to damaged areas. Cardenolide concentrations and the induction profile of A. syriaca were well predicted using models derived from reflectance spectroscopy, and this held true for repeatedly sampled plants. Correlations between cardenolides and other foliar-related variables were weak or not significant. Plant modification for latex reduction inhibited an induced cardenolide response. Our findings show that reflectance spectroscopy can characterize rapid phytochemical changes in vivo. We used reflectance spectroscopy to identify the mechanisms behind the production of plant secondary metabolites, simultaneously characterizing multiple foliar constituents. In this case, cardenolide induction appears to be largely driven by enhanced latex delivery to leaves following damage. © 2013 The Authors. New Phytologist © 2013 New Phytologist Trust.

  13. Ecological analysis of stands of ass. Asclepiadetum syriacae Lániková in Chytrý 2009 in Bačka region

    Directory of Open Access Journals (Sweden)

    Popov Milena M.

    2016-01-01

    Full Text Available Perennial adventitious species Asclepias syriaca L. which originates from Northern America is spread across Serbia, and especially Vojvodina, along the banks of waterways and borders of floodplain forests. Based on floristic and phytocenological studies in Bačka, the presence of ass. Asclepiadetum syriacae Lániková in Chytrý 2009 stands, in which A. syriaca is present with the highest degree of presence (V and with substantial covering value (2850, can be confirmed. The study shows ecological analysis of stands of mentioned association for basic environmental factors (moisture - F, reaction - R, nutrients - N, humus - H, aeration - D, light - L, temperature - T, and continentality - K based on floristic composition of stands and their ecological indices, considering population and every species coverage in a stand. Given that a combined scale for population and coverage of species in stands, along numerical, has descriptive marks, modification of evaluated values according to Westhoff & van der Maarel scale which is completely numerical was conducted, which enabled data processing. The obtained results of the ecological analysis point to favorable ecological conditions for development of stands of this association, which can help predict the possible directions of spread of this invasive species.

  14. Nectar protein content and attractiveness to Aedes aegypti and Culex pipiens in plants with nectar/insect associations.

    Science.gov (United States)

    Chen, Zhongyuan; Kearney, Christopher M

    2015-06-01

    We chose five easily propagated garden plants previously shown to be attractive to mosquitoes, ants or other insects and tested them for attractiveness to Culex pipiens and Aedes aegypti. Long term imbibition was tested by survival on each plant species. Both mosquito species survived best on Impatiens walleriana, the common garden impatiens, followed by Asclepias curassavica, Campsis radicans and Passiflora edulis, which sponsored survival as well as the 10% sucrose control. Immediate preference for imbibition was tested with nectar dyed in situ on each plant. In addition, competition studies were performed with one dyed plant species in the presence of five undyed plant species to simulate a garden setting. In both preference studies I. walleriana proved superior. Nectar from all plants was then screened for nectar protein content by SDS-PAGE, with great variability being found between species, but with I. walleriana producing the highest levels. The data suggest that I. walleriana may have value as a model plant for subsequent studies exploring nectar delivery of transgenic mosquitocidal proteins. Copyright © 2015 Elsevier B.V. All rights reserved.

  15. Does polyembryony confer a competitive advantage to the invasive perennial vine Vincetoxicum rossicum (Apocynaceae)?

    Science.gov (United States)

    Blanchard, Megan L; Barney, Jacob N; Averill, Kristine M; Mohler, Charles L; Ditommaso, Antonio

    2010-02-01

    Determining which traits may allow some introduced plant species to become invasive in their new environment continues to be a key question in invasion biology. Vincetoxicum rossicum is an invasive, perennial vine colonizing natural and seminatural habitats primarily in the northeastern United States and southeastern Canada. More than half its seeds exhibit polyembryony, a relatively uncommon condition in which a single seed produces multiple seedlings. For evaluating the potential consequences of polyembryony on invasiveness, V. rossicum plants derived from seeds of three embryonic classes-singlets, doublets, and triplets (one, two, and three seedlings per seed, respectively)-were paired in all combinations intraspecifically and with the co-occurring native herbs Solidago canadensis and Asclepias syriaca in a greenhouse study. Vincetoxicum rossicum biomass was 25-55% greater and follicle production 55-100% greater under intraspecific competition compared with interspecific competition. However, within a competitive environment, follicle production varied little. Regardless of competitive environment, V. rossicum originating from seeds with a greater number of embryos typically performed no better than plants arising from seed with fewer embryos (singlets = doublets = triplets)-except intraspecifically where doublets outperformed singlets, and with S. canadensis where triplets outperformed singlets. Our findings suggest that overall performance and fitness of V. rossicum is higher in monocultures than in mixed stands and that its ability to invade new habitats may not be attributable to the production of polyembryonic seeds.

  16. Estructura, dimensiones y producción de semilla de malezas del trópico húmedo

    Directory of Open Access Journals (Sweden)

    Juan Calder\\u00F3n

    2000-01-01

    Full Text Available Estructura, dimensiones y producción de propágulos sexuales de malezas del trópico húmedo. Los objetivos de este trabajo fueron determinar las dimensiones promedio, describir la estructura externa de las semillas, frutos o espiguillas y estimar el número producido por planta y por gramo, de doce especies de malezas. Se elaboraron esquemas de los propágulos. En las dicotiledóneas estudiadas, el número promedio de semillas por planta varió de 1290 en Asclepias curassavica hasta 195008 en Ludwigia sp. La segunda especie con más elevado número promedio de semillas por planta fue Sida rhombifolia (7962 seguida por Ipomoea sp.(2876. Hyptis capitata mostró mayor número promedio de cabezuelas por planta (341 que Bidens pilosa (106 y que Emilia sonchifolia (61. Mimosa pudica produjo un promedio de 3.3 semillas por fruto. En las Poaceae, Paspalum conjugatum y P. Virgatum produjeron mayor número de espiguillas por rama floral (381 y 1185 respectivamente que Ischaemum indicum (81 y que Rottboellia cochinchinensis (14. Se menciona la anemocoria, la hidrocoria y la zoocoria como mecanismos que contribuyen en la dispersión de estas especies

  17. Insect radiosensitivity: dose curves and dose-fractionation studies of dominant lethal mutations in the mature sperm of 4 insect species

    International Nuclear Information System (INIS)

    LaChance, L.E.; Graham, C.K.

    1984-01-01

    Males of 4 species of insects: Musca domestica L. (housefly) (Diptera), Oncopeltus fasciatus (Dallas) (milkweed bug) (Hemiptera), Anagasta kuhniella (Zeller) (mealmoth) (Lepidoptera) and Heliothis virescens (Fab.) (tobacco budworm) (Lepidoptera) were irradiated as adults. Dose-response curves for the induction of dominant lethal mutations in the mature sperm were constructed. The curves were analyzed mathematically and compared with theoretical computer simulated curves requiring 1, 2, 4, 8 and 16 'hits' for the induction of a dominant lethal mutation. The 4 species belonging to 3 different orders of insects showed a wide range in radiation sensitivity and vastly different dose-response curves. When the data were analyzed by several mathematical models the authors found that a logistic response curve gave reasonably good fit with vastly different parameters for the 4 species. Dose-fractionation experiments showed no reduction in the frequency of lethal mutations induced in any species when an acute dose was fractionated into 2 equal exposures separated by an 8-h period. (Auth.)

  18. Seed germination behavior of swallow wort

    Directory of Open Access Journals (Sweden)

    amir hosein pahlavani

    2009-06-01

    Full Text Available The exotic plant, Swallow- wort, a twining perennial of the Milkweed family, has become increasingly invasive in some place of Iran, especially orchards. Increased knowledge of wort germination biology would facilitate development of an optimum control program. Germination of Swallow wort seeds as affected by environmental factors was studied under controlled-environment growth chamber conditions. The following studies were conducted in plant Pests & Diseases Research Institute during the years 2003-4: 1- Effect of constant temperature on germination that including 10, 15, 18, 20, 25, 30, 35 and 40˚C; 2- Effect of light on constant germination; 3- Effect of temperature fluctuations on seed germination: 15/7, 20/12, 25/17 and 30/22˚C. All experiments were conducted with 8 replications. Swallow wort seeds showed no dormancy when detachment from mother plant. Seed germination was strongly influenced by temperature. Light did not play a crucial role on seed germination of this weed. Therefore Swallow wort seeds were not photoblastic and temperature fluctuations did not increase seed germination of Swallow wort. The above characteristics are very important in making swallowwort an invasive weed. Having precise information of these traits enables us to a better management and control of this troublesome weed.

  19. Ubx regulates differential enlargement and diversification of insect hind legs.

    Directory of Open Access Journals (Sweden)

    Najmus Mahfooz

    2007-09-01

    Full Text Available Differential enlargement of hind (T3 legs represents one of the hallmarks of insect evolution. However, the actual mechanism(s responsible are yet to be determined. To address this issue, we have now studied the molecular basis of T3 leg enlargement in Oncopeltus fasciatus (milkweed bug and Acheta domesticus (house cricket. In Oncopeltus, the T3 tibia displays a moderate increase in size, whereas in Acheta, the T3 femur, tibia, and tarsus are all greatly enlarged. Here, we show that the hox gene Ultrabithorax (Ubx is expressed in the enlarged segments of hind legs. Furthermore, we demonstrate that depletion of Ubx during embryogenesis has a primary effect in T3 legs and causes shortening of leg segments that are enlarged in a wild type. This result shows that Ubx is regulating the differential growth and enlargement of T3 legs in both Oncopeltus and Acheta. The emerging view suggests that Ubx was co-opted for a novel role in regulating leg growth and that the transcriptional modification of its expression may be a universal mechanism for the evolutionary diversification of insect hind legs.

  20. Public Knowledge of Monarchs and Support for Butterfly Conservation

    Directory of Open Access Journals (Sweden)

    Jerrod Penn

    2018-03-01

    Full Text Available Pollinator populations in North America are in decline, including the iconic monarch butterfly. In order to determine if public knowledge of monarchs informs opinions on butterfly conservation, we surveyed the public to assess their knowledge of monarchs. We also asked participants about their attitudes towards general butterfly conservation and if they believe that butterfly gardens contribute to conservation. Respondents generally had some knowledge of monarchs but were unaware of monarch population declines and the necessity of milkweed to their life cycle. Respondent knowledge was correlated with more positive attitudes about butterfly conservation. Furthermore, membership in an environmental organization increased the likelihood that the participant had prior knowledge of monarchs and cared about monarch conservation. Respondent socioeconomic factors of age and sex were also significantly correlated with conservation attitudes—older and female participants had more positive attitudes towards general butterfly conservation. Interestingly, females were also less likely than males to admit having prior knowledge of monarchs, indicating that gender may also play an important role in conservation outreach efforts. Our study indicates that educational efforts need to be directed more toward individuals not already associated with an environmental organization as these individuals are predisposed to regard conservation positively.

  1. Loss of migratory behaviour increases infection risk for a butterfly host

    Science.gov (United States)

    Satterfield, Dara A.; Maerz, John C.; Altizer, Sonia

    2015-01-01

    Long-distance animal migrations have important consequences for infectious disease dynamics. In some cases, migration lowers pathogen transmission by removing infected individuals during strenuous journeys and allowing animals to periodically escape contaminated habitats. Human activities are now causing some migratory animals to travel shorter distances or form sedentary (non-migratory) populations. We focused on North American monarch butterflies and a specialist protozoan parasite to investigate how the loss of migratory behaviours affects pathogen spread and evolution. Each autumn, monarchs migrate from breeding grounds in the eastern US and Canada to wintering sites in central Mexico. However, some monarchs have become non-migratory and breed year-round on exotic milkweed in the southern US. We used field sampling, citizen science data and experimental inoculations to quantify infection prevalence and parasite virulence among migratory and sedentary populations. Infection prevalence was markedly higher among sedentary monarchs compared with migratory monarchs, indicating that diminished migration increases infection risk. Virulence differed among parasite strains but was similar between migratory and sedentary populations, potentially owing to high gene flow or insufficient time for evolutionary divergence. More broadly, our findings suggest that human activities that alter animal migrations can influence pathogen dynamics, with implications for wildlife conservation and future disease risks. PMID:25589600

  2. Oosorption in response to poor food: complexity in the trade-off between reproduction and survival

    Science.gov (United States)

    Moore, Patricia J; Attisano, Alfredo

    2011-01-01

    Plasticity in reproductive physiology is one avenue by which environmental signals, such as poor quality food, can be coordinated with adaptive responses. Insects have the ability to resorb oocytes that are not oviposited. Oosorption is proposed to be an adaptive mechanism to optimize fitness in hostile environments, recouping resources that might otherwise be lost, and reinvesting them into future reproductive potential. We tested the hypothesis that oosorption is an evolved mechanism by which females can reallocate resources from current reproductive effort to survival and future reproduction, when conditions for reproduction are poor, by examining the reproductive physiology and life-history outcome under poor quality food in populations of the milkweed bug (Oncopeltus fasciatus) that have adapted to live on sunflower seed. Females fed a diet of pumpkin seeds, known to be a poor host food, had higher levels of ovarian apoptosis (oosorption), lower reproductive output, but no reduction in life span under poor nutrition, as predicted under the oosorption hypothesis. However, the schedule of reproduction was surprising given the “wait to reproduce” assumption of oosorption as early fecundity was unaffected. PMID:22393481

  3. The role of the pupal determinant broad during embryonic development of a direct-developing insect

    Science.gov (United States)

    Rynerson, Melody R.; Truman, James W.; Riddiford, Lynn M.

    2010-01-01

    Metamorphosis is one of the most common, yet dramatic of life history strategies. In insects, complete metamorphosis with morphologically distinct larval stages arose from hemimetabolous ancestors that were more direct developing. Over the past century, several ideas have emerged that suggest the holometabolous pupa is developmentally homologous to the embryonic stages of the hemimetabolous ancestor. Other theories consider the pupal stage to be a modification of a hemimetabolous nymph. To address this question, we have isolated an ortholog of the pupal determinant, broad (br), from the hemimetabolous milkweed bug and examined its role during embryonic development. We show that Oncopeltus fasciatus br (Of'br) is expressed in two phases. The first occurs during germ band invagination and segmentation when Of'br is expressed ubiquitously in the embryonic tissues. The second phase of Of'br expression appears during the pronymphal phase of embryogenesis and persists through nymphal differentiation to decline just before hatching. Knock-down of Of'br transcripts results in defects that range from posterior truncations in the least-affected phenotypes to completely fragmented embryonic tissues in the most severe cases. Analysis of the patterning genes engrailed and hunchback reveal loss of segments and a failure in neural differentiation after Of'br depletion. Finally, we show that br is constitutively expressed during embyrogenesis of the ametabolous firebrat, Thermobia domestica. This suggests that br expression is prominent during embryonic development of ametabolous and hemimetabolous insects but was lost with the emergence of the completely metamorphosing insects. PMID:20127251

  4. Anthropogenic changes in sodium affect neural and muscle development in butterflies

    Science.gov (United States)

    Snell-Rood, Emilie C.; Espeset, Anne; Boser, Christopher J.; White, William A.; Smykalski, Rhea

    2014-01-01

    The development of organisms is changing drastically because of anthropogenic changes in once-limited nutrients. Although the importance of changing macronutrients, such as nitrogen and phosphorus, is well-established, it is less clear how anthropogenic changes in micronutrients will affect organismal development, potentially changing dynamics of selection. We use butterflies as a study system to test whether changes in sodium availability due to road salt runoff have significant effects on the development of sodium-limited traits, such as neural and muscle tissue. We first document how road salt runoff can elevate sodium concentrations in the tissue of some plant groups by 1.5–30 times. Using monarch butterflies reared on roadside- and prairie-collected milkweed, we then show that road salt runoff can result in increased muscle mass (in males) and neural investment (in females). Finally, we use an artificial diet manipulation in cabbage white butterflies to show that variation in sodium chloride per se positively affects male flight muscle and female brain size. Variation in sodium not only has different effects depending on sex, but also can have opposing effects on the same tissue: across both species, males increase investment in flight muscle with increasing sodium, whereas females show the opposite pattern. Taken together, our results show that anthropogenic changes in sodium availability can affect the development of traits in roadside-feeding herbivores. This research suggests that changing micronutrient availability could alter selection on foraging behavior for some roadside-developing invertebrates. PMID:24927579

  5. 4-Alkynylphenylsilatranes: Insecticidal activity, mammalian toxicity, and mode of action

    International Nuclear Information System (INIS)

    Horsham, M.A.; Palmer, C.J.; Cole, L.M.; Casida, J.E.

    1990-01-01

    4-Ethynyl- and 4-(prop-1-ynyl)phenylsilatranes [N(CH 2 CH 2 O) 3 SiR, R = C 6 H 4 -4-C triple-bond CH or C 6 H 4 -4-C triple-bond CCH 3 ] are highly toxic to houseflies (pretreated with piperonyl butoxide) and milkweed bugs (topical LD 50 s 3-14 μg/g) and to mice (intraperitoneal LD 50 s 0.4-0.9 mg/kg), and they are moderately potent inhibitors of the [ 35 S]-tert-butylbicyclophosphorothionate or TBPS binding site (GABA-gated chloride channel) of mouse brain membranes. Scatchard analysis indicates noncompetitive interaction of 4-ethynylphenylsilatrane with the TBPS binding site. Phenylsilatrane analogues with 4-substituents of H, CH 3 , Cl, Br, and C triple-bond CSi(CH 3 ) 3 are highly toxic to mice but have little or no activity in the insect and receptor assays. Radioligand binding studies with [4- 3 H]phenylsilatrane failed to reveal a specific binding site in mouse brain. Silatranes with R = H, CH 3 , CH 2 Cl, CH double-bond CH 2 , OCH 2 CH 3 , and C 6 H 4 -4-CH 2 CH 3 are of little or no activity in the insect and mouse toxicity and TBPS binding site assays as are the trithia and monocyclic analogues of phenylsilatrane. 4-Alkynylphenylsilatranes are new probes to examine the GABA receptor-ionophore complex of insects and mammals

  6. Phylogenetic escalation and decline of plant defense strategies

    Science.gov (United States)

    Agrawal, Anurag A.; Fishbein, Mark

    2008-01-01

    As the basal resource in most food webs, plants have evolved myriad strategies to battle consumption by herbivores. Over the past 50 years, plant defense theories have been formulated to explain the remarkable variation in abundance, distribution, and diversity of secondary chemistry and other defensive traits. For example, classic theories of enemy-driven evolutionary dynamics have hypothesized that defensive traits escalate through the diversification process. Despite the fact that macroevolutionary patterns are an explicit part of defense theories, phylogenetic analyses have not been previously attempted to disentangle specific predictions concerning (i) investment in resistance traits, (ii) recovery after damage, and (iii) plant growth rate. We constructed a molecular phylogeny of 38 species of milkweed and tested four major predictions of defense theory using maximum-likelihood methods. We did not find support for the growth-rate hypothesis. Our key finding was a pattern of phyletic decline in the three most potent resistance traits (cardenolides, latex, and trichomes) and an escalation of regrowth ability. Our neontological approach complements more common paleontological approaches to discover directional trends in the evolution of life and points to the importance of natural enemies in the macroevolution of species. The finding of macroevolutionary escalating regowth ability and declining resistance provides a window into the ongoing coevolutionary dynamics between plants and herbivores and suggests a revision of classic plant defense theory. Where plants are primarily consumed by specialist herbivores, regrowth (or tolerance) may be favored over resistance traits during the diversification process. PMID:18645183

  7. Dusky Cotton Bug Oxycarenus spp. (Hemiptera: Lygaeidae: Hibernating Sites and Management by using Plant Extracts under Laboratory Conditions

    Directory of Open Access Journals (Sweden)

    Abbas Muneer

    2015-09-01

    Full Text Available The dusky cotton bug, Oxycarenus spp., has now attained the status of a major pest of cotton crops that affects lint as well as the seed quality of cotton. Surveys were conducted to explore the hibernating sites in the districts Faisalabad, Multan and Bahawalpur. The efficacies of six different plant extracts, i.e. Neem (Azadirachta indica, Milkweed (Calotropis procera, Moringa (Moringa oleifera, Citrus (Citrus sinensis, Tobacco (Nicotiana tobacum and Castor (Ricinus communis were tested by using three different concentrations of each plant extract, i.e. 5, 2.5 and 1.5% under laboratory conditions at 25±2°C and 70±5% RH. The data were recorded 24, 48, 72 and 96 hours after treatment application. However, Psidium guajava, Azadirachta indica, Eucalyptus camaldulensis and Mangifera indica were graded as host plants heavily infested by Oxycarenus spp. Results (α≤0.05 indicated that increasing the concentration of extracts also increased the mortality. Nicotiana tobacum and Calotropis procera respectively displayed maximum 72 and 71, 84 and 80, 97 and 89% mortality at all concentrations, i.e. 1.25, 2.50 and 5.00%, after 96 hours of application. Two concentrations (2.5 and 5% are the most suitable for obtaining significant control of the dusky cotton bug.

  8. Anthropogenic changes in sodium affect neural and muscle development in butterflies.

    Science.gov (United States)

    Snell-Rood, Emilie C; Espeset, Anne; Boser, Christopher J; White, William A; Smykalski, Rhea

    2014-07-15

    The development of organisms is changing drastically because of anthropogenic changes in once-limited nutrients. Although the importance of changing macronutrients, such as nitrogen and phosphorus, is well-established, it is less clear how anthropogenic changes in micronutrients will affect organismal development, potentially changing dynamics of selection. We use butterflies as a study system to test whether changes in sodium availability due to road salt runoff have significant effects on the development of sodium-limited traits, such as neural and muscle tissue. We first document how road salt runoff can elevate sodium concentrations in the tissue of some plant groups by 1.5-30 times. Using monarch butterflies reared on roadside- and prairie-collected milkweed, we then show that road salt runoff can result in increased muscle mass (in males) and neural investment (in females). Finally, we use an artificial diet manipulation in cabbage white butterflies to show that variation in sodium chloride per se positively affects male flight muscle and female brain size. Variation in sodium not only has different effects depending on sex, but also can have opposing effects on the same tissue: across both species, males increase investment in flight muscle with increasing sodium, whereas females show the opposite pattern. Taken together, our results show that anthropogenic changes in sodium availability can affect the development of traits in roadside-feeding herbivores. This research suggests that changing micronutrient availability could alter selection on foraging behavior for some roadside-developing invertebrates.

  9. Monarch butterfly population decline in North America: identifying the threatening processes

    Science.gov (United States)

    Thogmartin, Wayne E.; Wiederholt, Ruscena; Oberhauser, Karen; Drum, Ryan G.; Diffendorfer, Jay E.; Altizer, Sonia; Taylor, Orley R.; Pleasants, John M.; Semmens, Darius J.; Semmens, Brice X.; Erickson, Richard A.; Libby, Kaitlin; Lopez-Hoffman, Laura

    2017-01-01

    The monarch butterfly (Danaus plexippus) population in North America has sharply declined over the last two decades. Despite rising concern over the monarch butterfly's status, no comprehensive study of the factors driving this decline has been conducted. Using partial least-squares regressions and time-series analysis, we investigated climatic and habitat-related factors influencing monarch population size from 1993 to 2014. Potential threats included climatic factors, habitat loss (milkweed and overwinter forest), disease and agricultural insecticide use (neonicotinoids). While climatic factors, principally breeding season temperature, were important determinants of annual variation in abundance, our results indicated strong negative relationships between population size and habitat loss variables, principally glyphosate use, but also weaker negative effects from the loss of overwinter forest and breeding season use of neonicotinoids. Further declines in population size because of glyphosate application are not expected. Thus, if remaining threats to habitat are mitigated we expect climate-induced stochastic variation of the eastern migratory population of monarch butterfly around a relatively stationary population size.

  10. Powdery mildew of ornamental species caused by Oidiopsis haplophylli in Brazil Oídio em plantas ornamentais, causado por Oidiopsis haplophylli, no Brasil

    Directory of Open Access Journals (Sweden)

    Ailton Reis

    2007-12-01

    Full Text Available Oidiopsis haplophylli (syn. Oidiopsis sicula was identified as the causal agent of powdery mildew diseases occurring on five ornamental species in Brazil. This disease was observed in plastic house-grown lisianthus (Eustoma grandiflorum: Gentianaceae, in nasturtium (Tropaeolum majus: Tropaeolaceae cultivated under open field conditions and in greenhouse-grown calla lily (Zantedeschia aethiopica: Araceae, impatiens (Impatiens balsamina: Balsaminaceae and balloon plant (Asclepias physocarpa: Asclepiadaceae. Typical disease symptoms consisted of chlorotic areas on the upper leaf surface corresponding to a fungal colony in the abaxial surface. With the disease progression, these chlorotic areas eventually turned to necrotic (brown lesions. Fungi morphology on all hosts was similar to that described for the imperfect stage of Leveillula taurica (O. haplophylli. The Koch's postulates were fulfilled by inoculating symptom-free plants via leaf-to-leaf contact with fungal colonies. Additional inoculations using an isolate of O. haplophylli from sweet pepper (Capsicum annuum demonstrated that it is pathogenic to all five species belonging to distinct botanical families, indicating lack of host specialization. This is the first formal report of a powdery mildew disease on lisianthus, calla lilly, impatiens and nasturtium in Brazil. It is, to our knowledge, the first report of O. haplophyllii infecting A. physocarpa, extending the host range of this atypical powdery mildew-inducing fungus. This disease might become important on these ornamental crops especially in protected cultivation and also under field conditions in hot and dry areas of Brazil.O fungo Oidiopsis haplophylli (= O. sicula foi identificado como sendo o agente causal de uma nova doença do tipo oídio em beijo-de-frade (Impatiens balsamina: Balsaminaceae, capuchinha (Tropaeolum majus: Tropaeolaceae, copo-de-leite (Zantedeschia aethiopica: Araceae, lisianthus (Eustoma grandiflorum

  11. Initial Response by a Native Beetle, Chrysochus auratus (Coleoptera: Chrysomelidae), to a Novel Introduced Host-Plant, Vincetoxicum rossicum (Gentianales: Apocynaceae).

    Science.gov (United States)

    deJonge, R B; Bourchier, R S; Smith, S M

    2017-06-01

    Native insects can form novel associations with introduced invasive plants and use them as a food source. The recent introduction into eastern North America of a nonnative European vine, Vincetoxicum rossicum (Kleopow) Barbar., allows us to examine the initial response of a native chrysomelid beetle, Chrysochus auratus F., that feeds on native plants in the same family as V. rossicum (Apocynaceae). We tested C. auratus on V. rossicum and closely related or co-occurring native plants (Apocynum spp., Asclepias spp., and Solidago canadensis L.) using all life stages of the beetle in lab, garden, and field experiments. Experiments measured feeding (presence or absence and amount), survival, oviposition, and whether previous exposure to V. rossicum in the lab or field affected adult beetle feeding. Beetles fed significantly less on V. rossicum than on native Apocynum hosts. Adult beetles engaged in exploratory feeding on leaves of V. rossicum and survived up to 10 d. Females oviposited on V. rossicum, eggs hatched, and larvae fed initially on the roots; however, no larvae survived beyond second instar. Beetles collected from Apocynum cannabinum L. field sites intermixed with V. rossicum were less likely to feed on this novel nonnative host than those collected from colonies further from and less likely to be exposed to V. rossicum (>5 km). Our experimental work indicates that V. rossicum may act as an oviposition sink for C. auratus and that this native beetle has not adapted to survive on this recently introduced novel host plant. © The Authors 2017. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  12. Effects of elevated atmospheric carbon dioxide on biomass and carbon accumulation in a model regenerating longleaf pine community.

    Science.gov (United States)

    Runion, G B; Davis, M A; Pritchard, S G; Prior, S A; Mitchell, R J; Torbert, H A; Rogers, H H; Dute, R R

    2006-01-01

    Plant species vary in response to atmospheric CO2 concentration due to differences in physiology, morphology, phenology, and symbiotic relationships. These differences make it very difficult to predict how plant communities will respond to elevated CO2. Such information is critical to furthering our understanding of community and ecosystem responses to global climate change. To determine how a simple plant community might respond to elevated CO2, a model regenerating longleaf pine community composed of five species was exposed to two CO2 regimes (ambient, 365 micromol mol(-1) and elevated, 720 micromol mol(-1)) for 3 yr. Total above- and belowground biomass was 70 and 49% greater, respectively, in CO2-enriched plots. Carbon (C) content followed a response pattern similar to biomass, resulting in a significant increase of 13.8 Mg C ha(-1) under elevated CO2. Responses of individual species, however, varied. Longleaf pine (Pinus palustris Mill.) was primarily responsible for the positive response to CO2 enrichment. Wiregrass (Aristida stricta Michx.), rattlebox (Crotalaria rotundifolia Walt. Ex Gmel.), and butterfly weed (Asclepias tuberosa L.) exhibited negative above- and belowground biomass responses to elevated CO2, while sand post oak (Quercus margaretta Ashe) did not differ significantly between CO2 treatments. As with pine, C content followed patterns similar to biomass. Elevated CO2 resulted in alterations in community structure. Longleaf pine comprised 88% of total biomass in CO2-enriched plots, but only 76% in ambient plots. In contrast, wiregrass, rattlebox, and butterfly weed comprised 19% in ambient CO2 plots, but only 8% under high CO2. Therefore, while longleaf pine may perform well in a high CO2 world, other members of this community may not compete as well, which could alter community function. Effects of elevated CO2 on plant communities are complex, dynamic, and difficult to predict, clearly demonstrating the need for more research in this

  13. Historical flora of Moscow’s Railway Junction (until 2012

    Directory of Open Access Journals (Sweden)

    Vinogradova Yulia Konstantinovna

    2017-12-01

    Full Text Available The article touches upon the biodiversity at the railways. The list of species found within the Moscow Railways (≈300 km from 1851 until today has been compiled based on herbarium data [MHA, MW, LE] and personal observations conducted in 1980-2016. The list of “railways’ flora” includes 1087 taxa from 447 genera of 94 families – this is significantly higher than what is known for the railroads of other regions. A brief comparative analysis with the “railways’ flora” in other regions of the world in respect of the species number, taxonomy and life form spectrum has been performed. The therophytes absolutely prevail in the life-form spectrum (46 percent. The role of the railways as a pathway for alien species has been confirmed. Around 54 percent of all alien plants recorded for the Moscow Region (Moscow and Moscow Region grow along the railways. Several species new for the former USSR territory was found there, as well as many species new for the Moscow Region. The Railways are not only “donors/sources” of alien species, they also act as a refugee area for “the escapees”: over 30 years, Asclepias syriaca has been growing within the section of the Kursk-Moscow railway located near the All-Russian Research Institute of Medical and Aromatic Plants. Galega officinalis, a specie that forms a 200 m2 area of tangled vegetation, was found there, too. A trend when plants fall out of cultivation was established, this is how Sedum hispanicum and S. album emerged. The article also marks the role of the rail slopes as a refugium of rare and endangered plants of the natural flora: some 35 species included in the Red Book of Moscow were found within the area.

  14. Chemopreventive potential of β-Sitosterol in experimental colon cancer model - an In vitro and In vivo study

    Directory of Open Access Journals (Sweden)

    Paulraj Gabriel M

    2010-06-01

    Full Text Available Abstract Background Asclepias curassavica Linn. is a traditional medicinal plant used by tribal people in the western ghats, India, to treat piles, gonorrhoea, roundworm infestation and abdominal tumours. We have determined the protective effect of β-sitosterol isolated from A. curassavica in colon cancer, using in vitro and in vivo models. Methods The active molecule was isolated, based upon bioassay guided fractionation, and identified as β-sitosterol on spectral evidence. The ability to induce apoptosis was determined by its in vitro antiradical activity, cytotoxic studies using human colon adenocarcinoma and normal monkey kidney cell lines, and the expression of β-catenin and proliferating cell nuclear antigen (PCNA in human colon cancer cell lines (COLO 320 DM. The chemopreventive potential of β-sitosterol in colon carcinogenesis was assessed by injecting 1,2-dimethylhydrazine (DMH, 20 mg/kg b.w. into male Wistar rats and supplementing this with β-sitosterol throughout the experimental period of 16 weeks at 5, 10, and 20 mg/kg b.w. Results β-sitosterol induced significant dose-dependent growth inhibition of COLO 320 DM cells (IC50 266.2 μM, induced apoptosis by scavenging reactive oxygen species, and suppressed the expression of β-catenin and PCNA antigens in human colon cancer cells. β-sitosterol supplementation reduced the number of aberrant crypt and crypt multiplicity in DMH-initiated rats in a dose-dependent manner with no toxic effects. Conclusion We found doses of 10-20 mg/kg b.w. β-sitosterol to be effective for future in vivo studies. β-sitosterol had chemopreventive potential by virtue of its radical quenching ability in vitro, with minimal toxicity to normal cells. It also attenuated β-catenin and PCNA expression, making it a potential anticancer drug for colon carcinogenesis.

  15. Navigating the tip of the genomic iceberg: Next-generation sequencing for plant systematics.

    Science.gov (United States)

    Straub, Shannon C K; Parks, Matthew; Weitemier, Kevin; Fishbein, Mark; Cronn, Richard C; Liston, Aaron

    2012-02-01

    Just as Sanger sequencing did more than 20 years ago, next-generation sequencing (NGS) is poised to revolutionize plant systematics. By combining multiplexing approaches with NGS throughput, systematists may no longer need to choose between more taxa or more characters. Here we describe a genome skimming (shallow sequencing) approach for plant systematics. Through simulations, we evaluated optimal sequencing depth and performance of single-end and paired-end short read sequences for assembly of nuclear ribosomal DNA (rDNA) and plastomes and addressed the effect of divergence on reference-guided plastome assembly. We also used simulations to identify potential phylogenetic markers from low-copy nuclear loci at different sequencing depths. We demonstrated the utility of genome skimming through phylogenetic analysis of the Sonoran Desert clade (SDC) of Asclepias (Apocynaceae). Paired-end reads performed better than single-end reads. Minimum sequencing depths for high quality rDNA and plastome assemblies were 40× and 30×, respectively. Divergence from the reference significantly affected plastome assembly, but relatively similar references are available for most seed plants. Deeper rDNA sequencing is necessary to characterize intragenomic polymorphism. The low-copy fraction of the nuclear genome was readily surveyed, even at low sequencing depths. Nearly 160000 bp of sequence from three organelles provided evidence of phylogenetic incongruence in the SDC. Adoption of NGS will facilitate progress in plant systematics, as whole plastome and rDNA cistrons, partial mitochondrial genomes, and low-copy nuclear markers can now be efficiently obtained for molecular phylogenetics studies.

  16. Chemopreventive potential of β-Sitosterol in experimental colon cancer model - an In vitro and In vivo study

    Science.gov (United States)

    2010-01-01

    Background Asclepias curassavica Linn. is a traditional medicinal plant used by tribal people in the western ghats, India, to treat piles, gonorrhoea, roundworm infestation and abdominal tumours. We have determined the protective effect of β-sitosterol isolated from A. curassavica in colon cancer, using in vitro and in vivo models. Methods The active molecule was isolated, based upon bioassay guided fractionation, and identified as β-sitosterol on spectral evidence. The ability to induce apoptosis was determined by its in vitro antiradical activity, cytotoxic studies using human colon adenocarcinoma and normal monkey kidney cell lines, and the expression of β-catenin and proliferating cell nuclear antigen (PCNA) in human colon cancer cell lines (COLO 320 DM). The chemopreventive potential of β-sitosterol in colon carcinogenesis was assessed by injecting 1,2-dimethylhydrazine (DMH, 20 mg/kg b.w.) into male Wistar rats and supplementing this with β-sitosterol throughout the experimental period of 16 weeks at 5, 10, and 20 mg/kg b.w. Results β-sitosterol induced significant dose-dependent growth inhibition of COLO 320 DM cells (IC50 266.2 μM), induced apoptosis by scavenging reactive oxygen species, and suppressed the expression of β-catenin and PCNA antigens in human colon cancer cells. β-sitosterol supplementation reduced the number of aberrant crypt and crypt multiplicity in DMH-initiated rats in a dose-dependent manner with no toxic effects. Conclusion We found doses of 10-20 mg/kg b.w. β-sitosterol to be effective for future in vivo studies. β-sitosterol had chemopreventive potential by virtue of its radical quenching ability in vitro, with minimal toxicity to normal cells. It also attenuated β-catenin and PCNA expression, making it a potential anticancer drug for colon carcinogenesis. PMID:20525330

  17. Projecting the success of plant restoration with population viability analysis

    Science.gov (United States)

    Bell, T.J.; Bowles, M.L.; McEachern, A.K.; Brigham, C.A.; Schwartz, M.W.

    2003-01-01

    two plant species listed in the USA for which federal recovery planning calls for population restoration: Cirsium pitcheri, a short-lived semelparous herb, and Asclepias meadii, a long-lived iteroparous herb.

  18. Influences of Plant Species, Season and Location on Leaf Endophytic Bacterial Communities of Non-Cultivated Plants.

    Science.gov (United States)

    Ding, Tao; Melcher, Ulrich

    2016-01-01

    Bacteria are known to be associated endophytically with plants. Research on endophytic bacteria has identified their importance in food safety, agricultural production and phytoremediation. However, the diversity of endophytic bacterial communities and the forces that shape their compositions in non-cultivated plants are largely uncharacterized. In this study, we explored the diversity, community structure, and dynamics of endophytic bacteria in different plant species in the Tallgrass Prairie Preserve of northern Oklahoma, USA. High throughput sequencing of amplified segments of bacterial rDNA from 81 samples collected at four sampling times from five plant species at four locations identified 335 distinct OTUs at 97% sequence similarity, representing 16 phyla. Proteobacteria was the dominant phylum in the communities, followed by the phyla Bacteriodetes and Actinobacteria. Bacteria from four classes of Proteobacteria were detected with Alphaproteobacteria as the dominant class. Analysis of molecular variance revealed that host plant species and collecting date had significant influences on the compositions of the leaf endophytic bacterial communities. The proportion of Alphaproteobacteria was much higher in the communities from Asclepias viridis than from other plant species and differed from month to month. The most dominant bacterial groups identified in LDA Effect Size analysis showed host-specific patterns, indicating mutual selection between host plants and endophytic bacteria and that leaf endophytic bacterial compositions were dynamic, varying with the host plant's growing season in three distinct patterns. In summary, next generation sequencing has revealed variations in the taxonomic compositions of leaf endophytic bacterial communities dependent primarily on the nature of the plant host species.

  19. Influences of Plant Species, Season and Location on Leaf Endophytic Bacterial Communities of Non-Cultivated Plants.

    Directory of Open Access Journals (Sweden)

    Tao Ding

    Full Text Available Bacteria are known to be associated endophytically with plants. Research on endophytic bacteria has identified their importance in food safety, agricultural production and phytoremediation. However, the diversity of endophytic bacterial communities and the forces that shape their compositions in non-cultivated plants are largely uncharacterized. In this study, we explored the diversity, community structure, and dynamics of endophytic bacteria in different plant species in the Tallgrass Prairie Preserve of northern Oklahoma, USA. High throughput sequencing of amplified segments of bacterial rDNA from 81 samples collected at four sampling times from five plant species at four locations identified 335 distinct OTUs at 97% sequence similarity, representing 16 phyla. Proteobacteria was the dominant phylum in the communities, followed by the phyla Bacteriodetes and Actinobacteria. Bacteria from four classes of Proteobacteria were detected with Alphaproteobacteria as the dominant class. Analysis of molecular variance revealed that host plant species and collecting date had significant influences on the compositions of the leaf endophytic bacterial communities. The proportion of Alphaproteobacteria was much higher in the communities from Asclepias viridis than from other plant species and differed from month to month. The most dominant bacterial groups identified in LDA Effect Size analysis showed host-specific patterns, indicating mutual selection between host plants and endophytic bacteria and that leaf endophytic bacterial compositions were dynamic, varying with the host plant's growing season in three distinct patterns. In summary, next generation sequencing has revealed variations in the taxonomic compositions of leaf endophytic bacterial communities dependent primarily on the nature of the plant host species.

  20. The Complete Plastid Genome Sequence of Madagascar Periwinkle Catharanthus roseus (L.) G. Don: Plastid Genome Evolution, Molecular Marker Identification, and Phylogenetic Implications in Asterids

    Science.gov (United States)

    Ku, Chuan; Chung, Wan-Chia; Chen, Ling-Ling; Kuo, Chih-Horng

    2013-01-01

    The Madagascar periwinkle ( Catharanthus roseus in the family Apocynaceae) is an important medicinal plant and is the source of several widely marketed chemotherapeutic drugs. It is also commonly grown for its ornamental values and, due to ease of infection and distinctiveness of symptoms, is often used as the host for studies on phytoplasmas, an important group of uncultivated plant pathogens. To gain insights into the characteristics of apocynaceous plastid genomes (plastomes), we used a reference-assisted approach to assemble the complete plastome of C . roseus , which could be applied to other C . roseus -related studies. The C . roseus plastome is the second completely sequenced plastome in the asterid order Gentianales. We performed comparative analyses with two other representative sequences in the same order, including the complete plastome of Coffea arabica (from the basal Gentianales family Rubiaceae) and the nearly complete plastome of Asclepias syriaca (Apocynaceae). The results demonstrated considerable variations in gene content and plastome organization within Apocynaceae, including the presence/absence of three essential genes (i.e., accD, clpP, and ycf1) and large size changes in non-coding regions (e.g., rps2-rpoC2 and IRb-ndhF). To find plastome markers of potential utility for Catharanthus breeding and phylogenetic analyses, we identified 41 C . roseus -specific simple sequence repeats. Furthermore, five intergenic regions with high divergence between C . roseus and three other euasterids I taxa were identified as candidate markers. To resolve the euasterids I interordinal relationships, 82 plastome genes were used for phylogenetic inference. With the addition of representatives from Apocynaceae and sampling of most other asterid orders, a sister relationship between Gentianales and Solanales is supported. PMID:23825699

  1. Refining the Maritime Foundations of Andean Civilization: How Plant Fiber Technology Drove Social Complexity During the Preceramic Period.

    Science.gov (United States)

    Beresford-Jones, David; Pullen, Alexander; Chauca, George; Cadwallader, Lauren; García, Maria; Salvatierra, Isabel; Whaley, Oliver; Vásquez, Víctor; Arce, Susana; Lane, Kevin; French, Charles

    2018-01-01

    Moseley's (1975) Maritime Foundations of Andean Civilization hypothesis challenges, in one of humanity's few pristine hearths of civilization, the axiom that agriculture is necessary for the rise of complex societies. We revisit that hypothesis by setting new findings from La Yerba II (7571-6674 Cal bp) and III (6485-5893 Cal bp), Río Ica estuary, alongside the wider archaeological record for the end of the Middle Preceramic Period on the Peruvian coast. The La Yerba record evinces increasing population, sedentism, and "Broad Spectrum Revolution" features, including early horticulture of Phaseolus and Canavalia beans. Yet unlike further north, these changes failed to presage the florescence of monumental civilization during the subsequent Late Preceramic Period. Instead, the south coast saw a profound "archaeological silence." These contrasting trajectories had little to do with any relative differences in marine resources, but rather to restrictions on the terrestrial resources that determined a society's capacity to intensify exploitation of those marine resources. We explain this apparent miscarriage of the Maritime Foundations of Andean Civilization (MFAC) hypothesis on the south coast of Peru by proposing more explicit links than hitherto, between the detailed technological aspects of marine exploitation using plant fibers to make fishing nets and the emergence of social complexity on the coast of Peru. Rather than because of any significant advantages in quality , it was the potential for increased quantities of production, inherent in the shift from gathered wild Asclepias bast fibers to cultivated cotton, that inadvertently precipitated revolutionary social change. Thereby refined, the MFAC hypothesis duly emerges more persuasive than ever.

  2. Nectar plant selection by the Karner blue butterfly (Lycaeides melissa samuelis) at the Indiana Dunes National Lakeshore

    Science.gov (United States)

    Grundel, Ralph; Pavlovic, Noel B.; Sulzman, Christina L.

    2000-01-01

    The Karner blue butterfly, Lycaeides melissa samuelis, is an endangered species residing in savanna and barrens habitats in the Midwest and Northeast United States. To improve our understanding of nectar plant selection patterns by the Karner blue, we examined nectar plant choices made by 146 butterflies. Within observation areas of 2-m radius butterflies usually chose the nectar species with the greatest total number of flowers or flowering heads. This suggests that the Karner blue is opportunistic in selecting nectar plants. However, certain nectar species, including Arabis lyrata, Coreopsis lanceolata, Melilotus alba and Rubus flagellaris, were selected in a significant majority of cases when other nectar species were available nearby. At least in the case of R. flagellaris, this preference was not directly related to the species' local flower abundance. In a significant majority of cases (77.5%) adult Karner blues selected nectar plant species with yellow or white flowers over species with other-colored flowers. Comparison of nectar plant selections at Indiana Dunes National Lakeshore to selections from Michigan and Wisconsin suggests that the Karner blue most frequently chooses a suite of nectar plant species that includes A. lyrata, C. lanceolata, Euphorbia corollata, M. alba, Monarda punctata, Potentilla simplex, Rubus spp., Solidago speciosa and, perhaps, Asclepias tuberosa and Helianthus divaricatus. This suite includes plant species that readily flower in the sun and others that readily flower in the shade, an important consideration since Karner blues often move across the sun-shade interface.

  3. Micromorphology and Histochemistry of the Laticifers from Vegetative Organs of Asclepiadoideae species (Apocynaceae

    Directory of Open Access Journals (Sweden)

    Diego DEMARCO

    2015-01-01

    MICROMORFOLOGÍA E HISTOQUÍMICA DE LOS LATICÍFEROS DE ÓRGANOS VEGETATIVOS DE ESPECIES DE ASCLEPIADOIDEAE (APOCYNACEAE La micromorfología y las principales clases de componentes de las paredes de los laticíferos y del látex de Asclepias curassavica, Fischeria stellata, Gonioanthela axillaris, Matelea denticulata y Oxypetalum banksii, fueron analizadas y comparadas con las de especies de Apocynaceae de Cerrado. Los laticíferos de las especies estudiadas de diferentes tipos de bosques presentan características semejantes. Las paredes son primarias, altamente hidratadas, pecto-celulósicas y fuertemente adheridas a las paredes de las células adyacentes. El látex es blanco lechoso, constituido por polisacáridos, incluyendo mucílago, proteínas, lípidos, incluyendo ácidos grasos, compuestos fenólicos e alcaloides. Fischeria y Gonioanthela difieren de las demás especies por producir lípidos neutros. El látex de las especies investigadas está asociado a la protección de la planta contra herbivoría, pudiendo ser tóxico e inhibir la proliferación de microorganismos, además de coagular, sellando heridas de las plantas y funcionando como barrera física. Estas propiedades del látex proporcionan una mayor ventaja adaptativa a estas plantas en relación a las no latescentes.

  4. Uptake and Effects of Six Rare Earth Elements (REEs on Selected Native and Crop Species Growing in Contaminated Soils.

    Directory of Open Access Journals (Sweden)

    David Carpenter

    Full Text Available Rare earth elements (REEs have become increasingly important metals used in modern technology. Processes including mining, oil refining, discarding of obsolete equipment containing REEs, and the use of REE-containing phosphate fertilizers may increase the likelihood of environmental contamination. However, there is a scarcity of information on the toxicity and accumulation of these metals to terrestrial primary producers in contaminated soils. The objective of this work was to assess the phytotoxicity and uptake from contaminated soil of six REEs (chloride forms of praseodymium, neodymium, samarium, terbium, dysprosium, and erbium on three native plants (Asclepias syriaca L., Desmodium canadense (L. DC., Panicum virgatum L. and two crop species (Raphanus sativus L., Solanum lycopersicum L. in separate dose-response experiments under growth chamber conditions. Limited effects of REEs were found on seed germination and speed of germination. Effects on aboveground and belowground biomass were more pronounced, especially for the three native species, which were always more sensitive than the crop species tested. Inhibition concentrations (IC25 and IC50 causing 25 or 50% reductions in plant biomass respectively, were measured. For the native species, the majority of aboveground biomass IC25s (11 out of 18 fell within 100 to 300 mg REE/kg dry soil. In comparison to the native species, IC25s for the crops were always greater than 400 mg REE/kg, with the majority of results (seven out of 12 falling above 700 mg REE/kg. IC50s were often not detected for the crops. Root biomass of native species was also affected at lower doses than in crops. REE uptake by plants was higher in the belowground parts than in the above-ground plant tissues. Results also revealed that chloride may have contributed to the sensitivity of the native species, Desmodium canadense, one of the most sensitive species studied. Nevertheless, these results demonstrated that

  5. Isolation and structural elucidation of secondary metabolites from plants of the family Flacourtiaceae and Asclepiadaceae, and evaluation of biological activity of the sesquiterpene lactones and the diterpenes of Casearia sp

    International Nuclear Information System (INIS)

    Binns Quiros, Franklin

    2012-01-01

    A phytochemical study was realized of the plants Casearia aculeata, Casearia nitida and Asclepias verticillata, using experiments of nuclear magnetic resonance (NMR) of one and two dimensions. Ten secondary metabolites are isolated from C. aculeata and C. nitida. Three of the secondary metabolites have presented a structure known: a diterpene type kaurane: ent-kaurenic acid, a diterpene type pimarane: oxide of 3β-hydroximanoil and a steroid: 4-stigmastene-3-ona. Seven remaining compounds have corresponded to diterpene type clerodane of novel structure. Eight glycosides of poly oxidized pregnanes of novel structure are isolated from A. verticillata. In vitro tests of cytotoxicity and induction of caspase-3 are performed on leukemia cells type Jurkat T. These tests were performed at fifteen sesquiterpene lactones and at four diterpenes. The tests developed have had the purpose to describe structure-activity relationships that can be linked with the capacity to inhibit the factor NF-κB (sesquiterpene lactones) described in the literature and with the known mechanism of action induction of apoptosis in diterpenes type clerodane. A clear relationship between the capacity (high, intermediate or low) to inhibit the factor NF-κB and the capacity to induce to the caspase-3 has remained without observation in the sesquiterpene lactones. Some structural comparisons related with the cytotoxic capacity and the induction of the caspase-3 have been described for the series of LSs with carbon structure of pseudoguianolides. Diterpenes with carbon structure of diterpenes type clerodane have had greater cytotoxic activity with respect to without carbon structure. Diterpenes type clerodane isolated from the family Flacourtiaceae have been cytotoxics, their capacity to induce to the caspase-3 has remained without be nearby to induction realized by the actinomycin D (pure inducer of the caspase-3). (author) [es

  6. The phenotypic plasticity of developmental modules

    Directory of Open Access Journals (Sweden)

    Aabha I. Sharma

    2016-08-01

    Full Text Available Abstract Background Organisms develop and evolve in a modular fashion, but how individual modules interact with the environment remains poorly understood. Phenotypically plastic traits are often under selection, and studies are needed to address how traits respond to the environment in a modular fashion. In this study, tissue-specific plasticity of melanic spots was examined in the large milkweed bug, Oncopeltus fasciatus. Results Although the size of the abdominal melanic bands varied according to rearing temperatures, wing melanic bands were more robust. To explore the regulation of abdominal pigmentation plasticity, candidate genes involved in abdominal melanic spot patterning and biosynthesis of melanin were analyzed. While the knockdown of dopa decarboxylase (Ddc led to lighter pigmentation in both the wings and the abdomen, the shape of the melanic elements remained unaffected. Although the knockdown of Abdominal-B (Abd-B partially phenocopied the low-temperature phenotype, the abdominal bands were still sensitive to temperature shifts. These observations suggest that regulators downstream of Abd-B but upstream of DDC are responsible for the temperature response of the abdomen. Ablation of wings led to the regeneration of a smaller wing with reduced melanic bands that were shifted proximally. In addition, the knockdown of the Wnt signaling nuclear effector genes, armadillo 1 and armadillo 2, altered both the melanic bands and the wing shape. Thus, the pleiotropic effects of Wnt signaling may constrain the amount of plasticity in wing melanic bands. Conclusions We propose that when traits are regulated by distinct pre-patterning mechanisms, they can respond to the environment in a modular fashion, whereas when the environment impacts developmental regulators that are shared between different modules, phenotypic plasticity can manifest as a developmentally integrated system.

  7. Chasing migration genes: a brain expressed sequence tag resource for summer and migratory monarch butterflies (Danaus plexippus.

    Directory of Open Access Journals (Sweden)

    Haisun Zhu

    2008-01-01

    Full Text Available North American monarch butterflies (Danaus plexippus undergo a spectacular fall migration. In contrast to summer butterflies, migrants are juvenile hormone (JH deficient, which leads to reproductive diapause and increased longevity. Migrants also utilize time-compensated sun compass orientation to help them navigate to their overwintering grounds. Here, we describe a brain expressed sequence tag (EST resource to identify genes involved in migratory behaviors. A brain EST library was constructed from summer and migrating butterflies. Of 9,484 unique sequences, 6068 had positive hits with the non-redundant protein database; the EST database likely represents approximately 52% of the gene-encoding potential of the monarch genome. The brain transcriptome was cataloged using Gene Ontology and compared to Drosophila. Monarch genes were well represented, including those implicated in behavior. Three genes involved in increased JH activity (allatotropin, juvenile hormone acid methyltransfersase, and takeout were upregulated in summer butterflies, compared to migrants. The locomotion-relevant turtle gene was marginally upregulated in migrants, while the foraging and single-minded genes were not differentially regulated. Many of the genes important for the monarch circadian clock mechanism (involved in sun compass orientation were in the EST resource, including the newly identified cryptochrome 2. The EST database also revealed a novel Na+/K+ ATPase allele predicted to be more resistant to the toxic effects of milkweed than that reported previously. Potential genetic markers were identified from 3,486 EST contigs and included 1599 double-hit single nucleotide polymorphisms (SNPs and 98 microsatellite polymorphisms. These data provide a template of the brain transcriptome for the monarch butterfly. Our "snap-shot" analysis of the differential regulation of candidate genes between summer and migratory butterflies suggests that unbiased, comprehensive

  8. Environmental Persistence Influences Infection Dynamics for a Butterfly Pathogen.

    Directory of Open Access Journals (Sweden)

    Dara A Satterfield

    Full Text Available Many pathogens, including those infecting insects, are transmitted via dormant stages shed into the environment, where they must persist until encountering a susceptible host. Understanding how abiotic conditions influence environmental persistence and how these factors influence pathogen spread are crucial for predicting patterns of infection risk. Here, we explored the consequences of environmental transmission for infection dynamics of a debilitating protozoan parasite (Ophryocystis elektroscirrha that infects monarch butterflies (Danaus plexippus. We first conducted an experiment to observe the persistence of protozoan spores exposed to natural conditions. Experimental results showed that, contrary to our expectations, pathogen doses maintained high infectivity even after 16 days in the environment, although pathogens did yield infections with lower parasite loads after environmental exposure. Because pathogen longevity exceeded the time span of our experiment, we developed a mechanistic model to better explore environmental persistence for this host-pathogen system. Model analysis showed that, in general, longer spore persistence led to higher infection prevalence and slightly smaller monarch population sizes. The model indicated that typical parasite doses shed onto milkweed plants must remain viable for a minimum of 3 weeks for prevalence to increase during the summer-breeding season, and for 11 weeks or longer to match levels of infection commonly reported from the wild, assuming moderate values for parasite shedding rate. Our findings showed that transmission stages of this butterfly pathogen are long-lived and indicated that this is a necessary condition for the protozoan to persist in local monarch populations. This study provides a modeling framework for future work examining the dynamics of an ecologically important pathogen in an iconic insect.

  9. Influence of landscape structure on the functional groups of an aphidophagous guild: Active-searching predators, furtive predators and parasitoids

    Directory of Open Access Journals (Sweden)

    Julie-Éléonore Maisonhaute

    2011-12-01

    Full Text Available A lot of studies focusing on the effect of agricultural landscapes demonstrate that many arthropod species are influenced by landscape structure. In particular, non–crop areas and landscape diversity are often associated with a higher abundance and diversity of natural enemies in fields. Numerous studies focused on the influence of landscape structure on ground beetles, spiders and ladybeetles but few on other natural enemies or different functional groups. Thus, the objective of the present study was to determine the influence of landscape structure on the functional groups, i.e., active-searching predators, furtive predators and parasitoids of aphidophagous guilds. Natural enemies were sampled on milkweed infested with aphids, growing along the borders of ditches adjacent to cornfields. The sampling occurred weekly from June to September in 2006 and 2007, in the region of Lanaudičre (Quebec, Canada. The landscapes within a radius 200 and 500 m around each site were analyzed. The abundance, richness and species composition (based on functional groups of natural enemies were related to landscape structure. The results indicated that landscape structure explained up to 21.6% of the variation in natural enemy assemblage and confirm the positive effects of non-crop areas and landscape diversity. A lower influence of landscape structure on species composition was observed (6.4 to 8.8% and varied greatly among the functional groups. Coccinellidae and furtive predators were the group most influenced by landscape structure. In conclusion, the influence of landscape varied greatly among the different species of the same functional group.

  10. The Effects of Some Botanical Insecticides and Pymetrozine on Life Table Parameters of Silver Leaf Whitefly Bemisia tabaci Gennadius (Hemiptera: Aleyrodidae

    Directory of Open Access Journals (Sweden)

    Reihaneh Barati

    2013-01-01

    Full Text Available The objective of this research was to assess the effects of extracts of two medicinalplant species: Allium sativum (Linn and Calotropis procera (Aiton, and a formulation containingazadirachtin on life table parameters of silver leaf whitefly (SLW, Bemisia tabaci biotypeB (Gennadius (Hemiptera: Aleyrodidae, grown on greenhouse tomato plants. Theeffects were compared to that of pymetrozine, a synthetic insecticide. Bioassays were carriedout in a greenhouse under controlled conditions of 27 ± 2°C, R.H. of 55 ± 5% and 16:8h (L:D photo period.All treatments significantly affected the survivorship and fertility of SLW female adults,reducing the net reproduction rate, mean generation time and intrinsic rate of increase ofthis insect.The net reproductive rate [R0] values for the populations treated with garlic extract,milkweed extract, pymetrozine, azadirachtin, control for extracts (ethanol + distilled waterand control for pesticides (distilled water were 23.58, 19.32, 10.78, 8.23, 49.66, 57.55; theintrinsic rate of increases [rm] were 0.134, 0.139, 0.110, 0.090, 0.177, 0.178; the mean generationtimes [T] were 23.49, 21.23, 21.66, 23.50, 22.06, 22.69; the doubling times [DT] were 5.14,4.95, 6.27, 7.56, 3.91, 3.87, and the finite rates of increase [λ] were 1.144, 1.149, 1.116, 1.094, 1.193,1.195, respectively. Azadirachtin had the highest effect on the life table parameters of SLW.Our findings indicated that, although herbal extracts were not effective as much asthe chemical insecticides, they can be effective in pest control. Therefore, they are suitablechoices for replacing chemical insecticides and for alternative use with azadirachtin inSLW IPM program.

  11. Chasing Migration Genes: A Brain Expressed Sequence Tag Resource for Summer and Migratory Monarch Butterflies (Danaus plexippus)

    Science.gov (United States)

    Zhu, Haisun; Casselman, Amy; Reppert, Steven M.

    2008-01-01

    North American monarch butterflies (Danaus plexippus) undergo a spectacular fall migration. In contrast to summer butterflies, migrants are juvenile hormone (JH) deficient, which leads to reproductive diapause and increased longevity. Migrants also utilize time-compensated sun compass orientation to help them navigate to their overwintering grounds. Here, we describe a brain expressed sequence tag (EST) resource to identify genes involved in migratory behaviors. A brain EST library was constructed from summer and migrating butterflies. Of 9,484 unique sequences, 6068 had positive hits with the non-redundant protein database; the EST database likely represents ∼52% of the gene-encoding potential of the monarch genome. The brain transcriptome was cataloged using Gene Ontology and compared to Drosophila. Monarch genes were well represented, including those implicated in behavior. Three genes involved in increased JH activity (allatotropin, juvenile hormone acid methyltransfersase, and takeout) were upregulated in summer butterflies, compared to migrants. The locomotion-relevant turtle gene was marginally upregulated in migrants, while the foraging and single-minded genes were not differentially regulated. Many of the genes important for the monarch circadian clock mechanism (involved in sun compass orientation) were in the EST resource, including the newly identified cryptochrome 2. The EST database also revealed a novel Na+/K+ ATPase allele predicted to be more resistant to the toxic effects of milkweed than that reported previously. Potential genetic markers were identified from 3,486 EST contigs and included 1599 double-hit single nucleotide polymorphisms (SNPs) and 98 microsatellite polymorphisms. These data provide a template of the brain transcriptome for the monarch butterfly. Our “snap-shot” analysis of the differential regulation of candidate genes between summer and migratory butterflies suggests that unbiased, comprehensive transcriptional profiling

  12. Formation of Stylet Sheaths in āere (in air from eight species of phytophagous hemipterans from six families (Suborders: Auchenorrhyncha and Sternorrhyncha.

    Directory of Open Access Journals (Sweden)

    J Kent Morgan

    Full Text Available Stylet sheath formation is a common feature among phytophagous hemipterans. These sheaths are considered essential to promote a successful feeding event. Stylet sheath compositions are largely unknown and their mode of solidification remains to be elucidated. This report demonstrates the formation and solidification of in āere (in air produced stylet sheaths by six hemipteran families: Diaphorina citri (Psyllidae, Asian citrus psyllid, Aphis nerii (Aphididae, oleander/milkweed aphid, Toxoptera citricida (Aphididae, brown citrus aphid, Aphis gossypii (Aphididae, cotton melon aphid, Bemisia tabaci biotype B (Aleyrodidae, whitefly, Homalodisca vitripennis (Cicadellidae, glassy-winged sharpshooter, Ferrisia virgata (Pseudococcidae, striped mealybug, and Protopulvinaria pyriformis (Coccidae, pyriform scale. Examination of in āere produced stylet sheaths by confocal and scanning electron microscopy shows a common morphology of an initial flange laid down on the surface of the membrane followed by continuous hollow core structures with sequentially stacked hardened bulbous droplets. Single and multi-branched sheaths were common, whereas mealybug and scale insects typically produced multi-branched sheaths. Micrographs of the in āere formed flanges indicate flange sealing upon stylet bundle extraction in D. citri and the aphids, while the B. tabaci whitefly and H. vitripennis glassy-winged sharpshooter flanges remain unsealed. Structural similarity of in āere sheaths are apparent in stylet sheaths formed in planta, in artificial diets, or in water. The use of 'Solvy', a dissolvable membrane, for intact stylet sheath isolation is reported. These observations illustrate for the first time this mode of stylet sheath synthesis adding to the understanding of stylet sheath formation in phytophagous hemipterans and providing tools for future use in structural and compositional analysis.

  13. Root dynamics in an artificially constructed regenerating longleaf pine ecosystem are affected by atmospheric CO(2) enrichment.

    Science.gov (United States)

    Pritchard, S G.; Davis, M A.; Mitchell, R J.; Prior, S A.; Boykin, D L.; Rogers, H H.; Runion, G B.

    2001-08-01

    Differential responses to elevated atmospheric CO(2) concentration exhibited by different plant functional types may alter competition for above- and belowground resources in a higher CO(2) world. Because C allocation to roots is often favored over C allocation to shoots in plants grown with CO(2) enrichment, belowground function of forest ecosystems may change significantly. We established an outdoor facility to examine the effects of elevated CO(2) on root dynamics in artificially constructed communities of five early successional forest species: (1) a C(3) evergreen conifer (longleaf pine, Pinus palustris Mill.); (2) a C(4) monocotyledonous bunch grass (wiregrass, Aristida stricta Michx.); (3) a C(3) broadleaf tree (sand post oak, Quercus margaretta); (4) a C(3) perennial herbaceous legume (rattlebox, Crotalaria rotundifolia Walt. ex Gemel); and (5) an herbaceous C(3) dicotyledonous perennial (butterfly weed, Asclepias tuberosa L.). These species are common associates in early successional longleaf pine savannahs throughout the southeastern USA and represent species that differ in life-form, growth habit, physiology, and symbiotic relationships. A combination of minirhizotrons and soil coring was used to examine temporal and spatial rooting dynamics from October 1998 to October 1999. CO(2)-enriched plots exhibited 35% higher standing root crop length, 37% greater root length production per day, and 47% greater root length mortality per day. These variables, however, were enhanced by CO(2) enrichment only at the 10-30 cm depth. Relative root turnover (flux/standing crop) was unchanged by elevated CO(2). Sixteen months after planting, root biomass of pine was 62% higher in elevated compared to ambient CO(2) plots. Conversely, the combined biomass of rattlebox, wiregrass, and butterfly weed was 28% greater in ambient compared to high CO(2) plots. There was no difference in root biomass of oaks after 16 months of exposure to elevated CO(2). Using root and shoot

  14. Soil-applied imidacloprid translocates to ornamental flowers and reduces survival of adult Coleomegilla maculata, Harmonia axyridis, and Hippodamia convergens lady beetles, and larval Danaus plexippus and Vanessa cardui butterflies.

    Directory of Open Access Journals (Sweden)

    Vera Krischik

    Full Text Available Integrated Pest Management (IPM is a decision making process used to manage pests that relies on many tactics, including cultural and biological control, which are practices that conserve beneficial insects and mites, and when needed, the use of conventional insecticides. However, systemic, soil-applied neonicotinoid insecticides are translocated to pollen and nectar of flowers, often for months, and may reduce survival of flower-feeding beneficial insects. Imidacloprid seed-treated crops (0.05 mg AI (active ingredient /canola seed and 1.2 mg AI/corn seed translocate less than 10 ppb to pollen and nectar. However, higher rates of soil-applied imidacloprid are used in nurseries and urban landscapes, such as 300 mg AI/10 L (3 gallon pot and 69 g AI applied to the soil under a 61 (24 in cm diam. tree. Translocation of imidacloprid from soil (300 mg AI to flowers of Asclepias curassavica resulted in 6,030 ppb in 1X and 10,400 ppb in 2X treatments, which are similar to imidacloprid residues found in another plant species we studied. A second imidacloprid soil application 7 months later resulted in 21,000 ppb in 1X and 45,000 ppb in 2X treatments. Consequently, greenhouse/nursery use of imidacloprid applied to flowering plants can result in 793 to 1,368 times higher concentration compared to an imidacloprid seed treatment (7.6 ppb pollen in seed- treated canola, where most research has focused. These higher imidacloprid levels caused significant mortality in both 1X and 2X treatments in 3 lady beetle species, Coleomegilla maculata, Harmonia axyridis, and Hippodamia convergens, but not a fourth species, Coccinella septempunctata. Adult survival were not reduced for monarch, Danaus plexippus and painted lady, Vanessa cardui, butterflies, but larval survival was significantly reduced. The use of the neonicotinoid imidacloprid at greenhouse/nursery rates reduced survival of beneficial insects feeding on pollen and nectar and is incompatible with the

  15. Soil-applied imidacloprid translocates to ornamental flowers and reduces survival of adult Coleomegilla maculata, Harmonia axyridis, and Hippodamia convergens lady beetles, and larval Danaus plexippus and Vanessa cardui butterflies.

    Science.gov (United States)

    Krischik, Vera; Rogers, Mary; Gupta, Garima; Varshney, Aruna

    2015-01-01

    Integrated Pest Management (IPM) is a decision making process used to manage pests that relies on many tactics, including cultural and biological control, which are practices that conserve beneficial insects and mites, and when needed, the use of conventional insecticides. However, systemic, soil-applied neonicotinoid insecticides are translocated to pollen and nectar of flowers, often for months, and may reduce survival of flower-feeding beneficial insects. Imidacloprid seed-treated crops (0.05 mg AI (active ingredient) /canola seed and 1.2 mg AI/corn seed) translocate less than 10 ppb to pollen and nectar. However, higher rates of soil-applied imidacloprid are used in nurseries and urban landscapes, such as 300 mg AI/10 L (3 gallon) pot and 69 g AI applied to the soil under a 61 (24 in) cm diam. tree. Translocation of imidacloprid from soil (300 mg AI) to flowers of Asclepias curassavica resulted in 6,030 ppb in 1X and 10,400 ppb in 2X treatments, which are similar to imidacloprid residues found in another plant species we studied. A second imidacloprid soil application 7 months later resulted in 21,000 ppb in 1X and 45,000 ppb in 2X treatments. Consequently, greenhouse/nursery use of imidacloprid applied to flowering plants can result in 793 to 1,368 times higher concentration compared to an imidacloprid seed treatment (7.6 ppb pollen in seed- treated canola), where most research has focused. These higher imidacloprid levels caused significant mortality in both 1X and 2X treatments in 3 lady beetle species, Coleomegilla maculata, Harmonia axyridis, and Hippodamia convergens, but not a fourth species, Coccinella septempunctata. Adult survival were not reduced for monarch, Danaus plexippus and painted lady, Vanessa cardui, butterflies, but larval survival was significantly reduced. The use of the neonicotinoid imidacloprid at greenhouse/nursery rates reduced survival of beneficial insects feeding on pollen and nectar and is incompatible with the principles of IPM.

  16. Soil-Applied Imidacloprid Translocates to Ornamental Flowers and Reduces Survival of Adult Coleomegilla maculata, Harmonia axyridis, and Hippodamia convergens Lady Beetles, and Larval Danaus plexippus and Vanessa cardui Butterflies

    Science.gov (United States)

    Krischik, Vera; Rogers, Mary; Gupta, Garima; Varshney, Aruna

    2015-01-01

    Integrated Pest Management (IPM) is a decision making process used to manage pests that relies on many tactics, including cultural and biological control, which are practices that conserve beneficial insects and mites, and when needed, the use of conventional insecticides. However, systemic, soil-applied neonicotinoid insecticides are translocated to pollen and nectar of flowers, often for months, and may reduce survival of flower-feeding beneficial insects. Imidacloprid seed-treated crops (0.05 mg AI (active ingredient) /canola seed and 1.2 mg AI/corn seed) translocate less than 10 ppb to pollen and nectar. However, higher rates of soil-applied imidacloprid are used in nurseries and urban landscapes, such as 300 mg AI/10 L (3 gallon) pot and 69 g AI applied to the soil under a 61 (24 in) cm diam. tree. Translocation of imidacloprid from soil (300 mg AI) to flowers of Asclepias curassavica resulted in 6,030 ppb in 1X and 10,400 ppb in 2X treatments, which are similar to imidacloprid residues found in another plant species we studied. A second imidacloprid soil application 7 months later resulted in 21,000 ppb in 1X and 45,000 ppb in 2X treatments. Consequently, greenhouse/nursery use of imidacloprid applied to flowering plants can result in 793 to 1,368 times higher concentration compared to an imidacloprid seed treatment (7.6 ppb pollen in seed- treated canola), where most research has focused. These higher imidacloprid levels caused significant mortality in both 1X and 2X treatments in 3 lady beetle species, Coleomegilla maculata, Harmonia axyridis, and Hippodamia convergens, but not a fourth species, Coccinella septempunctata. Adult survival were not reduced for monarch, Danaus plexippus and painted lady, Vanessa cardui, butterflies, but larval survival was significantly reduced. The use of the neonicotinoid imidacloprid at greenhouse/nursery rates reduced survival of beneficial insects feeding on pollen and nectar and is incompatible with the principles of IPM

  17. Plant composition, pharmacological properties and mutagenic evaluation of a commercial Zulu herbal mixture: Imbiza ephuzwato.

    Science.gov (United States)

    Ndhlala, A R; Finnie, J F; Van Staden, J

    2011-01-27

    Imbiza ephuzwato is a traditional herbal tonic made from a mixture of extracts of roots, bulbs, rhizomes and leaves of 21 medicinal plants and is used in traditional medicine as a multipurpose remedy. To compile and investigate the bioactivity and mutagenic effects of extracts of the 21 plant species used in the preparation of Imbiza ephuzwato herbal tonic. The 21 plant species used to make Imbiza ephuzwato herbal mixture were each investigated for their pharmacological properties. Petroleum ether (PE), dichloromethane (DCM), 80% ethanol (EtOH) and water extracts of the 21 plants were evaluated against two gram-positive, two gram-negative bacteria and a fungus Candida albicans. The extracts were also evaluated for their inhibitory effects against cyclooxygenase (COX-1 and -2) and acetylcholinesterase AChE enzymes. Mutagenic effects of the water extracts were evaluated using the Ames test. Gunnera perpensa and Rubia cordifolia were the only plant species used to manufacture Imbiza ephuzwato that had water extracts which showed good antibacterial activity. The extracts of G. perpensa (EtOH), Hypericum aethiopicum (DCM) and Urginea physodes (EtOH) showed the best antifungal activity. The water extracts of H. aethiopicum, G. perpensa, Drimia robusta, Vitellariopsis marginata, Scadoxus puniceus and Momordica balsamina showed percentage inhibition of COX-1 that was over 70%. For COX-2 enzyme, the water extracts of G. perpensa, Cyrtanthus obliquus, M. balsamina and Tetradenia riparia exhibited inhibitory activity above 70%. Water extracts of G. perpensa, C. obliquus, V. marginata, Asclepias fruticosa and Watsonia densiflora showed good AChE inhibitory activity (>80%). The Ames test results revealed that all the water extracts of the 21 plant species used to make Imbiza ephuzwato were non-mutagenic towards the Salmonella typhimurium TA98 strain for the assay with and without S9 metabolic activation. In contrast, Imbiza ephuzwato showed mutagenic effects after exposure to S

  18. Citizen Science: Opportunities for Girls' Development of Science Identity

    Science.gov (United States)

    Brien, Sinead Carroll

    Many students in the United States, particularly girls, have lost interest in science by the time they reach high school and do not pursue higher degrees or careers in science. Several science education researchers have found that the ways in which youth see themselves and position themselves in relation to science can influence whether they pursue science studies and careers. I suggest that participation in a citizen science program, which I define as a program in which girls interact with professional scientists and collect data that contributes to scientific research, could contribute to changing girls' perceptions of science and scientists, and promote their science identity work. I refer to science identity as self-recognition and recognition by others that one thinks scientifically and does scientific work. I examined a case study to document and analyze the relationship between girls' participation in a summer citizen science project and their development of science identity. I observed six girls between the ages of 16 and 18 during the Milkweed and Monarch Project, taking field notes on focal girls' interactions with other youth, adults, and the scientist, conducted highly-structured interviews both pre-and post- girls' program participation, and interviewed the project scientist and educator. I qualitatively analyzed field notes and interview responses for themes in girls' discussion of what it meant to think scientifically, roles they took on, and how they recognized themselves as thinking scientifically. I found that girls who saw themselves as thinking scientifically during the program seemed to demonstrate shifts in their science identity. The aspects of the citizen science program that seemed to most influence shifts in these girls' science identities were 1) the framing of the project work as "real science, 2) that it involved ecological field work, and 3) that it created a culture that valued data and scientific work. However, some of the girls only

  19. Spectral Data Captures Important Variability Between and Among Species and Functional Types

    Science.gov (United States)

    Townsend, P. A.; Serbin, S. P.; Kingdon, C.; Singh, A.; Couture, J. J.; Gamon, J. A.

    2013-12-01

    different genotypes of aspen. A clonal species, aspen is widely recognized for its high genotypic and phenotypic variability, and this variability expresses itself in differences in both functional and spectral traits. We demonstrate that spectral characteristics can be used to identify different genets of aspen and that this spectral variability among genets is also related to differences in traits important to ecosystem processes. Third, we illustrate variability in spectral properties of soybean related to the presence of aphids, and how those spectral properties translate to differences in yield. Finally, we show how short-term variability in milkweed spectra (within hours) is related to changes in cardenolide concentrations associated with induced defensive responses. These results demonstrate the capacity of spectroscopy to not just characterize important plant traits, but also to measure how plants vary naturally and respond dynamically to environmental changes.

  20. Fueling the fall migration of the monarch butterfly.

    Science.gov (United States)

    Brower, Lincoln P; Fink, Linda S; Walford, Peter

    2006-12-01

    communities. Agricultural transformations of natural communities in the eastern United States and Great Plains, however, and especially the extensive planting of genetically modified herbicide-resistant soybeans and corn, may be changing the availability of nectar for monarchs and other pollinators. This new technology is eliminating virtually all forbs in and surrounding agricultural fields, including the monarch's larval hostplants (milkweeds) and native and nonnative nectar sources. To evaluate whether changes in nectar availability are altering the butterflies' ability to accumulate energy, we recommend that monarchs' lipid contents be assayed annually at sites throughout eastern North America.